(data stored in ACNUC9543 zone)

EMBL: CP001050

ID   CP001050; SV 1; circular; genomic DNA; STD; PRO; 2232025 BP.
XX
AC   CP001050;
XX
PR   Project:PRJNA29335;
XX
DT   12-JUL-2008 (Rel. 96, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 7)
XX
DE   Neisseria gonorrhoeae NCCP11945, complete genome.
XX
KW   .
XX
OS   Neisseria gonorrhoeae NCCP11945
OC   Bacteria; Proteobacteria; Betaproteobacteria; Neisseriales; Neisseriaceae;
OC   Neisseria.
XX
RN   [1]
RP   1-2232025
RX   DOI; 10.1128/JB.00566-08.
RX   PUBMED; 18586945.
RA   Chung G.T., Yoo J.S., Oh H.B., Lee Y.S., Cha S.H., Kim S.J., Yoo C.K.;
RT   "Complete genome sequence of Neisseria gonorrhoeae NCCP11945";
RL   J. Bacteriol. 190(17):6035-6036(2008).
XX
RN   [2]
RP   1-2232025
RA   Yoo C.K., Chung G.T., Yoo J.S., Oh H.B., Lee Y.S., Cha S.H., Kim S.J.;
RT   ;
RL   Submitted (17-APR-2008) to the INSDC.
RL   Center for Infectious Disease and Research, Korea National Institute of
RL   Health, 194, Tongil-lo, Eyunpyung-Gu, Seoul 122-701, Republic of Korea
XX
DR   MD5; df13167e6e09558030aeba1f056a3ca9.
DR   BioSample; SAMN02603475.
DR   EnsemblGenomes-Gn; EBG00001068669.
DR   EnsemblGenomes-Gn; EBG00001068670.
DR   EnsemblGenomes-Gn; EBG00001068671.
DR   EnsemblGenomes-Gn; EBG00001068672.
DR   EnsemblGenomes-Gn; EBG00001068673.
DR   EnsemblGenomes-Gn; EBG00001068674.
DR   EnsemblGenomes-Gn; EBG00001068675.
DR   EnsemblGenomes-Gn; EBG00001068676.
DR   EnsemblGenomes-Gn; EBG00001068677.
DR   EnsemblGenomes-Gn; EBG00001068678.
DR   EnsemblGenomes-Gn; EBG00001068679.
DR   EnsemblGenomes-Gn; EBG00001068680.
DR   EnsemblGenomes-Gn; EBG00001068681.
DR   EnsemblGenomes-Gn; EBG00001068682.
DR   EnsemblGenomes-Gn; EBG00001068683.
DR   EnsemblGenomes-Gn; EBG00001068684.
DR   EnsemblGenomes-Gn; EBG00001068685.
DR   EnsemblGenomes-Gn; EBG00001068686.
DR   EnsemblGenomes-Gn; EBG00001068687.
DR   EnsemblGenomes-Gn; EBG00001068688.
DR   EnsemblGenomes-Gn; EBG00001068689.
DR   EnsemblGenomes-Gn; EBG00001068690.
DR   EnsemblGenomes-Gn; EBG00001068691.
DR   EnsemblGenomes-Gn; EBG00001068692.
DR   EnsemblGenomes-Gn; EBG00001068693.
DR   EnsemblGenomes-Gn; EBG00001068694.
DR   EnsemblGenomes-Gn; EBG00001068695.
DR   EnsemblGenomes-Gn; EBG00001068696.
DR   EnsemblGenomes-Gn; EBG00001068697.
DR   EnsemblGenomes-Gn; EBG00001068698.
DR   EnsemblGenomes-Gn; EBG00001068699.
DR   EnsemblGenomes-Gn; EBG00001068700.
DR   EnsemblGenomes-Gn; EBG00001068701.
DR   EnsemblGenomes-Gn; EBG00001068702.
DR   EnsemblGenomes-Gn; EBG00001068703.
DR   EnsemblGenomes-Gn; EBG00001068704.
DR   EnsemblGenomes-Gn; EBG00001068705.
DR   EnsemblGenomes-Gn; EBG00001068706.
DR   EnsemblGenomes-Gn; EBG00001068707.
DR   EnsemblGenomes-Gn; EBG00001068708.
DR   EnsemblGenomes-Gn; EBG00001068709.
DR   EnsemblGenomes-Gn; EBG00001068710.
DR   EnsemblGenomes-Gn; EBG00001068711.
DR   EnsemblGenomes-Gn; EBG00001068712.
DR   EnsemblGenomes-Gn; EBG00001068713.
DR   EnsemblGenomes-Gn; EBG00001068714.
DR   EnsemblGenomes-Gn; EBG00001068715.
DR   EnsemblGenomes-Gn; EBG00001068716.
DR   EnsemblGenomes-Gn; EBG00001068717.
DR   EnsemblGenomes-Gn; EBG00001068718.
DR   EnsemblGenomes-Gn; EBG00001068719.
DR   EnsemblGenomes-Gn; EBG00001068720.
DR   EnsemblGenomes-Gn; EBG00001068721.
DR   EnsemblGenomes-Gn; EBG00001068722.
DR   EnsemblGenomes-Gn; EBG00001068723.
DR   EnsemblGenomes-Gn; EBG00001068724.
DR   EnsemblGenomes-Gn; EBG00001068725.
DR   EnsemblGenomes-Gn; EBG00001068726.
DR   EnsemblGenomes-Gn; EBG00001068727.
DR   EnsemblGenomes-Gn; EBG00001068728.
DR   EnsemblGenomes-Gn; EBG00001068729.
DR   EnsemblGenomes-Gn; EBG00001068730.
DR   EnsemblGenomes-Gn; EBG00001068731.
DR   EnsemblGenomes-Gn; EBG00001068732.
DR   EnsemblGenomes-Gn; EBG00001068733.
DR   EnsemblGenomes-Gn; EBG00001068734.
DR   EnsemblGenomes-Gn; EBG00001068735.
DR   EnsemblGenomes-Gn; EBG00001068736.
DR   EnsemblGenomes-Gn; EBG00001068737.
DR   EnsemblGenomes-Gn; EBG00001068738.
DR   EnsemblGenomes-Gn; EBG00001068739.
DR   EnsemblGenomes-Gn; EBG00001068740.
DR   EnsemblGenomes-Gn; EBG00001068741.
DR   EnsemblGenomes-Gn; EBG00001068742.
DR   EnsemblGenomes-Gn; EBG00001068743.
DR   EnsemblGenomes-Gn; EBG00001068744.
DR   EnsemblGenomes-Gn; EBG00001068745.
DR   EnsemblGenomes-Gn; EBG00001068746.
DR   EnsemblGenomes-Gn; EBG00001068747.
DR   EnsemblGenomes-Gn; EBG00001068748.
DR   EnsemblGenomes-Gn; EBG00001068749.
DR   EnsemblGenomes-Gn; NGK_rrna16s1.
DR   EnsemblGenomes-Gn; NGK_rrna16s2.
DR   EnsemblGenomes-Gn; NGK_rrna16s3.
DR   EnsemblGenomes-Gn; NGK_rrna16s4.
DR   EnsemblGenomes-Gn; NGK_rrna23s1.
DR   EnsemblGenomes-Gn; NGK_rrna23s2.
DR   EnsemblGenomes-Gn; NGK_rrna23s3.
DR   EnsemblGenomes-Gn; NGK_rrna23s4.
DR   EnsemblGenomes-Gn; NGK_rrna5s1.
DR   EnsemblGenomes-Gn; NGK_rrna5s2.
DR   EnsemblGenomes-Gn; NGK_rrna5s3.
DR   EnsemblGenomes-Gn; NGK_rrna5s4.
DR   EnsemblGenomes-Gn; NGK_tRNAArg4.
DR   EnsemblGenomes-Gn; NGK_tRNAGlu3.
DR   EnsemblGenomes-Gn; NGK_tRNAPro3.
DR   EnsemblGenomes-Gn; NGK_trnaAla1.
DR   EnsemblGenomes-Gn; NGK_trnaAla2.
DR   EnsemblGenomes-Gn; NGK_trnaAla3.
DR   EnsemblGenomes-Gn; NGK_trnaAla4.
DR   EnsemblGenomes-Gn; NGK_trnaAla5.
DR   EnsemblGenomes-Gn; NGK_trnaArg1.
DR   EnsemblGenomes-Gn; NGK_trnaArg2.
DR   EnsemblGenomes-Gn; NGK_trnaArg3.
DR   EnsemblGenomes-Gn; NGK_trnaArg5.
DR   EnsemblGenomes-Gn; NGK_trnaAsn1.
DR   EnsemblGenomes-Gn; NGK_trnaAsn2.
DR   EnsemblGenomes-Gn; NGK_trnaAsp1.
DR   EnsemblGenomes-Gn; NGK_trnaAsp2.
DR   EnsemblGenomes-Gn; NGK_trnaCys1.
DR   EnsemblGenomes-Gn; NGK_trnaGln1.
DR   EnsemblGenomes-Gn; NGK_trnaGln2.
DR   EnsemblGenomes-Gn; NGK_trnaGlu1.
DR   EnsemblGenomes-Gn; NGK_trnaGlu2.
DR   EnsemblGenomes-Gn; NGK_trnaGly1.
DR   EnsemblGenomes-Gn; NGK_trnaGly2.
DR   EnsemblGenomes-Gn; NGK_trnaGly3.
DR   EnsemblGenomes-Gn; NGK_trnaGly4.
DR   EnsemblGenomes-Gn; NGK_trnaHis1.
DR   EnsemblGenomes-Gn; NGK_trnaIle1.
DR   EnsemblGenomes-Gn; NGK_trnaIle2.
DR   EnsemblGenomes-Gn; NGK_trnaIle3.
DR   EnsemblGenomes-Gn; NGK_trnaIle4.
DR   EnsemblGenomes-Gn; NGK_trnaLeu1.
DR   EnsemblGenomes-Gn; NGK_trnaLeu2.
DR   EnsemblGenomes-Gn; NGK_trnaLeu3.
DR   EnsemblGenomes-Gn; NGK_trnaLeu4.
DR   EnsemblGenomes-Gn; NGK_trnaLeu5.
DR   EnsemblGenomes-Gn; NGK_trnaLys1.
DR   EnsemblGenomes-Gn; NGK_trnaLys2.
DR   EnsemblGenomes-Gn; NGK_trnaMet1.
DR   EnsemblGenomes-Gn; NGK_trnaMet2.
DR   EnsemblGenomes-Gn; NGK_trnaMet3.
DR   EnsemblGenomes-Gn; NGK_trnaPhe1.
DR   EnsemblGenomes-Gn; NGK_trnaPro1.
DR   EnsemblGenomes-Gn; NGK_trnaPro2.
DR   EnsemblGenomes-Gn; NGK_trnaSer1.
DR   EnsemblGenomes-Gn; NGK_trnaSer2.
DR   EnsemblGenomes-Gn; NGK_trnaSer3.
DR   EnsemblGenomes-Gn; NGK_trnaSer4.
DR   EnsemblGenomes-Gn; NGK_trnaThr1.
DR   EnsemblGenomes-Gn; NGK_trnaThr2.
DR   EnsemblGenomes-Gn; NGK_trnaThr3.
DR   EnsemblGenomes-Gn; NGK_trnaTrp1.
DR   EnsemblGenomes-Gn; NGK_trnaTyr1.
DR   EnsemblGenomes-Gn; NGK_trnaVal1.
DR   EnsemblGenomes-Gn; NGK_trnaVal2.
DR   EnsemblGenomes-Gn; NGK_trnaVal3.
DR   EnsemblGenomes-Tr; EBT00001671359.
DR   EnsemblGenomes-Tr; EBT00001671360.
DR   EnsemblGenomes-Tr; EBT00001671361.
DR   EnsemblGenomes-Tr; EBT00001671362.
DR   EnsemblGenomes-Tr; EBT00001671363.
DR   EnsemblGenomes-Tr; EBT00001671364.
DR   EnsemblGenomes-Tr; EBT00001671365.
DR   EnsemblGenomes-Tr; EBT00001671366.
DR   EnsemblGenomes-Tr; EBT00001671367.
DR   EnsemblGenomes-Tr; EBT00001671368.
DR   EnsemblGenomes-Tr; EBT00001671369.
DR   EnsemblGenomes-Tr; EBT00001671370.
DR   EnsemblGenomes-Tr; EBT00001671371.
DR   EnsemblGenomes-Tr; EBT00001671372.
DR   EnsemblGenomes-Tr; EBT00001671373.
DR   EnsemblGenomes-Tr; EBT00001671374.
DR   EnsemblGenomes-Tr; EBT00001671375.
DR   EnsemblGenomes-Tr; EBT00001671376.
DR   EnsemblGenomes-Tr; EBT00001671377.
DR   EnsemblGenomes-Tr; EBT00001671378.
DR   EnsemblGenomes-Tr; EBT00001671379.
DR   EnsemblGenomes-Tr; EBT00001671380.
DR   EnsemblGenomes-Tr; EBT00001671381.
DR   EnsemblGenomes-Tr; EBT00001671382.
DR   EnsemblGenomes-Tr; EBT00001671383.
DR   EnsemblGenomes-Tr; EBT00001671384.
DR   EnsemblGenomes-Tr; EBT00001671385.
DR   EnsemblGenomes-Tr; EBT00001671386.
DR   EnsemblGenomes-Tr; EBT00001671387.
DR   EnsemblGenomes-Tr; EBT00001671388.
DR   EnsemblGenomes-Tr; EBT00001671389.
DR   EnsemblGenomes-Tr; EBT00001671390.
DR   EnsemblGenomes-Tr; EBT00001671391.
DR   EnsemblGenomes-Tr; EBT00001671392.
DR   EnsemblGenomes-Tr; EBT00001671393.
DR   EnsemblGenomes-Tr; EBT00001671394.
DR   EnsemblGenomes-Tr; EBT00001671395.
DR   EnsemblGenomes-Tr; EBT00001671396.
DR   EnsemblGenomes-Tr; EBT00001671397.
DR   EnsemblGenomes-Tr; EBT00001671398.
DR   EnsemblGenomes-Tr; EBT00001671399.
DR   EnsemblGenomes-Tr; EBT00001671400.
DR   EnsemblGenomes-Tr; EBT00001671401.
DR   EnsemblGenomes-Tr; EBT00001671402.
DR   EnsemblGenomes-Tr; EBT00001671403.
DR   EnsemblGenomes-Tr; EBT00001671404.
DR   EnsemblGenomes-Tr; EBT00001671405.
DR   EnsemblGenomes-Tr; EBT00001671406.
DR   EnsemblGenomes-Tr; EBT00001671407.
DR   EnsemblGenomes-Tr; EBT00001671408.
DR   EnsemblGenomes-Tr; EBT00001671409.
DR   EnsemblGenomes-Tr; EBT00001671410.
DR   EnsemblGenomes-Tr; EBT00001671411.
DR   EnsemblGenomes-Tr; EBT00001671412.
DR   EnsemblGenomes-Tr; EBT00001671413.
DR   EnsemblGenomes-Tr; EBT00001671414.
DR   EnsemblGenomes-Tr; EBT00001671415.
DR   EnsemblGenomes-Tr; EBT00001671416.
DR   EnsemblGenomes-Tr; EBT00001671417.
DR   EnsemblGenomes-Tr; EBT00001671418.
DR   EnsemblGenomes-Tr; EBT00001671419.
DR   EnsemblGenomes-Tr; EBT00001671420.
DR   EnsemblGenomes-Tr; EBT00001671421.
DR   EnsemblGenomes-Tr; EBT00001671422.
DR   EnsemblGenomes-Tr; EBT00001671423.
DR   EnsemblGenomes-Tr; EBT00001671424.
DR   EnsemblGenomes-Tr; EBT00001671425.
DR   EnsemblGenomes-Tr; EBT00001671426.
DR   EnsemblGenomes-Tr; EBT00001671427.
DR   EnsemblGenomes-Tr; EBT00001671428.
DR   EnsemblGenomes-Tr; EBT00001671429.
DR   EnsemblGenomes-Tr; EBT00001671430.
DR   EnsemblGenomes-Tr; EBT00001671431.
DR   EnsemblGenomes-Tr; EBT00001671432.
DR   EnsemblGenomes-Tr; EBT00001671433.
DR   EnsemblGenomes-Tr; EBT00001671434.
DR   EnsemblGenomes-Tr; EBT00001671435.
DR   EnsemblGenomes-Tr; EBT00001671436.
DR   EnsemblGenomes-Tr; EBT00001671437.
DR   EnsemblGenomes-Tr; EBT00001671438.
DR   EnsemblGenomes-Tr; EBT00001671439.
DR   EnsemblGenomes-Tr; NGK_rrna16s1-1.
DR   EnsemblGenomes-Tr; NGK_rrna16s2-1.
DR   EnsemblGenomes-Tr; NGK_rrna16s3-1.
DR   EnsemblGenomes-Tr; NGK_rrna16s4-1.
DR   EnsemblGenomes-Tr; NGK_rrna23s1-1.
DR   EnsemblGenomes-Tr; NGK_rrna23s2-1.
DR   EnsemblGenomes-Tr; NGK_rrna23s3-1.
DR   EnsemblGenomes-Tr; NGK_rrna23s4-1.
DR   EnsemblGenomes-Tr; NGK_rrna5s1-1.
DR   EnsemblGenomes-Tr; NGK_rrna5s2-1.
DR   EnsemblGenomes-Tr; NGK_rrna5s3-1.
DR   EnsemblGenomes-Tr; NGK_rrna5s4-1.
DR   EnsemblGenomes-Tr; NGK_tRNAArg4-1.
DR   EnsemblGenomes-Tr; NGK_tRNAGlu3-1.
DR   EnsemblGenomes-Tr; NGK_tRNAPro3-1.
DR   EnsemblGenomes-Tr; NGK_trnaAla1-1.
DR   EnsemblGenomes-Tr; NGK_trnaAla2-1.
DR   EnsemblGenomes-Tr; NGK_trnaAla3-1.
DR   EnsemblGenomes-Tr; NGK_trnaAla4-1.
DR   EnsemblGenomes-Tr; NGK_trnaAla5-1.
DR   EnsemblGenomes-Tr; NGK_trnaArg1-1.
DR   EnsemblGenomes-Tr; NGK_trnaArg2-1.
DR   EnsemblGenomes-Tr; NGK_trnaArg3-1.
DR   EnsemblGenomes-Tr; NGK_trnaArg5-1.
DR   EnsemblGenomes-Tr; NGK_trnaAsn1-1.
DR   EnsemblGenomes-Tr; NGK_trnaAsn2-1.
DR   EnsemblGenomes-Tr; NGK_trnaAsp1-1.
DR   EnsemblGenomes-Tr; NGK_trnaAsp2-1.
DR   EnsemblGenomes-Tr; NGK_trnaCys1-1.
DR   EnsemblGenomes-Tr; NGK_trnaGln1-1.
DR   EnsemblGenomes-Tr; NGK_trnaGln2-1.
DR   EnsemblGenomes-Tr; NGK_trnaGlu1-1.
DR   EnsemblGenomes-Tr; NGK_trnaGlu2-1.
DR   EnsemblGenomes-Tr; NGK_trnaGly1-1.
DR   EnsemblGenomes-Tr; NGK_trnaGly2-1.
DR   EnsemblGenomes-Tr; NGK_trnaGly3-1.
DR   EnsemblGenomes-Tr; NGK_trnaGly4-1.
DR   EnsemblGenomes-Tr; NGK_trnaHis1-1.
DR   EnsemblGenomes-Tr; NGK_trnaIle1-1.
DR   EnsemblGenomes-Tr; NGK_trnaIle2-1.
DR   EnsemblGenomes-Tr; NGK_trnaIle3-1.
DR   EnsemblGenomes-Tr; NGK_trnaIle4-1.
DR   EnsemblGenomes-Tr; NGK_trnaLeu1-1.
DR   EnsemblGenomes-Tr; NGK_trnaLeu2-1.
DR   EnsemblGenomes-Tr; NGK_trnaLeu3-1.
DR   EnsemblGenomes-Tr; NGK_trnaLeu4-1.
DR   EnsemblGenomes-Tr; NGK_trnaLeu5-1.
DR   EnsemblGenomes-Tr; NGK_trnaLys1-1.
DR   EnsemblGenomes-Tr; NGK_trnaLys2-1.
DR   EnsemblGenomes-Tr; NGK_trnaMet1-1.
DR   EnsemblGenomes-Tr; NGK_trnaMet2-1.
DR   EnsemblGenomes-Tr; NGK_trnaMet3-1.
DR   EnsemblGenomes-Tr; NGK_trnaPhe1-1.
DR   EnsemblGenomes-Tr; NGK_trnaPro1-1.
DR   EnsemblGenomes-Tr; NGK_trnaPro2-1.
DR   EnsemblGenomes-Tr; NGK_trnaSer1-1.
DR   EnsemblGenomes-Tr; NGK_trnaSer2-1.
DR   EnsemblGenomes-Tr; NGK_trnaSer3-1.
DR   EnsemblGenomes-Tr; NGK_trnaSer4-1.
DR   EnsemblGenomes-Tr; NGK_trnaThr1-1.
DR   EnsemblGenomes-Tr; NGK_trnaThr2-1.
DR   EnsemblGenomes-Tr; NGK_trnaThr3-1.
DR   EnsemblGenomes-Tr; NGK_trnaTrp1-1.
DR   EnsemblGenomes-Tr; NGK_trnaTyr1-1.
DR   EnsemblGenomes-Tr; NGK_trnaVal1-1.
DR   EnsemblGenomes-Tr; NGK_trnaVal2-1.
DR   EnsemblGenomes-Tr; NGK_trnaVal3-1.
DR   EuropePMC; PMC2519540; 18586945.
DR   EuropePMC; PMC2859308; 19574307.
DR   EuropePMC; PMC2893595; 20525335.
DR   EuropePMC; PMC3067668; 21257765.
DR   EuropePMC; PMC3078933; 21533118.
DR   EuropePMC; PMC3122619; 21508163.
DR   EuropePMC; PMC3125207; 21711902.
DR   EuropePMC; PMC3153036; 21833316.
DR   EuropePMC; PMC3368873; 22701644.
DR   EuropePMC; PMC3454330; 23029370.
DR   EuropePMC; PMC3624559; 23378511.
DR   EuropePMC; PMC3941690; 24568221.
DR   EuropePMC; PMC3942440; 24594737.
DR   EuropePMC; PMC4243333; 25426337.
DR   EuropePMC; PMC4487204; 26122105.
DR   EuropePMC; PMC4549065; 22045584.
DR   EuropePMC; PMC4620152; 26579097.
DR   EuropePMC; PMC4635466; 25701734.
DR   EuropePMC; PMC5320588; 28348864.
DR   EuropePMC; PMC5320595; 28348871.
DR   EuropePMC; PMC5320596; 28348872.
DR   EuropePMC; PMC5874624; 29361673.
DR   EuropePMC; PMC5890773; 29182725.
DR   EuropePMC; PMC6454682; 30961546.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00114; S15.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00522; PreQ1.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01344; CRISPR-DR34.
DR   RFAM; RF01416; NrrF.
DR   RFAM; RF01725; SAM-I-IV-variant.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01843; neisseria_FSE.
DR   RFAM; RF01850; beta_tmRNA.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02221; sRNA-Xcc1.
DR   RFAM; RF02270; nse_sRNA.
DR   RFAM; RF02274; AniS.
DR   SILVA-LSU; CP001050.
DR   SILVA-SSU; CP001050.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2232025
FT                   /organism="Neisseria gonorrhoeae NCCP11945"
FT                   /strain="NCCP11945"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:521006"
FT   gene            206..1714
FT                   /locus_tag="NGK_0001"
FT   CDS_pept        206..1714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0001"
FT                   /product="putative chromosomal replication protein (DnaA)"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28704"
FT                   /db_xref="GOA:B4RNS3"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:B4RNS3"
FT                   /protein_id="ACF28704.1"
FT                   /translation="MLPHGQFAQWIAPLTVGEEGGVWVVYGKNQFACNMLKSQFAGKIE
FT                   AVREELAAGRPAFVFKPGEGVRYEMAAVEGAVEPAEPSLHAGSEEMPVQEVLLDELPSE
FT                   KPVKPAASKTAADILAERMKNLPHEPRQAAGPASRPESAAVAKARTDAQRDAEEARYEQ
FT                   TNLSPDYTFDTLVEGKGNRLAAAAAQAIAENPGQSYNPFFLYGSTGLGKTHLVQAVGNE
FT                   LLKNRPDAKVRYMHSDDYIRSFMKAVRNNTYDVFKQQYKQYDLLIIDDIQFIKGKDRTM
FT                   EEFFYLYNHFHNEKKQLILTCDVLPAKIEGMDDRLKSRFSWGLTLELEPPELEMRIAIL
FT                   QKKAEAAGISIEDEAALFIANLIRSNVRELEGAFNRVGASSRFMNRPVIDIDLARTALQ
FT                   DIIAEKHKVITADIIIDAVAKYYRIKISDVLGKKRTRNIARPRQVAMSLTKELTTLSLP
FT                   SIGDSFGGRDHTTVMHGIRAVAKLREEDPELAQDYEKLLILIQN"
FT   gene            1794..2417
FT                   /locus_tag="NGK_0002"
FT   CDS_pept        1794..2417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0002"
FT                   /product="DNA polymerase III subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28705"
FT                   /db_xref="GOA:B4RNS4"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:B4RNS4"
FT                   /protein_id="ACF28705.1"
FT                   /translation="MLILQAERDSLLKPLQAVTGIVERRHTLPILSNVLIEGRGGQTKL
FT                   LATDLEIQIDTAGPEGGAGDFRITTNAKKFQDILRALPAGALVSLDWDDNRLTLKAGKS
FT                   RFALQTLPAADFPMMNVGEDISATFSLGQERFKTMLSQVQYSMAVQDIRYYLNGLLMQV
FT                   EGSQLRLVATDGHRLDYAACAIDADLPRAEVILPRKRCWNCSNC"
FT   gene            2393..2896
FT                   /locus_tag="NGK_0003"
FT   CDS_pept        2393..2896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0003"
FT                   /product="DNA polymerase III subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28706"
FT                   /db_xref="GOA:B4RNS5"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:B4RNS5"
FT                   /protein_id="ACF28706.1"
FT                   /translation="MLELFKLLNNPDDPIQIELLDKQVRFQCNGTTIVSKVIDGKFPDF
FT                   NRVIPLDNDKIFVLSRAELLGALERVSILANEKFRGARLFLQPGLLSVVCSNNEQEEAR
FT                   EEIEIAYQGGELEVGFNIGYLMDVLRNIHSDDMQLAFGDANRSTLFTVPNNPNFKYIVM
FT                   PMRI"
FT   gene            complement(3045..5252)
FT                   /locus_tag="NGK_0004"
FT   CDS_pept        complement(3045..5252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0004"
FT                   /product="polyphosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28707"
FT                   /db_xref="GOA:B4RNS6"
FT                   /db_xref="InterPro:IPR003414"
FT                   /db_xref="InterPro:IPR024953"
FT                   /db_xref="InterPro:IPR025198"
FT                   /db_xref="InterPro:IPR025200"
FT                   /db_xref="InterPro:IPR036830"
FT                   /db_xref="InterPro:IPR036832"
FT                   /db_xref="InterPro:IPR041108"
FT                   /db_xref="UniProtKB/TrEMBL:B4RNS6"
FT                   /protein_id="ACF28707.1"
FT                   /translation="MPVSVFTLPRCLKQTVRHVMPPETGADAAKPSDGIVRPLRPNNNH
FT                   LWENLMTEQNRILCRELSLLAFNRRVLAQAEDKNVPLLERLRFLCIVSSNLDEFFEVRM
FT                   AWLKRENKLHPRRRPDNGKTPSETIADVTEAARSLIRHQYDLFNNVLQPELARESIHFY
FT                   RRRNWTGTQKKWIEDYFDRELLPILTPIGLDPSHPFPRPLNKSLNFAVELDGTDAFGRP
FT                   SGMAIVQAPRILPRVVPLPSELCGGGHGFVFLSSILHAHVGKLFPGMNVKGCHQFRLTR
FT                   DSDLTVDEEDVQNLRAAIQNELHDREYGDGVRLEVADTCPAYIRDFLLAQFRLTDAELY
FT                   QVKGPVNLVRLNAVPDLVNRPDLKFPPHTPGRLKALGKNSPIFDLVRQSPILLHHPYQS
FT                   FDPVVDMIREAAADPAVLAVKMTIYRTGTRSELVPALMKAALAGKQVTVVVELMARFDE
FT                   ANNVNWAKQLEEAGAHVVYGVFGYKVHAKMALVIRREDGVLKRYAHLGTGNYHQGTSRI
FT                   YTDFGLITADEQITADVNTLFMEITGLGKPGRLNKLYQSPFTLHKMVIGRIARETEHAK
FT                   AGKPARITAKMNSLIEPTVIEALYRASAAGVQIDLIVRGMCTLRPGVKGLSENIRVRSI
FT                   VGRQLEHARVYCFHNNGADDTFISSADWMGRNFFRRIETATPITAPELKKRVIREGLEM
FT                   ALADNTHAWLMQPDGGYIRAAPAEGESEADLQNDLWDLLRG"
FT   gene            complement(5271..5714)
FT                   /locus_tag="NGK_0005"
FT   CDS_pept        complement(5271..5714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0005"
FT                   /product="Periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28708"
FT                   /db_xref="UniProtKB/TrEMBL:B4RNS7"
FT                   /protein_id="ACF28708.1"
FT                   /translation="MPPRLLSGILCCLLTTAPVFAQGQPDAVSAYIQKKKVIVDTSKAE
FT                   LCFADDRQCHPVLIGTATPKGTFGLTLNSTDKPGYGGEVIGFKQEGDFLFALHRVWNQI
FT                   PSERRNERIASPSVSDRIMTNGCINVSDAVYEKLRHYFVLEVI"
FT   gene            complement(5721..6050)
FT                   /locus_tag="NGK_0006"
FT   CDS_pept        complement(5721..6050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0006"
FT                   /product="lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28709"
FT                   /db_xref="GOA:B4RNS8"
FT                   /db_xref="InterPro:IPR007450"
FT                   /db_xref="UniProtKB/TrEMBL:B4RNS8"
FT                   /protein_id="ACF28709.1"
FT                   /translation="MRPGLTKDDIYKIPGRPHYDEGMYGVREWDYLFHFHTPGVGIDPE
FT                   NTSGVEGVTTCQYKVIFDKDKFARSFYWNPVFPKDAVCPPPAPKAEPQVIIREIVPAKP
FT                   KRIRQ"
FT   gene            complement(6064..6237)
FT                   /locus_tag="NGK_0007"
FT   CDS_pept        complement(6064..6237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0007"
FT                   /product="lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28710"
FT                   /db_xref="UniProtKB/TrEMBL:B4RNS9"
FT                   /protein_id="ACF28710.1"
FT                   /translation="MKIKQIVKPSLAVLAAGILSACATIKQRQSRRHDRQSGFPGTLFR
FT                   NARQQARHIPDL"
FT   gene            complement(6234..6440)
FT                   /locus_tag="NGK_0008"
FT   CDS_pept        complement(6234..6440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0008"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28711"
FT                   /db_xref="UniProtKB/TrEMBL:B4RNT0"
FT                   /protein_id="ACF28711.1"
FT                   /translation="MSANRQIAGRMRKFARASFRMPYKYTAFTDTHVFYANITNQNQTF
FT                   KTLLMRLFRTKGRRASGKKGFCI"
FT   gene            6504..9134
FT                   /locus_tag="NGK_0009"
FT   CDS_pept        6504..9134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0009"
FT                   /product="leucyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28712"
FT                   /db_xref="GOA:B4RNT1"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002302"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR025709"
FT                   /db_xref="PDB:6Q8A"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4RNT1"
FT                   /protein_id="ACF28712.1"
FT                   /translation="MQEHYQPAAIEPAAQKKWDDARISNVSEDASKPKYYCLSMFPYPS
FT                   GKLHMGHVRNYTIGDVLSRFKLLNGFNVMQPMGWDAFGMPAENAAMKNNVAPAAWTYDN
FT                   IEYMKTQLKSLGFAVDWEREVATCKPEYYRWEQWLFTKLFEKGIVYRKNGTVNWDPVDQ
FT                   TVLANEQVIDGRGWRSGALIEKREIPMYYFKITDYAEELLNDLDKLEHWPEQVKTMQRN
FT                   WIGKSRGMTVRFAVSDDSKQGLEGDYAKFLQVYTTRPDTLMGATYVAVAAEHPLATAAA
FT                   ADKPELQAFIAECKAGSVAEADMATMEKKGVPTGRYVVNPLNGDKLEVWIANYVLWGYG
FT                   DGAVMAVPAHDERDFEFAAKYNLPKKQVIAVGDNAFDANRWQEWYGDKENGVLVNSGDL
FT                   DGLDFQTAFDAVAAKLQSQGAGEPKTQYRLRDWGISRQRYWGCPIPIVHCEKCGDVPVP
FT                   ADQLPVVLPENVVPDGMGSPLAKMPEFYETSCPCCGGAAKRETDTMDTFMESSWYFFRY
FT                   MSPKFSDGMVSAESAKYWGAVDQYIGGIEHAILHLLYARFFTKLMRDEGLVNVDEPFER
FT                   LLTQGMVVCETYYRENDKGGKDWINPADVELTFDDKGRPVSAVLKADGLPVVISGTEKM
FT                   SKSKNNGVDPQELINAYGADTARLFMMFAAPPEQSLEWSDSGVEGAHRFLRRLWRTVYE
FT                   YLKQGGAVKAFAGNQDGLSKELKDLRHKLHSTTAKVSDDYGRRQQFNTAIAAVMELLNQ
FT                   YDKTDTGSEQGRAVAQEVLEAAVRLLWPIVPHICETLWSELNGAKLWEAGWPTVDEAAL
FT                   VKSEIEVMVQVNGKLRGKITVAADASKADLEAAALANEGAVKFMEGKPAKKIIVVPGRL
FT                   VNIVV"
FT   gene            9363..10154
FT                   /locus_tag="NGK_0010"
FT   CDS_pept        9363..10154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0010"
FT                   /product="dam-replacing protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28713"
FT                   /db_xref="InterPro:IPR010324"
FT                   /db_xref="InterPro:IPR024064"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR041368"
FT                   /db_xref="UniProtKB/TrEMBL:B4RNT2"
FT                   /protein_id="ACF28713.1"
FT                   /translation="MNLFFDTQLGKQQNKATHKIRVMSEAWLEKNGYCPCCGSKPMQRF
FT                   ANNKPVADLFCPNCHEQYELKSKNQKTIGNSVPDGAYRTMLERIRSDTNPNFFFLAYKK
FT                   ADYSIRQLVLVPKHFITPDMIIPRNKGIKNRPHHIMCSINLAPLPESGKIFLIDDSRII
FT                   EPETVLKKWQSNLFLRNQNAERKDWLLAVMKCIDQLTEEFTLSQMYEFENKLSIQFPQN
FT                   NHIKDKIRQQLQILRDQNMIEFIGRGLYKKIDKLHPTPKAF"
FT   gene            10151..10291
FT                   /locus_tag="NGK_0011"
FT   CDS_pept        10151..10291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0011"
FT                   /product="putative type II restriction endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28714"
FT                   /db_xref="GOA:B4RNT3"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B4RNT3"
FT                   /protein_id="ACF28714.1"
FT                   /translation="MISNHDTEFTRNIYSSAILKTVEVQRNIAAKGSSRKKVGELLAIY
FT                   D"
FT   gene            10284..10436
FT                   /locus_tag="NGK_0012"
FT   CDS_pept        10284..10436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0012"
FT                   /product="Putative Modification methylase DpnIIB"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28715"
FT                   /db_xref="GOA:B4RNT4"
FT                   /db_xref="UniProtKB/TrEMBL:B4RNT4"
FT                   /protein_id="ACF28715.1"
FT                   /translation="MIDFDKPAEEAAIYQSRLKKSFQTTLSSTTKIPLTSCGRYWKNIQ
FT                   TAVLI"
FT   gene            10433..10768
FT                   /locus_tag="NGK_0013"
FT   CDS_pept        10433..10768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0013"
FT                   /product="putative modification methylase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28716"
FT                   /db_xref="GOA:B4RNT5"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B4RNT5"
FT                   /protein_id="ACF28716.1"
FT                   /translation="MIFADPPYFLSNDGFSCQNGQMVSVNKGNWDKSKGMAADLEFYEE
FT                   WLRLCYALLKPNGTIWVCGTFHNIYLIGYLMQTVGYHILNNITWEKPNPPPNLSCRFFT
FT                   HSTETIL"
FT   gene            10814..11092
FT                   /locus_tag="NGK_0014"
FT   CDS_pept        10814..11092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0014"
FT                   /product="putative modification methylase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28717"
FT                   /db_xref="GOA:B4RNT6"
FT                   /db_xref="InterPro:IPR001091"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B4RNT6"
FT                   /protein_id="ACF28717.1"
FT                   /translation="MKTQNDGKQMKCVWTFPPPNKTEKTFGKHPTQKPLPLLERCILSA
FT                   SNIGDLIFDPFMGSGTTGVAALKHGRRFCGCELEEDFFELAKKRLEK"
FT   gene            11164..11544
FT                   /locus_tag="NGK_0015"
FT   CDS_pept        11164..11544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0015"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28718"
FT                   /db_xref="UniProtKB/TrEMBL:B4RNT7"
FT                   /protein_id="ACF28718.1"
FT                   /translation="MFEEIPGYDLRKTDDNAGYEVWFNGELKAYCFKKYEFYRFLERLE
FT                   YNINWKDHLSKRLLPDNGLFIIIRDTLFIIEIKFQQTPGSVDEKLQTCDFKRKQYTKLV
FT                   HSLGWRVGYVYVLNDWFTKPEY"
FT   gene            complement(12094..12306)
FT                   /locus_tag="NGK_0016"
FT   CDS_pept        complement(12094..12306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0016"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28719"
FT                   /db_xref="UniProtKB/TrEMBL:B4RNT8"
FT                   /protein_id="ACF28719.1"
FT                   /translation="MPDRIKPSRNGGGADGIARQQGTAQTGAKPETSPTARHGDFLRPL
FT                   QGGIGFKRRGLEGKTGGAQNCLNAV"
FT   gene            complement(12416..12727)
FT                   /locus_tag="NGK_0017"
FT   CDS_pept        complement(12416..12727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0017"
FT                   /product="Helix-turn-helix family protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28720"
FT                   /db_xref="GOA:B4RNT9"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B4RNT9"
FT                   /protein_id="ACF28720.1"
FT                   /translation="MKYKSGIFAAIHETMQGLHDIGAIDKKTMRGFDKSCLTEIKPLSG
FT                   GDIKAIREKEALSQAAFAIYLNVGKNHVSAWERGVKKPSGAALKLLTIVKNKGIEAIA"
FT   gene            complement(12724..12966)
FT                   /locus_tag="NGK_0018"
FT   CDS_pept        complement(12724..12966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0018"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28721"
FT                   /db_xref="InterPro:IPR009387"
FT                   /db_xref="UniProtKB/TrEMBL:B4RNU0"
FT                   /protein_id="ACF28721.1"
FT                   /translation="MIKQRIARQGQGRSGGYRSLIFFRHGERAFFMTAFAKNDRENITD
FT                   KELTELKKTAAIILAMTETDIEQAKSNGTFTEIQP"
FT   gene            complement(12963..13091)
FT                   /locus_tag="NGK_0019"
FT   CDS_pept        complement(12963..13091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0019"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28722"
FT                   /db_xref="InterPro:IPR009387"
FT                   /db_xref="UniProtKB/TrEMBL:B4RNU1"
FT                   /protein_id="ACF28722.1"
FT                   /translation="MRIFKNQWIVKFAKKHKISDSELIEAVERADNGLIDADLGGA"
FT   gene            13340..13624
FT                   /locus_tag="NGK_0020"
FT   CDS_pept        13340..13624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0020"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28723"
FT                   /db_xref="UniProtKB/TrEMBL:B4RNU2"
FT                   /protein_id="ACF28723.1"
FT                   /translation="MRFGFSFRYAPTAKTVKNRKTPKVVTDSLPFVTAFVTNFLSFSYF
FT                   YSELNLNRYGVASPCRTICTVCGSPPCPDLNLIHYISYTYLSNFSPVTR"
FT   gene            13787..13906
FT                   /locus_tag="NGK_0021"
FT   CDS_pept        13787..13906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0021"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28724"
FT                   /db_xref="UniProtKB/TrEMBL:B4RNU3"
FT                   /protein_id="ACF28724.1"
FT                   /translation="MRYFSDTVKNQVSSIRADWTGLHSQEGDGRITISLKSLY"
FT   gene            complement(13981..14066)
FT                   /locus_tag="NGK_trnaLeu1"
FT   tRNA            complement(13981..14066)
FT                   /locus_tag="NGK_trnaLeu1"
FT                   /product="tRNA-Leu"
FT   gene            complement(14080..14430)
FT                   /locus_tag="NGK_0022"
FT   CDS_pept        complement(14080..14430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0022"
FT                   /product="putative protein-export protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28725"
FT                   /db_xref="GOA:B4RNU4"
FT                   /db_xref="InterPro:IPR004692"
FT                   /db_xref="UniProtKB/TrEMBL:B4RNU4"
FT                   /protein_id="ACF28725.1"
FT                   /translation="MEAFKTLIWIINIISALAVIVLVLLQHGKGADAGATFGSGSGSAQ
FT                   GVFGSAGNANFLSRSTAVAATFFFATCMAMVYIHTHTTKHGLDFSNIRQTQQAPKPVSN
FT                   TEPSAPVPQQQK"
FT   gene            complement(14437..15192)
FT                   /locus_tag="NGK_0023"
FT   CDS_pept        complement(14437..15192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0023"
FT                   /product="triosephosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28726"
FT                   /db_xref="GOA:B4RNU5"
FT                   /db_xref="InterPro:IPR000652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020861"
FT                   /db_xref="InterPro:IPR022896"
FT                   /db_xref="InterPro:IPR035990"
FT                   /db_xref="UniProtKB/TrEMBL:B4RNU5"
FT                   /protein_id="ACF28726.1"
FT                   /translation="MWDQKWVIGNWKMNGRLQNNNALMHRFRILPTAERVLIGLAAPTV
FT                   YLLQLHNAMQIVLNNRILTCAQDVSRFPDNGAYTGEVSAEMLADTGTDIVLIGHSERSL
FT                   YFGEKNEIQRRKMENVLNVGLIPLLCVGESLEERETGKEHEVIAHQLSILQGLDTKNIA
FT                   VAYEPVWAIGTGKVATVEQIADMHAFIYKEILSLCGSDVKIRVLYGGSVKADNAADIFA
FT                   VPYVDGALVGGASLSYDSFTAIISAAQNA"
FT   gene            15274..15393
FT                   /locus_tag="NGK_0024"
FT   CDS_pept        15274..15393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0024"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28727"
FT                   /db_xref="UniProtKB/TrEMBL:B4RNU6"
FT                   /protein_id="ACF28727.1"
FT                   /translation="MDMRRVRNLGRAAAGAVWNVVSGRMFYNGCLICMQIWEI"
FT   gene            15381..15896
FT                   /locus_tag="NGK_0025"
FT   CDS_pept        15381..15896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0025"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28728"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:B4RNU7"
FT                   /protein_id="ACF28728.1"
FT                   /translation="MGDMMHALHFSASDKAALYREVLPQIESVVADEADWVANLANTAA
FT                   VLKEAFGWLWVGFYLVDTRSDELVLAPFQGPLACTRIPFGRGVCGQAWAKGETVVVKDV
FT                   NAHPDHIACSSLSRSEIVVPLFSDGRCIGVLDADSEHLAQFDEADALYLGELAKILERR
FT                   FEASSQAA"
FT   gene            15999..16655
FT                   /locus_tag="NGK_0026"
FT   CDS_pept        15999..16655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0026"
FT                   /product="Protein-L-isoaspartate O-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28729"
FT                   /db_xref="GOA:B4RNU8"
FT                   /db_xref="InterPro:IPR000682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B4RNU8"
FT                   /protein_id="ACF28729.1"
FT                   /translation="MDFEKARFNMVEQQIRPWDVLDFDVLDALEEIPRELFADESLQGL
FT                   AYADMELPLANGHKMLEPKIVARLAQGLKLTKNDTVLEIGTGSGYATALLAKLAGRVVS
FT                   DDIDAERQKRAKAVLDGLSLENIDYVQNNGLTELSAGAPFDAVYVGGAVTLVPEVLKEQ
FT                   LKDGGRMAVIVGRRPVQRALLITRRGDVFEEKVLFDTLVAHLDDKDAHPFDSFNF"
FT   gene            16688..17059
FT                   /locus_tag="NGK_0027"
FT   CDS_pept        16688..17059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0027"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28730"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:B4RNU9"
FT                   /protein_id="ACF28730.1"
FT                   /translation="MGLQTAFCLVFFGGFVMDIVQLPSAALKAWMDEGRMFCLLDVRTD
FT                   EEAAVCSLPNALHIPMNLIPLRQNELPDDVPLVVYCHHGIRSLHTAMYLAEAGFENLYN
FT                   LQGGIDAWAVEVDAEMARY"
FT   gene            complement(17322..19049)
FT                   /locus_tag="NGK_0029"
FT   CDS_pept        complement(17322..19049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0029"
FT                   /product="TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28732"
FT                   /db_xref="GOA:B4RNV0"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:B4RNV0"
FT                   /protein_id="ACF28732.1"
FT                   /translation="MEVVRGVAGLPDGTGEPSATVNLVRKHPTRKPLFEVRAEAGNRKH
FT                   FGLGADVSGSLNAEGTLRGRLVSTFGRGDSWRQLERSRDAELYGILEYDIAPQTRVHAG
FT                   MDYQQAKETADAPLSYAVYDSQGYATAFGPKDNPATNWSNSRNRALNLFAGIEHRFNQD
FT                   WKLKAEYDYTRSRFRQPYGVAGVLSIDHSTAATDLIPGYWHADPRTHSASMSLTGKYRL
FT                   FGREHDLIAGINGYKYASNKYGERSIIPNAIPNAYEFSRTGAYPQPSSFAQTIPQYDTR
FT                   RQIGGYLATRFRAADNLSLILGGRYSRYRAGSYNSRTQGMTYVSANRFTPYTGIVFDLT
FT                   GNLSLYGSYSSLFVPQLQKDEHGSYLKPVTGNNLEADIKGEWLEGRLNASAAVYRARKN
FT                   NLATAAGRDQSGNTYYRAANQAKTHGWEIEVGGRITPEWQIQAGYSQSKPRDQDGSRLN
FT                   PDSVPERSFKLFTAYHLAPEAPSGRTIGAGVRRQGETHTDPAALHIPNPAAKARAVANS
FT                   RQKAYAVADIMARYRFNPRTELSLNVDNLFNKHYRTQPDRHSHGALRTVNAAFTYRFK"
FT   gene            19119..19334
FT                   /locus_tag="NGK_0028"
FT   CDS_pept        19119..19334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0028"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28731"
FT                   /db_xref="UniProtKB/TrEMBL:B4RNV1"
FT                   /protein_id="ACF28731.1"
FT                   /translation="MVVGDAAAAREQVVVARAVGAGLVPVACNRARSSVLMFWSRICCD
FT                   VMTLTLCGISRRVMGSPNGVCVPETV"
FT   gene            complement(19752..20075)
FT                   /locus_tag="NGK_0030"
FT   CDS_pept        complement(19752..20075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0030"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28733"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B4RNV2"
FT                   /protein_id="ACF28733.1"
FT                   /translation="MQNETINLKQHLAAIKEYWQPEIINRHGFQFRLVKLLGDYGWHTH
FT                   GYSDKVLFAVEGDMAVDFADGGNMTIREGEMAVVPKSVSHRPRSENGCSVVLIDLPDPS
FT                   EAA"
FT   gene            complement(20108..21079)
FT                   /locus_tag="NGK_0032"
FT   CDS_pept        complement(20108..21079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0032"
FT                   /product="Ferric enterobactin transporter binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28735"
FT                   /db_xref="GOA:B4RNV3"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="InterPro:IPR033870"
FT                   /db_xref="UniProtKB/TrEMBL:B4RNV3"
FT                   /protein_id="ACF28735.1"
FT                   /translation="MKPRFYWAACAVLPAACSPEPAAEKTVSAASQAASTPVATLTVPT
FT                   ARGDAVVPKNPERVAVYDWAALDTLTEPGVNVGATTAPVRVDYLQPAFDKAATVGTLFE
FT                   PDCESLHRHNPQFVITGGPGAEAYEQLAKNATTIDLTVDNGNIRTSGEKQMETLSRIFG
FT                   KEARVAELNAQIDALFAQKREAAKGKGRGLVLSVTGNKVSAFGTQSRLASWIHGDIGLP
FT                   PVDESLRNEGHGQPVSFEYIKEKNPGWIFIIDRTAAIGQEGPAAVEVLDNALVCGTNAW
FT                   KRKQIIVMPAANYIVAGGARQLIQAAEQLKAAFEKAEPVAAQ"
FT   gene            21083..21208
FT                   /locus_tag="NGK_0031"
FT   CDS_pept        21083..21208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0031"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28734"
FT                   /db_xref="UniProtKB/TrEMBL:B4RNV4"
FT                   /protein_id="ACF28734.1"
FT                   /translation="MRFLCIRIRMFIIKQTTCRNHAAKRKIPDTAKQIPETEKVV"
FT   gene            21315..22271
FT                   /locus_tag="NGK_0033"
FT   CDS_pept        21315..22271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0033"
FT                   /product="putative AraC-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28736"
FT                   /db_xref="GOA:B4RNV5"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:B4RNV5"
FT                   /protein_id="ACF28736.1"
FT                   /translation="MNTAAIYRQYQTYVRSDKSGWALDGCSDSALIAQAKQPGLHLKMC
FT                   INRFDSGITLSRMRGGGTGAFPTEIHNFSHNCALFVMVSGQNRLQMGGREYRPSAGEIW
FT                   LVRGELADVSETLLPDSGGMCALHLDFSLEKLRRWHDEGLLDERLFSPQTIGRFALQRL
FT                   AQNAGTLTAAACPLLQRPFESDGFGLLADEADALELSARLLRFTFRRHDNGYRRRRIDE
FT                   AADILNSEFARPLTIAEIARRVGLNECYLKRYFKAQTGETVAGRLRRLRLEHALALIES
FT                   GSTIQAAMHFCGYRHAGRFNEAFRRHYGFLPSDVKKC"
FT   gene            complement(22384..24399)
FT                   /locus_tag="NGK_0034"
FT   CDS_pept        complement(22384..24399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0034"
FT                   /product="putative prolyl endopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28737"
FT                   /db_xref="GOA:B4RNV6"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002470"
FT                   /db_xref="InterPro:IPR023302"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B4RNV6"
FT                   /protein_id="ACF28737.1"
FT                   /translation="MKSYPDPYRHFENLDSAETQNFAAEANAETRARFLNNDKARALSD
FT                   GILNQMQDTRQIPFCQEHRARMYHFHQNAEYPKGVYRMCTAATYRSGYPEWKILFSVAD
FT                   FDELLGDDVYLGGVSHLVEQPNRALLTLNKSGGDTAYTLEVDLEAGELVEGGFHFPAGK
FT                   NHVSWRDENSVWVCPAWDERQLTESGYPREVWLVERGKSFEESLPAYQIDKGAMMVNAW
FT                   RYLDPQGSPIDLIEASDGFYTKTYLQVSSEGGAKPLNLPNDCDVVGYLAGHLLLTLRKD
FT                   WHRANQSYPSGALVAVKLNRGELGAAQLLFAPDETQALESVETTKRFVVASLLENVQGR
FT                   LKAWRFADSKWQEAELPHLPSGALEMTDQPWGGDVVYLAASDFTTPLTLFALDLNVMEL
FT                   TVMRLQPQQFVSDGIEVRQFWAVSSDGERIPYFHVGKNAAPDTPTLVYAYGGFGIPELP
FT                   HYLGSVGKYWLEEGNAFVLANIRGGGEFGPRWHQAAQGISKHKSVDDLLAVVRDLSERG
FT                   MSSPKHIGLQGGSNGGLITAAAFVREPQSIGALVCEVPLTDMIRYPLLSAGSSWTDEYG
FT                   NPQKYEACKRRLGELSPYHNLSDGIDYPPALITTSLSDDRVHPAHALKFYAKLRETSPQ
FT                   SWLYSPDGGGHTGNGTQRESADKLACVLLFLKEFLG"
FT   gene            complement(24495..25805)
FT                   /locus_tag="NGK_0035"
FT   CDS_pept        complement(24495..25805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0035"
FT                   /product="N-acetylglutamate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28738"
FT                   /db_xref="GOA:B4RNV7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR010167"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR033719"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:B4RNV7"
FT                   /protein_id="ACF28738.1"
FT                   /translation="MNAPDSFVAHFREAAPYIRQMRGTTLVAGIDGRLLEGGTLNKLAA
FT                   DIGLLSQLGIRLVLIHGAYHFLDRLAAAQGRTPHYCRGLRVTDETSLGQAQQFAGTVRS
FT                   RFEAALCGSVSGFARAPSVPLVSGNFLTARPIGVIDGTDMEYAGVIRKTDTAALRFQLD
FT                   AGNIVWMPPLGHSYGGKTFNLDMVQAAASVAVSLQAEKLVYLTLSDGISRPDGTLAETL
FT                   SAQEAQSLAEHAASETRRLISSAVAALEGGVHRVQILNGAADGSLLQELFTRNGIGTSI
FT                   AKEAFVSIRQAHSGDIPHIAALIRPLEEQGILLHRSREYLENHISEFSILEHDGNLYGC
FT                   AALKTFAEADCGEIACLAVSPQAQDGGYGERLLAHIIDKARGIGISRLFALSTNTGEWF
FT                   AERGFQTASEDELPETRRKDYRSNGRNPHILVRRLHR"
FT   gene            complement(25802..26230)
FT                   /locus_tag="NGK_0036"
FT   CDS_pept        complement(25802..26230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0036"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28739"
FT                   /db_xref="GOA:B4RNV8"
FT                   /db_xref="InterPro:IPR011723"
FT                   /db_xref="UniProtKB/TrEMBL:B4RNV8"
FT                   /protein_id="ACF28739.1"
FT                   /translation="MPACFCPHCKTRLWVKETQLNVAQGFVVCQKCEGLFKAKDHLAST
FT                   KEPIFNDLPEAVSDVKLVHRIGTHAISKKQISRDEIADILNGGTTLHDTPPATAAAAPA
FT                   AAPQVSVPPARQEGLNWTIATLFALIVLIMQLSYLFIL"
FT   gene            complement(26304..26945)
FT                   /locus_tag="NGK_0037"
FT   CDS_pept        complement(26304..26945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0037"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28740"
FT                   /db_xref="GOA:B4RNV9"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4RNV9"
FT                   /protein_id="ACF28740.1"
FT                   /translation="MTDFRQDFLKFSLAQNVLKFGEFTTKAGRRSPYFFNAGLFNDGAS
FT                   TLQLAKFYAQSIIESGIRFDMLFGPAYKGIILAAATAMMLAEKGVNVPFAYNRKEAKDR
FT                   GEGGVLVGAPLKGRVLIIDDVISAGTSVRESIKLIEAEGATPAGVAIALDRMEKGTGEL
FT                   SAVQEVEKQYGLPVAPIASLNDLFILLQNNPEFGQFLEPVRTYRRQYGVE"
FT   gene            complement(27007..27744)
FT                   /locus_tag="NGK_0038"
FT   CDS_pept        complement(27007..27744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0038"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28741"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:B4RNW0"
FT                   /protein_id="ACF28741.1"
FT                   /translation="MLSARYLHLHEALGLGPMWLKQAAAVLPPKNTPATPAQARPQTVR
FT                   AATIRPSQPHNVQARLETMKALETAAVHTRKPAPETETPPPGLSDGIAPVPAASGITKL
FT                   AVVSLCPPIEDAVYGQLFHGKAGILLDNILKAAGLDAAYVHKTCWVKTAAVGNPMPSEQ
FT                   AVADALGQIAGELDGCRAPAVLFLGQAFVNLERQAMIETLCGSRPFFIIDHPARLLRQP
FT                   ELKARNWQVLKQLKRALRQGGGS"
FT   gene            complement(27738..28178)
FT                   /locus_tag="NGK_0039"
FT   CDS_pept        complement(27738..28178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0039"
FT                   /product="putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28742"
FT                   /db_xref="GOA:B4RNW1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR006464"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR017255"
FT                   /db_xref="UniProtKB/TrEMBL:B4RNW1"
FT                   /protein_id="ACF28742.1"
FT                   /translation="MNIRPALPSDCAALAALDTVCNPSAWTQRQFESALVSPSEQVFLA
FT                   EKDGRIAAFIVWQNLPDESELHLIATAPECRRRGVASALLEYWYAHLPEGTQRLLLEVR
FT                   AGNAAAQALYTKHGFSIAGRRKNYYCAADGQTEDAVLMEKIC"
FT   gene            complement(28175..28852)
FT                   /locus_tag="NGK_0040"
FT   CDS_pept        complement(28175..28852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0040"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28743"
FT                   /db_xref="GOA:B4RNW2"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:B4RNW2"
FT                   /protein_id="ACF28743.1"
FT                   /translation="MQADFNRPVLAVDTGTSYLSLALRADGEIRLFHQEVGIRQSELIL
FT                   PEIRTLFRNAGITAADLGAIVYAKGPGAFTGLRIGIGVAQGLATPFDTPLIGIPTLDAA
FT                   ASLPPPQSCILAAADARMGEVFYAWFDTLNRRRLSDYQVGRAADIALPEGYVFSDGIGS
FT                   AFALENRPPFSGKPDMPTAADFLALALGGGYPATGAAHAELLYVRNKIALTAKEQAERK
FT                   ART"
FT   gene            complement(28991..29800)
FT                   /locus_tag="NGK_0041"
FT   CDS_pept        complement(28991..29800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0041"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28744"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR014902"
FT                   /db_xref="UniProtKB/TrEMBL:B4RNW3"
FT                   /protein_id="ACF28744.1"
FT                   /translation="MTAGPDSDRLQQRRGGGGGVAADIGTGLADALTAPLDHKDKGLKS
FT                   LTLEASIPQNGTLTLSAQGAEKTFKAGGKDNSLNTGKLKNDKISRFDFVQKIEVDGQTI
FT                   TLASGEFQIYKQDHSAVVALRIEKINNPDKIDSLINQRSFLVSDLGGEHTAFNQLPDGK
FT                   AEYHGKAFSSDDAGGKLTYTIDFAAKQGHGKIEHLKTPEQNVELASAELKADEKSHAVI
FT                   LGDTRYGGEEKGTYRLALFGGRAQEIAGSATVKIGEKVHEIGIADKQ"
FT   gene            complement(29987..31126)
FT                   /locus_tag="NGK_0042"
FT   CDS_pept        complement(29987..31126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0042"
FT                   /product="fructose-bisphosphate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28745"
FT                   /db_xref="GOA:B4RNW4"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR006412"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B4RNW4"
FT                   /protein_id="ACF28745.1"
FT                   /translation="MSRLWFFAVKNIIIRLIYLLPKETQMALVSMRQLLDHAAENSYGL
FT                   PAFNVNNLEQMRAIMEAADQVNAPVIVQASAGARKYAGAPFLRHLILAAVEEFPHIPVV
FT                   MHQDHGASPDVCQRSIQLGFSSVMMDGSLLEDGKTPSSYEYNVNATRTVVNFSHACGVS
FT                   VEGEIGVLGNLETGEAGEEDGVGAAGKLSHDQMLTSVEDAVRFVKDTGVDALAIAVGTS
FT                   HGAYKFTRPPTGDVLRIDRIKEIHQALPNTHIVMHGSSSVPQEWLKVINEYGGNIGETY
FT                   GVPVEEIVEGIKHGVRKVNIDTDLRLASTGAVRRYLAENPSDFDPRKYLGKTIEAMKQI
FT                   CLDRYLAFGCEGQAGKIKPVSLEKMASRYAKGELNQIVK"
FT   gene            31245..32162
FT                   /locus_tag="NGK_0043"
FT   CDS_pept        31245..32162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0043"
FT                   /product="putative site-specific recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28746"
FT                   /db_xref="GOA:B4RNW5"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR011931"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4RNW5"
FT                   /protein_id="ACF28746.1"
FT                   /translation="MVLDGFAAYFDAYLENIVREGKSEHTVAAYRRDLEELFALLAQMP
FT                   SEDAGGVPQDLSRRDFTAALRRLSQRGLDGRTLARKLSAWRQYCAWLVKRGLMRADPTA
FT                   DIKPPKQPERVPKALPQEWLNRMLDLPVDGGDPLAVRDHALFELMYGSGLRVSEIHGLN
FT                   ADDVYLDEAWVHVTGKGRKQRQVPLTGKSVEALKNYLPLRQTASDGKALFTGRNGTRLS
FT                   QRQIQKRLESWAAQYGDGRHVSPHMMRHSYAGHLLQASRDIRAVQELLGHSSLSTTQIY
FT                   TKLDFDHIARLYDEAHPRAKRQDE"
FT   gene            32247..34160
FT                   /locus_tag="NGK_0044"
FT   CDS_pept        32247..34160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0044"
FT                   /product="1-deoxy-D-xylulose-5-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28747"
FT                   /db_xref="GOA:B4RNW6"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005477"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4RNW6"
FT                   /protein_id="ACF28747.1"
FT                   /translation="MNPSPLLDLIDSPQDLRRLDKKQLPRLAGELRAFLLESVGQTGGH
FT                   FASNLGAVELTIALHYVYDTPEDKLVWDVGHQSYPHKILTGRKNQMHTMRQYGGLAGFP
FT                   KRCESEYDAFGVGHSSTSIGAALGMAATDKLLGGDRRSVAIIGDGAMTAGQAFEALNCA
FT                   GDMDVDLLVVLNDNEMSISPNVGALPKYLASNVVRDMHGLLSTVKAQTGKVLDKIPGAM
FT                   EFAQKVEHKIKTLAEEAEHAKQSLSLFENFGFRYTGPVDGHNVENLVDVLKDLRSRKGP
FT                   QLLHVITKKGNGYKLAENDPVKYHAVANLPKEGGAQMPSEKEPKPAAKPTYTQVFGKWL
FT                   CDRAAADSRLVAITPAMREGSGLVEFEQRFPDRYFDVGIAEQHAVTFAGGLACEGMKPV
FT                   VAIYSTFLQRAYDQLVHDIALQNLPVLFAVDRAGIVGADGPTHAGLYDLSFLRCVPNMI
FT                   VAAPSDENECRLLLSTCYQADAPAAVRYPRGTGTGAPVSDGMETVEIGKGIIRREGEKT
FT                   AFIAFGSMVAPALAVAEKLNATVADMRFVKPIDEELIVRLARSHDRIVTLEENAEQGGA
FT                   GGAVLEVLAKHGICKPVLLLGVADTVTEHGDPKKLLDDLGLSAEAVERRVREWLPDRDA
FT                   AN"
FT   gene            34228..34401
FT                   /locus_tag="NGK_0045"
FT   CDS_pept        34228..34401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0045"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28748"
FT                   /db_xref="UniProtKB/TrEMBL:B4RNW7"
FT                   /protein_id="ACF28748.1"
FT                   /translation="MKPRRRQEGFGRRLSGGAWCAVARLEIYSACPYNGGGAVCRYKAK
FT                   CRLKRFRRHFSA"
FT   gene            complement(34407..35735)
FT                   /locus_tag="NGK_0047"
FT   CDS_pept        complement(34407..35735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0047"
FT                   /product="Bifunctional enzyme involved in thiolation and
FT                   methylation of tRNA"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28750"
FT                   /db_xref="GOA:B4RNW8"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006463"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4RNW8"
FT                   /protein_id="ACF28750.1"
FT                   /translation="MKKVFIRTFGCQMNEYDSEKMLSVLAEEHGGIEQVTQADEADIIL
FT                   FNTCSVREKAQEKVFSDLGRVRPLKEKNPGLIIGVAGCVASQEGENIIKRAPYVDVVFG
FT                   PQTLHRLPKMIVDKETSGLSQVDISFPEIEKFDHLPPARVEGGAAFVSIMEGCSKYCSF
FT                   CVVPYTRGEEFSRPLNDVLTEIANLAQQGVKEINLLGQNVNAYRGEMDDGEICDFATLL
FT                   RIVHEIPGIERMRFTTSHPREFTDSIIECYRDLPKLVSHLHLPIQSGSDRVLSAMKRGY
FT                   TALEYKSIIRKLRAIRPDLCLSSDFIVGFPGETEREFEQTLKLVKDIAFDLSFVFIYSP
FT                   RPGTPAANLPDDTPHEEKVRRLEALNEVIEAETARINQTMIGTVQRCLVEGISKKDPDQ
FT                   LQARTANNRVVNFTGTPDMINQMIDLEITEAYTFSLRGKIVEA"
FT   gene            35739..35885
FT                   /locus_tag="NGK_0046"
FT   CDS_pept        35739..35885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0046"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28749"
FT                   /db_xref="UniProtKB/TrEMBL:B4RNW9"
FT                   /protein_id="ACF28749.1"
FT                   /translation="MCLSRAAVIAGLMVVGMKKFQTARRCRLKIGADYSTMWVWEAKYC
FT                   FKI"
FT   gene            35932..36093
FT                   /locus_tag="NGK_0048"
FT   CDS_pept        35932..36093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0048"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28751"
FT                   /db_xref="UniProtKB/TrEMBL:B4RNX0"
FT                   /protein_id="ACF28751.1"
FT                   /translation="MCVWAALLLCACTSNFGDREHQFLRYSGLNLNQYSVASPCRTICT
FT                   VCGFVALS"
FT   gene            complement(36335..36496)
FT                   /locus_tag="NGK_0049"
FT   CDS_pept        complement(36335..36496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0049"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28752"
FT                   /db_xref="UniProtKB/TrEMBL:B4RNX1"
FT                   /protein_id="ACF28752.1"
FT                   /translation="MPSERQVSGLEAESPILSFFRLRQGFARFFADYANRIPDDGTLVF
FT                   FLFICVKR"
FT   gene            36509..37789
FT                   /locus_tag="NGK_0050"
FT   CDS_pept        36509..37789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0050"
FT                   /product="glutamate-1-semialdehyde aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28753"
FT                   /db_xref="GOA:B4RNX2"
FT                   /db_xref="InterPro:IPR004639"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4RNX2"
FT                   /protein_id="ACF28753.1"
FT                   /translation="MNRNEILFDRAKAIIPGGVNSPVRAFGSVGGVPRFIKKAEGAYVW
FT                   DENGTRYTDYVGSWGPAIVGHAHPEVVEAVREAALGGLSFGAPTEGEIAIAEQIAEIMP
FT                   SVERLRLVSSGTEATMTAIRLARGFTGRDKIIKFEGCYHGHSDSLLVKAGSGLLTFGNP
FT                   SSAGVPADFTKHTLVLEYNNIAQLEEAFAQSGDEIACVIVEPFVGNMNLVRPTEAFVKA
FT                   LRGLTEKHGAVLIYDEVMTGFRVALGGAQSLHGITPDLTTMGKVIGGGMPLAAFGGRKD
FT                   IMECISPLAGVYQAGTLSGNPIAVAAGLKTLEIIQREGFYENLTALTQRLANGIAAAKA
FT                   HGIEFAADSVGGMFGLYFAAHVPRNYADMARSNIDAFKRFFHGMLDRGIAFGPSAYEAG
FT                   FVSAAHTPELIDETVAVAVEVFKAMAA"
FT   gene            complement(37888..38016)
FT                   /locus_tag="NGK_0051"
FT   CDS_pept        complement(37888..38016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0051"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28754"
FT                   /db_xref="UniProtKB/TrEMBL:B4RNX3"
FT                   /protein_id="ACF28754.1"
FT                   /translation="MTIYFRRHFYSRLKSKMYTPVIPAQAGIRKVGLAVIFNHYRN"
FT   gene            complement(38013..38606)
FT                   /locus_tag="NGK_0052"
FT   CDS_pept        complement(38013..38606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0052"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ACF31262"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:B4RNX4"
FT                   /protein_id="ACF31262.1"
FT                   /translation="MYGSRRLPCAQTDADGAQKKTAAYKGQDPAKVTHYLTRPAGFSDC
FT                   QRVCPDETGFDRRLFRPYARSLKGQMAKARISGKRYRRLSLVSAQVGNRPIAPMVCQNT
FT                   VAGVFFEARFQQCLLPALAQKSVIISDNARFRRMGALRGTAEKLGHKVLPPAPYSPEPN
FT                   PIEKVWANIKRYLRTVLSDYARFDDALLSYFDFN"
FT   gene            complement(38716..38835)
FT                   /locus_tag="NGK_0053"
FT   CDS_pept        complement(38716..38835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0053"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ACF31263"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJT0"
FT                   /protein_id="ACF31263.1"
FT                   /translation="MLIRYITDNAKTPAKPQQRLTCQETRFTCGFALKNKQAA"
FT   gene            complement(39095..39658)
FT                   /locus_tag="NGK_0054"
FT   CDS_pept        complement(39095..39658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0054"
FT                   /product="oligoribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28755"
FT                   /db_xref="GOA:B4RNX6"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR022894"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B4RNX6"
FT                   /protein_id="ACF28755.1"
FT                   /translation="MQDKNNLCWLDMEMTGLNPETDRIIEVAMIITDSDLNVLAQSEVY
FT                   AIHQSDDLLDNMDEWNTATHGRTGLTQRVRESSHTEAEVEQKLLDFMSEWIPGRATPMC
FT                   GNSIHQDRRFMVKYMPKLENYFHYRNLDVSTLKELAKRWNPPIAKSVVKRGSHKALDDI
FT                   LESIEEMRHYREHFLISAPKAEAQ"
FT   gene            complement(39676..40611)
FT                   /locus_tag="NGK_0055"
FT   CDS_pept        complement(39676..40611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0055"
FT                   /product="ribosomal protein L11 methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28756"
FT                   /db_xref="GOA:B4RNX7"
FT                   /db_xref="InterPro:IPR004498"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B4RNX7"
FT                   /protein_id="ACF28756.1"
FT                   /translation="MPRRLKPISIFPRKPVMPYQQITVNVNDAVAERLADALMEHGALS
FT                   AAIEDACAGTQNEQAIFGEPGMPTEQIWQQSKVIALFGEHDEAAAVIDAAAQECGLKDL
FT                   AYTGETIEDQDWVRLTQSQFDPIRISDRLWITPSWHEAPEGCAVNLRLDPGLAFGTGSH
FT                   PTTRLCLKWLDTQLKNGESVLDYGCGSGILTIAALKLGAGSAVGVDIDEQAVRAGRDNA
FT                   EQNNVDAQFFLPDSLPQGQFDVVVANILANPLRMLGEMLAARTKQGGRIVLSGLLDEQA
FT                   EELGGIYSQWFDLDPAETDEGWARLSGVKR"
FT   gene            complement(40667..42028)
FT                   /locus_tag="NGK_0056"
FT   CDS_pept        complement(40667..42028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0056"
FT                   /product="acetyl-CoA carboxylase, biotin carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28757"
FT                   /db_xref="GOA:B4RNX8"
FT                   /db_xref="InterPro:IPR004549"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:B4RNX8"
FT                   /protein_id="ACF28757.1"
FT                   /translation="MLKKVLIANRGEIALRVLRACREMGIATVAVHSEADKGSLHVKLA
FT                   DESVCIGPAASAQSYLNIPAIIAAAEVTFADAVHPGYGFLAENADFAEQVEQSGFTFIG
FT                   PKPDTIRLMGDKVSAKHAMIAAGVPCVPGSDGALPDDDAEILKIADKVGYPVIIKASGG
FT                   GGGRGMRVVEKKEDLLQSVEMTKAEAGAAFGNPMVYMERYLQRPRHVEIQVLADEHGNA
FT                   VYLAERDCSLQRRHQKVIEEAPAPFIDEEARKKIGKACTDACKRIGYRGAGTFEFLYED
FT                   GEFFFIEMNTRVQVEHPVTELITGVDIVQEQLRIASGLPLQYKQKDIKIEGHAFECRIN
FT                   AEDPYNFIPSPGPIESCHLPGGFGIRVDSHIYQGYRIPPYYDSLIGKICVHGKTREQAM
FT                   AKMRVALAELAVTGIKTNTPLHRDLFADAGFQEGGVSIHYLEHWLEARKTKQDK"
FT   gene            complement(42142..42603)
FT                   /locus_tag="NGK_0057"
FT   CDS_pept        complement(42142..42603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0057"
FT                   /product="acetyl-CoA carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28758"
FT                   /db_xref="GOA:B4RNX9"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001249"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:B4RNX9"
FT                   /protein_id="ACF28758.1"
FT                   /translation="MDLRKLKKLIDLVEESGIAEIEVTEGEEKVRITRTIAAAAAPVYA
FT                   APVPAAAPAVTPAAAPVAASAPAAAPAARDLSDAQKSPMVGTFYRAPGPNAAAFVEVGQ
FT                   QVKAGDTLCIIEAMKLMNEIEAEKSGTVKEILVENGTPVEFGEPLFIIG"
FT   gene            complement(42585..42842)
FT                   /locus_tag="NGK_0058"
FT   CDS_pept        complement(42585..42842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0058"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28759"
FT                   /db_xref="UniProtKB/TrEMBL:B4RNY0"
FT                   /protein_id="ACF28759.1"
FT                   /translation="MRKIKLPAHFPQKPPFFDILLDIYRQLRENEHNFTVVSHHRKTVS
FT                   EHHSARFAPLPQAGCFLKNQRNNPPEHRQPLKEQKWICAN"
FT   gene            42929..43999
FT                   /locus_tag="NGK_0059"
FT   CDS_pept        42929..43999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0059"
FT                   /product="S-adenosylmethionine:tRNA
FT                   ribosyltransferase-isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28760"
FT                   /db_xref="GOA:B4RNY1"
FT                   /db_xref="InterPro:IPR003699"
FT                   /db_xref="InterPro:IPR036100"
FT                   /db_xref="InterPro:IPR042118"
FT                   /db_xref="InterPro:IPR042119"
FT                   /db_xref="UniProtKB/TrEMBL:B4RNY1"
FT                   /protein_id="ACF28760.1"
FT                   /translation="MAACPNESVKMDISDFDFTLPEHLIAQHPPEVRGSSRLLVALPDM
FT                   PLQDRVFGDLPDYVEAGDVLVFNNTKVMKARLFGQKDSGGRIEALIERVLDNHTALAHI
FT                   RSSKSPKPGMGLVFEGGIRAVMVGREGELFCLRFEGGQTVYELLEQNGHLPLPPYIERA
FT                   ADADDDSRYQTVYAKYQGAVAAPTAGLHFTEELLRRLKDKGAVTAEVTLHVGAGTFQPV
FT                   RVDKIEEHKMHSEWFEVPSETVAAVEAAKARGNKAWAVGTTSMRALESAARATGYLKDG
FT                   QGDTDIFITPGYRFNVVDRLVTNFHLPKSTLLMLVGAFSGMGHIRAVYRHAIEREYRFF
FT                   SYGDAMVLGRNEGGGL"
FT   gene            complement(43996..44115)
FT                   /locus_tag="NGK_0060"
FT   CDS_pept        complement(43996..44115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0060"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28761"
FT                   /db_xref="UniProtKB/TrEMBL:B4RNY2"
FT                   /protein_id="ACF28761.1"
FT                   /translation="MTFKHPNLGRWIIQLPDIHKNTARTTVQTASALQRTAAV"
FT   gene            complement(44200..46626)
FT                   /locus_tag="NGK_0061"
FT   CDS_pept        complement(44200..46626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0061"
FT                   /product="carbamoyl phosphate synthase large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28762"
FT                   /db_xref="GOA:B4RNY3"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005480"
FT                   /db_xref="InterPro:IPR005483"
FT                   /db_xref="InterPro:IPR006275"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR033937"
FT                   /db_xref="InterPro:IPR036897"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:B4RNY3"
FT                   /protein_id="ACF28762.1"
FT                   /translation="MRNASLAVLREIGVDTGGSNVQFAVNPENGEMIVIEMNPRVSRSS
FT                   ALASKATGFPIAKVAAKLAVGFTLDELRNDITGGRTPASFEPSIDYVVTKIPRFAFEKF
FT                   PAADDRLTTQMKSVGEVMAMGRTIQESFQKALRGLETGLCGFNPRSEDKAEIRRELANP
FT                   GPERMLFVADAFRAGFTPEEIHEICAIDPWFLAQIEDLMKEEKSVSDGQLQDLDYAALR
FT                   RLKRKGFSDKRLAQLLNVSEKEVREHRYALKLHPVYKRVDTCAAEFATETAYLYSTYEE
FT                   ECESRPSDRKKVMILGGGPNRIGQGIEFDYCCVHAALALRESGFETIMVNCNPETVSTD
FT                   FDTSDRLYFEPLTLEDVLEIVRTENPWGVIVHYGGQTPLKLANALVENGVNIIGTSADS
FT                   IDAAEDRERFQKVLNDLGLRQPPNRIAHNEEEALVKAEEIGYPLVVRPSYVLGGRAMQI
FT                   VHSAEALQKYMREAVQVSEDSPVLLDFFLNNAIEVDVDCVSDGKDVVIGGIMQHVEQAG
FT                   IHSGDSGCSLPPYSLSEEIQDEIRRQTKAMAYALGVVGLMNVQFAVQDGVVFVLEVNPR
FT                   ASRTVPFVSKATGVPLAKVGARCMAGISLKEQGVEKEVVPDFYAVKEAVFPFIKFPGVD
FT                   TILSPEMRSTGEVMGVGASFGEAYYKAQLGAGERLNPTGKIFLSVREEDKERVIKTAKN
FT                   FQALGYGICATRGTAQYLTEHGLIVQAINKVPEGRPHIGDALKNGEIALVVNTVSSDPQ
FT                   SVSDSHIIRQSALQQRVPQYTTTAGGEAMSEGAKSRDYLGVYSVQELHGRLKNRN"
FT   gene            complement(46647..47414)
FT                   /locus_tag="NGK_0062"
FT   CDS_pept        complement(46647..47414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0062"
FT                   /product="carbamoyl phosphate synthase large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28763"
FT                   /db_xref="GOA:B4RNY4"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005483"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:B4RNY4"
FT                   /protein_id="ACF28763.1"
FT                   /translation="MPKRTDLKSILIIGAGPIVIGQACEFDYSGAQACKALREEGYKVI
FT                   LVNSNPATIMTDPEMADVTYIEPIMWQTVEKIIAKERPDAILPTMGGQTALNCALDLAR
FT                   NGVLAKYNVELIGATEDAIDKAEDRGRFKEAMEKIGLSCPKSFVCHTMNEALAAQEQVG
FT                   FPTLIRPSFTMGGSGGGIAYNKDEFLAICERGFDASPTHELLIEQSVLGWKEYEMEVVR
FT                   DKADNCIIICSIENFDPMGVHTGDSITVAPAQR"
FT   gene            complement(47421..47762)
FT                   /locus_tag="NGK_0063"
FT   CDS_pept        complement(47421..47762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0063"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28764"
FT                   /db_xref="UniProtKB/TrEMBL:B4RNY5"
FT                   /protein_id="ACF28764.1"
FT                   /translation="MGNWQFVQVDSKGTGRVFYTAKDKKMAEIADYGFILWDGKSIGSL
FT                   NNIAELLQLNKPSLVYHSQTKEFFKIKSSADLENILSNIEDDVLASILEKGNTFLKSYV
FT                   TKQPSLIQE"
FT   gene            complement(48692..48838)
FT                   /locus_tag="NGK_0064"
FT   CDS_pept        complement(48692..48838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0064"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28765"
FT                   /db_xref="UniProtKB/TrEMBL:B4RNY6"
FT                   /protein_id="ACF28765.1"
FT                   /translation="MKNNLNLQPLISGRLKKDARNINSGNFSGSLYCQADGTNAASVFS
FT                   DNL"
FT   gene            complement(49716..50105)
FT                   /locus_tag="NGK_0065"
FT   CDS_pept        complement(49716..50105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0065"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28766"
FT                   /db_xref="InterPro:IPR007569"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:B4RNY7"
FT                   /protein_id="ACF28766.1"
FT                   /translation="MNPPEKLLTAENPALRQRAKAMRQEMSEAEAKLWQHLRAGRLNGY
FT                   KFRRQQPMGNYIVDFMCVTPKLIVEADGGQHAEQAVYDHARTVYLNSLGFTVLRFWNHE
FT                   ILQQTNDVLAEILRVLQELEKQPAR"
FT   gene            complement(50268..50435)
FT                   /locus_tag="NGK_0066"
FT   CDS_pept        complement(50268..50435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0066"
FT                   /product="30S ribosomal protein S15"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28767"
FT                   /db_xref="GOA:B4RNY8"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:B4RNY8"
FT                   /protein_id="ACF28767.1"
FT                   /translation="MPADRYAPLETVLQELSAHGIKPLSGIVARTGAMGKIQSVYLRDP
FT                   DGNLLEISSY"
FT   gene            complement(50701..51900)
FT                   /locus_tag="NGK_0067"
FT   CDS_pept        complement(50701..51900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0067"
FT                   /product="carbamoyl-phosphate synthase small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28768"
FT                   /db_xref="GOA:B4RNY9"
FT                   /db_xref="InterPro:IPR002474"
FT                   /db_xref="InterPro:IPR006274"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR035686"
FT                   /db_xref="InterPro:IPR036480"
FT                   /db_xref="UniProtKB/TrEMBL:B4RNY9"
FT                   /protein_id="ACF28768.1"
FT                   /translation="MPPAEVPSDGIVKNFIKNRIPIMNTPALLVLADGSVFHGTSIGYE
FT                   GSASGEVVFNTSMTGYQEILTDPSYCKQIVTLTYPHIGNTGTNAEDEESRSVYAAGLII
FT                   RDLPLLHSNFRASESLHDYLVRNETVAIADIDTRRLTMLLREKGAQGGAILTGADATVE
FT                   KAQELIAAFGSMVGKDLAKEVSCTETYEWTEGEWELGKGFVTPDKQPYHVVAYDFGVKT
FT                   NILRMLASRGCRLTVVPAQTSAEDVLALNPDGVFLSNGPGDPEPCTYAIEAVQKLMESG
FT                   KPIFGICLGHQLISLAIGAKTLKMRFSHHGANHPVQDLDSGKVVITSQNHGFAVDADTL
FT                   PANARITHKSLFDNTLQGIELTDKPVFCFQGHPEASPGPQDVGYLFDKFIGNMKAAKQA
FT                   "
FT   gene            complement(52010..52126)
FT                   /locus_tag="NGK_0068"
FT   CDS_pept        complement(52010..52126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0068"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28769"
FT                   /db_xref="UniProtKB/TrEMBL:B4RNZ0"
FT                   /protein_id="ACF28769.1"
FT                   /translation="MGKCVTGIGGAERAVLCPGFPFSREHISPPAAFALEIV"
FT   gene            52226..52420
FT                   /locus_tag="NGK_0069"
FT   CDS_pept        52226..52420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0069"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28770"
FT                   /db_xref="UniProtKB/TrEMBL:B4RNZ1"
FT                   /protein_id="ACF28770.1"
FT                   /translation="MRFYVLDSRLRGNDGGAVSVFSDKFLKLKISSFLQKQKTKIRNLK
FT                   SRHSHESGNLGLSAQKLIG"
FT   gene            complement(52549..52695)
FT                   /locus_tag="NGK_0070"
FT   CDS_pept        complement(52549..52695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0070"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ACF31264"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="UniProtKB/TrEMBL:B4RNZ2"
FT                   /protein_id="ACF31264.1"
FT                   /translation="MPVWYELHPTMESAITREKQLKKWNRAWKLQLIEENNVSWRDLWF
FT                   DII"
FT   gene            52999..53175
FT                   /locus_tag="NGK_0071"
FT   CDS_pept        52999..53175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0071"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28771"
FT                   /db_xref="UniProtKB/TrEMBL:B4RNZ3"
FT                   /protein_id="ACF28771.1"
FT                   /translation="MLLSHVLDSRLRGNDGGAVSVFSDKFLKLKISSFLQKQKTKIRNL
FT                   KSRHSHESGNPVF"
FT   gene            53156..53401
FT                   /locus_tag="NGK_0072"
FT   CDS_pept        53156..53401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0072"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28772"
FT                   /db_xref="UniProtKB/TrEMBL:B4RNZ4"
FT                   /protein_id="ACF28772.1"
FT                   /translation="MGIRFFEFQSFPINCLSIECLDSRLRGNDGGAVSVFSDKFLKLKI
FT                   SSFPQKQKTKIRNLKPRHSHESGNPVRSVSLVLSFG"
FT   gene            53597..53710
FT                   /locus_tag="NGK_0073"
FT   CDS_pept        53597..53710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0073"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28773"
FT                   /db_xref="UniProtKB/TrEMBL:B4RNZ5"
FT                   /protein_id="ACF28773.1"
FT                   /translation="MPPPPEKRKKMPSEDLSDGICGKTGRAGGSEEDFAPA"
FT   gene            complement(53684..56851)
FT                   /locus_tag="NGK_0074"
FT   CDS_pept        complement(53684..56851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0074"
FT                   /product="PilC2"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28774"
FT                   /db_xref="InterPro:IPR008707"
FT                   /db_xref="UniProtKB/TrEMBL:B4RNZ6"
FT                   /protein_id="ACF28774.1"
FT                   /translation="MNKTLKRRVFRHTALYAAILMFSHTGGGGTQAQTRKYAIIMNERK
FT                   QPEVKWEGQYSQSTLKDKGRERTFSHTSQRNWNGQQNNFISFNNSDELVSQQSGTAVFG
FT                   TATYLPPYGKVSGFDTDSLKGRANAAGWIRTTRPGLAGYAYTGIRCGHARDCPKLTYKT
FT                   RFSFDNPDLAKTGGRLDRHTESSRENSPIYKLKDYPWLGVSFNLGAEGTAKDGRSSSRL
FT                   ISSFDENNSNSNQNLVYTTEGRDISLGNWQSESTAVAYYLNAKLHLLDKKKIKDITGKT
FT                   VQLGVLKPSIDVKTQNTGFAGLLNFWSKWDIKDNGQIPVKLGLPEVKAGRCTNKPNPNN
FT                   NTKAPSPALTAPALWFGPVQNGKVQMYSASVSTYPGSSSSRIFLQELKTQTDPARPGRH
FT                   SLAALNARDIKSREPNFNSRQTVIRLPGGVYRIAPTRDRIVGLNGNDGKNDTFGIYKER
FT                   LVTPDADEWAKVLLPWTVRYYGNDDIFKTFNQPNNKKQSDKKQYSQKYRIRTKEDDNDK
FT                   PRDLGDIVNSPIVAVDGYLATSANDGMVHLFKRNGTDQRGYELKLSYIPGTMPRQYFDN
FT                   DTSALQDSDLAKELRTFAEKGYVGDRYGVDGGFVLRRITDDQDKQKHFFMFGAMGLGGR
FT                   GAYALDLSKIDSSNLTGVSMFDVQNDKNNNKNDNNRVKLGYTVGTPQIGKTQNGKYAAF
FT                   LASGYAAKDINSNDNKTALYVYDLENGSGSLIKKIEAPSGKGGLSSPTLVDKDLDGTVD
FT                   IAYAGDRGGNMYRFDLSDSNPSKWSVSTIFEGQRPITSAPAVSRLADKRVVIFGTGSDL
FT                   SESDVFNTDEQYIYGIFDDDKANVSVKVKDHMGDGLLKQNLTQENKTLFLTNNKASGGS
FT                   ADKGWVVKLREGERVTVKPTVVLRTAFVTIRSYTGNDKCGAQTAILGINTADGGALTPR
FT                   SARPIVPDHNSVAQYSGHKKTSKGKSIPIGCMEKGGKTVCPNGYVYDKPVNVRYLDEKK
FT                   TDDFPVTADGDAGGSGTFKEGKKPARNNRCFSGKGVRTLLMNDLDSLDITGPMCGIKRL
FT                   SWREVFF"
FT   gene            56951..57115
FT                   /locus_tag="NGK_0075"
FT   CDS_pept        56951..57115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0075"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28775"
FT                   /db_xref="UniProtKB/TrEMBL:B4RNZ7"
FT                   /protein_id="ACF28775.1"
FT                   /translation="MCRPACWNIFYPLNLASRDTVGGRRAANGGIGQTARSRARRIAGW
FT                   KTPLAGCNV"
FT   gene            complement(57454..57618)
FT                   /locus_tag="NGK_0076"
FT   CDS_pept        complement(57454..57618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0076"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ACF31265"
FT                   /db_xref="UniProtKB/TrEMBL:B4RNZ8"
FT                   /protein_id="ACF31265.1"
FT                   /translation="MPQLGECPLPGPPPRGREWVSADFSVAGGLKNRLDLQPLISGRLK
FT                   SKKQPAQPD"
FT   gene            complement(57734..57898)
FT                   /locus_tag="NGK_0077"
FT   CDS_pept        complement(57734..57898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0077"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28776"
FT                   /db_xref="UniProtKB/TrEMBL:B4RNZ9"
FT                   /protein_id="ACF28776.1"
FT                   /translation="MPPFGECPLPSPPPQGREWVSADFSVAGGLKNRLDLQPLISGRLK
FT                   SKKQPAQPD"
FT   gene            58287..58487
FT                   /locus_tag="NGK_0078"
FT   CDS_pept        58287..58487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0078"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28777"
FT                   /db_xref="UniProtKB/TrEMBL:B4RP00"
FT                   /protein_id="ACF28777.1"
FT                   /translation="MLQGKQVVQVAFYFSDDLKSTVVNPICFSNRLQPKNLPQSAPSPV
FT                   GEGRGEGILQVAATFPNNSTA"
FT   gene            complement(59171..60250)
FT                   /locus_tag="NGK_0079"
FT   CDS_pept        complement(59171..60250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0079"
FT                   /product="putative atpase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28778"
FT                   /db_xref="GOA:B4RP01"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="UniProtKB/TrEMBL:B4RP01"
FT                   /protein_id="ACF28778.1"
FT                   /translation="MNIQNIRTLLDTVAVPNTARTLGGEKAVRSVGQRSDGIHIALHFG
FT                   FPVAHIAAALADAVQETLMPLTGDTHIHLSIDTEIGTHKVRPGVATIKGVKNIIAVASG
FT                   KGGVGKSTATANLAAAMARMGARVGVLDADLYGPSQPTMLGVHDRKPDQKNQKLIPVES
FT                   SDGIQVMSIGFLVDTGQAVVWRGPMVSQALQQLMFQSEWDEVDYLFIDLPPGTGDIQLT
FT                   LSQRIPVTGSVIVTTPQDIALIDARKAVDMFRKVNIPILGVLENMSVHICSNCGHSEAL
FT                   FGTDGGKDLAARLNVPLLGQLPLSLPVREAMDGGTPAQLFDEHPAIARIYTDAAFQIAL
FT                   GIADKGKDFSSRFPKIVVE"
FT   gene            60469..60544
FT                   /locus_tag="NGK_trnaLys1"
FT   tRNA            60469..60544
FT                   /locus_tag="NGK_trnaLys1"
FT                   /product="tRNA-Lys"
FT   gene            60624..61133
FT                   /locus_tag="NGK_0080"
FT   CDS_pept        60624..61133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0080"
FT                   /product="putative thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28779"
FT                   /db_xref="GOA:B4RP02"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B4RP02"
FT                   /protein_id="ACF28779.1"
FT                   /translation="MKKKLLSGIKFAVRTALVFLLVSLFLDWVRKPDEPAGAAGRPLTL
FT                   LSGQRLTLGQFSRDRTVLVYFWGSWCGVCRYQSPIIDDLAADGVPVVGVAVRSGSASEV
FT                   AAYMAKRGLGFPTVSDEDGGLARSWRIAATPAVVLVKNGKMVRYTTGISSYWGLRARIF
FT                   QADFFG"
FT   gene            61181..61294
FT                   /locus_tag="NGK_0081"
FT   CDS_pept        61181..61294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0081"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28780"
FT                   /db_xref="UniProtKB/TrEMBL:B4RP03"
FT                   /protein_id="ACF28780.1"
FT                   /translation="MPCAADAAAFVFWERAGAPADVIPCCDCGKNRLKYNY"
FT   gene            61474..61914
FT                   /locus_tag="NGK_0082"
FT   CDS_pept        61474..61914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0082"
FT                   /product="putative marR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28781"
FT                   /db_xref="GOA:B4RP04"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR012712"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B4RP04"
FT                   /protein_id="ACF28781.1"
FT                   /translation="MPTQSKHASINIGLIQAREALMTQFRPILNQANITDQQWRIIRLL
FT                   AENGTLDFQDLANQACILRPSLTGILTRLEKAGLVVRLKPSNDQRRVYLKLTSEGEKLY
FT                   EEIGEEVDERYDAIEEVLGREKMLLLKDLLAELAKIEDALNS"
FT   gene            62029..62529
FT                   /locus_tag="NGK_0083"
FT   CDS_pept        62029..62529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0083"
FT                   /product="putative flavoprotein oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28782"
FT                   /db_xref="GOA:B4RP05"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR011982"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:B4RP05"
FT                   /protein_id="ACF28782.1"
FT                   /translation="MADLQKTFQTSFRDAMASCAAGVHVITTDGAAGRYGITMTAVAPV
FT                   TDEPPTVMLCINRSARIIPILSENGSLCINMLADEHQDVAEHFAGLTGLSPEERFAYHI
FT                   WHRGKTGQLEIEGALAHLHGHIVGKHEIGTHFVFYVRLDEIKNCGCKRPALLYFRRQFR
FT                   PLD"
FT   gene            62545..63240
FT                   /locus_tag="NGK_0084"
FT   CDS_pept        62545..63240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0084"
FT                   /product="putative sugar-phosphate transferase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28783"
FT                   /db_xref="GOA:B4RP06"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B4RP06"
FT                   /protein_id="ACF28783.1"
FT                   /translation="MKAMILAAGRGERMRPLTDTTPKPLLDVAGKPLIGWHLCRLKQAG
FT                   FTEIVINHAWLGRQIENALGDGSAYGVNIAYSPEPAGGLETAGGIAQALPLLGGQPFLV
FT                   ANGDVLTDIDFTAAFQTASSLPGHISAHLWLVGNPPHNPDGDFSLLPDGSVRPEVSGGN
FT                   GLTFSGVGIYRPEMFDGIEAGSVAKLAPVLLNEMRQNRVSGQKHTGLWLDVGTVCRLKE
FT                   AQALAAAWK"
FT   gene            complement(63294..63704)
FT                   /locus_tag="NGK_0085"
FT   CDS_pept        complement(63294..63704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0085"
FT                   /product="Integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28784"
FT                   /db_xref="GOA:B4RP07"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B4RP07"
FT                   /protein_id="ACF28784.1"
FT                   /translation="MGSNAWLFWALASAGFASLTAVFAKMGLQGIDSDFAAFIRTLVIL
FT                   AALVLFLTYTGKWQGVNGFTGRNRTFLVLSGLATGASWLAYFKALQLGNAPQVAPVDKF
FT                   SLVLVALMAVIFLDERPNTQEWIDLGLVTAAC"
FT   gene            63879..65555
FT                   /locus_tag="NGK_0086"
FT   CDS_pept        63879..65555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0086"
FT                   /product="putative formate--tetrahydrofolate ligase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28785"
FT                   /db_xref="GOA:B4RP08"
FT                   /db_xref="InterPro:IPR000559"
FT                   /db_xref="InterPro:IPR020628"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4RP08"
FT                   /protein_id="ACF28785.1"
FT                   /translation="MSFKTDAETAQSSTMRPIGEIAAKLGLNVDNIEPYGHYKAKINPA
FT                   EAFKLPQKQGRLILVTAINPTPAGEGKTTVTIGLADALRHIGKDSVIALREPSLGPVFG
FT                   VKGGAAGGGYAQVLPMEDINLHFTGDFHAIGAANNLLAAMLDNHIYQGNELNIDPKRVL
FT                   WRRVVDMNDRQLRNIIDGMGKPVDGVMRPDGFDITVASEVMAVFCLAKDISDLKERFGN
FT                   ILVAYAKDGSPVYAKDLKAHGAMAALLKDAIKPNLVQTIEGTPAFVHGGPFANIAHGCN
FT                   SVTATRLAKHLADYAVTEAGFGADLGAEKFCDIKCRLAGLKPDAAVVVATVRALKYNGG
FT                   VERANLGEENLEALAKGLPNLLKHISNLKNVFGLPVVVALNRFVSDSDAELAMIEKACA
FT                   EHGVEVSLTEVWGKGGAGGADLARKVVNAIDNQPNNFGFAYDVELGIKDKIRAIAQKVY
FT                   GAEDVDFSAEASAEIASLEKLGLDKMPICMAKTQYSLSDNAKLLGCPEGFRITVRGITV
FT                   SAGAGFIVALCGNMMKMPGLPKVPAAEKIDVDEHGVIHGLF"
FT   gene            65669..66760
FT                   /locus_tag="NGK_0087"
FT   CDS_pept        65669..66760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0087"
FT                   /product="putative GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28786"
FT                   /db_xref="GOA:B4RP09"
FT                   /db_xref="InterPro:IPR004396"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR013029"
FT                   /db_xref="InterPro:IPR023192"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR041706"
FT                   /db_xref="UniProtKB/TrEMBL:B4RP09"
FT                   /protein_id="ACF28786.1"
FT                   /translation="MSLKCGIVGLPNVGKSTLFNALTQSGIEAANYPFCTIEPNVGIVE
FT                   VPDPRMAELAKIVNPQKMQPAIVEFVDIAGLVAGASKGEGLGNRFLANIRETDAIVNVV
FT                   RCFDDDNIVHVSGKVDPIADIETIGTELALADLASVEKAIVREEKRARSGDKDAQKLVD
FT                   LCKKLLPHLDEGKPVRSFGLDAEERALLKPLFLLTAKPAMYVGNVAEDGFENNPHLDRL
FT                   KELAAKENAPVVAVCAAMESEIAELEDGEKAEFLAEMGLEEPGLNRLIRAGYDLLGLQT
FT                   YFTAGVKEVRAWTIHKGDTAPQAAGVIHTDFERGFIRAQVIAYDDFVSLGGEAKAKEAG
FT                   KMRVEGKEYVVQDGDVMHFLFNV"
FT   gene            66789..67037
FT                   /locus_tag="NGK_0088"
FT   CDS_pept        66789..67037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0088"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28787"
FT                   /db_xref="UniProtKB/TrEMBL:B4RP10"
FT                   /protein_id="ACF28787.1"
FT                   /translation="MPEMPSEAGFGGFRRSHTAGMQPHQNKIPPAFPICPPRFLQNKPP
FT                   ALPLREAVRYSEYPEPRYKMTFQTAFAQPAAFQVKTL"
FT   gene            67034..68032
FT                   /locus_tag="NGK_0089"
FT   CDS_pept        67034..68032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0089"
FT                   /product="putative lipo-oligosaccharide acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28788"
FT                   /db_xref="GOA:B4RP11"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:B4RP11"
FT                   /protein_id="ACF28788.1"
FT                   /translation="MSQALPYRPDIDTLRAAAVLSVIVFHIEKDWLPGGFLGVDIFFVI
FT                   SGFLMTAILLREMSGGRFFLKTFYIRRIKRILPAFFAVLAATLAGGFFLFTKDDFFLLW
FT                   KSALTALGFASNLYFARGKDYFDPAQEEKPLLHIWSLSVEEQFYFVFPILLLLVARKSL
FT                   RVQFGFLAALCALSLAASFMPSALDKYYLPHLRACEMLVGSLTAVRMRYRQQRNPAVGK
FT                   RYAAVGALFSACILSACLFAYSEQTAYFPGPAALIPCLAVAALIYFNHYEHPLKKFFQW
FT                   KITVAAGLISYSLYLWHWPILAFMRYIGPDNLPPYSPAAAIVLTLAFSLIS"
FT   gene            68109..68909
FT                   /locus_tag="NGK_0090"
FT   CDS_pept        68109..68909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0090"
FT                   /product="putative lipo-oligosaccharide acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28789"
FT                   /db_xref="GOA:B4RP12"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:B4RP12"
FT                   /protein_id="ACF28789.1"
FT                   /translation="MLVLGAGSFFAMRLPFMAQYDRLGLTRSNTSCHNNTGKQCLWGDT
FT                   EKQPELLVLGDSHADHYKTFFDAVGKKEKWSATMVSADACAYVEGYASRVFQNWAACRA
FT                   VYRYAEEHLPRYPKVVLAMRWGSQMPENSRSLAYDAGFFQKFDRMLHKLSSEKQAVYLM
FT                   ADNLASSYNVQRAYILSSRIPGCRQTLRPDDESTLKANARIRELAAKYPNVYIIDAAAY
FT                   IPADFQIGGLPVYSDKDHINPYGGTELAKRFSEKQRFLDTRHNH"
FT   gene            68971..70266
FT                   /locus_tag="NGK_0091"
FT   CDS_pept        68971..70266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0091"
FT                   /product="putative tyrosyl-tRNA synthase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28790"
FT                   /db_xref="GOA:B4RP13"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024088"
FT                   /db_xref="InterPro:IPR024107"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="PDB:6OTJ"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4RP13"
FT                   /protein_id="ACF28790.1"
FT                   /translation="MSVIQDLQSRGLIAQTTDIEALDALLNEQKIALYCGFDPTADSLH
FT                   IGHLLPVLALRRFQQAGHTPIALVGGATGMIGDPSFKAAERSLNSAETVAGWVGSIRSQ
FT                   LTPFLSFEGGNAAIMANNADWFGSMNCLDFLRDIGKHFSVNAMLNKESVKQRIDRDGAG
FT                   ISFTEFAYSLLQGYDFAELNKRHGAVLEIGGSDQWGNITAGIDLTRRLNQKQVFGLTLP
FT                   LVTKSDGTKFGKTEGGAVWLNAKKTSPYQFYQFWLKVADADVYKFLKYFTFLSIEEIGV
FT                   VEAKDKASGSKPEAQRILAEEMTRLIHGEEALAAAQRISESLFAEDQSRLTESDFEQLA
FT                   LDGLPAFEVSDGINAVEALVKTGLAASNKEARGFVNAKAVLLNGKPAEANNPNHAAERP
FT                   DDAYLLIGEYKRFGKYTILRRGKRNHALLVWK"
FT   gene            70272..70454
FT                   /locus_tag="NGK_0092"
FT   CDS_pept        70272..70454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0092"
FT                   /product="truncated pilin"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28791"
FT                   /db_xref="UniProtKB/TrEMBL:B4RP14"
FT                   /protein_id="ACF28791.1"
FT                   /translation="MPQKCRLKLSDGIFIKCKTPCACRYVVISMQAGIQTCPHGNLSGK
FT                   TVSSVLRSRCPLSWE"
FT   gene            complement(70550..70711)
FT                   /locus_tag="NGK_0093"
FT   CDS_pept        complement(70550..70711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0093"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28792"
FT                   /db_xref="UniProtKB/TrEMBL:B4RP15"
FT                   /protein_id="ACF28792.1"
FT                   /translation="MLPTVSDGIFYIIPAIFHHSRQHRNLETRHSRAGGNLDLSVQELI
FT                   GQNGFLRF"
FT   gene            70729..70866
FT                   /locus_tag="NGK_0094"
FT   CDS_pept        70729..70866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0094"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28793"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKN1"
FT                   /protein_id="ACF28793.1"
FT                   /translation="MNRWASVRHSHQSNISTVFIESIESAPFDNLTLCNRTVIPTEVGI
FT                   "
FT   gene            70941..71099
FT                   /locus_tag="NGK_0095"
FT   CDS_pept        70941..71099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0095"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28794"
FT                   /db_xref="UniProtKB/TrEMBL:B4RP17"
FT                   /protein_id="ACF28794.1"
FT                   /translation="MTGFEITVLSGMTVRVFYCARPAPVNGGRLKMPSEGSDGIGIGGS
FT                   EAVAHAQ"
FT   gene            complement(71073..71756)
FT                   /locus_tag="NGK_0096"
FT   CDS_pept        complement(71073..71756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0096"
FT                   /product="outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28795"
FT                   /db_xref="GOA:B4RP18"
FT                   /db_xref="InterPro:IPR003394"
FT                   /db_xref="InterPro:IPR006315"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:B4RP18"
FT                   /protein_id="ACF28795.1"
FT                   /translation="MQADLAYAYEHITHDYPEPTGTKKDKISTVSDYFRNIRTHSVHPR
FT                   VSVGYDFGGWRIAADYARYRKWNNNKYSVSIKELLRNKGNGNRTDQKTENQENGTFHAV
FT                   SSLGLSAVYDFDTGSRFKPYIGARVAYGHVRHSIDSTKKTTEVTTILHGPDTTPTVYPG
FT                   KNTQDDHREGNSIRRVGLGVIAGVGFDITPKLTLDAGYRYHNWGRLENTRFKTHEASLG
FT                   MRYRF"
FT   gene            complement(71862..72059)
FT                   /locus_tag="NGK_0097"
FT   CDS_pept        complement(71862..72059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0097"
FT                   /product="sugar ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28796"
FT                   /db_xref="GOA:B4RP19"
FT                   /db_xref="UniProtKB/TrEMBL:B4RP19"
FT                   /protein_id="ACF28796.1"
FT                   /translation="MCRPFRPPDAGKVGKFPAAERAKRIKRAAGAVLCIETPPGTRYNP
FT                   PFNISENLFLTGQTDIRSRK"
FT   gene            72087..73043
FT                   /locus_tag="NGK_0098"
FT   CDS_pept        72087..73043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0098"
FT                   /product="Riboflavin kinase/FMN adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28797"
FT                   /db_xref="GOA:B4RP20"
FT                   /db_xref="InterPro:IPR002606"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015864"
FT                   /db_xref="InterPro:IPR015865"
FT                   /db_xref="InterPro:IPR023465"
FT                   /db_xref="InterPro:IPR023468"
FT                   /db_xref="UniProtKB/TrEMBL:B4RP20"
FT                   /protein_id="ACF28797.1"
FT                   /translation="MTACFTTYPNATMKIRLGRHNAPDFPHGAAVTIGNFDGVHLGHKH
FT                   ILQKLRLEADTRGLPVVAVVFEPQPKEFFALRTGKTPPCRISPLRTKLELLEGTGCVDA
FT                   AWVLRFDRNFSEISAQAFIDRLLRQTLNTRYLLVGDDFRFGAGREGCFELLAQQPDMQT
FT                   ERTPSVIVEDIRTSSTTVRQALSDGNLAYAKKLLGHDYVLGGRVVHGRKLGRTLNAPTA
FT                   NIRLPRHRYALGGVFVVEADGAFGTRRGVASFGFNPTVDGGCSQKLEVHLFDFQGDLYG
FT                   QRLNVRFLHKLRDEEKFDGMEELKRRIEADMEAAKCW"
FT   gene            73068..73181
FT                   /locus_tag="NGK_0099"
FT   CDS_pept        73068..73181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0099"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28798"
FT                   /db_xref="UniProtKB/TrEMBL:B4RPY5"
FT                   /protein_id="ACF28798.1"
FT                   /translation="MGYNQPFNCSDGTGVSRCEILFEAQCRLKPKYCNNRD"
FT   gene            73185..75974
FT                   /locus_tag="NGK_0100"
FT   CDS_pept        73185..75974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0100"
FT                   /product="isoleucyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28799"
FT                   /db_xref="GOA:B4RPY6"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002301"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023585"
FT                   /db_xref="InterPro:IPR033708"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4RPY6"
FT                   /protein_id="ACF28799.1"
FT                   /translation="MTDYSKTVNLLESPFPMRGNLAKCEPAWLKSWYEQKRYQKLREIA
FT                   KGRPKFILHDGPPYANGDIHIGHAVNKILKDIIIRSKTQAGFDAPYVPGWDCHGLPIEV
FT                   MVEKLHGKDMPKARFRELCREYAAEQIARQKKDFIRLGVLGDWDNPYLTMDFKTEADTV
FT                   RMLGEIYKSGYLYRGAKPVQFCLDCGSSLAEAEVEYKDKVSPAIDVAYPFKDTVALAAA
FT                   FGLAGIEGKAFAVIWTTTPWTLPASQAVSAGADVVYQLIDTPKGKLVLAKDLAEGALKR
FT                   YGFSDGIAILAETTGDKLENLHMNHPFLERDIPMLNGEHVTTDAGTGLVHTAPAHGLED
FT                   YAVCNKYGIELYNPVNAEGKYISETPRVAGMSVWEANPVILQWPEETGNLLASSKIEHS
FT                   YAHCWRHKTPLIYRATGQWFVGMDKAGSDGKTLRDKAIKAVDDTEFFPPWGRARLESMI
FT                   EGRPDWVVSRQRYWGTPMTFFVHKETGELHPNSAELLEKVAQRIEEKGIEAWFSLDKSE
FT                   LLSAEDCEHYDKLPDTMDVWFDSGSTHYSVVKQREELEWPADLYLEGSDQHRGWFQSSM
FT                   LTGCASSMGRAPYKQLLTHGFVVDQNGRKMSKSIGNVVAPQEVYNEFGADILRLWAAST
FT                   DYSGELAISKEILKRVTESYRRIRNTLSFLFANLSDFNPIEDAVPQAEMVEIDRYALVL
FT                   ARRLQERLAGGYYPRYAFHFAVKDIVSFCSEDLGAFYLDILKDRLYTTKADSRARRSAQ
FT                   TALYHITRSLVLLIAPILCFTGEEAWDIIGGGEEDSVLFHTWHEFPAINEKAEAELVKK
FT                   WTAIREAREAVTAAIEPLRADKTVGSSLQAEAEITAPEEMAGYLNALGEELRFALLVSK
FT                   AEVKVGDELAVAAKASDGEKCERCWHYTRDVGAVAGYETVCKRCAENVGGEGETRHYA"
FT   gene            complement(76190..76381)
FT                   /locus_tag="NGK_0101"
FT   CDS_pept        complement(76190..76381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0101"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28800"
FT                   /db_xref="UniProtKB/TrEMBL:B4RPY7"
FT                   /protein_id="ACF28800.1"
FT                   /translation="MPSEPSDGIFDAPAVYRRGAGAVKYPNRHSRQHRNLEIRHSRAGG
FT                   NLDLSVQELIGQNGFLRF"
FT   gene            complement(76395..77063)
FT                   /locus_tag="NGK_0102"
FT   CDS_pept        complement(76395..77063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0102"
FT                   /product="P28_NEIGO Opacity protein V28 precursor"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28801"
FT                   /db_xref="GOA:B4RPY8"
FT                   /db_xref="InterPro:IPR003394"
FT                   /db_xref="InterPro:IPR006315"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:B4RPY8"
FT                   /protein_id="ACF28801.1"
FT                   /translation="MQADLAYAAERITHDYPEPTGTGKNKISTVSDYFRNIRTHSIHPR
FT                   VSVGYDFGGWRIAADYARYRKWNNNKYSVSIKELKNNNNKKKKTENQENGSFHAVSSLG
FT                   LSAVYDFKLNDKFKPYIGARVAYGHVRHSISTKKTTEFLTVARNRVTVPGTYKVSTTPG
FT                   AHQESNSIRRVGLGVIAGVGFDITPNLTLDAGYRYHNWGRLENTRFKTHEASLGVRYRF
FT                   "
FT   gene            complement(77196..77312)
FT                   /locus_tag="NGK_0103"
FT   CDS_pept        complement(77196..77312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0103"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ACF31266"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKN4"
FT                   /protein_id="ACF31266.1"
FT                   /translation="MSRGGATPYRFLLIRHIVLKHRPEPDIIRPSTSVKIFF"
FT   gene            78024..78152
FT                   /locus_tag="NGK_0104"
FT   CDS_pept        78024..78152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0104"
FT                   /product="pilS cassette"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28802"
FT                   /db_xref="UniProtKB/TrEMBL:B4RPZ0"
FT                   /protein_id="ACF28802.1"
FT                   /translation="MSTVFIESIESAFSTTRPYATEPSFPRKWESRTRGLGNRFIR"
FT   gene            78159..78782
FT                   /locus_tag="NGK_0105"
FT   CDS_pept        78159..78782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0105"
FT                   /product="signal peptidase II"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28803"
FT                   /db_xref="GOA:B4RPZ1"
FT                   /db_xref="InterPro:IPR001872"
FT                   /db_xref="UniProtKB/TrEMBL:B4RPZ1"
FT                   /protein_id="ACF28803.1"
FT                   /translation="MRTGPDSRLRGNDGFQDYGICRFGYRKGGFRVEWHSFIRLLKNMS
FT                   SSVSSKTRYWVLALAAIVLDQWSKWAVLSSFQYRERVNVIPSFFDLTLVYNPGAAFSFL
FT                   ADQGGWQKYFFLVLAVAVSAYLVRAILRDEFAALGKIGAAMIIGGASGNVIDRLIHGHV
FT                   VDFLLFYWQNWFYPAFNIADSFICVGAVLAVLDNIVHRKDSKKT"
FT   gene            78812..79780
FT                   /locus_tag="NGK_0106"
FT   CDS_pept        78812..79780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0106"
FT                   /product="4-hydroxy-3-methylbut-2-enyl diphosphate
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28804"
FT                   /db_xref="GOA:B4RPZ2"
FT                   /db_xref="InterPro:IPR003451"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4RPZ2"
FT                   /protein_id="ACF28804.1"
FT                   /translation="MNGKTIILANPRGFCAGVDRAISIVERALEEFGAPVYVRHEVVHN
FT                   KFVVDNLREKGAVFIEDLAEVPPGATLVYSAHGVSKAVQQEAAERGFRVFDATCPLVTK
FT                   VHKEVARLDAQDCEIIMIGHKGHAEVEGTMGQLAPGKMLLVETVGDVAKLEVRNPDKLA
FT                   YVSQTTLSVDETKDIIAALNARFPNIRNPHKEDICYATTNRQTAVKELAEQCDIVIVVG
FT                   SPNSSNSNRLREVAASRGIDAYMVDNASYLQRTWFEGKSKVGVTAGASAPEVLVREVLA
FT                   TIRGWGHETVREGGGAEESIVFVLPKELRREGETKPDLCKR"
FT   gene            79881..80330
FT                   /locus_tag="NGK_0107"
FT   CDS_pept        79881..80330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0107"
FT                   /product="IS1106 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28805"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:B4RPZ3"
FT                   /protein_id="ACF28805.1"
FT                   /translation="MSTFFRQTAQAMTAKHIGRFPLSELDQVIDWQPIEQYLIRQKTRY
FT                   LRDRRGRPAHPLSSMFKAVLPGQWHSLSDPELEHSLITRIGFNLFCRFDEPGIPGCSTL
FT                   CRYRKFRYARAAYFGLLKVGVQSHLKAMCLNLLKAANRLSAPAAA"
FT   gene            complement(80537..81196)
FT                   /locus_tag="NGK_0108"
FT   CDS_pept        complement(80537..81196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0108"
FT                   /product="putative phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28806"
FT                   /db_xref="GOA:B4RPZ4"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:B4RPZ4"
FT                   /protein_id="ACF28806.1"
FT                   /translation="MTPPKLIIFDWDGTLADTTQPIIDTMRRSFAECGFPPPEAERVRS
FT                   LIGYSLPEIIRALLEMPSEAAVADIARTYSAHYLNPNNRNMTLFPDAPPCLDKLKAQGF
FT                   RLAVATGKGRAGLDNAISQTATGGYWLATACAGEYPSKPSPEMVFGLCGELGLDPKEAL
FT                   VVGDTAHDLHMAANAGAAAVGVATGAHSREQLLGAPHLAVLDGLSELPGFLARHYA"
FT   gene            81344..81571
FT                   /locus_tag="NGK_0109"
FT   CDS_pept        81344..81571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0109"
FT                   /product="TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28807"
FT                   /db_xref="UniProtKB/TrEMBL:B4RPZ5"
FT                   /protein_id="ACF28807.1"
FT                   /translation="MGQFMSVFRINMTAATVLAALSSPVFAAQTADLETVHIKGQRSYN
FT                   AIATEKNGDYSSLKAAIWMTASIPASPPAA"
FT   gene            81623..82060
FT                   /locus_tag="NGK_0110"
FT   CDS_pept        81623..82060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0110"
FT                   /product="TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28808"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:B4RPZ6"
FT                   /protein_id="ACF28808.1"
FT                   /translation="MGKRVMEGVETEISGAITPKWQIHAGYSYLHSQIKTAANPRDDGI
FT                   FLLVPKHSANLWTTYQVTPGLTVGGGVNAMSGITSSAGMHAGGYATFDAMAAYRFTPKL
FT                   KLQINADNIFNRHYYARVGGTNTFNIPGSERSLTANLRYSF"
FT   gene            82130..82450
FT                   /locus_tag="NGK_0111"
FT   CDS_pept        82130..82450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0111"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28809"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B4RPZ7"
FT                   /protein_id="ACF28809.1"
FT                   /translation="MRSQPEYGIAKENRPNRQADRFAGSVLPLAASLTHKPNIMKPIPT
FT                   DTFQPAILPQAFETEIKSTCTGRIYRIQTATLGEMQSEGYPVLFVLDGEAFFPRCTTSC
FT                   SR"
FT   gene            82438..83019
FT                   /locus_tag="NGK_0112"
FT   CDS_pept        82438..83019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0112"
FT                   /product="Putative esterase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28810"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B4RPZ8"
FT                   /protein_id="ACF28810.1"
FT                   /translation="MQSLMNNPVTRSNAPCLIVGIGYTTGSVRDLAQRAADYTPPLGDN
FT                   ATADERRQFGQADRFADFIDSELTAFLESRYTLNRNETAVFGHSFGALFGLYSLLSHRC
FT                   FRRHWLVSPRFGGTTGGYSTLCRLKTGWTASMPASTSAHSSGAAVANAGKNATWQGRPN
FT                   KWRQSWTGAGPPYFSGNIRMPTTAMSRFTR"
FT   gene            complement(83712..87146)
FT                   /locus_tag="NGK_0113"
FT   CDS_pept        complement(83712..87146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0113"
FT                   /product="putative DNA polymerase III, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28811"
FT                   /db_xref="GOA:B4RPZ9"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004805"
FT                   /db_xref="InterPro:IPR011708"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR029460"
FT                   /db_xref="InterPro:IPR040982"
FT                   /db_xref="InterPro:IPR041931"
FT                   /db_xref="UniProtKB/TrEMBL:B4RPZ9"
FT                   /protein_id="ACF28811.1"
FT                   /translation="MTEPTYIPLRLHTEFSITDGMVRIKKLIAKAQEYGLPALGISDLM
FT                   NEFGLVKFYKACRGAGIKPVGAADVWIGNPNAPDKPFRAMLVIRNDAGYLRLSELLTEA
FT                   YVGQDRNIHHAELNPEWLENGDNSGLICLSGAHYGEVGVNLLNGNEDAARAAALKYAAW
FT                   FPDTFYLELQRLPERPEWEACVSGSVKLAEELGLPVVATHPTQFMNRDDFNAHEARVCI
FT                   AGGWVLTDKKRPRDFTPSQFFIPPETMLERFADLPEALENTVEIAKRCNLHITLGKNFL
FT                   PLFPTPDGLSLDDCLIKLSNEGLQERMVQLYPDEAERAAKMPEYQERLDFELNIIIQMK
FT                   FPGYFLIVQDFINWAKTHGCPVGPGRGSGAGSLVAYSLKITDLDPLKYALLFERFLNPE
FT                   RVSMPDFDVDFCQANRGRVIEYVREKYGAQAVSQIVTFGTMSSKAVIRDVGRVLELPFM
FT                   LCDKLSKLIPLEANKPLSLDDAMKAQPQIQELLEAEEADELITLAKKLEDLTRGLGMHA
FT                   GGVLIAPGKISDYSPVYQADESASPVSMYDKGDVEDVGLVKFDFLGLRNLTIIEMAQNN
FT                   IKNTAGDIVDVGKIPLDDQTAYQIFRDANTTAVFQFESTGMKKMLKTAHTTKFEELIAF
FT                   VSLYRPGPMDNIPDFVARMKGQEFQYIHPLLEGILAPTYGIMVYQEQVMQAAQIIGGYS
FT                   LGGADLLRRAMGKKKPEEMVKHREIFAEGAAKQGISREKSDEIFNYMEKFAGYGFNKSH
FT                   AAAYALISYQTAWLKAHYPAEFMAATMSSELDNTDQLKHFYDDCRANGIEFLPPDINES
FT                   DYRFTPYPNMKIRYALGAIKGTGEAAVESIIAARQSGGKFTGLLDFCERVGKEHMNRRT
FT                   LEALIRGGAFDSIEPNRAMLLANIDLAMDNADQKAANANQGGLFDMMEDAIEPVRLIDA
FT                   PMWSESEKLAEEKTVIGFYLSGHPFGPYAQEVRQIAPTKLGRLKPQDSVRLAGFVTAVR
FT                   TMMGKRGKIAFVSLEDSSGQAEIMVGGQTLENCADCLKADQVLIIESKVSRDDYGGGDG
FT                   LRIMANQVMTLQTARERYARSLSLALAPHHDIGGLVRLLAAHQLPDTPRIPLQLSYANE
FT                   KASGRLQVPPKWTVTPSSALFGELETLLGSRSVRVNW"
FT   gene            87159..87320
FT                   /locus_tag="NGK_0114"
FT   CDS_pept        87159..87320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0114"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28812"
FT                   /db_xref="UniProtKB/TrEMBL:B4RQ00"
FT                   /protein_id="ACF28812.1"
FT                   /translation="MDNKRRIVAGLSLDGGAGNAVSDSDGMTCKCFLSFYDGKKMPPAV
FT                   WRRLPKEY"
FT   gene            87431..87667
FT                   /locus_tag="NGK_0115"
FT   CDS_pept        87431..87667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0115"
FT                   /product="Conserved secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28813"
FT                   /db_xref="UniProtKB/TrEMBL:B4RQ01"
FT                   /protein_id="ACF28813.1"
FT                   /translation="MPIAGVSGSPRLRMCISVNADSSGNRICSLPLGRISLDGWRHTGF
FT                   QTAFLRNRQCGHIAGFAAILGAAAAGATITPSF"
FT   gene            87679..87912
FT                   /locus_tag="NGK_0116"
FT   CDS_pept        87679..87912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0116"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28814"
FT                   /db_xref="GOA:B4RQ02"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:B4RQ02"
FT                   /protein_id="ACF28814.1"
FT                   /translation="MEATVYLEDNEYIALCDLLKLAGLAESGGQAKAFIAEGLVLRNGG
FT                   TEIRKTAKIRGGEVIEFDGARLEIADGYDPEA"
FT   gene            87890..88093
FT                   /locus_tag="NGK_0117"
FT   CDS_pept        87890..88093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0117"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28815"
FT                   /db_xref="InterPro:IPR019180"
FT                   /db_xref="UniProtKB/TrEMBL:B4RQ03"
FT                   /protein_id="ACF28815.1"
FT                   /translation="MDTTLKHKAEALLGEPLLDEPVRPESWECCGSDCGEACIQTIYWA
FT                   DKARYDAQRKKLKEAGWPDDAV"
FT   gene            complement(88161..88292)
FT                   /locus_tag="NGK_0118"
FT   CDS_pept        complement(88161..88292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0118"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28816"
FT                   /db_xref="UniProtKB/TrEMBL:B4RQ04"
FT                   /protein_id="ACF28816.1"
FT                   /translation="MQRKSRYAVIPAQARIQTLIYWKCLRLTAISNFRIPAFEGMAI"
FT   gene            88388..89224
FT                   /locus_tag="NGK_0119"
FT   CDS_pept        88388..89224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0119"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28817"
FT                   /db_xref="GOA:B4RQ05"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniProtKB/TrEMBL:B4RQ05"
FT                   /protein_id="ACF28817.1"
FT                   /translation="MIDLHCHSTVSDGMLPPAEVVRLAHQNGCTLLALTDHDHTGGISE
FT                   ARAEADRLGLRLINGVEISVTWRGRTIHVVGLDFDEQDENLQNLLADVRKGRLKRLEAI
FT                   AAKLEKKGIGGAYDGALALAANKEMVSRTHVAEFLIKNGHVKNKRQAFTKYLGDGKSCA
FT                   VRHEWATLADCVSAVNGAGGMAVIAHPMRYDLSATAKRNLFEEFKNLGGAGIEVHSGNC
FT                   CKNDRLNYALLADRFGLLASAGSDFHRLDDFSGGILGACPDLPENCKPVRAHFSRH"
FT   gene            complement(89276..90634)
FT                   /locus_tag="NGK_0120"
FT   CDS_pept        complement(89276..90634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0120"
FT                   /product="valine--pyruvate transaminase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28818"
FT                   /db_xref="GOA:B4RQ06"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B4RQ06"
FT                   /protein_id="ACF28818.1"
FT                   /translation="MPSEPSDGIPYKPICLTHTEFDMQFSAFGEKFTQHSGILQLMDDL
FT                   GDALKSDKPVNMLGGGNPARIPEIDRAFADIFSKLAAEHAVENIGNYSNPQGDAALIDA
FT                   LTAFPNREYGWNLTVGNIALTNGSQNAFFYLFNLFGGKFKLSDGTSAEKAILLPLAPEY
FT                   IGYADVHVEGRHFVSVKPKIENVEHEGEAGFFKYRVDFDALENLPELKAGKIGAIYCSR
FT                   PTNPTGNVLTDGEMARLDALAREHGIPPIIDNAYGMPFPNIIDSGVTLNWHENIILCFS
FT                   LSKVGLPGVRTGIIVAAPEAVKAVSSLNAIVNLAPTRFGAAIAAPLLESGEMKRLADQV
FT                   IRPFYRNQAQTAVSLLKRELGAYPMKIHKPEGAIFLWLWFENLPVSSQTLYEMLKAEGT
FT                   LIIPGEHFFVGIDTQDYPHAGECIRMSIAQDAQTLEKGIAAIGKTVRKPYDNV"
FT   gene            complement(90624..92534)
FT                   /locus_tag="NGK_0121"
FT   CDS_pept        complement(90624..92534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0121"
FT                   /product="pilin glycosylation protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28819"
FT                   /db_xref="GOA:B4RQ07"
FT                   /db_xref="InterPro:IPR003869"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041561"
FT                   /db_xref="UniProtKB/TrEMBL:B4RQ07"
FT                   /protein_id="ACF28819.1"
FT                   /translation="MNLETLIALPRNIKKICFLIHDFLMIFTAFWFTQSLKADYSDEWF
FT                   DFANWQSFLLTALLTITLFIRMGLYRAVTRFVSFHVLTTAFAGSLASAVLFFLNTLIFE
FT                   ERLRLALPIVYFLLLFVSVTGSRMVLRGLLSDHQKKTHDPVIIYGAGRSGRQLLEAVKQ
FT                   MREYSAAAFVDDNPKLWHTVIYDLAVYQPDAIAFLIERYGVEKILLAIPSATQEQRRRI
FT                   ISKLKAYPCEVLTIPGMKDLMDGKISIGTLKKISVSDLLGRDSVAPDDRLMNADTEGKT
FT                   VMVTGAGGSIGSELCRQIIRRRPERLLLFELSEFALYTVEKELCEYCARNGIAAEILPF
FT                   LGSVQNRTLLTHIMTAFSVTTVYHAAAYKHVPMVEFNTVEGIRNNIFGTLECALAATAS
FT                   GVETFVLISTDKAVRPANTMGAGKRMAELCLQALAAEPGQKTRFSMVRFGNVLGSSGSV
FT                   VPLFEKQIAEGGPITLTHPDITRYFMTIPEAAQLVIQAGAMGRGGDVFVLDMGESVKIT
FT                   DLARQMITLSGLKPKTPEQPDGDIEILITGLRPGEKLYEELLIGDNVRKTGHPRIMTAD
FT                   ETMLPWHELSALLDRIRTACDRYDQQAIRDLLVNAPTGFTPTGGICDLLWVCETHRKNA
FT                   V"
FT   gene            complement(92582..93787)
FT                   /locus_tag="NGK_0122"
FT   CDS_pept        complement(92582..93787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0122"
FT                   /product="PglC"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28820"
FT                   /db_xref="GOA:B4RQ08"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B4RQ08"
FT                   /protein_id="ACF28820.1"
FT                   /translation="MPSEPDGPNTMLNTALSPWPSFTQEEADAVSKVLLSNKVNYWTGS
FT                   ECREFEKEFAAFAGTRYAVALSNGTLALDAALKAIGIGAGDDVIVTSRTFLASASCIVN
FT                   AGANPVFADVDLNSQNISAETVKAVLTPNTKAVIVVHLAGMPAEMDGIMALAKEHDLWV
FT                   IEDCAQAHGATYKGKSVGSIGHVGAWSFCQDKIITTGGEGGMVTTNDKTLWEKMWAYKD
FT                   HGKSYDAVYHREHAPGFRWLHESFGTNWRMMEMQAVIGRIQLKHLPEWTARRQENAAKL
FT                   AESLRKFKSIRLIEVAGYIGHAQYKFYAFVKPEHLKDDWTRDRIVSELNARNVPCYQGG
FT                   CSEVYLEKAFDNTPWRPKERLKNAVELGGTALTFLVHPTLTDDEIAFCKKHIEAVLTEA
FT                   AR"
FT   gene            complement(93888..95144)
FT                   /locus_tag="NGK_0123"
FT   CDS_pept        complement(93888..95144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0123"
FT                   /product="PglB"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28821"
FT                   /db_xref="GOA:B4RQ09"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR020019"
FT                   /db_xref="InterPro:IPR041561"
FT                   /db_xref="UniProtKB/TrEMBL:B4RQ09"
FT                   /protein_id="ACF28821.1"
FT                   /translation="MKDWQMSKAVKRLFDIIASASGLIVLSPVFLVLIYLIRKNLGSPV
FT                   FFIRERPGKDGKPFKMVKFRSMRDALDSDGIPLPDSERLTPFGKKLRTASLDELPELWN
FT                   VLKGEMSLVGPRPLLMQYLPLYNKFQNRRHEMKPGITGWAQVNGRNALSWDEKFSCDVW
FT                   YTDNFSFWLDMKILFLTVKKVLIKEGISAQGEATMPPFAGNRKLAVIGAGGHGKVVAEL
FT                   AAALGTYGEIVFLDDRTQGSVNGFPVIGTTLLLENSLSPEQFDITVAVGNNRIRRQITE
FT                   KAAALGFKLPVLIHPDATVSPSATIGQGSVVMAKAVVQAGSVLKDGVIVNTAATVDHDC
FT                   LLDAFVHISPGAHLSGNTRIGEESRIGTGACSRQQTTVGSGVTAGAGAVIVCDIPDGMT
FT                   VAGNPAKPLTGKNPKTGTA"
FT   gene            complement(95145..95300)
FT                   /locus_tag="NGK_0124"
FT   CDS_pept        complement(95145..95300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0124"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28822"
FT                   /db_xref="UniProtKB/TrEMBL:B4RQ10"
FT                   /protein_id="ACF28822.1"
FT                   /translation="MKIILTTSMSVLGGTGTTSSIAKCRAKPTPFSPTKSSAASGATFP
FT                   IGKSST"
FT   gene            complement(95297..96907)
FT                   /locus_tag="NGK_0125"
FT   CDS_pept        complement(95297..96907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0125"
FT                   /product="Lipopolysaccharide biosynthesis translocase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28823"
FT                   /db_xref="GOA:B4RQ11"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="UniProtKB/TrEMBL:B4RQ11"
FT                   /protein_id="ACF28823.1"
FT                   /translation="MPPFCYIITPIKNGPFRPPPARKSATRTAAPRRQPRRPESRQIPI
FT                   KKGFRRHRQHHAAARTSKMDTKEILGYAAGSIGSAVLAVIILPLLSWYFPADDIGRIVL
FT                   MQTAAGLTVSVLCLGLDQAYVREYYAAADKDTLFKTLFLPPLLFSAAIAALLLSRPSLP
FT                   SEILFSLDDAAAGIGLVLFELSFLPIRFLLLVLRMEGRALAFSSAQLVPKLAILLLLPL
FT                   TVGLLHFPANTAVLTTVYALANLAAAAFLLFQNRCRLKAVRRAPFSPAVLHRGLRYGIP
FT                   LALSSLAYWGLASADRLFLKKYAGLEQLGVYSMGISFGGAALLLQSIFSTVWTPYIFRA
FT                   IEENATPARLSATAESAAALLASALCLTGIFSPLASLLLPENYAAVRFTVVSCMLPPLF
FT                   YTLTEISGIGLNVVRKTRPIALATLGALAANLLLLGLAVPSGGTRGAAVACAASFWLFF
FT                   VFKTESSCRLWQPLKRLPLYMHTLFCLASSAAYTCFGTPANYPLFAGVWAAYLAGCILR
FT                   HRKNLHKLFHYLKKQGFPL"
FT   gene            complement(96913..97998)
FT                   /locus_tag="NGK_0126"
FT   CDS_pept        complement(96913..97998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0126"
FT                   /product="Riboflavin biosynthesis protein RibD"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28824"
FT                   /db_xref="GOA:B4RQ12"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR004794"
FT                   /db_xref="InterPro:IPR011549"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:B4RQ12"
FT                   /protein_id="ACF28824.1"
FT                   /translation="MMENALRLAALGRFSTSPNPRVGCVIAHGRQIVGQGFHVKAGEPH
FT                   AEVHALRQAGEMAKGATAFVTLEPCSHYGRTPPCAEALLRSGVTRVVAAMRDPNPPVAG
FT                   KGLVLLKAAGIKTECGLLENKARELNRGFLSRIERRRPFVRLKCAVSLDGKTALSDGSS
FT                   FWITGEEARADVQVLRAESCAVLTGIGTVLADNPRLNVRAFPTLRQPARIVLDSRLRLP
FT                   PNSHLVTDGQSPTYIATLERDEDKLRPYREHAHIRILMPSETADGKIDLHHLMRLLADE
FT                   GFGEIMVEAGSELTSAFLAENLADEIVLYRSPKILGGGKDLFSLPENRAALSAPPLWTP
FT                   VSSEILGHDIKTVFRKNGNAF"
FT   gene            complement(98054..98518)
FT                   /locus_tag="NGK_0127"
FT   CDS_pept        complement(98054..98518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0127"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28825"
FT                   /db_xref="GOA:B4RQ13"
FT                   /db_xref="InterPro:IPR003796"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="UniProtKB/TrEMBL:B4RQ13"
FT                   /protein_id="ACF28825.1"
FT                   /translation="MKCPFCSHPDTRVADSRLMEERNTVRRRRHCPGCGKRFGTLETVE
FT                   LKMPAVIGPDKKRSPFNAQRLRNDLTAAARKSALTPEQIDETVRLTEHRLYTSGQRDIS
FT                   SSELVEIVLEELFGQNTEAAVRFAALHKRFDSPEHFASWLAQAVKTGGKT"
FT   gene            complement(98547..99371)
FT                   /locus_tag="NGK_0128"
FT   CDS_pept        complement(98547..99371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0128"
FT                   /product="YafJ"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28826"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR026869"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:B4RQ14"
FT                   /protein_id="ACF28826.1"
FT                   /translation="MNCNTPTDIMFSFEGFRRRGGITDHHADGFGIGFFEGKGVRLFHD
FT                   DKPSANSPVADLVRAYQIKSENVVAHIRKASQGQTSLANTHPFMREMWGGYWLFAHNGH
FT                   LVDFFPEQGEFFHPVGTTDSERAFCHILNRLRTRFAARPDDDTLFDAIAGLTHEIRKFG
FT                   LFNFMLSDGISLFAHASTLLHYIVRQAPFGKARLLDDDVMVDFAEVTTPDDRVAVISTL
FT                   PLTRDESWSQLAVNELVMFREGNIVRHDRPENPVYMSAEEGLEIARAAGVSV"
FT   gene            complement(99476..99625)
FT                   /locus_tag="NGK_0129"
FT   CDS_pept        complement(99476..99625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0129"
FT                   /product="putative phage associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28827"
FT                   /db_xref="UniProtKB/TrEMBL:B4RQ15"
FT                   /protein_id="ACF28827.1"
FT                   /translation="MKFQIPACAGMTAQKLRNEKQPKPDKSDSRLRGNDGILSFRLCFL
FT                   FSRE"
FT   gene            complement(99933..100088)
FT                   /locus_tag="NGK_0130"
FT   CDS_pept        complement(99933..100088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0130"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28828"
FT                   /db_xref="UniProtKB/TrEMBL:B4RQ16"
FT                   /protein_id="ACF28828.1"
FT                   /translation="MMTFHHHSPRKRASGYSILQGFIRNNDNLSAVISAQMEIWKFKIT
FT                   GIYPEL"
FT   gene            complement(100129..101208)
FT                   /locus_tag="NGK_0131"
FT   CDS_pept        complement(100129..101208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0131"
FT                   /product="AroB"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28829"
FT                   /db_xref="GOA:B4RQ17"
FT                   /db_xref="InterPro:IPR016037"
FT                   /db_xref="InterPro:IPR030960"
FT                   /db_xref="InterPro:IPR030963"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4RQ17"
FT                   /protein_id="ACF28829.1"
FT                   /translation="MKTLTVHTPSHSYPIFIGNGLLPQAGSLLKPHLGKRAAIITNETV
FT                   APLYLGTLQTALDAAGVSHFSIILPDGEAHKNWQTLNLIFDGLMQNRAERKTTLIALGG
FT                   GVIGDMVGFAAATYQRGAPFIQIPTTLLSQVDSSVGGKTAINHPLGKNMIGAFYQPQAV
FT                   LADLDTLHTLPARELSAGMAEVIKYGALGDIGFFEWLEQHMPELMALERAPLTQAVYRC
FT                   CQMKADIVAQDETEQGIRAWLNLGHTFGHAVEAEMGYGVWLHGEAVAAGCVLAARLSEQ
FT                   LGKTSAADTARLAALLEAAGLPSAPPVFAFEKWLAHMSHDKKVSGGIMRFIGLNRLGEA
FT                   VITEITDTDILRRTLQPYL"
FT   gene            complement(101288..101803)
FT                   /locus_tag="NGK_0132"
FT   CDS_pept        complement(101288..101803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0132"
FT                   /product="AroK"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28830"
FT                   /db_xref="GOA:B4RQ18"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR023000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:B4RQ18"
FT                   /protein_id="ACF28830.1"
FT                   /translation="MMKNFNGKLILIGLMGAGKTTLGRQMAQRLDYRFYDSDHEIAAAA
FT                   GVPIPTIFEMEGEQGFRSRETAILKKLIVLPHIVLSTGGGAVLKEENRALIRKSGTVVY
FT                   LHAPPETLLERTRCDNSRPLLQVADPLAKLRELYAARDPVYRQTADFTVESANCRETVQ
FT                   TLLKRLSR"
FT   gene            101813..101956
FT                   /locus_tag="NGK_0133"
FT   CDS_pept        101813..101956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0133"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28831"
FT                   /db_xref="UniProtKB/TrEMBL:B4RQ19"
FT                   /protein_id="ACF28831.1"
FT                   /translation="MFDPPAFRGGRVRACRVTAGFYTKSAGRRYVWKNNPTIPNFSDFK
FT                   EK"
FT   gene            102239..102403
FT                   /locus_tag="NGK_0134"
FT   CDS_pept        102239..102403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0134"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28832"
FT                   /db_xref="UniProtKB/TrEMBL:B4RQ20"
FT                   /protein_id="ACF28832.1"
FT                   /translation="MLIRYKDRRASAAVIPAQAGIQSVRFQPYPTDSCRVAVLDSRLCG
FT                   NDGISAGEG"
FT   gene            102748..102924
FT                   /locus_tag="NGK_0135"
FT   CDS_pept        102748..102924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0135"
FT                   /product="putative phage associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28833"
FT                   /db_xref="UniProtKB/TrEMBL:B4RQ21"
FT                   /protein_id="ACF28833.1"
FT                   /translation="MTGCFGLLFFVEMTRLWIARIYPFRRYSHESGNLEMKSNRNLSEM
FT                   TETERTGFPISRE"
FT   gene            102921..103043
FT                   /locus_tag="NGK_0136"
FT   CDS_pept        102921..103043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0136"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28834"
FT                   /db_xref="UniProtKB/TrEMBL:B4RQ22"
FT                   /protein_id="ACF28834.1"
FT                   /translation="MTAQKLRDEKQPKPDKLDSRLRGNDGISVAAKSIKKGHML"
FT   gene            complement(103068..105263)
FT                   /locus_tag="NGK_0137"
FT   CDS_pept        complement(103068..105263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0137"
FT                   /product="PilQ"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28835"
FT                   /db_xref="GOA:B4RQ23"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004845"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR005644"
FT                   /db_xref="InterPro:IPR011662"
FT                   /db_xref="InterPro:IPR013355"
FT                   /db_xref="InterPro:IPR021731"
FT                   /db_xref="InterPro:IPR038591"
FT                   /db_xref="UniProtKB/TrEMBL:B4RQ23"
FT                   /protein_id="ACF28835.1"
FT                   /translation="MNTKLTKIISGLFVATAAFQTASAGNITDIKVSSLPNKQKIVKVS
FT                   FDKEIVNPTGFVTSSPARIALDFEQTGISMDQQVLEYADPLLSKISAAQNSSRARLVLN
FT                   LNKPGQYNTEVRGNKVWIFINESDDTVSAPARPAVKAAPAAPAKQQAAAPFTESVVSVS
FT                   APFSPAKQQAAASAKQQAATPAKQTNIDFRKDGKNAGIIELAALGFAGQPDISQQHDHI
FT                   IVTLKNHTLPTALQRSLDVADFKTPVQKVTLKRLNNDTQLIITTTGNWELVNKSAAPGY
FT                   FTFQVLPKKQNLESGGVNNAPKTFTGRKISLDFQDVEIRTILQILAKESGMNIVASDSV
FT                   NGKMTLSLKDVPWDQALDLVMQARNLDMRQQGNIVNIAPRDELLAKDKAFLQAEKDIAD
FT                   LGALYSQNFQLKYKNVEEFRSILRLDNADTTGNRNTLVSGRGSVLIDPATNTLIVTDTR
FT                   SVIEKFRKLIDELDVPAQQVMIEARIVEAADGFSRDLGVKFGATGRKKLKNETSAFGWG
FT                   VNSGFGGGDKWEAQTKINLPVAAAANSISLVRAISSGALNLELSASESLSKTKTLANPR
FT                   VLTQNRKEAKIESGYEIPFTVTTASGGGNSTNTELKKAVLGLTVTPNITPDGQIIMTVK
FT                   INKDSPAQCASGNNTILCISTKSLNTQAMVENGGTLIVGGIYEENNGNTLTKVPLLGDI
FT                   PVIGNLFKTRGKKTDRRELLIFITPRIIDTAGNSLRY"
FT   gene            complement(105282..105749)
FT                   /locus_tag="NGK_0138"
FT   CDS_pept        complement(105282..105749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0138"
FT                   /product="PilP"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28836"
FT                   /db_xref="InterPro:IPR007446"
FT                   /db_xref="UniProtKB/TrEMBL:B4RQ24"
FT                   /protein_id="ACF28836.1"
FT                   /translation="MAQTRREAKAEIIPFQAPTLPVAPVYSPPQLTGPNAFDFRRMETA
FT                   KKGENAPDTKRIKETLEKFSLENMRYVGILKSGQKVSGFIEAEGYVYTVGVGNYLGQNY
FT                   GRIESITDDSIILNELIEDSTGNWVSRKAELLLNSSDKNTEQAAAPAAEQN"
FT   gene            complement(105845..106492)
FT                   /locus_tag="NGK_0139"
FT   CDS_pept        complement(105845..106492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0139"
FT                   /product="PilO"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28837"
FT                   /db_xref="GOA:B4RQ25"
FT                   /db_xref="InterPro:IPR007445"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="UniProtKB/TrEMBL:B4RQ25"
FT                   /protein_id="ACF28837.1"
FT                   /translation="MASKSSKTNLDLNNLHLLNLPARLFIALLVVAAVLGLGYAGLFKS
FT                   QMESLEEYEAKETELKNTYKQKSIDAASLNNLRDELASIRSAFDIMLKQLPTDAEIPNL
FT                   VQELHQAGSSNGLRLDSVMPQPPVDDGPIKKLPYSISITGNYEQISQFTRDVGSLSRII
FT                   TLESLKIAQSPENGGNPDGKSSILNLSAIATTYQAKSVEELAAEAAQNAEQK"
FT   gene            complement(106493..107092)
FT                   /locus_tag="NGK_0140"
FT   CDS_pept        complement(106493..107092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0140"
FT                   /product="PilN"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28838"
FT                   /db_xref="GOA:B4RQ26"
FT                   /db_xref="InterPro:IPR007813"
FT                   /db_xref="UniProtKB/TrEMBL:B4RQ26"
FT                   /protein_id="ACF28838.1"
FT                   /translation="MNNLIKINLLPYREEMNKRKQQQFKTLMYGAVLTGVAAVAATYLF
FT                   IDNMINKQSEKNTLLEISIAHLDTELSKIQKLKQEKDAFLIKKNKIGELQIKRLQAAKI
FT                   LDSLNEAVPGSTYLTSLDAVTADSYRLSGRTSSDNRVAAMMRAMPNTGIFKQPELLSIK
FT                   KNNSHQEFTLQATLQPIVKAAESKENPASGNAQEAN"
FT   gene            complement(107095..108210)
FT                   /locus_tag="NGK_0141"
FT   CDS_pept        complement(107095..108210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0141"
FT                   /product="PilM"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28839"
FT                   /db_xref="InterPro:IPR005883"
FT                   /db_xref="UniProtKB/TrEMBL:B4RQ27"
FT                   /protein_id="ACF28839.1"
FT                   /translation="MRLFKSLKNPKKTDAKLPKKSSGLNNRAAIGIDIDQHSIKMVQLS
FT                   GRSLNQIQLEKYVIAKLPKNIIQGNKVQNYDQLVTYLQQAYAKLGTSCKNIVASVPQNL
FT                   ATIEQLTYTAKDAELDLQGFVESSISEASSISLEEANYDYQVLSQSAVGEAVLSVASRK
FT                   DEIEPLIDAFNAAGMKLSALDVDIFGQYNAYALWINHFAPELADEKVAIFGVYAAQTYA
FT                   LVIQDGKILYKQETSVSEEQLNQLIQRTYQVTAEKAEEIINSPQKPSDYQESVANYFNQ
FT                   QITQEIQRVLQFYYTTQTADDMTDIKHILLTGEAVRQKGIAQTVASQTNADVQCVHPAR
FT                   YFANDLKTDEQQFELDAPTLTKAFGLAVRGL"
FT   gene            108362..110758
FT                   /locus_tag="NGK_0142"
FT   CDS_pept        108362..110758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0142"
FT                   /product="PonA"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28840"
FT                   /db_xref="GOA:B4RQ28"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031376"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:B4RQ28"
FT                   /protein_id="ACF28840.1"
FT                   /translation="MIKKILTTCFGLFFGFCVFGVGLVAIAILVTYPKLPSLDSLQHYQ
FT                   PKMPLTIYSADGEVIGMYGEQRREFTKIGDFPEVLRNAVIAAEDKRFYRHWGVDVWGVA
FT                   RAAVGNVVSGSVQSGASTITQQVAKNFYLSSEKTFTRKFNEVLLAYKIEQSLSKDKILE
FT                   LYFNQIYLGQRAYGFASAAQIYFNKNVRDLTLAEAAMLAGLPKAPSAYNPIVNPERAKL
FT                   RQKYILNNMLEEKMITVQQRDQALNEELHYERFVRKIDQSALYVAEMVRRELYEKYGED
FT                   AYTQGFKVYTTVRTDHQKAATEALRKALRNFDRGSSYRGAENYIDLSKSEDVEETVSQY
FT                   LSGLYTVDKMVPAVVLDVTKKKNVVIQLPGGRRVALDRRALGFAARAVDNEKMGEDRIR
FT                   RGAVIRVKNNGGRWAVVQEPLPQGALVSLDAKTGAVRALVGGYDFHSKTFNRAVQAMRQ
FT                   PGSTFKPFVYSAALSKGMTASTVVNDAPISLPGKGPNGSVWTPKNSDGRYSGYITLRQA
FT                   LTASKNMVSIRILMSIGVGYAQQYIRRFGFRPSELPASLSMALGTGETTPLKVAEAYSV
FT                   FANGGYRVSSHVIDKIYDRDGRLRAQMQPLVAGQNAPQAIDPRNAYIMYKIMQDVVRVG
FT                   TARGAAALGRTDIAGKTGTTNDNKDAWFVGFNPDVVTAVYIGFDKPKSMGRAGYGGTIA
FT                   VPVWVDYMRFALKGKQGKGMKMPEGVVSSNGEYYMKERMVTDPGLMLDNSGIAPQPSRR
FT                   AKEDDEAAVENEQQGRSDETRQDVQETPVLPSNTDSKQQQLDSLF"
FT   gene            complement(110879..111508)
FT                   /locus_tag="NGK_0143"
FT   CDS_pept        complement(110879..111508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0143"
FT                   /product="GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28841"
FT                   /db_xref="GOA:B4RQ29"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019987"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030393"
FT                   /db_xref="PDB:5UCV"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4RQ29"
FT                   /protein_id="ACF28841.1"
FT                   /translation="MNLFQNAKFFTTVNHLKDLPDTPLEIAFVGRSNAGKSSAINTLTN
FT                   HVRLAYVSKTPGRTQHINFFELQNGNFMVDLPGYGYAQVPEAVRAHWVNLLGDYLRHRK
FT                   QLIGLVLIMDARHPLKELDIRMLDFFHTTGRPVHILLSKADKLSKNEQIKTLSQVKKLL
FT                   KPYSDRQNISVQLFSSLKKQGIDEANRTVGSWFDAADAAASSPEEN"
FT   gene            111733..112338
FT                   /locus_tag="NGK_0144"
FT   CDS_pept        111733..112338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0144"
FT                   /product="putative cytochrome precursor"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28842"
FT                   /db_xref="GOA:B4RQ30"
FT                   /db_xref="InterPro:IPR008168"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR024167"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:B4RQ30"
FT                   /protein_id="ACF28842.1"
FT                   /translation="MAFVLAAGAVSASPKADVEKGKQVAATVCAACHAADGNSGIAMYP
FT                   RLAAQHTAYIYHQTIGIRDGKRTHGSAAVMKPVVMNLSDQDILNVSAFYAKQQPKSGEA
FT                   NPKENPELGAKIYRGGLSDKKVPACMSCHGPSGAGMPGGGSEIQAYPRLGGQHQAYIVE
FT                   QMNAYKSGQRKNTIMEDIANRMSEEDLKAVANFIQGLR"
FT   gene            112616..114568
FT                   /locus_tag="NGK_0145"
FT   CDS_pept        112616..114568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0145"
FT                   /product="putative cytochrome biogenesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28843"
FT                   /db_xref="GOA:B4RQ31"
FT                   /db_xref="InterPro:IPR007816"
FT                   /db_xref="UniProtKB/TrEMBL:B4RQ31"
FT                   /protein_id="ACF28843.1"
FT                   /translation="MRFAVALLSLLGIASVIGTVLQQNQPQTDYLVKFGPFWTRIFDFL
FT                   GLYDVYASAWFVVIMMFLVVSTSLCLIRNVPPFWREMKSFREKVKEKSLAAMRHSSLLD
FT                   VKIAPEVAKRYLEVRGFQGKTVSREDGSVLIAAKKGTMNKWGYIFAHVALIVICLGGLI
FT                   DSNLLLKLGMLAGRIVPDNQAVYAKDFKPESILGASNLSFRGNVNISEGQSADVVFLNA
FT                   DNGMLVQDLPFEVKLKKFHIDFYNTGMPRDFASDIEVTDKATGEKLERTIRVNHPLTLH
FT                   GITIYQASFADGGSDLTFKAWNLRDASREPVVLKATSIHQFPLEIGKHKYRLEFDQFTS
FT                   MNVEDMSEGAEREKSLKSTLNDVRAVTQEGKKYTNIGPSIVYRIRDAAGQAVEYKNYML
FT                   PILQDKDYFWLTGTRSGLQQQYRWLRIPLDKQLKADTFMALREFLKDGEGRKRLVADAT
FT                   KDAPAEIREQFMLAAENTLNIFAQKGYLGLDEFITSNIPKGQQDKMQGYFYEMLYGVMN
FT                   AALDETIRRYGLPEWRQDEARNRFLLHSMDAYTGLTEYPAPMLLQLDGFSEVRSSGLQM
FT                   TRSPGALLVYLGSVLLVLGTVFMFYVREKRAWVLFSDGKIRFAMSSARSERDLQKEFPK
FT                   HVESLQRLGKDLNHD"
FT   gene            114561..115748
FT                   /locus_tag="NGK_0146"
FT   CDS_pept        114561..115748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0146"
FT                   /product="putative cytochrome synthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28844"
FT                   /db_xref="GOA:B4RQ32"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="InterPro:IPR017562"
FT                   /db_xref="UniProtKB/TrEMBL:B4RQ32"
FT                   /protein_id="ACF28844.1"
FT                   /translation="MTEHYKTLPEHELLIQKSLIRNLNLWDWVFAVLVFAATVFVQTRS
FT                   GMHMDIYETVMLWASAGIAVFLGWFFKPMRWFVPLSVLLAYAAVGLYGGNIKSAEIFLL
FT                   RYFLSSQSAIMWQCAFVFFALFAYISGAVLASVKNVPTNTLLGMGTVFAWVSAVAGFTG
FT                   LLVRWHESYLLRPDAGHIPVSNLYEVFILFLVITALMYLYYEGKFAVQKLGGFVFGFMA
FT                   VVVGFVLWYSVSREAHTIQPLIPALQSWWMKIHVPANFIGYGAFCISAMLGIAELVSLR
FT                   AEEKGGKLWLPPSALIDEVMYKAIAVGFLFFTIATILGALWAADAWGRYWSWDPKETWA
FT                   FIVWLNYAVWLHLRLVAGWRGKVLAWWAIIGLFVTAFAFIGVNMFLSGLHSYGTL"
FT   gene            115864..116928
FT                   /locus_tag="NGK_0147"
FT   CDS_pept        115864..116928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0147"
FT                   /product="O-sialoglycoprotein endopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28845"
FT                   /db_xref="GOA:B4RQ33"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4RQ33"
FT                   /protein_id="ACF28845.1"
FT                   /translation="MLVLGIESSCDETGVALYDTERGLRSHCLHTQMAMHAEYGGVVPE
FT                   LASRDHIRRLVPLTEGCLAQAGASYGDIDAVAFTQGPGLGGALLAGSSYANALALALDK
FT                   PVIPVHHLEGHLLSPLLAEEKPDFPFVALLVSGGHTQIMAVRGIGDYELLGESVDDAAG
FT                   EAFDKTAKLLGLPYPGGAKLSELAESGRPEAFVFPRPMIHSDDLQMSFSGLKTAVLTAV
FT                   EKVREANGSETIPEQTRNNICRAFQDAVVEVLEAKVKKALLQTGFRTVVVAGGVGANRK
FT                   LRETFGNMTVQIPTPKGKPKHPSEKVSVFFPPMAYCTDNGAMIAFAGAMHLGKGREVGA
FT                   FNVRPRWSLSEIVK"
FT   gene            complement(116973..117896)
FT                   /locus_tag="NGK_0148"
FT   CDS_pept        complement(116973..117896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0148"
FT                   /product="lipid A biosynthesis lauroyl acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28846"
FT                   /db_xref="GOA:B4RQ34"
FT                   /db_xref="InterPro:IPR004960"
FT                   /db_xref="UniProtKB/TrEMBL:B4RQ34"
FT                   /protein_id="ACF28846.1"
FT                   /translation="MPQYFPFSDGMFRLQFRLFPPLRTAMHILLTALLKCLSLLSLSCL
FT                   HTLGNRLGHLAFYLLKEDRARIVANMRQAGLNPDTQTVKAVFAETAKCGLELAPAFFKK
FT                   PEDIETMFKAVHGWEHVQQALDKGEGLLFITPHIGSYDLGGRYISQQLPFHLTAMYKPP
FT                   KIKAIDKIMQAGRVRGKGKTAPTGIQGVKQIIKALRAGEATIILPDHVPSPQEGGGVWA
FT                   DFFGKPAYTMTLAAKLAHVKGVKTLFFCCERLPDGQGFVLHIRPVQGELNGNKAHDAAV
FT                   FNRNTEYWIRRFPTQYLFMYNRYKTP"
FT   gene            117945..118088
FT                   /locus_tag="NGK_0149"
FT   CDS_pept        117945..118088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0149"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28847"
FT                   /db_xref="UniProtKB/TrEMBL:B4RQ35"
FT                   /protein_id="ACF28847.1"
FT                   /translation="MPTCFSNGKVRWTVEKPMWLAGAIQTRLMREFFCLYETYGQRFQS
FT                   AV"
FT   gene            118212..119381
FT                   /locus_tag="NGK_0150"
FT   CDS_pept        118212..119381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0150"
FT                   /product="S-adenosylmethionine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28848"
FT                   /db_xref="GOA:B4RQ36"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4RQ36"
FT                   /protein_id="ACF28848.1"
FT                   /translation="MSEYLFTSESVSEGHPDKVADQVSDAILDAILAQDPKARVAAETL
FT                   VNTGLCVLAGEITTTAQVDYIKVARETIKRIGYNSSELGFDANGCAVGVYYDQQSPDIA
FT                   QGVNEGEGIDLNQGAGDQGLMFGYACDETPTLMPFAIYYSHRLMQRQSELRKDGRLPWL
FT                   RPDAKAQLTVVYDSETGKVKRIDTVVLSTQHDPAISHEELSKAVIEQIIKPVLPPELLT
FT                   DETKYLINPTGRFVIGGPQGDCGLTGRKIIVDTYGGAAPHGGGAFSGKDPSKVDRSAAY
FT                   ACRYVAKNIVAAGLATQCQIQVSYAIGVAEPTSISIDTFGTGKISEEKLIALVCEHFDL
FT                   RPKGIVQMLDLLRPIYGKSAAYGHFGREEPEFTWERTDKAASLKAAAGL"
FT   gene            complement(119446..120972)
FT                   /locus_tag="NGK_0151"
FT   CDS_pept        complement(119446..120972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0151"
FT                   /product="Penicillin-binding protein 3"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28849"
FT                   /db_xref="GOA:B4RQ37"
FT                   /db_xref="InterPro:IPR000667"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:B4RQ37"
FT                   /protein_id="ACF28849.1"
FT                   /translation="MVTIIIYVISPANKPVRRPGVPTYPALPYNCFFYVTDSPMNFPKT
FT                   AASLLLLLASLAAHALDTGRIPQNEIAVYVQELDSGKVIIDHRAGIPVNPASTMKLVTA
FT                   FAAFKTFGSNYRWATEFKSNGTVNDGTLDGNLYWAGSGDPVFNQENLLAVQRQLRDKGI
FT                   RNITGRLMLDHSLWGEVGSPDHFEADSGSPFMTPPNPTMLSAGMVMVRAERNAAGSTDI
FT                   LTDPPLPHIFAQNNLKITASQAACPSVKKLMRASFSGNTLKLRGNIPESCLGKPVGVRM
FT                   FALDELIRQSFTNRWLLGGGRISDGIGIADTPEGAQTLAVAHSKPMKEILTDMNKRSDN
FT                   LIARSVFLKLGGDGKLPAVSEQAASAVRRELAVSGIDVADLVLENGSGLSRKERVTARM
FT                   MAQMLETAYFSPFAQDFIDTLPIAGTDGTLRNRFKQSGGLLRLKTGTLNNVRALAGYWL
FT                   GDKPMAVVVIINSGRAVSLLPDLDNFVAKNIISGGDGWLDAKLMCKERRA"
FT   gene            121014..121586
FT                   /locus_tag="NGK_0152"
FT   CDS_pept        121014..121586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0152"
FT                   /product="Oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28850"
FT                   /db_xref="GOA:B4RQ38"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:B4RQ38"
FT                   /protein_id="ACF28850.1"
FT                   /translation="MIVAKKISILVGSLRRASFARKVALNAAEMFPEGWQAEIVEIGHL
FT                   PLYNFDYDDPAVEDVPLPESYTAFRETIKASDGILFVTSENNRTIPACLKNAVDIGSKP
FT                   NADVAWKNKPAGIISHSVGKMGGYSSQKNLRLALSYFDMPVTGQPEVFLGNSPTLFDEN
FT                   GKLIDSARDFVQSYINQFVGLIERNAK"
FT   gene            121567..121764
FT                   /locus_tag="NGK_0153"
FT   CDS_pept        121567..121764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0153"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28851"
FT                   /db_xref="UniProtKB/TrEMBL:B4RQ39"
FT                   /protein_id="ACF28851.1"
FT                   /translation="MKEMPNKQTKSKSRKTGSGFAAFLYGPGSVKVCRLPDNARQMIGV
FT                   FKIPRVRHAPRSAMIGGSFV"
FT   gene            121817..121948
FT                   /locus_tag="NGK_0154"
FT   CDS_pept        121817..121948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0154"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28852"
FT                   /db_xref="UniProtKB/TrEMBL:B4RQ40"
FT                   /protein_id="ACF28852.1"
FT                   /translation="MFRIGCRREMTDGCRNVGRREWNARLIPHMLAVLPARAVLCSK"
FT   gene            121964..123277
FT                   /locus_tag="NGK_0155"
FT   CDS_pept        121964..123277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0155"
FT                   /product="putative magnesium citrate secondary transporter"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28853"
FT                   /db_xref="GOA:B4RQ41"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="InterPro:IPR014738"
FT                   /db_xref="UniProtKB/TrEMBL:B4RQ41"
FT                   /protein_id="ACF28853.1"
FT                   /translation="MLTFIGLLIIGVIVWLLLTEKVSPIIALILVPLIGALLAGFDVSQ
FT                   LKEFYSGGTKSVTQIVIMFMFSILFFGIMNDVGLFRPMIGGLIKLTRGNIVAVSVGTVL
FT                   VSVVAQLDGAGATTFLSVVPALLPLYKRLHMNPYLLFLLLTSSAGLINLLPRGGPIGRV
FT                   ASVLGADVGELYKPLLTVQIIGVVFILVLSLFLGVREKRRIVRELGALPAVADLIKPAP
FT                   LSEEEQKLARPKLFWWNVLLFLAAMSLLFSGIFPPGYVFMLAATAALLLNYRSPQEQME
FT                   RIYAHAGGAVMMASIILAAGTFLGILKGAGMLDAISKDLVHILPDALLPYLHIAIGVLG
FT                   IPLELVLSTDAYYFGLFPIVEQITSQAGVAPEAAGYAMLIGSIVGTFVTPLSPALWMGL
FT                   GLAKLSMGKHIRYSFFWAWGLSLAILISSIAAGIVPLP"
FT   gene            123545..124174
FT                   /locus_tag="NGK_0156"
FT   CDS_pept        123545..124174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0156"
FT                   /product="BasR"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28854"
FT                   /db_xref="GOA:B4RQ42"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B4RQ42"
FT                   /protein_id="ACF28854.1"
FT                   /translation="MSASLKDGGYAVDWVKNGAQVAAAAAAQPYDLMLLDLGLPGRDGL
FT                   DVLSEIRAAGCTVPVLIVTARDDLYSRLNGLDGGADDYIVKPFDMAEFKARMRAVLRRG
FT                   SGQAQACLSNGALSLNPATYQVEIIAEGRQVALSNQEFSVLQALLARPGVILSRSDSED
FT                   KVYGWGGEVESNAVDFLIHGLCKKLGKESIQNVRGVGWLMPRQDAV"
FT   gene            124187..125506
FT                   /locus_tag="NGK_0157"
FT   CDS_pept        124187..125506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0157"
FT                   /product="BasS"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28855"
FT                   /db_xref="GOA:B4RQ43"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B4RQ43"
FT                   /protein_id="ACF28855.1"
FT                   /translation="MPDRFFKILKHSLQVRISLALIWMFVPLAMLAGMFSYYETFHETE
FT                   ALQDDLLRQAALYVGPDSKSETLPEGDGDTRILVQMPQQEDPVVSLPAHLADGLHTLRA
FT                   DGDDDYYRAYIRTTEQGRIAVMQENEYREDLAEDAARQSVLPLLAALPLMILLTVWITH
FT                   KAMRPVRKLSQSLEQRRINGLPALSVYNIPSEIRGFVTAINLLLKRVDEDIRRRQRFVA
FT                   DAAHELRTPMTALSLQAERLNNMPLPPDAGRQSAVLQQSIRRNKHLLEQLLALARSQSD
FT                   ETPLTKTTFGLQSRFRQVLQELMPLVLEKRQDIGVAVGGDVEVSADETEIYTLVKTFAD
FT                   NAVRYTPNGGRIDLGFTDEGKYLAVWVEDNGNGIPESECARVLDPFYRILGTEQQGAGL
FT                   GLSIADTLAKKYGGYLELTDSRRFGHGLLIRALLDKETLK"
FT   gene            complement(125541..127034)
FT                   /locus_tag="NGK_0158"
FT   CDS_pept        complement(125541..127034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0158"
FT                   /product="Cytoplasmic axial filament protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28856"
FT                   /db_xref="GOA:B4RQ44"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004659"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019307"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:B4RQ44"
FT                   /protein_id="ACF28856.1"
FT                   /translation="MLSGLPIPKDIARPPETILVNITPQETRVAVLEENNICELHIERN
FT                   SGHSLVGNIYLGVVRRVLPGMQSAFIDIGLERAAFLHIVDVLEQRRNPEETQRIEHMLF
FT                   EGQSVLVQVIKDPINTKGARLSTQISLAGRFLVHLPQEDHIGVSQRIEDDAERSSLRER
FT                   LDKLLPENACRGYIIRTNAENATDEQLQSDIDYLTKVWEHIQEQAKIRPPETLLYQDLP
FT                   LSLRVLRDMVGCDTQKILVDSTVNHGRMTRFAEQYVHGALGRIELFKGERPLFETHNIE
FT                   QEISRALQPRVNLNFGSYLIIESTEAMTTIDVNTGGFVGARNFDETIFRTNLEACHTIA
FT                   RELRLRNLGGIIIIDFIDMAQESHREAVLQELAKALAFDRTRVTLHGFTSLGLVELTRK
FT                   RSRENLNQVLCEPCPSCQGRGRLKTPQTVCYEIQREIVREARRYDAESFRILAAPNVID
FT                   LFLDEESQSLAMLIDFIGKPISLAVETAYTQEQYDIVLM"
FT   gene            127015..127149
FT                   /locus_tag="NGK_0159"
FT   CDS_pept        127015..127149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0159"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28857"
FT                   /db_xref="UniProtKB/TrEMBL:B4RQ45"
FT                   /protein_id="ACF28857.1"
FT                   /translation="MGSPDNMVFPENVIKIFLHPFRPAAQSGCKNIFHNAYHTLKKKL"
FT   gene            127229..127510
FT                   /locus_tag="NGK_0160"
FT   CDS_pept        127229..127510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0160"
FT                   /product="putative glutaredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28858"
FT                   /db_xref="GOA:B4RQ46"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011767"
FT                   /db_xref="InterPro:IPR011900"
FT                   /db_xref="InterPro:IPR014025"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B4RQ46"
FT                   /protein_id="ACF28858.1"
FT                   /translation="MQNFRKPNMQTVTMYTGPFCPYCAMAKRLLHAAGVGHIDEIRVDA
FT                   SPEAFAEMQRLSGQRSVPQIFIGETHVGGFTDLYRLQQEGGLDGLLNP"
FT   gene            127531..127974
FT                   /locus_tag="NGK_0161"
FT   CDS_pept        127531..127974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0161"
FT                   /product="export protein SecB"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28859"
FT                   /db_xref="GOA:B4RQ47"
FT                   /db_xref="InterPro:IPR003708"
FT                   /db_xref="InterPro:IPR035958"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4RQ47"
FT                   /protein_id="ACF28859.1"
FT                   /translation="MSEELQPVFSIERLYVKDLSLEVPHAPQIFLEQGDPEVDMRVSTG
FT                   SQKLEDGYYDVDVTVTVTAKLDNERTMFLNEVTQSGIFRLENIPEEDVQLLLGVACPNI
FT                   LFPYAREAVSGTVTRAGFPPVLLAPINFEAIYQQQQEAEAAGA"
FT   gene            128060..130102
FT                   /locus_tag="NGK_0162"
FT   CDS_pept        128060..130102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0162"
FT                   /product="RecG"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28860"
FT                   /db_xref="GOA:B4RQ48"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR004609"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033454"
FT                   /db_xref="UniProtKB/TrEMBL:B4RQ48"
FT                   /protein_id="ACF28860.1"
FT                   /translation="MMSPETQKQLKITDVSAKKLDKLNLHTAWDLVLHLPLRYEDETHI
FT                   MPIKDAPIGVPCQVEGEVIHQEVTFKPRKQLIVQIADGSGSVLFLRFIHFYASHQKQTA
FT                   VGKRIRAVGEIKHGFYGDEMIHPKIRDAEGGGLAESLTPVYPTVNGLNQPTLRRIIQTA
FT                   LDVTPLHDTLPDALLGRLKLPRLAESLRLLHSPPPSFTIHQLSDGTLPAWQRLKFDELL
FT                   AQQLSMRLARQKRVSGTAAALRGDGTLTQALRQALPFALTDAQEKVVSEICRDMAQTHP
FT                   MHRLLQGDVGSGKTIVAALSALTAIESGAQVAVMAPTEILAEQHFIKFKQWLEPLGIEV
FT                   VCLFGSLRKKAKDEAKAKLADGSVKIAVGTHALFSDGVAFHNLGLSIVDEQHRFGVAQR
FT                   LALKNKGREVHQLMMSATPIPRTLAMSFFADLDVSVIDELPPGRTPIKTRLVNNVRRAE
FT                   VEGFVLGTCRKGRQAYWVCPLIEESETLQLQTAAETLARLQTALPEPNIGLVHGRMKAA
FT                   EKAEVMAEFAAGRLNVLVATTVIEVGVDVPNAALMVIEHAERMGLAQLHQLRGRVGRGA
FT                   GESVCVLLFAEPLGELAKARLKVIYEHTDGFEIARQDLNIRGPGEFLGARQSGVPMLRF
FT                   AKLEEDLHLLEQARETAPMLIEQNPEIVEAHLARWLSGREGYLGV"
FT   gene            complement(130442..130627)
FT                   /locus_tag="NGK_0163"
FT   CDS_pept        complement(130442..130627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0163"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28861"
FT                   /db_xref="UniProtKB/TrEMBL:B4RQ49"
FT                   /protein_id="ACF28861.1"
FT                   /translation="MGSDGFWLIIPRKQKSKIPSFPQKRESSLSGFSNFRHISTRFDSV
FT                   ISPVSIVSDNTVVFHF"
FT   gene            complement(130696..131739)
FT                   /locus_tag="NGK_0164"
FT   CDS_pept        complement(130696..131739)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0164"
FT                   /product="N-acetyl-gamma-glutamyl-phosphate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28862"
FT                   /db_xref="GOA:B4RQ50"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR000706"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR023013"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4RQ50"
FT                   /protein_id="ACF28862.1"
FT                   /translation="MSKKIKAGIVGATGYTGVELLRLLAAHPDVEVAAVTSRSEAGTAV
FT                   ADYFPSLRGVYGLAFQTPDEAGLEQCDIVFFATPNGIAMKDAPRLIEQGVRVIDLSADF
FT                   RIRDIPTWEHWYGMTHAAPGLVSQAVYGLSELNREAVAQARLVANPGCYPTCVSLPLVP
FT                   LLRQCRLKPGMPLIADCKSGVSGAGRKGNVGSLLCEAGDNFKAYGTAGHRHLPEIRQTI
FT                   AGLQDGIAEGFVFTPHLAPMIRGMHATVYLHLSDGSDPETVLRDYYRDSPFMDILPAGS
FT                   TPETRSVRGANLCRISIRQAAQSDVWVVLSVIDNLVKGAAGQAVQNMNIMFGLEETHGL
FT                   GGIPLLP"
FT   gene            complement(131736..132017)
FT                   /locus_tag="NGK_0165"
FT   CDS_pept        complement(131736..132017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0165"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28863"
FT                   /db_xref="UniProtKB/TrEMBL:B4RQ51"
FT                   /protein_id="ACF28863.1"
FT                   /translation="MKTLVLLLLSFSTTTAFAAYGLGLGQAPKYPAGFRAYGYVYSGRQ
FT                   GWVLKTEADAIKLDTLFKRFVYRPSAANQNPVGQRSDGIPANHTKEKP"
FT   gene            132041..132169
FT                   /locus_tag="NGK_0166"
FT   CDS_pept        132041..132169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0166"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28864"
FT                   /db_xref="UniProtKB/TrEMBL:B4RQ52"
FT                   /protein_id="ACF28864.1"
FT                   /translation="MKPDYSKRSSENRFQTTFYLITIKMLTTKNKPLFSVWRQIFN"
FT   gene            132269..133423
FT                   /locus_tag="NGK_0167"
FT   CDS_pept        132269..133423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0167"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28865"
FT                   /db_xref="InterPro:IPR003347"
FT                   /db_xref="InterPro:IPR039994"
FT                   /db_xref="UniProtKB/TrEMBL:B4RQ53"
FT                   /protein_id="ACF28865.1"
FT                   /translation="MGIHLDFGISPKTFRQTYLYQKPKLFKGAVRNLEAASCKYINEIY
FT                   QRADPTAPLFHLRKKGAIVPKEEYVESFDDLGKTRYRFIKSVIYEHMKNGASLVYNHIN
FT                   NEPFSDHIARQVARFAGAHTIVSGYLAFGSDESYKNHWDARDMYAVQLFGKKRWQLTAP
FT                   DFPMPLYMQQTKDTDISIPEHIDMDIILEAGDVLYIPRGWWHRPIPLGCETFHFAVGTF
FT                   PPNGYNYLEWLMKKFPTIESLRHSFSDWEQDRTRINDTAAQIAAMIADPVNYEAFSEDF
FT                   LGKERTDTAFHLEQFANPNATPLSDDVRLRLNANNLDTLEKGYLIGNGMKISVDELGKK
FT                   VLEHIGKNEPLLLKNLLVNFNQGKYEEVRKLIYQLIELDFLEIL"
FT   gene            134327..135340
FT                   /locus_tag="NGK_0168"
FT   CDS_pept        134327..135340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0168"
FT                   /product="putative secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28866"
FT                   /db_xref="UniProtKB/TrEMBL:B4RQ54"
FT                   /protein_id="ACF28866.1"
FT                   /translation="MEDGEKVKAGDKLFALSTSRFGAGGSVQQQLKTEAVLKKTLAEQE
FT                   LGRLKLIHENETRSLKATVERLENQKLHISQQIDGQKRRIRLAEEMLRKYRFLSANDAV
FT                   SKQETMNVEAELLEQKAKLDAYRREEAGLLQEIRTQNLTLASLPKRHETEQSQLERTIA
FT                   DISQEVLDFEMRSEQIIRAGRSGYIAIPNVEVGRQVDPSKLLLSIVPERTELYAHLYIP
FT                   SSAAGFIKPKDKVVLRYQAYPYQKFGLASGSVVSVAKTALGRQELSGLGMVSSDLAKSN
FT                   EPVYLVKIKPDKPTITAYGEEKPLQIGMTLEADILHEKRRLYEWVLEPIYSMSGRL"
FT   gene            135669..135872
FT                   /locus_tag="NGK_0169"
FT   CDS_pept        135669..135872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0169"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28867"
FT                   /db_xref="UniProtKB/TrEMBL:B4RQ55"
FT                   /protein_id="ACF28867.1"
FT                   /translation="MAGGALVTGGNPAGIAIGGAGGGWVGAEGGSALGGHIGGFAGAKW
FT                   GKMIDRRNCQCGEDCHCDPCNC"
FT   gene            135886..136101
FT                   /locus_tag="NGK_0170"
FT   CDS_pept        135886..136101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0170"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28868"
FT                   /db_xref="GOA:B4RQ56"
FT                   /db_xref="UniProtKB/TrEMBL:B4RQ56"
FT                   /protein_id="ACF28868.1"
FT                   /translation="MDFAHYLKHWKAAVLIYLAISILTDILCYFLNFDGVFYKGRFFSV
FT                   TVAGPVGALSFLAYLLYLKREENRSH"
FT   gene            136203..137924
FT                   /locus_tag="NGK_0171"
FT   CDS_pept        136203..137924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0171"
FT                   /product="putative protein export protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28869"
FT                   /db_xref="GOA:B4RQ57"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR005074"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033838"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:B4RQ57"
FT                   /protein_id="ACF28869.1"
FT                   /translation="MDYLQNLSLGLTKKLPVILQTEVAECGLACLAAVAGFYGFYTDLR
FT                   ALRSKYCLSLKGENLADIVRFADDMGLTGRALRLDLDELGSLRLPCILHWDLNHFVVLE
FT                   SVSSDGAAVMDPASGRRKVKTEEISRKFTGIALELWPNTRFEAGEEKQEIRILPMLRGI
FT                   SGLGRTLFQLLALAAAMEVFALVSPFFMQWVIDHVVVTGDRNLLATLALGFTLLLLVQN
FT                   TVSVMQGWLGMHFSTTLNVQWKSNVFKRLIDLPTDYFAKRHLGDVVSRFGAVDSIQGTL
FT                   TSTFFVLVLNSLTAVFTFVLMIVYSPILTGLVAATLVVYIAVRWVAYYPLRRATEENII
FT                   HAAKQSSYFMETVRGIRAVKQFGKGPQRYSAWMGLLVDTVNTGLTVQKLGIWFGLANKL
FT                   LFGLANILIIYLAAGMVLDGVFTVGVLMAFLAYKGQFEGRIGSLVDQFVQIKMLSLHAE
FT                   RLADTVLNETESEATPDVGIPDISDDIEISVENVSFRYADNEPYVLQNVSFKIGRGESL
FT                   ALIGRSGCGKSTFLDILSGNLPPESGKVMINGHDIYSLPPRFIRNLSAMVRQDDVL"
FT   gene            138117..138398
FT                   /locus_tag="NGK_0172"
FT   CDS_pept        138117..138398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0172"
FT                   /product="putative ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28870"
FT                   /db_xref="GOA:B4RQ58"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:B4RQ58"
FT                   /protein_id="ACF28870.1"
FT                   /translation="MIREEISAMPMGYETLIGDMGSALSGGQKQRIVLARALYCEPKIL
FT                   FLDEAASHLDIANEKAVNANLNGLSIIKIMAAHRKETVESADRKMSLG"
FT   gene            complement(138419..139645)
FT                   /locus_tag="NGK_0173"
FT   CDS_pept        complement(138419..139645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0173"
FT                   /product="ribonuclease BN/unknown domain fusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28871"
FT                   /db_xref="GOA:B4RQ59"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="InterPro:IPR023679"
FT                   /db_xref="UniProtKB/TrEMBL:B4RQ59"
FT                   /protein_id="ACF28871.1"
FT                   /translation="MTFLQRWQGLADNKICAFAWFVIRRFSEERVPQAAASMTFTTLLA
FT                   LVPVLTVMVAVASIFPVFDRWSDSFVSFVNQTIVPQGADMVFDYIDAFRDQANRLTAIG
FT                   SVMLVVTSLMLIRTIDNAFNRIWRVNTQRPWMMQFLVYWALLTFGPLSLGVGISFMVGS
FT                   VQDSVLSSGAQQWADALKTAARLAFMTLLLWGLYRFVPNRFVPARQAFVGALITAFCLE
FT                   TARFLFTWYMGNFDGYRSIYGAFAAVPFFLLWLNLLWTLVLGGAVLTSSLSYWQGEAFR
FT                   RGFDSRGRFDDVLKILLLLDAAQKEGRTLSVQEFRRHINMGYDELGELLEKLARYGYIY
FT                   SGRQGWVLKTGADSIELSELFKLFVYRPLPVERDHVNQAVDAVMTPCLQTLNMTLAEFD
FT                   AQAKKQQQS"
FT   gene            139744..139908
FT                   /locus_tag="NGK_0174"
FT   CDS_pept        139744..139908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0174"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28872"
FT                   /db_xref="GOA:B4RQ60"
FT                   /db_xref="InterPro:IPR001226"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:B4RQ60"
FT                   /protein_id="ACF28872.1"
FT                   /translation="MNPNPLKILVLYYSQNGSTRNPARRITRGIDSVEGCEAVLRTVPK
FT                   VSAVCEAVK"
FT   gene            140134..140793
FT                   /locus_tag="NGK_0175"
FT   CDS_pept        140134..140793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0175"
FT                   /product="YbaX"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28873"
FT                   /db_xref="GOA:B4RQ61"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018317"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4RQ61"
FT                   /protein_id="ACF28873.1"
FT                   /translation="MSNQKALVIFSGGQDSTTCLIQAIQTYGRENVQAITFRYGQRHAV
FT                   ELERAEWIAQDLGVSQTVLDLSLMRQITHNALMDETAAIETADNGVPNTFVDGRNALFL
FT                   LYAAIFAKGQGIRHIIAGVCETDFSGYPDCRGVFVKSMNVTLNLAMDYDFQIHTPLMYL
FT                   TKAQTWALADEMGVLDYIREQTHTCYKGIVGGCRECPSCILRERGLAECLESKKAV"
FT   gene            140821..141336
FT                   /locus_tag="NGK_0176"
FT   CDS_pept        140821..141336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0176"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28874"
FT                   /db_xref="InterPro:IPR011440"
FT                   /db_xref="UniProtKB/TrEMBL:B4RQ62"
FT                   /protein_id="ACF28874.1"
FT                   /translation="MPKLHMFYLGGNAGRSNIEVHDIQFAVCDDYREAVPALKAAWFGD
FT                   TDKIHIDGWQVVEWADGYDIAVSETPKTKMPPENAPRLYFANVGGYRAGQLAEAHAFGL
FT                   FAAATPAEAKQKALQTLLTDYVRQHKDNLKDVDNLLALEHIGNFHIRLTPNPHGKPAEI
FT                   GFQGYLPI"
FT   gene            141424..141858
FT                   /locus_tag="NGK_0177"
FT   CDS_pept        141424..141858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0177"
FT                   /product="putative 6-pyruvoyl-tetrahydropterin synthase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28875"
FT                   /db_xref="GOA:B4RQ63"
FT                   /db_xref="InterPro:IPR007115"
FT                   /db_xref="InterPro:IPR038418"
FT                   /db_xref="UniProtKB/TrEMBL:B4RQ63"
FT                   /protein_id="ACF28875.1"
FT                   /translation="MKITKIFTFDSSHMLDGHDGKCQNLHGHTYKLEITVSDGTIKGGA
FT                   KDGMVMDFTDLKAIVKQHITDHFDHAFIYHGGNGRESQIAALLEGWNMKTLRLPCRTTA
FT                   ENMAVEMYCRLKNAGLNVCRVKLWETPTSCAEYEGGEGIF"
FT   gene            142129..142497
FT                   /locus_tag="NGK_0178"
FT   CDS_pept        142129..142497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0178"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28876"
FT                   /db_xref="GOA:B4RQ64"
FT                   /db_xref="InterPro:IPR009732"
FT                   /db_xref="UniProtKB/TrEMBL:B4RQ64"
FT                   /protein_id="ACF28876.1"
FT                   /translation="MKLLSTILVLLVAAEHFYIAWLEMTQIPGEKAAEMFKLPYEFMEQ
FT                   KRVQTLFGNQGLYNGFLAVGLLWAQFAAPDNAVYGATVLFLGFVLIAAAWGAFSSGNKG
FT                   ILVKQGLPAFLAAAVLAV"
FT   gene            142494..143132
FT                   /locus_tag="NGK_0179"
FT   CDS_pept        142494..143132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0179"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28877"
FT                   /db_xref="GOA:B4RQ65"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024924"
FT                   /db_xref="UniProtKB/TrEMBL:B4RQ65"
FT                   /protein_id="ACF28877.1"
FT                   /translation="MKKISVAPENPQYRIVEIFESLQGEGRNTGMPAVFVRLGKCNLAC
FT                   GWCDTDYLTFGMMSLSDILGCLKTYAARNIIITGGEPTIQPHLDMLLDTLKAEGYFLCL
FT                   ETNGLKPAPPQIDYVATSPKACYAAKYETNCIAEADEVRIVADGDVLAFCENMERKIRA
FT                   RHYYLSPCEQNGVMNIYDTIRQIGILNSRPDAPVHWQLSVQTHKWAGIE"
FT   gene            complement(143468..143544)
FT                   /locus_tag="NGK_trnaPro1"
FT   tRNA            complement(143468..143544)
FT                   /locus_tag="NGK_trnaPro1"
FT                   /product="tRNA-Pro"
FT   gene            143558..143677
FT                   /locus_tag="NGK_0180"
FT   CDS_pept        143558..143677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0180"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28878"
FT                   /db_xref="UniProtKB/TrEMBL:B4RQ66"
FT                   /protein_id="ACF28878.1"
FT                   /translation="MIIAQKIRRAYTVLPFCRVSGGFKGLCLNTVLISILISK"
FT   gene            complement(143769..144854)
FT                   /locus_tag="NGK_0181"
FT   CDS_pept        complement(143769..144854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0181"
FT                   /product="beta-hexosaminidase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28879"
FT                   /db_xref="GOA:B4RQ67"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR019800"
FT                   /db_xref="InterPro:IPR022956"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4RQ67"
FT                   /protein_id="ACF28879.1"
FT                   /translation="MTVPHIPRGPVMADIAAFRLTEEEKQRLLDPAIGGIILFRRNFQN
FT                   IEQLKTLTAEIKALRTPELIIAVDHEGGRVQRFIEGFTRLPAMSTLGEIWDSEGAETAE
FT                   THAEHIGWVLATELSACGIDLSFTPVLDLDWGNCAVIGNRSFHRNPEAVARLALALQKG
FT                   LAKGGMKSCGKHFPGHGFVEGDSHLVLPEDGRSLDELEAADLAPFRIMSREGMAAVMPA
FT                   HVVYPQVDTKPAGFSEIWLKQILRRDIGFKGVIFSDDLTMEGACGAGGIKERARISFEA
FT                   GCDIILVCNRPDLVDELRDGFTIPDNQDLAGRWQYMENSLGHEAVQAVIQTTGFQAAQA
FT                   FVAGLASPQDTAGGVKVGEAF"
FT   gene            complement(144911..146380)
FT                   /locus_tag="NGK_0182"
FT   CDS_pept        complement(144911..146380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0182"
FT                   /product="Integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28880"
FT                   /db_xref="GOA:B4RQ68"
FT                   /db_xref="InterPro:IPR018461"
FT                   /db_xref="UniProtKB/TrEMBL:B4RQ68"
FT                   /protein_id="ACF28880.1"
FT                   /translation="MALALAVITRRVLLSLGIGILVGVAFLVGGNPVDGLTHLKDMVVG
FT                   LAWADGDWSLGKPKILVFLILLGIFTSLLTYSGSNQAFADWAKRHIKNRRGAKMLTACL
FT                   VFVTFIDDYFHSLAVGAIARPVTDKFKVSRAKLAYILDSTASPMCVLMPVSSWGASIIA
FT                   TLAGLLVTYKITEYTPMGTFVAMSLMNYYALFALIMVFVVAWFSFDIGSMARFEQAALN
FT                   EAHDETAASDATKGRVYALIIPVLALIASTVSAMIYTGAQASETFSILGAFENTDVNTS
FT                   LVFGGTCGVLAVVLCTFGTIKTADYPKAVWQGAKSMFGAIAILILAWLISTVVGEMHTG
FT                   DYLSTLVAGNIHPGFLPVILFLLASVMAFATGTSWGTFGIMLPIAAAMAVKVEPALIIP
FT                   CMSAVMAGAVCGDHCSPISDTTILSSTGARCNHIDHVTSQLPYALTVAAAAASGYLALG
FT                   LTKSALLGFSTTGIVLAVLIFLLKDKKRADV"
FT   gene            146459..146608
FT                   /locus_tag="NGK_0183"
FT   CDS_pept        146459..146608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0183"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28881"
FT                   /db_xref="UniProtKB/TrEMBL:B4RQ69"
FT                   /protein_id="ACF28881.1"
FT                   /translation="MGGYLSASGLGFVGKMGGNIFCRKKYLFKINQLIFVKCPLIGIDG
FT                   HFII"
FT   gene            complement(146634..148133)
FT                   /locus_tag="NGK_0184"
FT   CDS_pept        complement(146634..148133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0184"
FT                   /product="putative serine protease"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28882"
FT                   /db_xref="GOA:B4RQ70"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR011782"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:B4RQ70"
FT                   /protein_id="ACF28882.1"
FT                   /translation="MFKKYQYFALAALCAALLAGCEKAGSFFGADKKEASFVERIEHTK
FT                   DDGSVSMLLPDFAQLVQSEGPAVVNIQAAPAPRTQNGSGNAETDSDPLADSDPFYEFFK
FT                   RLVPNMPEIPQEEADDGGLNFGSGFIISKNGYILTNTHVVAGMGSIKVLLNDKREYTAK
FT                   LIGSDVQSDVALLKIDATEELPVVKIGNPKNLKPGEWVAAIGAPFGFDNSVTAGIVSAK
FT                   GRSLPNESYTPFIQTDVAINPGNSGGPLFNLKGQVVGINSQIYSRSGGFMGISFAIPID
FT                   VAMNVAEQLKNTGKVQRGQLGVIIQEVSYGLAQSFGLDKASGALIAKILPGSPAERAGL
FT                   QAGDIVLSLDGGEIRSSGDLPVMVGAITPGKEVSLGVWRKGEEITIKAKLGNAAEHTGA
FT                   SSKTDEAPYTEQQSGTFSVESAGITLQTHTDSSGKHLVVVRVSDAAERAGLRRGDEILA
FT                   VGQVPVNDEAGFRKAMDKAGKNVPLLVMRRGNTLFIALNLQ"
FT   gene            complement(148271..148933)
FT                   /locus_tag="NGK_0185"
FT   CDS_pept        complement(148271..148933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0185"
FT                   /product="putative endonuclease III"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28883"
FT                   /db_xref="GOA:B4RQ71"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR005759"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:B4RQ71"
FT                   /protein_id="ACF28883.1"
FT                   /translation="MPTAQTDCTKKMNRQIRQEIFERFRAANPHPTTELNFNSPFELLI
FT                   AVLLSAQATDVGVNKATAKLFPVADTPQAMLDLGLDGVMEYTKTIGLYKTKSKHIMQTC
FT                   RILLEKYNGEVPEDREALESLPGVGRKTANVVLNTAFGHPVMAVDTHIFRVSNRTKIAP
FT                   GKDVREVEDKLMRFIPKEFLMDAHHWLILHGRYTCKALKPQCQTCIINDLCEYPAKS"
FT   gene            complement(148947..149483)
FT                   /locus_tag="NGK_0186"
FT   CDS_pept        complement(148947..149483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0186"
FT                   /product="Membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28884"
FT                   /db_xref="GOA:B4RQ72"
FT                   /db_xref="UniProtKB/TrEMBL:B4RQ72"
FT                   /protein_id="ACF28884.1"
FT                   /translation="MPDKKGAYGCAVFLHRPPPFGGGVKIPYNPSPIFTCLGLFAMIPS
FT                   YTYAALAFSAFTSATLLPGTSEAAFALFVRNFPKHAYGALLCAGLANGLGSMVSYWMGR
FT                   LLPSRKMPSEKTLNLIRRFGIWLLAFAWLPVVGDALPLTAGWLRLNPWTSGLMLVIGKT
FT                   ARYAFILWGMQYYAA"
FT   gene            149510..149656
FT                   /locus_tag="NGK_0187"
FT   CDS_pept        149510..149656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0187"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28885"
FT                   /db_xref="UniProtKB/TrEMBL:B4RQ73"
FT                   /protein_id="ACF28885.1"
FT                   /translation="MPRCGISEFSGYGGGFSFYWERFLQARRNFLKSIKTYANNCKILI
FT                   SAA"
FT   gene            149739..151019
FT                   /locus_tag="NGK_0188"
FT   CDS_pept        149739..151019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0188"
FT                   /product="putative sugar transporter"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28886"
FT                   /db_xref="GOA:B4RQ74"
FT                   /db_xref="InterPro:IPR005964"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B4RQ74"
FT                   /protein_id="ACF28886.1"
FT                   /translation="MSISIFLKRAIFRHHERQIMSAQSQNNHTSPLVVLTTLFFMMGFI
FT                   TCMNDILIPHLKEIFDLSYVQAMLIQFCFFTAYAVMSIPMGAFVGKVGYKNGVIGGFLL
FT                   TAVGCLLFYPAAGSHSYAVFLGALFILASGVTLLQVAGNPYVTLLAKPGKESATLTLVQ
FT                   AFNALGTTIAPQIGAFLILADATQTVSKAEQISSVQIPYLGLAGLLIILAVFVKMIRLP
FT                   DARKIAAEESAHNHDGKTGVWQYKHLVFGTAGIFCYVGAEVSIGSLMVNVLGYLKGLDH
FT                   ASAAHYLSFYWGGAMVGRFLGSAVMAKFAPNRYLAFNASAAVVLLAVAMATGSGNADVA
FT                   MWSLLAIGFFNSIMFPTIFSLATKGLGKFTNAASGVLCTAIVGGAVVPVIQGWAADTYT
FT                   LMSSFVVSVICYLYIVFFAVYGYRADK"
FT   gene            151035..151151
FT                   /locus_tag="NGK_0189"
FT   CDS_pept        151035..151151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0189"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28887"
FT                   /db_xref="UniProtKB/TrEMBL:B4RQ75"
FT                   /protein_id="ACF28887.1"
FT                   /translation="MPSEHLSDGIFAYRCLRRVCRGFNTSIHKSLICQQIKK"
FT   gene            151309..152688
FT                   /locus_tag="NGK_0190"
FT   CDS_pept        151309..152688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0190"
FT                   /product="NhaC"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28888"
FT                   /db_xref="GOA:B4RQ76"
FT                   /db_xref="InterPro:IPR004770"
FT                   /db_xref="InterPro:IPR018461"
FT                   /db_xref="UniProtKB/TrEMBL:B4RQ76"
FT                   /protein_id="ACF28888.1"
FT                   /translation="MFAFKSLLDMPRGEALAVVVALIAAMGYTIISLEWLPHMSIIAAI
FT                   VVLILYGLARGLKYNDMQAGMIGALNQGMGAVYLFFFIGLMVSALMMSGAIPTLMYYGF
FT                   GLISPTYFYFSAFALCSVIGVSIGSSLTACATVGVAFMGMAAAFQADMAMTAGAIVSGV
FT                   FFGDKMSPLSDTTGISASIVGIDLFEHIKNMMYTTIPAWLISAALMLWLLPSVAAQDLN
FT                   SVESFRSQLEATGLVHGYSLIPFALLVVLALMRVNAVVAMLFTVIAAVAVTYLHSTPDL
FT                   RQLGAWFYGGYKLEGEAFKDIAKLISRGGLESMFFTQTIVILGMSLGGLLFALGVIPSL
FT                   LEAVRTFLTNAGRATFSVAMTSVGVNFLIGEQYLSILLSGETFKPVYDKLGLHSRNLSR
FT                   TLEDAGTVINPLVPWSVCGVFISHALGVPVWEYLPYAFFCYLSLALTLLFGWTGLTLSK
FT                   K"
FT   gene            complement(152831..153655)
FT                   /locus_tag="NGK_0191"
FT   CDS_pept        complement(152831..153655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0191"
FT                   /product="Magnesium and cobalt transporter"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28889"
FT                   /db_xref="GOA:B4RQ77"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:B4RQ77"
FT                   /protein_id="ACF28889.1"
FT                   /translation="MDGAQPKTNFFERLIARLAREPDSAEDVLNLLRQAHEQEVFDADT
FT                   LTRLEKVLDFAELEVRDAMITRSRMNVLKENDSIERITAYVIDTAHSRFPVIGEDKDEV
FT                   LGILHAKDLLKYMFNPEQFHLKSVLRPAVFVPEGKSLTALLKEFREQRNHMAIVIDEYG
FT                   GTSGLVTFEDIIEQIVGDIEDEFDEDESADNIHSVSAERWRIHAATEIEDINAFFGTEY
FT                   GSEEADTIGGLVIQELGHLPVRGEKVLIGGLQFTVARADNRRLHTLMATRVK"
FT   gene            complement(153657..154292)
FT                   /locus_tag="NGK_0192"
FT   CDS_pept        complement(153657..154292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0192"
FT                   /product="Putative metalloprotease NGO0145"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28890"
FT                   /db_xref="GOA:B4RQ78"
FT                   /db_xref="InterPro:IPR002036"
FT                   /db_xref="InterPro:IPR020549"
FT                   /db_xref="InterPro:IPR023091"
FT                   /db_xref="UniProtKB/TrEMBL:B4RQ78"
FT                   /protein_id="ACF28890.1"
FT                   /translation="MFNAFKEWKRRGVYHILNVSSDGTVRSMLYLRPQNTKPATMKRAK
FT                   KYPFLTLQRQRFHLNFENVSSAAGIPAERDFYRWAWSALKNEYLRADIGLILLDEEEAR
FT                   AYNRDYRGKDYATNVLSFALNEGEILPCQVSERLYGDLIICPQVVLKEAAEQGKTPERH
FT                   FAHLTIHGTLHLMGYDHIKDDEAEIMEAEEIRLMRAAGYPNPYREDGH"
FT   gene            154291..155226
FT                   /locus_tag="NGK_0193"
FT   CDS_pept        154291..155226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0193"
FT                   /product="porphobilinogen deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28891"
FT                   /db_xref="GOA:B4RQ79"
FT                   /db_xref="InterPro:IPR000860"
FT                   /db_xref="InterPro:IPR022417"
FT                   /db_xref="InterPro:IPR022418"
FT                   /db_xref="InterPro:IPR022419"
FT                   /db_xref="InterPro:IPR036803"
FT                   /db_xref="UniProtKB/TrEMBL:B4RQ79"
FT                   /protein_id="ACF28891.1"
FT                   /translation="MNPKKLVIASRESLLAMWQAKHIQGRLKALYPDCEVEILGMTTRG
FT                   DRILDRTLSKVGGKGLFVKELEQSLQDGRADLAVHSIKDVPMDLPEGFALAAISERANP
FT                   FDAFVSNRYARLEEMPEGAVVGTSSLRREAQLRARYPHLLIKPLRGNVQTRLSKLDNGE
FT                   YDAIILAAAGLQRLELDERIRMILSESDSLPAAGQGALGIEIATHREDLYEVLKPLNHD
FT                   TTHACVTAERALARALGGSCQVPLAAYCTEENGLLILRGLVGHPDGSIVLQADAQAPAG
FT                   YADALGRAVAKKLADDGAQELIGAVLNTEN"
FT   gene            155262..155459
FT                   /locus_tag="NGK_0194"
FT   CDS_pept        155262..155459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0194"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28892"
FT                   /db_xref="UniProtKB/TrEMBL:B4RQ80"
FT                   /protein_id="ACF28892.1"
FT                   /translation="MFLINLFNKFYLPYFVIPAQAGIQFARFQLFLINSCSIGFPDSRL
FT                   RGNDGGKVFVASDNTVAFKF"
FT   gene            complement(155512..155823)
FT                   /locus_tag="NGK_0195"
FT   CDS_pept        complement(155512..155823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0195"
FT                   /product="IS1016 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ACF31267"
FT                   /db_xref="UniProtKB/TrEMBL:B4RQ81"
FT                   /protein_id="ACF31267.1"
FT                   /translation="MPPAVKKKIMPDGIVYADSPGSRGKSDAGGFIRCRINRSKEFADR
FT                   RNHINGIGNFWNQAKRALRKYNGIDRKPFPPLLRECEFRLNFGTPSRQLKILRDRCGI"
FT   gene            156237..156356
FT                   /locus_tag="NGK_0196"
FT   CDS_pept        156237..156356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0196"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ACF31268"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJT0"
FT                   /protein_id="ACF31268.1"
FT                   /translation="MLIRYITDNAKTPAKPQQRLTCQETRFTCGFALKNKQAA"
FT   gene            156378..157058
FT                   /locus_tag="NGK_0197"
FT   CDS_pept        156378..157058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0197"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28893"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJS9"
FT                   /protein_id="ACF28893.1"
FT                   /translation="MPPNRIGKNRLDMSGGIRMPVCMKSPNILIVRQPPFAMRPNRCGW
FT                   RAKKTAAYKGQDPAKVTHYLTRPAGFSDCQRVCPDETGFDRRLFRPYARSLKGQMAKAR
FT                   ISGKRYRRLSLVSAQVGNRPIAPMVCQNTVAGVFFEARFQQCLLPALAQKSVIISDNAR
FT                   FRRMGALRGTAEKLGHKVLPPAPYSPEPNPIEKVWANIKRYLRTVLSDYARFDDALLSY
FT                   FDFN"
FT   gene            complement(157136..157732)
FT                   /locus_tag="NGK_0198"
FT   CDS_pept        complement(157136..157732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0198"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28894"
FT                   /db_xref="InterPro:IPR006905"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B4RQ84"
FT                   /protein_id="ACF28894.1"
FT                   /translation="MWIWLIPFGDNRCSVGVVGTPDKLAGESETVLKKFVYECPMLSEI
FT                   LDKAVWENDFPFRSIQGYSANVKSLHGRHFALLGNAAEFLDPVFSSGVTIALHSAELAA
FT                   DLLTKQLKSEAADWQTEFAEPLMIGVDAFRTYVDGWYDFRFQNVVYAPDRSPEISRMLS
FT                   SILAGYAWDTENPFVAKSEQRLTALSEWVGQLESE"
FT   gene            157749..157862
FT                   /locus_tag="NGK_0199"
FT   CDS_pept        157749..157862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0199"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28895"
FT                   /db_xref="UniProtKB/TrEMBL:B4RQ85"
FT                   /protein_id="ACF28895.1"
FT                   /translation="MGGNQDFVAVEFRVGNVVVDVREMRLARRQVRGRFQV"
FT   gene            complement(158159..158374)
FT                   /locus_tag="NGK_0200"
FT   CDS_pept        complement(158159..158374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0200"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28896"
FT                   /db_xref="GOA:B4RQ86"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B4RQ86"
FT                   /protein_id="ACF28896.1"
FT                   /translation="MSTQFDVAVIGAGPAGSAASALLRKKGYQVCVLENSTFRASSSAK
FT                   ACCRTVWKCWKKPVLPMPFAPGPAFS"
FT   gene            complement(158554..159927)
FT                   /locus_tag="NGK_0201"
FT   CDS_pept        complement(158554..159927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0201"
FT                   /product="putative ATP-dependent RNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28897"
FT                   /db_xref="GOA:B4RQ87"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B4RQ87"
FT                   /protein_id="ACF28897.1"
FT                   /translation="MSNPFSSLGLGTELVSALTAQGYENPTPIQAAAIPKALAGHDLLA
FT                   AAQTGTGKTAAFMLPSLERLKRYATASTSPAMHPVRMLVLTPTRELADQIDQNVQGYIK
FT                   NLPLRHTVLFGGVNMDKQTADLRAGCEIVVATVGRLLDHVKQKNISLNKAEIVVLDEAD
FT                   RMLDMGFIDDIRKIMQMLPRQRQTLLFSATFSAPIRKLAQDFMNAPETVEVAAQNTTNA
FT                   NVEQHIIAVDTFQKRNLLERLIVDLHMNQVIVFCKTKQSVDRVTRELVRRNLSAQAIHG
FT                   DRSQQSRLETLNAFKDGSLRVLVATDIAARGLDIAELPFVINYEMPAQPEDYIHRIGRT
FT                   GRAGADGVAISLMDESEQKMFEAIKELTGNKLLIERIEGFEPRWWEQEGSKPEKTETSE
FT                   PRQRNRYESARAQREKNTRPETTANDAGAACGKIAGRSRRSRRGHRTCALLQPRYGVK"
FT   gene            complement(159951..160139)
FT                   /locus_tag="NGK_0202"
FT   CDS_pept        complement(159951..160139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0202"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28898"
FT                   /db_xref="UniProtKB/TrEMBL:B4RQ88"
FT                   /protein_id="ACF28898.1"
FT                   /translation="MGPRFKKVRHCTFFKQDFQSADAPAIGAGTVLWHNPHTNSRPRRS
FT                   QAGSLFPRPIGFPLQTA"
FT   gene            160141..161145
FT                   /locus_tag="NGK_0203"
FT   CDS_pept        160141..161145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0203"
FT                   /product="tRNA-dihydrouridine synthase B"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28899"
FT                   /db_xref="GOA:B4RQ89"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR024036"
FT                   /db_xref="InterPro:IPR032887"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:B4RQ89"
FT                   /protein_id="ACF28899.1"
FT                   /translation="MHIGGYFIDNPIALAPMAGITDKPFRRLCRAFGAGWAVCEMLASD
FT                   PTLRNTGKTLHRSDFADEGGIVAVQIAGSDPEQMADAARYNVGLGAQVIDINMGCPAKK
FT                   VCNVQAGSALMQDEPLVAAILEAVVKAAGVPVTLKTRLGWHDDHQNLPAIAKIAEDCGI
FT                   AALAVHGRARTQMYKGEARYELIAETKSRLNIPVWVNGDITSPQKAAAVLKQTAADGIM
FT                   IGRGAQGRPWFFRDLKHYAEHGVLPPALSLAECRAAILNHIRAMHAFYGETVGVRIARK
FT                   HIGWYIGEMPDGEQARREINRLDNAAAQYDTLAGYLERLAGKTDRWACGYREG"
FT   gene            161244..161573
FT                   /locus_tag="NGK_0204"
FT   CDS_pept        161244..161573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0204"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28900"
FT                   /db_xref="GOA:B4RQ90"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR005412"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:B4RQ90"
FT                   /protein_id="ACF28900.1"
FT                   /translation="MPSENEWNGFRQKAFRRHSVLKTFQSKGYAMNPATADIAQCIEQN
FT                   LNQYFKDLNGTEPCGVYDMVLHQVEKPLLVCVMEQCGGNQSKASVMLGLNRNTLRKKLI
FT                   QHGLL"
FT   gene            161570..162112
FT                   /locus_tag="NGK_0205"
FT   CDS_pept        161570..162112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0205"
FT                   /product="Holliday junction resolvase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28901"
FT                   /db_xref="GOA:B4RIU4"
FT                   /db_xref="InterPro:IPR002176"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR020563"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B4RIU4"
FT                   /protein_id="ACF28901.1"
FT                   /translation="MNMSATVRILGIDPGSRVTGFGIIDVRGRDHFYVASGCIKTPADE
FT                   PLADRIAVIVRHIGEVVAVYKPQQAAVEQVFVNVNPASTLMLGQARGAALAALVSHKLP
FT                   VSEYTALQVKQAVVGKGKAAKEQVQHMVVQMLGLSGTPQADAADGLAVALTHALRNHGL
FT                   AAKLNPSGMQVKRGRFQ"
FT   gene            162133..163032
FT                   /locus_tag="NGK_0206"
FT   CDS_pept        162133..163032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0206"
FT                   /product="lipid A acyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28902"
FT                   /db_xref="GOA:B4RIU5"
FT                   /db_xref="InterPro:IPR004960"
FT                   /db_xref="UniProtKB/TrEMBL:B4RIU5"
FT                   /protein_id="ACF28902.1"
FT                   /translation="MPPEKKMCTEMKFIFFVLYVLQFLPFALLHKIAGLIGSLAYLLVK
FT                   PRRRIGEINLAKCFPEWDEEKRKTVLKQHFKHMAKLMLEYGLYWYAPAKCLKSLVRYRN
FT                   KHYLDDALAAGEKVIILYPHFTAFEMAVYALNQDVPLISMYSHQKNKILDEQILKGRNR
FT                   YHNVFLIGRTEGLRALVKQFRKSSAPFLYLPDQDFGRNNSVFVDFFGIQTATITGLSRI
FT                   AALANAKVIPAIPVREADNTVTLQFYPAWKSFPSEDAQADAQRMNRFIEERVREHPEQY
FT                   FWLHKRFKTRPEGSPDFY"
FT   gene            163108..163260
FT                   /locus_tag="NGK_0207"
FT   CDS_pept        163108..163260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0207"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28903"
FT                   /db_xref="UniProtKB/TrEMBL:B4RIU6"
FT                   /protein_id="ACF28903.1"
FT                   /translation="MYKRDLPDGFNGSVVCKNNAFLKLTKNEIGFKGLFREQRGVDAEN
FT                   PVNIL"
FT   gene            163635..163820
FT                   /locus_tag="NGK_0208"
FT   CDS_pept        163635..163820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0208"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28904"
FT                   /db_xref="UniProtKB/TrEMBL:B4RIU7"
FT                   /protein_id="ACF28904.1"
FT                   /translation="MKKGVHSATQNYRYSGAMPSERIFRSVLRLVGVSSDTVKRKFAGA
FT                   GLSYAGKAAGESLYCL"
FT   gene            163921..164730
FT                   /locus_tag="NGK_0209"
FT   CDS_pept        163921..164730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0209"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28905"
FT                   /db_xref="GOA:B4RIU8"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR019288"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B4RIU8"
FT                   /protein_id="ACF28905.1"
FT                   /translation="MQGTAMNTILAFDIETVPDVQGIRTLYDLPSSLPDDEVVLFAQQK
FT                   RRAQTGGDFMQHHLHQVVAVSCCMRWGQDKVHVGTIGEMDDGEEVVIAKFFELVEKHTP
FT                   QLVSWNGGGFDLPVLHYRSLIYGINAARYWDMGDGDFGDSRDFKWNNYISRYHQRHCDL
FT                   MDLLALYQPRANVPLDDMAKLCGFPGKLGMDGSKVWEAFHAGRLKEIRNYCETDAVNTY
FT                   LMYLRFCLVSGRFDADEYEMEIKRIRNYLSAQTEDKPHWAEFVQAWK"
FT   gene            164711..164872
FT                   /locus_tag="NGK_0210"
FT   CDS_pept        164711..164872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0210"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28906"
FT                   /db_xref="UniProtKB/TrEMBL:B4RIU9"
FT                   /protein_id="ACF28906.1"
FT                   /translation="MSKRGNRNLLSEGGTLVPPFRFQTAYGGLNSNRYSLASPCLTICT
FT                   VCGFVALS"
FT   gene            164955..167558
FT                   /locus_tag="NGK_0211"
FT   CDS_pept        164955..167558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0211"
FT                   /product="putative aminopeptidase N"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28907"
FT                   /db_xref="GOA:B4RIV0"
FT                   /db_xref="InterPro:IPR001930"
FT                   /db_xref="InterPro:IPR012779"
FT                   /db_xref="InterPro:IPR014782"
FT                   /db_xref="InterPro:IPR024601"
FT                   /db_xref="InterPro:IPR027268"
FT                   /db_xref="InterPro:IPR035414"
FT                   /db_xref="InterPro:IPR037144"
FT                   /db_xref="InterPro:IPR038438"
FT                   /db_xref="InterPro:IPR042097"
FT                   /db_xref="UniProtKB/TrEMBL:B4RIV0"
FT                   /protein_id="ACF28907.1"
FT                   /translation="MSKTVRYLKDYQTPAYRILETELHFDIAEPQTVVKSRLTVEPQRA
FT                   GEPLVLDGSAKLLSVKINGAAADYVLEGETLTIADVPSERFTVEVETEILPAENKSLMG
FT                   LYASGGNLFTQCEPEGFRKITFYIDRPDVMSKFTTTIVADKKRYPVLLSNGNKIDGGEF
FT                   SDGRHWVKWEDPFAKPSYLFALVAGDLAVTEDRFTTMSGRNVKIEFYTTEADKPKVGFA
FT                   VESLKNAMKWDETRFGLEYDLDIFMVVAVGDFNMGAMENKGLNIFNTKFVLADSRTATD
FT                   TDFEGIESVVGHEYFHNWTGNRVTCRDWFQLSLKEGLTVFRDQEFSGDRAGRAVRRIEN
FT                   IRLLRQNQFPEDAGPTAHPVRPVSYEEMNNFYTMTVYEKGAEVVRMYHTLLGEEGFQKG
FT                   MKLYFQRHDGQAVTCDDFRAAMADANGINLDQFALWYSQAGTPVLEAEGRLKNNVFELT
FT                   IKQTVPPTPDMADKQPMMIPVKVGLLNRNGEAVAFDYQGKRATEAVLLMTEAEQAFPLE
FT                   GVTEAVVPSLLRGFSAPVYLNYPYSDDDLLLLLAHDSDAFTCWEAAQTLYRRAVAANLA
FT                   ALSDGIGLPKHEKLLAAVEKVISDDLLDNAFKALLLGVPSEAELWDGTENIDPLRYHQA
FT                   REALLDTLAVRFLPKWHELDRQAAKQENQSYEYSPETADWRTLRNVCRAFVLRADPAHI
FT                   ETVAEKYGEMAQNMTHEWGILSAVNGNESDTRNCLLAQFADKFSDDALVMDKYFALIGS
FT                   SRRSDTLQQVQTALQHPKFSLENPNKARSLIGSFSRNVPHFHAQDGSGYRFIADKVIEI
FT                   DRFNPQVAARLVQAFNLCNKLEPHRKNLVKQELQCIRAQEGLSKDVGEIVGKILG"
FT   gene            167620..168273
FT                   /locus_tag="NGK_0212"
FT   CDS_pept        167620..168273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0212"
FT                   /product="IS1016 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28908"
FT                   /db_xref="InterPro:IPR024445"
FT                   /db_xref="UniProtKB/TrEMBL:B4RIV1"
FT                   /protein_id="ACF28908.1"
FT                   /translation="MKITHCKLKKEVQKEPLRSFVPEVTARSAADILGIHPDSAALFYR
FT                   KIRTVTNHRLALAADEVFERPAGPGGSCFGVRRKGRRGRGAAGKAVVFGIPKRNGRAYT
FT                   VAEDDAEPETLPPAVKKKIMPDGIVYADSPGSRGKSDAGGFTRCRINRSKEFADRRNHI
FT                   NGIGNFWNQAKRALRKYNGIDRKPFPPLLRECEFRLNFGTPSRQLKILRDRCGI"
FT   gene            complement(168407..168598)
FT                   /locus_tag="NGK_0213"
FT   CDS_pept        complement(168407..168598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0213"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28909"
FT                   /db_xref="UniProtKB/TrEMBL:B4RIV2"
FT                   /protein_id="ACF28909.1"
FT                   /translation="MLPACSVSSLLLGEYLEFEENGTKIAAEIGSAWHFLGAACRISIN
FT                   GKYYAGNRIVWFAKKAES"
FT   gene            complement(168618..169097)
FT                   /locus_tag="NGK_0214"
FT   CDS_pept        complement(168618..169097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0214"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28910"
FT                   /db_xref="UniProtKB/TrEMBL:B4RIV3"
FT                   /protein_id="ACF28910.1"
FT                   /translation="MQINNISDEQVMIVKMSCYLKKDEIFKNIERYGYQSSDIKKINPP
FT                   FPLNILPVPKPYYFYLYDTHLNQIYDLAWSCNDFLMFEIFILDRESIKYIDKDKLFKPG
FT                   ETLYLNFKSIKNQCKNYFFAVLVLMPLTLKAVRVKWQIIILFLMPFLYSLFNQII"
FT   gene            complement(169154..169492)
FT                   /locus_tag="NGK_0215"
FT   CDS_pept        complement(169154..169492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0215"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28911"
FT                   /db_xref="UniProtKB/TrEMBL:B4RIV4"
FT                   /protein_id="ACF28911.1"
FT                   /translation="MKTFEKTWSAQYRDMEISVRNFWNLKRTGAEVYINGRRVYHNEAG
FT                   MASASLRSLMGEYLEFEESGTKITVEIGSAWHFNETIRNINTHLRGTKLPGSNWRVQDK
FT                   GHFHLWKR"
FT   gene            complement(169537..169725)
FT                   /locus_tag="NGK_0216"
FT   CDS_pept        complement(169537..169725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0216"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28912"
FT                   /db_xref="UniProtKB/TrEMBL:B4RIV5"
FT                   /protein_id="ACF28912.1"
FT                   /translation="MKHIYEFNRESFIFSDVLLQKGESEENFSEIVLKSIKNNKILTVE
FT                   VRSGLHFDLRNIYRIEM"
FT   gene            complement(169972..170292)
FT                   /locus_tag="NGK_0217"
FT   CDS_pept        complement(169972..170292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0217"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28913"
FT                   /db_xref="UniProtKB/TrEMBL:B4RIV6"
FT                   /protein_id="ACF28913.1"
FT                   /translation="MSLDIFQGLSELEKKIEPQDLMDDVYRAFDSVGNILNFRIVEKEQ
FT                   KGFWVSTKIKTVVFDSADMPSDDLFLKCLQSSYKAYSETEPAGLDKRQLMKTLIQKCGF
FT                   SC"
FT   gene            complement(170319..170858)
FT                   /locus_tag="NGK_0218"
FT   CDS_pept        complement(170319..170858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0218"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28914"
FT                   /db_xref="UniProtKB/TrEMBL:B4RIV7"
FT                   /protein_id="ACF28914.1"
FT                   /translation="MKKQITAAVMMLSMIAPAMANGLDNQAFEDQVFHTRADAPMQLAE
FT                   LSQKEMKETEGAFLPLAILGGAAIGMWTQHGFSYATTGRPASVRDVAGGLGAIPGDVGA
FT                   AGKVVSFAKYGREIKIGNNMRIAPFGNRTGHPIGKFPHYHRRVTDNTGKTLPGQGIGRH
FT                   RPWESKSTDRSWKNRF"
FT   gene            complement(170901..171686)
FT                   /locus_tag="NGK_0219"
FT   CDS_pept        complement(170901..171686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0219"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28915"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:B4RIV8"
FT                   /protein_id="ACF28915.1"
FT                   /translation="MTDKGKWKLETSLTYLNSENSRAALASPVYIQTGSASFIPVPTEI
FT                   QENGSNTDMLAGTLGLRYGLTGNTDIYGSGSYLWHEERKLDGNGKTRNKRMSDISAGIS
FT                   HTFLKDGKNPALIAFLESTVYEKSRNKASSGKSWLIGATTYKAIDPIVLSLTAAYRING
FT                   SKTLSDDVKYKAGNYWMLNPNISFAANDRISLTGGIQWLGKQPDRIDGKKESARNTSTY
FT                   AHFGAGFGFTKTAALNASARFNVSGQSSSELKLGVQHTF"
FT   gene            complement(171987..172901)
FT                   /locus_tag="NGK_0220"
FT   CDS_pept        complement(171987..172901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0220"
FT                   /product="periplasmic binding protein MntC"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28916"
FT                   /db_xref="GOA:B4RIV9"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR006128"
FT                   /db_xref="InterPro:IPR006129"
FT                   /db_xref="UniProtKB/TrEMBL:B4RIV9"
FT                   /protein_id="ACF28916.1"
FT                   /translation="MKHLKLTLITALLATAATAAPLPVVTSFSILGDVAKQIGGERVAV
FT                   QSLVGANQDTHAYHMTSGDIKKIRSAKLVLLNGLGLEAADIQRAVKQSKVSYAEATKGI
FT                   QPLKAEEEGGHHHDHDHDHEGHHHDHGEYDPHVWNDPVLMSDYAQNVAEALIKADPEGK
FT                   VYYQQRLGNYQMQLKKLHSDAQAAFNAVPAAKRKVLTGHDAFSYMGNRYNISFIAPQGV
FT                   SSEAEPSAKQVAAIIRQIKREGIKAVFTENIKDTRMVDRIAKETGVNVSGKLYSDALGN
FT                   APADTYIGMYRHNVKALTNAMKQ"
FT   gene            complement(172978..173853)
FT                   /locus_tag="NGK_0221"
FT   CDS_pept        complement(172978..173853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0221"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28917"
FT                   /db_xref="GOA:B4RIW0"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:B4RIW0"
FT                   /protein_id="ACF28917.1"
FT                   /translation="MNLYDLLLAPFAEFDFMHYALASVFCLSLSAAPVGVFLVMRRMSL
FT                   IGDALSHAVLPGAAVGYMFAGLSLPAMGVGGFAAGMLMALLAGLVSRFTTLKEDANFAA
FT                   FYLSSLAIGVILISKNGSSVDLLHLLFGSVLAVDIPALQLIAAVSGLTLITLAVIYRPL
FT                   VLESIDPLFLKSVNGKGGLWHVVFLILVVMNLVSGFQALGTLMSVGLMMLPAITARLWA
FT                   RNMGTLILLSVLIALFCGLIGLLISYHIEIPSGPAIILCCSVLYLFSVILGKEGGILPK
FT                   WFKNHRHHTT"
FT   gene            complement(173888..174643)
FT                   /locus_tag="NGK_0222"
FT   CDS_pept        complement(173888..174643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0222"
FT                   /product="putative ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28918"
FT                   /db_xref="GOA:B4RIW1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B4RIW1"
FT                   /protein_id="ACF28918.1"
FT                   /translation="MGCLPLGGIGMSIIVENLTVSYRRRPAVHHVDITFEEHSMWAVFG
FT                   PNGAGKSTFLKSLMGLQPIDTGSIRLDGLTSQNIAYLPQQSDIDRSQPMTVFDLAAMGL
FT                   WYEIGFFKGINTAQKQRVHEALERVGMRQFARRQIAHLSNGQFQRVLFARMLVQNAKFL
FT                   LLDEPFNAVDARTTYELLDVLQKCHCGGHAIIAVLHDYEQVRAYFPNTLLLAREKIAAG
FT                   ATETILTESYLAQASAKMQQQESPDWCAS"
FT   gene            complement(174934..175299)
FT                   /locus_tag="NGK_0223"
FT   CDS_pept        complement(174934..175299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0223"
FT                   /product="50s ribosomal protein L19"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28919"
FT                   /db_xref="GOA:B4RIW2"
FT                   /db_xref="InterPro:IPR001857"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR018257"
FT                   /db_xref="InterPro:IPR038657"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4RIW2"
FT                   /protein_id="ACF28919.1"
FT                   /translation="MNLIQQLEQEEIARLNKEIPEFAPGDTVVVSVRVVEGTRSRLQAY
FT                   EGVVIARRNRGLNSNFIVRKISSGEGVERTFQLYSPTVEKIEVKRRGDVRRAKLYYLRG
FT                   LTGKAARIKEKLPARKG"
FT   gene            complement(175314..176063)
FT                   /locus_tag="NGK_0224"
FT   CDS_pept        complement(175314..176063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0224"
FT                   /product="putative tRNA (guanine-N1)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28920"
FT                   /db_xref="GOA:B4RIW3"
FT                   /db_xref="InterPro:IPR002649"
FT                   /db_xref="InterPro:IPR016009"
FT                   /db_xref="InterPro:IPR023148"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4RIW3"
FT                   /protein_id="ACF28920.1"
FT                   /translation="MLIQAVTIFPEMFDSITRYGVTGRANRQGIWQFEAVNPRKFADNR
FT                   LGYIDDRPFGGGPGMIMMAPPLHAAIEHAKAQSSQTAKVIYLSPQGKPLTHQKAAELAE
FT                   LTHLILLCGRYEGIDERLLQSSVDEEISIGDFVVSGGELPAMMLMDAVLRLVPGILGDI
FT                   QSAEQDSFSSGILDCPHYTKPLEFQGMAVPEVLRSGNHGLIAEWRLEQSLRRTLERRPD
FT                   LLEKRVLIPKESRLLNKILQEQREIQS"
FT   gene            complement(176063..176545)
FT                   /locus_tag="NGK_0225"
FT   CDS_pept        complement(176063..176545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0225"
FT                   /product="Probable 16S rRNA-processing protein rimM"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28921"
FT                   /db_xref="GOA:B4RIW4"
FT                   /db_xref="InterPro:IPR002676"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR011961"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="InterPro:IPR036976"
FT                   /db_xref="UniProtKB/TrEMBL:B4RIW4"
FT                   /protein_id="ACF28921.1"
FT                   /translation="MGYIKGVFGIKGWLKIAANTEYSDSLLDYPEWHLAKDGKTVSVTL
FT                   EAGKVVNGELQVKFEGIDDRDSAFSLRGYTIEIPREAFAPTEEDEYYWADLVGMTVVNK
FT                   DDTVLGKVSNLMETGANDVLMIDGEHGQILIPFVSQYIETVDTGSKTITADWGLDY"
FT   gene            complement(176588..176833)
FT                   /locus_tag="NGK_0226"
FT   CDS_pept        complement(176588..176833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0226"
FT                   /product="30S ribosomal protein S16"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28922"
FT                   /db_xref="GOA:B4RIW5"
FT                   /db_xref="InterPro:IPR000307"
FT                   /db_xref="InterPro:IPR023803"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4RIW5"
FT                   /protein_id="ACF28922.1"
FT                   /translation="MVVIRLARGGSKHRPFYNVIVTDSRSRRDGRFIERVGFYNPVANE
FT                   KQERVRLNADRLNHWIAQGAQVSDSVAKLIKEQKAV"
FT   gene            complement(176878..177132)
FT                   /locus_tag="NGK_0227"
FT   CDS_pept        complement(176878..177132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0227"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28923"
FT                   /db_xref="GOA:B4RIW6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B4RIW6"
FT                   /protein_id="ACF28923.1"
FT                   /translation="MRGSGLAQKMMELIIQTAAQQGYLSMSADILKTNTPMIKLAEKSG
FT                   FTLKESDTEKNLYRAYLNLAADKTTGKTNKNLRTGHKIT"
FT   gene            complement(177174..177581)
FT                   /locus_tag="NGK_0228"
FT   CDS_pept        complement(177174..177581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0228"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28924"
FT                   /db_xref="UniProtKB/TrEMBL:B4RIW7"
FT                   /protein_id="ACF28924.1"
FT                   /translation="MQSAAAYLEHKNPTAAEFLRHTSEAAAELLGSKTETGAAVPNVLA
FT                   PYPAAHPKTLSLKNNTTVTIIPLLPEDAEAKQQFVRSLGPEARYTRFMTHTNELPAATL
FT                   ARLCNPDYHCEPHGRQGMPTATSSPSSATAA"
FT   gene            complement(177922..179301)
FT                   /locus_tag="NGK_0229"
FT   CDS_pept        complement(177922..179301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0229"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28925"
FT                   /db_xref="GOA:B4RIW8"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B4RIW8"
FT                   /protein_id="ACF28925.1"
FT                   /translation="MPAQTDPGYFFMPNHIILIGASEQPYSLGERVLSNLLSTPFQGKI
FT                   TPVNPRHHTIAGLPAYTSLNKIPGSADLIITVTPPDSYDTLLKTCRKKQLRHIILIQDW
FT                   DSLSAAELHTAETAIRKHHGNGLNITAYTTAGIQLPSLGLNISTQDGYAAGHTAILTGN
FT                   AAVSRQIDNILNKLRQGTSRHINLHPGISPITSADWLNRFGHSLHTKTAVLHHNPEEDQ
FT                   RRLFSAIRQFTRHTPLILHITCLTTETDRAVLHCLARHCNFLISFNADDLEAALSAQLS
FT                   DLPPLSRLDILSDTPAEWLHAHAPKNLTLHFPNLPHHIRNGHLTGTPTPSICHDIASRQ
FT                   LARPDTQAVLTILGPSGHEDYKKTARALIRLSEQTAKPLLVNSPFSDGITHFDTPAQAI
FT                   RTLSYRNTAAALKQAQLDIAPPQPCRLKTPQPQNIKKALAAANPALLAEALHLPLPAHH
FT                   P"
FT   gene            complement(179419..180825)
FT                   /locus_tag="NGK_0230"
FT   CDS_pept        complement(179419..180825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0230"
FT                   /product="putative two-component system sensor kinase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28926"
FT                   /db_xref="GOA:B4RIW9"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B4RIW9"
FT                   /protein_id="ACF28926.1"
FT                   /translation="MKLFQRIFATFCAVIVCAIFVASFSFWLVQNTLAENQFNQRRTIE
FT                   TTLMGSIISAFKTRGDNGAREILTEWKNSPVSSAVYVIQGDEKKDILNRYIDNYTIERA
FT                   RLFAANNPHSNLVRIEYDRFGEEYLFFIKGWDNHQAQRLPSPLFIPGLPLAPIWHEFII
FT                   LSFIIIVGLLMAYILAGNIAKPIRILGNGMDRVANGELETRISQQVDDRDDELSHLAIQ
FT                   FDKMAEKLEKLVAKERYLLHHVSHEMRSPLARMQAIVGLIQAQPQKREQYLKRLEGELT
FT                   RMDTLAGELLTLSRLETSNMALEKESLKLLPFLGNLVEDNQSIAQKNGQTVALSADGKI
FT                   PENTTILANESYLYRAFDNVIRNAVNYSPEGSTILINIGQDHKHWIIDVTDNGPGVDEM
FT                   QLPHIFTAFYRADSSANKPGTGLGLALTQHIIEQHCGKIIAENIKPNGLRMRFILPKKK
FT                   TGFKTEKSAN"
FT   gene            complement(180838..181515)
FT                   /locus_tag="NGK_0231"
FT   CDS_pept        complement(180838..181515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0231"
FT                   /product="putative two-component system regulator"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28927"
FT                   /db_xref="GOA:B4RIX0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B4RIX0"
FT                   /protein_id="ACF28927.1"
FT                   /translation="MSRVLLVDDDALLTELLTEYLSAEGLNVRSVPDGEAGVQEILSGQ
FT                   YDVVVLDSMMPKMNGLDVLKNVRARSTVPIIMLTAKGDDIDRIIGLEMGADDYVPKPCT
FT                   PRELLARINAILRRAQHSGEQNNAPNSISVSDVVLYPAKRQASVKDMPLELTSTEFNLL
FT                   EVLMRHAGQVVSKETLSVEALDRKLAKFDRSIDVHISSIRHKLGDASLIQTVRGLGYLF
FT                   VKN"
FT   gene            complement(181591..183519)
FT                   /locus_tag="NGK_0232"
FT   CDS_pept        complement(181591..183519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0232"
FT                   /product="Possible integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28928"
FT                   /db_xref="GOA:B4RIX1"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="InterPro:IPR021797"
FT                   /db_xref="InterPro:IPR031726"
FT                   /db_xref="UniProtKB/TrEMBL:B4RIX1"
FT                   /protein_id="ACF28928.1"
FT                   /translation="MSAETTVSGARPAAKLPIYILPCFLWIGIIPFTFALRLKPSPDFY
FT                   HDAAAAAGLIVLLFLTAGKKLFDVKIPAISFLLFAMAAFWWLQARLMNLIYPGMNDIAS
FT                   WVFILLAVSAWACKSLVAHYGQERIVTLFAWSLLIGSLLQSCIVVIQFAGWENTPLLQN
FT                   IIVHRGQGVIGHIGQRNNLGHYLMWGILASAYLNGQRKIPAALGAICLIMQTAVLGLVN
FT                   SRTILTYIAAIALILPFWYFRSDKSNRRTMLGIAAAVFLTALFQFSMNAILETFTGIRY
FT                   ETAVERVANGGFTDLPRQSEWNKALAAFQSAPIFGHGWNSFAQQTFLINAEQHTIHDNF
FT                   LSTLFTHSHNIILQLLAEMGISGTLLVAATLLTGIAGLLKRSLTPASLFLLCALAVSMC
FT                   HSMLEYPLWYVYFLIPFGLMLFLSPAEASDGIAFKKAANLGILTASAAIFAGLLHLDWT
FT                   YTRLVNSFSPAADDSAKTLNRKINELRYISANSPMLSFYADFSLVNFALPEYPETQTWA
FT                   EEATLKALKYRPYSATYRIALYLMRQGKVAEAKQWMRATQSYYPYLMPRYADEIRKLPV
FT                   WAPLLPELLKDCKAFAAAPGHPETKPCKRPASADADTARNVKLHARHCKKQQTGREIRY
FT                   QKTLQPC"
FT   gene            complement(183509..183862)
FT                   /locus_tag="NGK_0233"
FT   CDS_pept        complement(183509..183862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0233"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28929"
FT                   /db_xref="GOA:B4RIX2"
FT                   /db_xref="InterPro:IPR018643"
FT                   /db_xref="UniProtKB/TrEMBL:B4RIX2"
FT                   /protein_id="ACF28929.1"
FT                   /translation="MNRQTAYFLASFSLIALIALSLSWELWIAPLRPGGSWLALKALPL
FT                   CLPLSGILKKKIYTYQYSSMLVLIYFAEAVMRLFNAYPAEKICAALSAVFSIIFFISCL
FT                   SFVKQYKETNNVR"
FT   gene            complement(183871..184518)
FT                   /locus_tag="NGK_0234"
FT   CDS_pept        complement(183871..184518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0234"
FT                   /product="Maf-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28930"
FT                   /db_xref="GOA:B4RIX3"
FT                   /db_xref="InterPro:IPR003697"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:B4RIX3"
FT                   /protein_id="ACF28930.1"
FT                   /translation="MPSEAPPHIKEHTVNTLYLGSGSPRRMEILTQLGYRVVKLPAGID
FT                   ETVKAGETPAPYVQRMAEEKNQAALTLFCETNGAMPDFPLITADTCVFSDGIILGKPRS
FT                   QAEAIEFLNRLSGKQHTVLTAVCIHYRGKTSSRVQTNRVVFKPLSSEEISAYVQSGEPM
FT                   EKAGAYAVQGIGGIFIQSIEGSFSGIMGLPVYETVSMLQDLGYRPPLSALKP"
FT   gene            complement(184523..185293)
FT                   /locus_tag="NGK_0235"
FT   CDS_pept        complement(184523..185293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0235"
FT                   /product="Sec-independent protein translocase component"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28931"
FT                   /db_xref="GOA:B4RIX4"
FT                   /db_xref="InterPro:IPR002033"
FT                   /db_xref="UniProtKB/TrEMBL:B4RIX4"
FT                   /protein_id="ACF28931.1"
FT                   /translation="MSETQNEQTVQLLVEHLIELRRRLMWMVVGILVCFFGMMPFAQQL
FT                   YTFIADPLMANLPKDTSMIATDVIAPFFVPVKVTLMAAFLVSLPHTLYQIWAFVAPALY
FT                   QNEKRLITPLVLSSVSLFFIGMAFAYFLVFPVIFKFLAGVTPVGVNMATDIDKYLSFIL
FT                   GMFVAFGTAFEVPIVVILLTKIGAVTTEQLKHARPYVIVGAFVVAAVITPPDIISQTLL
FT                   AIPLILLYEAGIWFGRFFTPRSEQDGDIQPPAKT"
FT   gene            complement(185306..185992)
FT                   /locus_tag="NGK_0236"
FT   CDS_pept        complement(185306..185992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0236"
FT                   /product="Sec-independent protein translocase protein
FT                   tatB-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28932"
FT                   /db_xref="GOA:B4RIX5"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR018448"
FT                   /db_xref="UniProtKB/TrEMBL:B4RIX5"
FT                   /protein_id="ACF28932.1"
FT                   /translation="MFDFGLGELIFVGIIALIVLGPERLPEAARTAGRLIGRLQRFVGS
FT                   VKQELDTQIELEELRKVKQAFEAAAAQVRDSLKETDTDMQNSLHDISDGLKPWEKLPEQ
FT                   RTPADFGVDENGNPLPDTANTVSDGISDVMPSERSDTSAETLGDDRQTGSTAEPAETDK
FT                   DRAWREYLTASAAAPVVQAVEVSYIDTAVETPVPHTTSLRKQAINRKRDFRPKHRAKPK
FT                   LRVRKS"
FT   gene            complement(185996..186199)
FT                   /locus_tag="NGK_0237"
FT   CDS_pept        complement(185996..186199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0237"
FT                   /product="Sec-independent protein translocase protein
FT                   tatA/E-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28933"
FT                   /db_xref="GOA:B4RIX6"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4RIX6"
FT                   /protein_id="ACF28933.1"
FT                   /translation="MGSFSLTHWIIVLIIVVLIFGTKKLRNVGKDLGGAVHDFKQGLNE
FT                   GTDGKEAQKDDVIEHKKDEDKA"
FT   gene            complement(186246..186599)
FT                   /locus_tag="NGK_0238"
FT   CDS_pept        complement(186246..186599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0238"
FT                   /product="HitA"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28934"
FT                   /db_xref="GOA:B4RIX7"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR019808"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:B4RIX7"
FT                   /protein_id="ACF28934.1"
FT                   /translation="MLFSDGNGAVMDNCIFCKIAAKEIPAQTVYEDGEMVCFKDINPAA
FT                   PLHLLLIPKVHFDSLAHAAPEHQPLLGKMMLKVPEIAKASGLTDGFKTLINTGKGGGQE
FT                   VFHLHIHIMGTPV"
FT   gene            complement(186643..187095)
FT                   /locus_tag="NGK_0239"
FT   CDS_pept        complement(186643..187095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0239"
FT                   /product="putative phosphoribosyl-ATP cyclohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28935"
FT                   /db_xref="GOA:B4RIX8"
FT                   /db_xref="InterPro:IPR008179"
FT                   /db_xref="InterPro:IPR021130"
FT                   /db_xref="UniProtKB/TrEMBL:B4RIX8"
FT                   /protein_id="ACF28935.1"
FT                   /translation="MQQHKCRLKRSDGIFQRNATGVLPESSRLAYHSEQTETNRRKIMG
FT                   DSVLSAIQQTIIQRKSADPSESYVAQLLHKGEDKILKKVIEEAGEVLMASKDKDPSHLV
FT                   YEVADLWFHTMILLTHHDLKAEDVLDELSRRQGLSGLAEKAARTES"
FT   gene            complement(187107..188171)
FT                   /locus_tag="NGK_0240"
FT   CDS_pept        complement(187107..188171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0240"
FT                   /product="putative zinc-binding alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28936"
FT                   /db_xref="GOA:B4RIX9"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B4RIX9"
FT                   /protein_id="ACF28936.1"
FT                   /translation="MKAARFYNKGDIRIEDIPEPTVAPGTVGINVAWCGICGTDLHEFM
FT                   EGPIFIPPCGHPHPISGESAPVTMGHEFSGVVYAVGEGVDDIKVGQHVVVEPYIIRDDV
FT                   PTGEGSNYHLSKDMNFIGLGGCGGGLSEKIAVKRRWVHPISDKIPLDQAALIEPLSVGH
FT                   HAYVRSGAKAGDVALVGGAGPIGLLLAAVLKAKGIKVIITELSKARKDKARESGVADYI
FT                   LDPSEVDVVEEVKKLTNGEGVDVAFECTSVNKVLDTLVEACKPGANLVIVSIWSHPATV
FT                   NVHSVVMKELDVRGTIAYCNDHAETIKLVEEGKINLEPFITQRIKLDKLVSEGFERLIH
FT                   NNESAVKIIVNPNL"
FT   gene            complement(188445..188894)
FT                   /locus_tag="NGK_0241"
FT   CDS_pept        complement(188445..188894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0241"
FT                   /product="IS1106 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ACF31269"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:B4RIY0"
FT                   /protein_id="ACF31269.1"
FT                   /translation="MNTFFRQTAQAMTAKHIGRFPLSELDQVIDWQPIEQYLIRQKTRY
FT                   LRDRRGRPAHPLSSMFKAVLPGQWHSLSDPELEHSLITRIGFNLFCRFDEPGIPGCSTL
FT                   CRYRKFRYARAAYFGLLKVGAQSHLKAMCLNLLKAANRLSAPAAA"
FT   gene            188997..189215
FT                   /locus_tag="NGK_0242"
FT   CDS_pept        188997..189215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0242"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28937"
FT                   /db_xref="UniProtKB/TrEMBL:B4RIY1"
FT                   /protein_id="ACF28937.1"
FT                   /translation="MPALPFFRTSIPMLVQNRMESIFNHNKDAIFLEGWSLGDAAMIME
FT                   LLWQNISTSRRELTKLFLYKNFWGCTR"
FT   gene            189561..190523
FT                   /locus_tag="NGK_0243"
FT   CDS_pept        189561..190523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0243"
FT                   /product="Irg1"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ACF31270"
FT                   /db_xref="GOA:B4RIY2"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:B4RIY2"
FT                   /protein_id="ACF31270.1"
FT                   /translation="MRNTVGLDISKLTFDATAIVGNAEYSAKFDNDSKGLDQFSDRLKS
FT                   LGCQNLHICMEATGNYYEEVADYFAQYYSVYVVNPLKISKYAESRFKRTKTGKQDAKLI
FT                   AQYCRSAQESELVKRQKPTDEQYRLSRMIAAYAQIKSECAAMKNRHHAAKDEEAAKAYA
FT                   QIIKAMNEQLEVLKEKIKEQTEKPNCKEGVKRLETIPAIGRMTAAVLFHHLTSSKFETS
FT                   NKFAAFAGLSPQQKESGTSVRGKGKLTKFGNRKLRAVLFMPAMVAYRIRAFPDFIKRLE
FT                   EKKKPKKVIIAALMRKLAVIAYHVHKKGGDYDPSRYKSA"
FT   gene            190689..190889
FT                   /locus_tag="NGK_0244"
FT   CDS_pept        190689..190889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0244"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28938"
FT                   /db_xref="UniProtKB/TrEMBL:B4RIY3"
FT                   /protein_id="ACF28938.1"
FT                   /translation="MGSGNLQKSSEKSEVLDSRFHGNDGISDGILPPRHSRAGGNLVRS
FT                   VSVIYDKFLLPFISGFPLSRE"
FT   gene            complement(191067..191819)
FT                   /locus_tag="NGK_0245"
FT   CDS_pept        complement(191067..191819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0245"
FT                   /product="UPF0341 protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28939"
FT                   /db_xref="GOA:B4RIY4"
FT                   /db_xref="InterPro:IPR007536"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4RIY4"
FT                   /protein_id="ACF28939.1"
FT                   /translation="MTDILIDDTATEAVRTLIRAFPLVPVSQPPEQGSYLLAEHDTVSL
FT                   RLVGEKSNVIVDFTSGAAQYRRTKGGGELIAKAVNHTAHPTVWDATAGLGRDSFVLASL
FT                   GLTVTAFEQHPAVACLLSDGIRRALLNPETQDTAARINLHFGNAAEQMPALVKTQGKPD
FT                   IVYLDPMYPERRKSAAVKKEMAYFHRLVGEAQDEVILLHTARQTAKKRVVVKRPRLGEH
FT                   LAGQAPAYQYTGKSTRFDVYLPYGADKG"
FT   gene            complement(191919..193643)
FT                   /locus_tag="NGK_0246"
FT   CDS_pept        complement(191919..193643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0246"
FT                   /product="Rsp"
FT                   /note="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28940"
FT                   /db_xref="GOA:B4RIY5"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B4RIY5"
FT                   /protein_id="ACF28940.1"
FT                   /translation="MVISNPRELEKLKDRIPNLINIIRVAIVFPLMIMHILGLETGSRA
FT                   NLHASWTAWAFYLWLAIACWLIFFSTLNPQWQWQWQALRIPSFSAVADITMIGVLTYLF
FT                   GGIDSGFGILILPFVGSSCLLSYGRYPLLYASYASILLIFNALADSNINMYPLILDAKT
FT                   VTNTFVVVAGSYFVAMIASLSVRYIDRAGKLAHENHVAYRRIRGLNQIVLNRVQEAVVV
FT                   INVEHQTILFNKKAKDLLPMLEIGQHTSLFDPVAILWDKTSSRTFEHYIDTPELTARIR
FT                   AVPMNKKQNKLLILYIRPQSEIQAEALSVKLAALGQLTANLAHEIRNPMSAIRHADGGT
FT                   LFLDEVADLPLSMQVKLLRAIQEKAVRRIGDATEQPVDVRIVCATHKNLEALVESGAFR
FT                   QDLYYRLNVVSLNMPSLREMRENLKLPTPYLLYKHSHNNRPYTLSPAAQQMLLNYSYPG
FT                   NFRELENILERAVALCVGYTVQIDDLQIQDVHHKPVRTETAVPVADTLPSETAAAPSRL
FT                   LPFDPDTMQIQDYLDKIERDIIGQVLKQTEGNRTQAAKRLGISFRSMRYRMERLNID"
FT   gene            complement(193663..195966)
FT                   /locus_tag="NGK_0247"
FT   CDS_pept        complement(193663..195966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0247"
FT                   /product="DNA topoisomerase IV subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28941"
FT                   /db_xref="GOA:B4RIY6"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005742"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:B4RIY6"
FT                   /protein_id="ACF28941.1"
FT                   /translation="MNTQPHASHTDSNTLMLGRYAERAYLEYAMSVVKGRALPEVSDGQ
FT                   KPVQRRILFAMRDMGLTAGAKPVKSARVVGEILGKYHPHGDRSAYEAMVRMAQDFTLRY
FT                   PLIDGIGNFGSRDGDGAAAMRYTEARLTPIAELLLSEINQGTVDFMPNYDGAFDEPLHL
FT                   PARLPMVLLNGASGIAVGMATEIPSHNLNEVTQAAIALLKKPTLETADLMQYIPAPDFA
FT                   GGGQIITPADELRRIYETGKGSVRVRARYEIEKLARGQWRVIVTELPPNANSAKILAEI
FT                   EEQTNPKPKAGKKQLNQDRLNTKKLMLDLIDRVRDESDGEHPVRLVFEPKSSRIDTDTF
FT                   INTLMAQTSLEGNVSMNLVMMGLDNRPAQKNLKTILQEWLDFRVVTVTRRLKFRLNQVE
FT                   KRLHILEGRLKVFLHIDEVIKVIRESDDPKADLMAVFGLTEIQAEDILEIRLRQLARLE
FT                   GFKLEKELNELREEQGRLNILLGDENEKRKLIIKEMQADMKQFGDARRTLVEEAGRAVL
FT                   TQTAADEPITLILSEKGWIRSRAGHNLDLSQTAFKEGDRLKQTLEGRTVLPVVILDSSG
FT                   RTYSIDAAEIPGGRGDGVPVSSLIELQNGAKPVAMLTGLPEQHYLLSSSGGYGFIAKLG
FT                   DMVGRVKAGKVVMTADSGETVLPPVAVYASSFINPDCKIIAATSQNRALAFPIGELKIM
FT                   AKGKGLQIIGLNAGESMTHTAVSSEPEILIESEGRRGAAHKDRLPVALIEAKRGKKGRL
FT                   LPISGSLKQLSSPK"
FT   gene            196115..196798
FT                   /locus_tag="NGK_0248"
FT   CDS_pept        196115..196798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0248"
FT                   /product="phosphoglyceromutase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28942"
FT                   /db_xref="GOA:B4RIY7"
FT                   /db_xref="InterPro:IPR005952"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="PDB:5UM0"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4RIY7"
FT                   /protein_id="ACF28942.1"
FT                   /translation="MELVFIRHGQSEWNAKNLFTGWRDVKLSEQGLAEAAAAGKKLKEN
FT                   GYEFDIAFTSVLTRAIKTCNIVLEESDQLFVPQIKTWRLNERHYGRLQGLDKKQTAEKY
FT                   GDEQVRIWRRSYDTLPPLLDKDDAFSAHKDRRYAHLPADVVPDGENLKVTLERVLPFWE
FT                   DQIAPAILSGKRVLVAAHGNSLRALAKHIEGISDEDIMGLEIPTGQPLVYKLDDNLKVI
FT                   EKFYL"
FT   gene            196815..196958
FT                   /locus_tag="NGK_0249"
FT   CDS_pept        196815..196958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0249"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28943"
FT                   /db_xref="UniProtKB/TrEMBL:B4RIY8"
FT                   /protein_id="ACF28943.1"
FT                   /translation="MPSEGLSISDGIFDGKRREGFSLPINNRKRRNSNRRVGFSPLIDK
FT                   QK"
FT   gene            complement(197844..198428)
FT                   /locus_tag="NGK_0250"
FT   CDS_pept        complement(197844..198428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0250"
FT                   /product="IS1016 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28944"
FT                   /db_xref="InterPro:IPR024445"
FT                   /db_xref="UniProtKB/TrEMBL:B4RIY9"
FT                   /protein_id="ACF28944.1"
FT                   /translation="MKITHCKLKKEVQKEPLRSFVPEVTARSAADILGIHPDSAALFYR
FT                   KIRTVANHRLALAADEVFEGPAGPGASCFGGRRKGRRGRGAAGKAVVFGIPKRNGRAYT
FT                   VAEDDAEPETLPPAVKKKIMPDGIVYADSPGSRGKLDAGGFTRCRINRSKEFADRRNHI
FT                   NGIGNFWNQAKRALRKYNGIDRKPFPPFLRE"
FT   gene            complement(199230..201854)
FT                   /locus_tag="NGK_0251"
FT   CDS_pept        complement(199230..201854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0251"
FT                   /product="AlaS"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28945"
FT                   /db_xref="GOA:B4RIZ0"
FT                   /db_xref="InterPro:IPR002318"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018162"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR018164"
FT                   /db_xref="InterPro:IPR018165"
FT                   /db_xref="InterPro:IPR023033"
FT                   /db_xref="UniProtKB/TrEMBL:B4RIZ0"
FT                   /protein_id="ACF28945.1"
FT                   /translation="MKTSELRQKFLKFFETKGHTVVRSSSLVPHDDPTLLFTNAGMNQF
FT                   KDVFLGFDKRPYSRATTAQKCVRAGGKHNDLENVGYTARHHTFFEMMGNFSFGDYFKRD
FT                   AIHFAWEFLTSPEWLNIPKDKLLATVYAEDDEAYNIWLNEIGMPSERIVRIGDNKGAKY
FT                   ASDNFWQMGDTGPCGPCSEIFYDHGKEIWGGIPGSPEEDGDRWIEIWNCVFMQFNRDEQ
FT                   GNMNPLPKPSVDTGMGLERMAAVMQHVHSNYEIDLFQDLLKAVARETGAPFSMEEPSLK
FT                   VIADHIRSCSFLIADGVLPSNEGRGYVLRRIIRRAVRHGYKLGQSKPFFHKLVADLVQE
FT                   MGGAYPELKEKQAQIEEALKNEESRFAQTLETGMALLENALAKGGKTLGGEIIFKLYDT
FT                   YGFPYDLTADICRERNIEPDEAGFEREMEAQRARARAAQSFKANAQLPYDGQDTEFKGY
FT                   SERQTESKVLALYKDGGQVVELNEGDSGAVVIDFTPFYAESGGQVGDVGYIFAGENRFE
FT                   VRDTQKIKAAVFGQFGVQTSGRLKVGDSVTAKVDDEIRNANMRNHSATHLMHKALRDVL
FT                   GGHVEQKGSLVTAESTRFDISHPQAVTAEEIAEVERRVNEAVLANVAVNAAIMSMEDAQ
FT                   KTDAMMLFGEKYGDEVRVLQMGGFSTELCGGTHVSRTGDIGLFKIISEGGIAAGVRRIE
FT                   AITGLNALKWAQEQERLVKDIIAETKAQTEKDVLAKIQAGAAHAKALEKELARAKAELA
FT                   VHAGAKLLDDAKDLGAAKLVAAQIEADAAALRETVTDLTGKSDNAVILLAAVNEGKVSL
FT                   CAGVSKALTGKVKAGDLVKFAAEQVGGKGGGRPDLAQAGGTDADKLPEMLASAEGWLCQ
FT                   KLS"
FT   gene            201886..202020
FT                   /locus_tag="NGK_0252"
FT   CDS_pept        201886..202020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0252"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28946"
FT                   /db_xref="UniProtKB/TrEMBL:B4RIZ1"
FT                   /protein_id="ACF28946.1"
FT                   /translation="MVKAGKTNGGILPQIPVSSYGSGGFQTALRDFECRLKPCYQYRL"
FT   gene            202058..203188
FT                   /locus_tag="NGK_0253"
FT   CDS_pept        202058..203188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0253"
FT                   /product="Spermidine/putrescine ABC transporter,
FT                   periplasmic spermidine/putrescine-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28947"
FT                   /db_xref="GOA:B4RIZ2"
FT                   /db_xref="InterPro:IPR001188"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:B4RIZ2"
FT                   /protein_id="ACF28947.1"
FT                   /translation="MVKHLPLAVLTALLLAACGGSDKPPAEKPAPAENQNVLKIYNWSE
FT                   YVDPETVADFEKKNGIKVTYDVYDSDETLESKVLTGKSGYDIVAPSNAFVGRQIKAGAY
FT                   QKIDKSMIPNYKHLNPEMMRLMDGVDPDHEYAVPFYWGTNTFAINTERVKKALGTDKLP
FT                   DNQWDLVFNPEYTFKLKQCGISYLDSAAEIYPMVLNYLGKNPNSSNTEDIREATALLKK
FT                   NRPNIKRFTSSGFIDDLARGDTCVTIGFGGDLNIAKRRAEEAGGKEKIRVMMPKEGVGI
FT                   WVDSFVIPKDAKNVANAHKYINDFLDPEVSAKNGNFVTYAPSSKPARDLMEDEFKNDNT
FT                   IFPSGEDLKNSFIMVPIRPAALKFMVRQWQDVKAGK"
FT   gene            complement(203229..204131)
FT                   /locus_tag="NGK_0255"
FT   CDS_pept        complement(203229..204131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0255"
FT                   /product="Conserved hypothetical integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28949"
FT                   /db_xref="GOA:B4RIZ3"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B4RIZ3"
FT                   /protein_id="ACF28949.1"
FT                   /translation="MDTAKKDILGSGWMLVAAACFTVMNVLIKEASAKFALGSGELVFW
FT                   RMLFSTVTLGAAAVLRRDTFRTPHWKNHLNRSMVGTGAMLLLFYAVTHLPLTTGVTLSY
FT                   TSSIFLAVFSFLILKERISVYTQAVLLLGFAGVVLLLNPSFRSGQEPAALAGLAGGAMS
FT                   GWAYLKVRELSLAGEPGWRVVFYLSATGVAMSSVWATLTGWHTLSFPSAVYLSGIGVSA
FT                   LIAQLSMTRAYKVGDKFTVASLSYMTVVFSALSAAFFLGEELFWQEILGMCIIILSGIL
FT                   SSIRPIAFKQRLQALFRQR"
FT   gene            204270..204767
FT                   /locus_tag="NGK_0254"
FT   CDS_pept        204270..204767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0254"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28948"
FT                   /db_xref="InterPro:IPR012640"
FT                   /db_xref="UniProtKB/TrEMBL:B4RIZ4"
FT                   /protein_id="ACF28948.1"
FT                   /translation="MAGMKKYLIPLSIAAVLSGCQSIYVPTLTEIPVNPINTVKTEAPA
FT                   KGFRLAPSHWADVAKISDEATRLGYQVGIGKMTKVQAAQYLNNFRKRLVGRNAVDDSMY
FT                   EIYLRSAVDSQRGEINTEQSKLYIENALRGWQQRWKNMDAKPDNPAFTNFLMEVMKMQP
FT                   LK"
FT   gene            complement(204829..205734)
FT                   /locus_tag="NGK_0256"
FT   CDS_pept        complement(204829..205734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0256"
FT                   /product="MtrA"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28950"
FT                   /db_xref="GOA:B4RIZ5"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR032783"
FT                   /db_xref="UniProtKB/TrEMBL:B4RIZ5"
FT                   /protein_id="ACF28950.1"
FT                   /translation="MDILDKLVDLAQLTGSADVQCLLGGQWSVRHETLQCEGLVHIVTA
FT                   GSGYLCIDGETSPRPVGTGDIVFFPRGLGHVLSHDGKYGESLQPDIRQNGTFMVKQCGN
FT                   GLDMSLFCARFRYDTHADLMNGLPETVFLNIAHPSLQYVVSMLQLESEKPLTGTVSVVN
FT                   ALPSVLLVLILRAYLEQDKDVELSGVLKGWQDKRLGHLIQKVIDKPEDEWNIDKMVAAA
FT                   NMSRAQLMRRFKSQVGLSPHAFVNHIRLQKGALLLKKTPDSVLEVALSVGFQSETHFGK
FT                   AFKRQYHVSPGQYRKEGGQK"
FT   gene            205863..206198
FT                   /locus_tag="NGK_0257"
FT   CDS_pept        205863..206198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0257"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28951"
FT                   /db_xref="GOA:B4RIZ6"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:B4RIZ6"
FT                   /protein_id="ACF28951.1"
FT                   /translation="MFKDWKEHTALVKKSFGELGKAHPKMLQAYGALEQAAAAEALDAK
FT                   TRELIAIAVAITTRCESCISVHAAAAAKAGATDSEIAGALATAIALNAGAAYTYALRAL
FT                   EAVETQK"
FT   gene            206216..206332
FT                   /locus_tag="NGK_0258"
FT   CDS_pept        206216..206332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0258"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28952"
FT                   /db_xref="UniProtKB/TrEMBL:B4RIZ7"
FT                   /protein_id="ACF28952.1"
FT                   /translation="MPSENISDGILPVMLPDILQTTYAAVFFRRHLRNMEQV"
FT   gene            206329..206799
FT                   /locus_tag="NGK_0259"
FT   CDS_pept        206329..206799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0259"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28953"
FT                   /db_xref="GOA:B4RIZ8"
FT                   /db_xref="UniProtKB/TrEMBL:B4RIZ8"
FT                   /protein_id="ACF28953.1"
FT                   /translation="MKYHRLALFAAISCLLLSAVFIAPYLTAFHEQEKIFEYADLTVTA
FT                   PNRSGRAIKLEADGRQYRLSCYGFDSLCTGGNIGRAIRARQVKIVLSETVGKGFLNGVL
FT                   LEYRNSGSVYSNKDFSRTEDRLVEVLAQPAVFSLKPGILLLLPAIFLRLKKM"
FT   gene            206905..207468
FT                   /locus_tag="NGK_0260"
FT   CDS_pept        206905..207468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0260"
FT                   /product="PgsA"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28954"
FT                   /db_xref="GOA:B4RIZ9"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR004570"
FT                   /db_xref="UniProtKB/TrEMBL:B4RIZ9"
FT                   /protein_id="ACF28954.1"
FT                   /translation="MPWNIPIFLTWLRVLLIPVLIVLFYLPFSWFSEEAVNVAAAVIFA
FT                   VAALTDWFDGFLARLWKQTSDFGAFLDPVADKLMVAVSLLLLVKLDRTYVLFAMIIIGR
FT                   EITISALREWMAQMGKRSSVAVAAVGKFKTAAQMLAIFFLLLNFPDFYGFNLVVIGNIL
FT                   MFIASLLTVWSMLYYLKMAWKEIA"
FT   gene            207549..207624
FT                   /locus_tag="NGK_trnaGly1"
FT   tRNA            207549..207624
FT                   /locus_tag="NGK_trnaGly1"
FT                   /product="tRNA-Gly"
FT   gene            207650..207725
FT                   /locus_tag="NGK_trnaGly2"
FT   tRNA            207650..207725
FT                   /locus_tag="NGK_trnaGly2"
FT                   /product="tRNA-Gly"
FT   gene            207751..207826
FT                   /locus_tag="NGK_trnaGly3"
FT   tRNA            207751..207826
FT                   /locus_tag="NGK_trnaGly3"
FT                   /product="tRNA-Gly"
FT   gene            207852..207925
FT                   /locus_tag="NGK_trnaCys1"
FT   tRNA            207852..207925
FT                   /locus_tag="NGK_trnaCys1"
FT                   /product="tRNA-Cys"
FT   gene            208026..208115
FT                   /locus_tag="NGK_trnaLeu2"
FT   tRNA            208026..208115
FT                   /locus_tag="NGK_trnaLeu2"
FT                   /product="tRNA-Leu"
FT   gene            208165..209271
FT                   /locus_tag="NGK_0261"
FT   CDS_pept        208165..209271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0261"
FT                   /product="putative protease"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28955"
FT                   /db_xref="GOA:B4RJ00"
FT                   /db_xref="InterPro:IPR002142"
FT                   /db_xref="InterPro:IPR013703"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJ00"
FT                   /protein_id="ACF28955.1"
FT                   /translation="MGMDNIDMFMPEQEEIQSMWKEILLNYGIFLLELLTVFGAIALIV
FT                   LAIVQSKKQSESGSVVLTDFSENYKKQRQSFETFFLSEEETKHQEKKEKKKEKAEAKAE
FT                   KKRLKEGGEKSAETQKSRLFVLDFDGDLYAHAVESLRHEITAVLLIAKPEDEVLLRLES
FT                   PGGVVHGYGLAASQLRRLRERNIPLTVAVDKVAASGGYMMACVADKIVSAPFAIIGSVG
FT                   VVAEVPNIHRLLKKHDIDVDVMTAGEFKRTVTFMGENTEKGKQKFRQELEETHQLFKQF
FT                   VSENRPGLDIEKIATGEHWFGRQALALNLIDEISTSDDLLLKAFENKQVIEVKYQEKRS
FT                   LIQRIGLQAEASVEKLFAKLVNRRADVM"
FT   gene            complement(209322..210176)
FT                   /locus_tag="NGK_0262"
FT   CDS_pept        complement(209322..210176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0262"
FT                   /product="Integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28956"
FT                   /db_xref="GOA:B4RJ01"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJ01"
FT                   /protein_id="ACF28956.1"
FT                   /translation="MWKMLKHIAKTHRKRLIGTFSPVGLENLLMLGYPVFGGWAINAVI
FT                   AGRVWQALLYALVVFLMWLVGAARRIADTRTFTRIYTEIAVPVVLEQRQRQVPHSAVTA
FT                   RVALSREFVSFFEEHLPIAATSVVSIFGACIMLLVLEFWVGVSAVGILALFLWLLPRFA
FT                   AISENLYFRLNNSLERDNHFDERQLYRHYGLVSRLRVLISNREAFGYLCVGAAMGILFG
FT                   FAFVMMTLKGYGSAGHIYSVGTYLWMFAMSLDDVPRLVEQYSNLKDIGQRIEWSERNIK
FT                   AGT"
FT   gene            complement(210187..210618)
FT                   /locus_tag="NGK_0263"
FT   CDS_pept        complement(210187..210618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0263"
FT                   /product="putative MarR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28957"
FT                   /db_xref="GOA:B4RJ02"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJ02"
FT                   /protein_id="ACF28957.1"
FT                   /translation="MNRLDQLGIRINLICNVFDKWIGQQDLNYNLFTVLYTLATEGSRT
FT                   QKHIGEEWSLPKQTVSGVCKTLAGQGLIEWQEGEQDRRERLLSLTEKGKVHAAPLTENA
FT                   QEFSDKVFSTFGDKRTTRLFADLDALAEVMEKTISENKK"
FT   gene            complement(210853..211722)
FT                   /locus_tag="NGK_0264"
FT   CDS_pept        complement(210853..211722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0264"
FT                   /product="3-hydroxyacid dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28958"
FT                   /db_xref="GOA:B4RJ03"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJ03"
FT                   /protein_id="ACF28958.1"
FT                   /translation="MSAETYTQIGWVGLGQMGLPMVTRLLDGGIEVGVYNRSPDKTAPI
FT                   SAKGAKVYGSTAELVRACPVIFLMVSDYAAVCDILNGVRDGLAGKIIVNMSTISPTENL
FT                   AVKALVEAAGGQFAEAPVSGSVGPATNGTLLILFGGSEAVLNPLQKIFSLVGKKTFHFG
FT                   DVGKGSGAKLVLNSLLGIFGEAYSEAMLMARQFGIDTDTIVEAIGGSAMDSPMFQTKKS
FT                   LWANREFPPAFALKHASKDLNLAVKELEQAGNTLPAVETVAASYRKAVEAGYGEQDVSG
FT                   VYLKLAEH"
FT   gene            complement(211798..212709)
FT                   /locus_tag="NGK_0265"
FT   CDS_pept        complement(211798..212709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0265"
FT                   /product="imidazoleglycerol-phosphate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28959"
FT                   /db_xref="GOA:B4RJ04"
FT                   /db_xref="InterPro:IPR000807"
FT                   /db_xref="InterPro:IPR020565"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR038494"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJ04"
FT                   /protein_id="ACF28959.1"
FT                   /translation="MTKTQLHLNNFLTLAQEAGSLPKLAKLCGYRTPVALYKLKQRLEK
FT                   QAEDPDARGIRPSLMAKLEKHTGKPKGWLDRKHRERTVPETAAESTGTAETRIAETASA
FT                   AGCRSVTVNRNTCETQITVSINLDGSGKSRLDTGVPFLEHMIDQIARHGMIDIDISCKG
FT                   DLHIDDHHTAEDIGITLGQAIRQALGDKKGIRRYGHSYVPLDEALSRVVIDLSGRPGLV
FT                   YNIEFTRALIGRFDVDLFEEFFHGIVNHSMMTLHIDNLSGKNAHHQAETVFKAFGRALR
FT                   MAVEHDPRMAGQTPSTKGTLTA"
FT   gene            complement(212726..213805)
FT                   /locus_tag="NGK_0266"
FT   CDS_pept        complement(212726..213805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0266"
FT                   /product="histidinol-phosphate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28960"
FT                   /db_xref="GOA:B4RJ05"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR005861"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4RJ05"
FT                   /protein_id="ACF28960.1"
FT                   /translation="MKSVRSFIRNDILAMSAYKITDVPPGFAKLDAMESPAHPFEGHEA
FT                   LMREWRAQLASAPIHLYPNPSGCGLQEALRSAFDIPDCAAVALGNGSDELIQFITMLTA
FT                   KPGAAMLAAEPGFIMYRHNAALYGMDYVGVPLNGDFTLNLPAVLEAVRKHRPALTFIAY
FT                   PNNPTGVCFTRAEIEAAIEASDGIVVVDEAYGAFNGDSFLPQAGRIPNLIVLRTLSKIG
FT                   FAGLRIGYATGCPEVIGELQKILPPYNMNQLSLTTAKLALQHYGIISANIDSLKNERER
FT                   MFAELGKICRLNAFPSQANFITIRVPDADLLFDTLKQNRILVKKLHGAHPLLEHCLRIT
FT                   IGSSAQNDAVLDVIRRLYR"
FT   gene            complement(213851..215140)
FT                   /locus_tag="NGK_0267"
FT   CDS_pept        complement(213851..215140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0267"
FT                   /product="histidinol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28961"
FT                   /db_xref="GOA:B4RJ06"
FT                   /db_xref="InterPro:IPR001692"
FT                   /db_xref="InterPro:IPR012131"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR022695"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJ06"
FT                   /protein_id="ACF28961.1"
FT                   /translation="MKKLNTQSPDFQAGLKALLAFETAQNPETERIVADICADVQKRGD
FT                   AALIEYTNKFDQTNAKSIDDLILTQADLNAAFERIPNDVQTALQTAARRVESYHQRQKM
FT                   ESWSYTDEDGTLLGQQITPLDRVGIYVPGGKAAYPSSVIMNAMPAHVAGVKEIIMVVPT
FT                   PKGERNDIVLAAAYVAGVTKVFTVGGAQAIAALAYGTETIPQVDKITGPGNAFVAAAKR
FT                   RVFGVVGIDMVAGPSEILVIADGTTPADWVAMDLFSQAEHDEIAQAILIGTSQAYLDEV
FT                   EAAMDRLIETMPRRDIIEASLGNRGAMILVKDLNEACEISNYISPEHLELSVENPQEWA
FT                   KKIRHAGAIFMGRYTGESLGDYCAGPNHVLPTSRTARFSSPLGTYDFQKRSSLIQVSEQ
FT                   GAQKLGETASVLAHGESLTAHARAAEFRMK"
FT   gene            complement(215137..216024)
FT                   /locus_tag="NGK_0268"
FT   CDS_pept        complement(215137..216024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0268"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28962"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJ07"
FT                   /protein_id="ACF28962.1"
FT                   /translation="MVAKIKKFSDSTLSVLNNGERRFYVYCLTDLKKDKILYIGKGCGN
FT                   RIFEHEWVASRSQDPVSGEIIDRKLKAISKCKKLGRYIISYHLTEVEALAAESALIHFV
FT                   KSVLGKKLKNKIAGHGPGGISVEELDRRFGFSSLPLSEINPDGLILAIKIHNAFDLDTD
FT                   EELDYLFDNQDDANLKSRTLGNWVIGKDVASKVKYVIGVHTGLQNAVVSAYEVDGFETM
FT                   TEETKNGRKQTRYRFRTTSRSEEVLAKLGLQQKCLPELKFGSGGGKAYIRPKTEQETLQ
FT                   TIPSPKITKENPKS"
FT   gene            complement(216116..216850)
FT                   /locus_tag="NGK_0269"
FT   CDS_pept        complement(216116..216850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0269"
FT                   /product="ATP phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28963"
FT                   /db_xref="GOA:B4RJ08"
FT                   /db_xref="InterPro:IPR001348"
FT                   /db_xref="InterPro:IPR013820"
FT                   /db_xref="InterPro:IPR018198"
FT                   /db_xref="InterPro:IPR024893"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJ08"
FT                   /protein_id="ACF28963.1"
FT                   /translation="MPSAPPAPVQTALLFQPTKDIHTMQDNALTIALSKGRIFEETLPL
FT                   LAAAGIAPTEEPEKSRKLIIGTNHENIRLVIVRATDVPTYVRYGAADFGIAGKDVLIEH
FT                   GGTGLYRPLDLEIAKCRMMVAVRKGFDYEAASQPGCRLKIATKYPEIAASHFAGKGVHV
FT                   DIIKLYGSMELAPLVGLSDAIVDLVSTGNTLKANGLEAVEHIVDISSYLVVNKAALKTK
FT                   YALLEPIIQSFGGAVKAKWAFI"
FT   gene            complement(216860..217513)
FT                   /locus_tag="NGK_0270"
FT   CDS_pept        complement(216860..217513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0270"
FT                   /product="Lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28964"
FT                   /db_xref="GOA:B4RJ09"
FT                   /db_xref="InterPro:IPR003782"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJ09"
FT                   /protein_id="ACF28964.1"
FT                   /translation="MFSVPRSFLPGVFVLAALAACKPQDNSAAQAASSSASAPAAENAA
FT                   KPQTRGTDMRKEDIGGDFTLTDGEGKPFSLSDLKGKVVILSFGFTHCPDVCPTELLTYS
FT                   DTLKQLGGQAKDVKVVFVSIDPERDTPEIIGKYAKQFNPDFIGLTATGGQNLPVIKQQY
FT                   RVVSAKINQKDDSENYLVDHSSGAYLIDKNGEVAIFSPYGSEPETIAADVRTLL"
FT   gene            complement(217592..217759)
FT                   /locus_tag="NGK_0271"
FT   CDS_pept        complement(217592..217759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0271"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28965"
FT                   /db_xref="GOA:B4RJ10"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJ10"
FT                   /protein_id="ACF28965.1"
FT                   /translation="MRFCKPFFEIILSVFILFLILNRIFIILILLFFPLQRFCMIRQFL
FT                   PYGQRKKILH"
FT   gene            217789..217873
FT                   /locus_tag="NGK_trnaLeu3"
FT   tRNA            217789..217873
FT                   /locus_tag="NGK_trnaLeu3"
FT                   /product="tRNA-Leu"
FT   gene            217907..218023
FT                   /locus_tag="NGK_0272"
FT   CDS_pept        217907..218023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0272"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28966"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJ11"
FT                   /protein_id="ACF28966.1"
FT                   /translation="MLFNEIDKTKYSGLNLNRYGVASPCRTICTVCGFVVLS"
FT   gene            218567..220294
FT                   /locus_tag="NGK_0273"
FT   CDS_pept        218567..220294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0273"
FT                   /product="IlvI"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28967"
FT                   /db_xref="GOA:B4RJ12"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR039368"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJ12"
FT                   /protein_id="ACF28967.1"
FT                   /translation="MQLSGAQIIVQSLKAEGVEYVFGYPGGAVIEIYDALFQLNKFKHI
FT                   LTRHEQAAVHAADAYARVSGKVGVALVTSGPGVTNALTGIATAYTDSIPMVVISGQVGN
FT                   SLIGTDAFQEVDTVGITRPCVKHNFLVTDINELVETIKKAFQIAASGRPGPVVLDVPKD
FT                   VTQAMAKFSYPQEDIFIRSYQPVVQGHIGQIKKAVQMLASAKRPVVYFGGGVVLGNASE
FT                   ELTRFVRMTGAPCTGTLMGLGAYPSGDRQFLGMLGMHGTYEANLAMQNADVVLAVGARF
FT                   DDRVVSVPSKFFEKAKKVIHIDVDPSSIAKRVKADIPIVGDVKNILSEMVALWQKQESV
FT                   PSEDALGKWWKTIEEWRSRDCLWFDNGSEIIKPQYVIQKLAEITGNSAIITSDVGQHQM
FT                   FAAQYYPFERPRQWLNSGGLGTMGVGLPYAIGAKLAAPDQDVFCITGDGSIQMNIQELS
FT                   TCFQYRIPVNVITLNNGYLGMVRQWQEIYYGGRESETYFDSLPDFVKLAEAYGHIGIRV
FT                   DKKSDVEGALLEALNQKDRLVFIDFLTDQKQNVMPMVGNGKGLDEMVLPPHMRTDGKA"
FT   gene            220305..220796
FT                   /locus_tag="NGK_0274"
FT   CDS_pept        220305..220796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0274"
FT                   /product="acetolactate synthase isozyme III small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28968"
FT                   /db_xref="GOA:B4RJ13"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004789"
FT                   /db_xref="InterPro:IPR019455"
FT                   /db_xref="InterPro:IPR027271"
FT                   /db_xref="InterPro:IPR039557"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJ13"
FT                   /protein_id="ACF28968.1"
FT                   /translation="MRHILSVLIENESGAMSRVVGLFSARDYNIDSLAVAPTEDKTLSR
FT                   MTIVTHGDEQVIEQITKQLNKLIEVIKVVDLNESRFVERELMLVKVRAAGKDRDEFLRL
FT                   TEIYRGSIIDVTDRSYTIEITGSTDKLDSFLETVGRAQILETVRTGAAGIGRGERILKI
FT                   "
FT   gene            220818..221156
FT                   /locus_tag="NGK_0275"
FT   CDS_pept        220818..221156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0275"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28969"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJ14"
FT                   /protein_id="ACF28969.1"
FT                   /translation="MVFECRLKNERQERFMSNIKIVALVTVKPEYTETLAAQFKELVKA
FT                   SRAEEGNISYNLHQEIGKPNRFVFVENWKSQAAIDEHNASAHFQAFVQSVDGKTEALEI
FT                   VLMNEVAV"
FT   gene            221140..222249
FT                   /locus_tag="NGK_0276"
FT   CDS_pept        221140..222249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0276"
FT                   /product="ketol-acid reductoisomerase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28970"
FT                   /db_xref="GOA:B4RJ15"
FT                   /db_xref="InterPro:IPR000506"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013023"
FT                   /db_xref="InterPro:IPR013116"
FT                   /db_xref="InterPro:IPR014359"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJ15"
FT                   /protein_id="ACF28970.1"
FT                   /translation="MKLPFKRHTLFNPSEAAQHFKASTTIYLKGNQMQVYYDKDADLSL
FT                   IKGKTVAIIGYGSQGHAHAANLKDSGVNVVIGLRHGSSWKKAEAAGHVVKTVAEATKEA
FT                   DVVMLLLPDETMPAVYHAEVAANLKEGATLAFAHGFNVHYNQIVPRADLDVIMVAPKGP
FT                   GHTVRSEYKRGGGVPSLIAVYQDNSGKAKDIALSYAAANGGTKGGVIETTFREETETDL
FT                   FGEQAVLCGGVAELIKAGFETLTEAGYAPEMAYFECLHEMKLIVDLIFEGGIANMNYSI
FT                   SNNAEYGEYVTGPEVVNASSKEAMRNALKRIQTGEYAKMFIQEGNVNYASMTARRRLNA
FT                   DHQVEKVGARLRAMMPWITANKLVDQDKN"
FT   gene            complement(222368..223363)
FT                   /locus_tag="NGK_0277"
FT   CDS_pept        complement(222368..223363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0277"
FT                   /product="OtcC"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28971"
FT                   /db_xref="GOA:B4RJ16"
FT                   /db_xref="InterPro:IPR002292"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR024904"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJ16"
FT                   /protein_id="ACF28971.1"
FT                   /translation="MNLKNRHFLKLLDFTPEEITTYLDLAAELKDAKKAGREIQRMKGK
FT                   NIALIFEKTSTRTRCAFEVAARDQGADATYLEPSASQIGHKESIKDTARVLGRMYDAIE
FT                   YRGFAQETVEELAKYAGVPVFNGLTNEFHPTQMLADALTMREHSGKPLNQTAFAYVGDA
FT                   RYNMGNSLLILGAKLGMDVRIGAPQSLWPSEGIIAAAHAAAKETGAKITLTENAHEAVK
FT                   GVGFIHTDVWVSMGEPKEVWQERIDLLKDYRVTPELMAASGNPQVKFMHCLPAFHNRET
FT                   KVGEWIYETFGLNGVEVTEEVFESPAGIVFDQAENRMHTIKAVMVAALGD"
FT   gene            complement(223505..226090)
FT                   /locus_tag="NGK_0278"
FT   CDS_pept        complement(223505..226090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0278"
FT                   /product="aconitate hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28972"
FT                   /db_xref="GOA:B4RJ17"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004406"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015929"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR015932"
FT                   /db_xref="InterPro:IPR015933"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="InterPro:IPR036288"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJ17"
FT                   /protein_id="ACF28972.1"
FT                   /translation="MLEAYRKAAAERAALGIPALPLNAQQTADLVELLKNPPAGEGEFL
FT                   VELLAHRVPPGVDDAAKVKASFLAAVAEGSASSPLVSPKYATELLGTMLGGYNIHALIE
FT                   LLDDDKLAPIAAKGLKHTLLMFDSFHDVQEKAEKGNKYAQEVLQSWADAEWFASRAKVP
FT                   EKITVTVFKVDGETNTDDLSPAPDAWSRPDIPLHALAMLKNPRDGITPDKPGEVGPIKL
FT                   LEELKAKGHPVAYVGDVVGTGSSRKSATNSVIWHTGEDIPFVPNKRFGGVCLGGKIAPI
FT                   FFNTQEDSGALPIEVDVSALKMGDVVNILPYEGKIVKNGETVAEFELKSQVLLDEVQAG
FT                   GRINLIIGRGLTAKAREALKLPASTAFRLPQAPAESKVGFTLAQKMVGRACGLPEGQGV
FT                   RPGTYCEPRMTTVGSQDTTGPMTRDELKDLACLGFSADMVMQSFCHTAAYPKPVDVKTH
FT                   KELPAFISTRGGVSLRPGDGVIHSWLNRLLLPDTVGTGGDSHTRFPIGISFPAGSGLVA
FT                   FAAATGVIPLDMPESVLVRFSGKLQPGVTLRDLVNAIPLYAIKQGLLTVAKAGKKNIFS
FT                   GRILEIEGLPDLKVEQAFELTDASAERSAAGCTVKLNKEPIIEYMKSNVVLMKNMIANG
FT                   YQDPRALERRIKAMEKWLANPELLEADKDAEYAAVIEINMDDIKEPIIACPNDPDDVCF
FT                   MSERSGTKIDEVFIGSCMTNIGHFRAASKLLEGKSDIPVRLWVAPPTKMDAKELSDEGH
FT                   YGVLGRAGARMEMPGCSLCMGNQAQVREGATVMSTSTRNFPNRLGKNTFVYLGSAELAA
FT                   ICSKLGKIPTVEEYQANIGIINEQGDKIYRYMNFNEIDSYNEVAETVNV"
FT   gene            complement(226238..226399)
FT                   /locus_tag="NGK_0279"
FT   CDS_pept        complement(226238..226399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0279"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28973"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJ18"
FT                   /protein_id="ACF28973.1"
FT                   /translation="MPSEPLFRRHLFSLTHSRRHIAVPYYSGLNLNRYGVASPCRTICT
FT                   VCGFAALS"
FT   gene            complement(226404..227474)
FT                   /locus_tag="NGK_0280"
FT   CDS_pept        complement(226404..227474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0280"
FT                   /product="Conserved hypothetical integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28974"
FT                   /db_xref="GOA:B4RJ19"
FT                   /db_xref="InterPro:IPR005495"
FT                   /db_xref="InterPro:IPR030923"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJ19"
FT                   /protein_id="ACF28974.1"
FT                   /translation="MNLISRYIIRQMAVMAVCALLAFLALYSFFEILYETGNLGKGSYG
FT                   IWEMLGYTALKMPARAYELMPLAVLIGGLASLSQLAAGSELAVIKASGMSTKKLLLILS
FT                   QFGFIFAIAAVALGEWVAPTLSQKAENIKAAAINGKISTGHTGLWLKEKNSIINVRGML
FT                   PDHTLLGIKIWARNDKNELAEAVEADSAVLNSDGSWQLKNIRRSIMGTDKIETSAAAEE
FT                   TWPIAVRRNLMDVLLVKPDQMSVGELTTYIRHLQNNSQNTQIYAIAWWRKLVYPVAAWV
FT                   MALVAFAFTPQTTRHGNMGLKLFGGICLGLLFHLAGRLFGFTSQLYGTPPFLAGALPTI
FT                   AFALLAVWLIRKQEKR"
FT   gene            complement(227471..228586)
FT                   /locus_tag="NGK_0281"
FT   CDS_pept        complement(227471..228586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0281"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28975"
FT                   /db_xref="GOA:B4RJ20"
FT                   /db_xref="InterPro:IPR005495"
FT                   /db_xref="InterPro:IPR030922"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJ20"
FT                   /protein_id="ACF28975.1"
FT                   /translation="MIYQRNLIKELSFTAVGIFVVLLAVLVSTQAINLLGRAADGRVAI
FT                   DAVLALVGFWVIGMTPLLLVLTAFISTLTVLTRYWRDSEMSVWLSCGLALKQWIRPVMQ
FT                   FAVPFAILIAVMQLWVIPWAELRSREYAEILKQKQELSLVEAGEFNNLGKRNGRVYFVE
FT                   TFDTESGIMKNLFLREQDKNGGDNIIFAKEGNFSLNDNKRTLELRHGYRYSGTPGRADY
FT                   NQVSFQKLNLIISTTPKLIDPVSHRRTISTAQLIGSSNPQHQAELMWRISLTVSVLLLC
FT                   LLAVPLSYFNPRSGHTYNILIAIGLFLIYQNGLTLLFEAVEDGKIHFWLGLLPMHIIMF
FT                   VIAIVLLRVRSMPSQPFWQAVGKSLTLKGGK"
FT   gene            228575..228757
FT                   /locus_tag="NGK_0282"
FT   CDS_pept        228575..228757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0282"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28976"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJ21"
FT                   /protein_id="ACF28976.1"
FT                   /translation="MINHKIAVRGAVSGSAQADCPRKVSDGASKNGVQSCQPSSDGLLS
FT                   ERPSENYRQPSQSGE"
FT   gene            228760..230166
FT                   /locus_tag="NGK_0283"
FT   CDS_pept        228760..230166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0283"
FT                   /product="AmpA"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28977"
FT                   /db_xref="GOA:B4RJ22"
FT                   /db_xref="InterPro:IPR000819"
FT                   /db_xref="InterPro:IPR008283"
FT                   /db_xref="InterPro:IPR011356"
FT                   /db_xref="InterPro:IPR023042"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJ22"
FT                   /protein_id="ACF28977.1"
FT                   /translation="MEFSTKTEILQEQQAGAQLFVCADKAPEHNTAAHALFSALEEGQN
FT                   FSDTKIPTDNGLQAVAVVRLEKTDRAALNKAAAEAAKWAQNQETVNVDVHAFDEAQAAA
FT                   VAEAFAIAFGNAAYRFDRYKKEAKPAKFSQAVFHSAHEAAVKEALRVAEAQVYGQSLCR
FT                   DLGNAAPNECTPEFLARTAKAEAEKLGAHAKIIEKDYIKENMGSFWSVAKGSVEDPYLV
FT                   ELSYFGAADKEAAPVVLVGKGITFDTGGISLKPGLNMDEMKFDMCGAATVISTFCAAVK
FT                   LQLPINLIAIVATCENMPSGAANKPGDVVKSMKGLTIEVLNTDAEGRLILCDALTYAEQ
FT                   FKPKAVIDVATLTGACIVALGHDVSGVMGNNQDLIDSLLAASYNVDDKAWQLPLFETYK
FT                   DQLKSNFADIPNIGTPGAGTITAATFLSYFTEGYPWAHLDIAGTAWKSGAEKGATGRPV
FT                   PLLMNYLRNL"
FT   gene            230169..230669
FT                   /locus_tag="NGK_0284"
FT   CDS_pept        230169..230669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0284"
FT                   /product="HolC"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28978"
FT                   /db_xref="GOA:B4RJ23"
FT                   /db_xref="InterPro:IPR007459"
FT                   /db_xref="InterPro:IPR036768"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJ23"
FT                   /protein_id="ACF28978.1"
FT                   /translation="MPQCRLKLFRRHHPVKCSNNMPKVTFYTHVDQIPLFTCRLIARAI
FT                   RDGGRILVWSDSFGRLQELDKMLWQYEAESFIPHEIWETEEAMPSDTSVLLACGGNLPR
FT                   IPEGMAVLNLSDGFWNTASVLPARVLEIVGNSLEDLADARERFTAYRRSGFAIEHHGME
FT                   GKA"
FT   gene            230929..231747
FT                   /locus_tag="NGK_0285"
FT   CDS_pept        230929..231747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0285"
FT                   /product="putative peptidyl-prolylisomerase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28979"
FT                   /db_xref="GOA:B4RJ24"
FT                   /db_xref="InterPro:IPR000774"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR036944"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJ24"
FT                   /protein_id="ACF28979.1"
FT                   /translation="MNTIFKISALTLSAALALSACGKKEAAPASASEPAAASAAQGDTS
FT                   SIGGTMQQASYAMGVDIGRSLKQMKEQGAEIDLKVFTDAMQAVYDGKEIKMTEEQAQEV
FT                   MMKFLQEQQAKAVEKHKADAKANKEKGEAFLKENAAKDGVKTTASGLQYKITKQGKGKQ
FT                   PTKDDIVTVEYEGRLIDGTVFDSSKANGGPATFPLSQVIPGWTEGVRLLKEGGEATFYI
FT                   PSNLAYREQGAGEKIGPNATLVFDVKLVKIGAPENAPAKQPDQVDIKKVN"
FT   gene            231758..232480
FT                   /locus_tag="NGK_0286"
FT   CDS_pept        231758..232480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0286"
FT                   /product="putative phosphoribosylglycinamidetransformylase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28980"
FT                   /db_xref="GOA:B4RJ25"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR004607"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJ25"
FT                   /protein_id="ACF28980.1"
FT                   /translation="MPETGFRAFLRQMPSEATKQRFRRHPFQKRTIMKNIVILISGRGS
FT                   NMQAIVNAAIPNVRIAAVLSNSETAAGLQWAAERGIPTDSLNHKNFESRLAFDTAMMEK
FT                   IDAYQPDLVVLAGFMRILTPEFCAHYEGRLMNIHPSILPSFTGLHTHERALEAGCRVAG
FT                   CTIHFVTAELDCGQIVSQGIVPILDGDTADDVAARVLAVEHKLYPKAVADFAAGRLIIE
FT                   GNRVRNSENADAARFLTA"
FT   gene            232496..233167
FT                   /locus_tag="NGK_0287"
FT   CDS_pept        232496..233167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0287"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28981"
FT                   /db_xref="InterPro:IPR021457"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJ26"
FT                   /protein_id="ACF28981.1"
FT                   /translation="MMKTFKNIFSAAILSAALPCAYAARLPQSAVLHYSGSYGIPATMT
FT                   FERSGNAYKIVSTIKVPLYNIRFESGGTVVGNTLHPAYYKDIRRGKLYAEAKFADGSVT
FT                   YGKAGESKTEQSPKAMDLFTLAWQLAANDAKLPPGLKITNGKKLYSVGGLNKAGTGKYS
FT                   IGGVETEVVKYRVRRGDDTVTYFFAPSLNNIPAQIGYTDDGKTYTLKLKSVQINGQAAK
FT                   P"
FT   gene            233246..233707
FT                   /locus_tag="NGK_0288"
FT   CDS_pept        233246..233707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0288"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28982"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJ27"
FT                   /protein_id="ACF28982.1"
FT                   /translation="MQSGFNAIFGNDTMQVTSKWIDGMCFVGTAEGGHSVVMEGSAAEG
FT                   AAKRGPSPLEMLLLGVAGCSSIDVVMIAEKQRQKVTDCRATVTAKRADDAPRVFTEIHI
FT                   HFKVIGHDLKESAIERAVQMSAEKYCSASIMLGKAAKITHSFEIAGAEK"
FT   gene            234230..234946
FT                   /locus_tag="NGK_0289"
FT   CDS_pept        234230..234946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0289"
FT                   /product="putative GntR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28983"
FT                   /db_xref="GOA:B4RJ28"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJ28"
FT                   /protein_id="ACF28983.1"
FT                   /translation="MNFENDDIIHAPTTSSLILEERHDSELFRVYALILDGITDQVLLP
FT                   GKKLTESELCRQMVCSRNTVRGALSLLAHDKIVDLQPNRGAFVHVPDLKEMQDVFNARI
FT                   EMETMILNILAGLPDLETRLKPLYAMIRCEEEASGRGDRVGWNRLSNAFHVELARLVGN
FT                   DVLFDIMNTLCARSSLIVAVAGVHREKKHAINTHTHSEHREILDLLLAGRRNRVVKILR
FT                   RHLGNCMERLEKTLED"
FT   gene            234943..235098
FT                   /locus_tag="NGK_0290"
FT   CDS_pept        234943..235098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0290"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28984"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJ29"
FT                   /protein_id="ACF28984.1"
FT                   /translation="MNAGADKPPEPSGGFLMANLMPSEIWMRVSAIFRRQFLSRTYHAA
FT                   IKEGRG"
FT   gene            235095..235997
FT                   /locus_tag="NGK_0291"
FT   CDS_pept        235095..235997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0291"
FT                   /product="Hypothetical integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28985"
FT                   /db_xref="GOA:B4RJ30"
FT                   /db_xref="InterPro:IPR005642"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJ30"
FT                   /protein_id="ACF28985.1"
FT                   /translation="MSSLMTLFSVLVPMFAGFFIRVPKPYLPASDKVLSVLVYAVLLLI
FT                   GVSLSRVEDLGSRLGDMALTVLWLFVCTVGANLLALAVLGKLSPWRIGGKGKGVSVGVS
FT                   GSVRQLGCVLIGFVSGKLMCDIWMPSENAGMYCLMLLVFLIGVQLKSSGVSLRQVLLNR
FT                   RGIRLSVWFILSSLSGGLLFAASADGVSWTKGLAMASGFGWYSLSGLVMTEAYGAVWGS
FT                   IMLLNDLARELFALAFIPLLMKRFPDAAVGVGGATSMDFTLPVIQGAGGLEVVPVAVSF
FT                   GVVVNIAAPFLMVVFSTLG"
FT   gene            236040..236723
FT                   /locus_tag="NGK_0292"
FT   CDS_pept        236040..236723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0292"
FT                   /product="putative DeoR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28986"
FT                   /db_xref="GOA:B4RJ31"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJ31"
FT                   /protein_id="ACF28986.1"
FT                   /translation="MKPKIQRHGEILSLVRRHQFMSVDELAAALDVTPQTIRCDIRELE
FT                   EGGSLKRHHGGASSGGNLPEGLPADRQTRCQNEKNAIARLIAEHIPDGSSLFVSIGTTM
FT                   EAAASELVKRRSSLRIITNNIHVASVVSARTDYTVIITSGVVRPLDGGITGVATVDFIN
FT                   QFKVDYAVMSTHGVESDGSLLDYDYKEVSVMQAMIANARVRFLGVDHSKFRSNALVRLG
FT                   GITGV"
FT   gene            236798..236917
FT                   /locus_tag="NGK_0293"
FT   CDS_pept        236798..236917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0293"
FT                   /product="Sensor protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28987"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJ32"
FT                   /protein_id="ACF28987.1"
FT                   /translation="MPMPSERYVKARKSGTINTSSNRFRRHTEPPQCRLKPSV"
FT   gene            236893..238614
FT                   /locus_tag="NGK_0294"
FT   CDS_pept        236893..238614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0294"
FT                   /product="glutaminyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28988"
FT                   /db_xref="GOA:B4RJ33"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR004514"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020059"
FT                   /db_xref="InterPro:IPR020061"
FT                   /db_xref="InterPro:IPR022861"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJ33"
FT                   /protein_id="ACF28988.1"
FT                   /translation="MPSEAICLKKTMLNKDQFADNHFIRTIIEDDLKSGKHEAVQTRFP
FT                   PEPNGYLHIGHAKSICLNFGLAYIYDGLCNLRFDDTNPEKENDEYVNAIKEDVEWLGFH
FT                   WAGEPRFASDYFDRLYDYAVGLIKDGKAYVDDLTPEEMREYRGTLTEAGKNSPYRDRSI
FT                   EENLDLFTRMKNGEFPDGSKTLRLKIDMAAGNINMRDPVIYRIRRAHHHNTGDKWCIYP
FT                   MYDYTHCISDAIEGITHSLCTLEFEAHRPLYDWVLDNIPAPHATRPRQYEFSRLELLYT
FT                   ITSKRKLNQLVVEKHVSGWDDPRMPTISGMRRRGYTPEGVRLFAKRAGISKSENIVDMS
FT                   VLEGAIREELENSAPRLMAVLNPLKVTLTNFQAGKTQSRRAAFHPNHEEMGDREVPVSQ
FT                   TIYIEADDFAENPPKGFKRLIPGGEVRLRHGYVIKCGEVVKDEAGNVVELKCSIDHDTL
FT                   GKNPEGRKVKGVIHWVSAEHAAEIKVRLYDRLFTVERPGAVRGEDGEYLPFTDFLNPES
FT                   VKEITAYAEPAAKDLPAESRWQFERIGYFVTDRQDHGKDTPVFNRTVTLKDSWQPK"
FT   gene            238706..239662
FT                   /locus_tag="NGK_0295"
FT   CDS_pept        238706..239662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0295"
FT                   /product="glutathione synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28989"
FT                   /db_xref="GOA:B4RJ34"
FT                   /db_xref="InterPro:IPR004215"
FT                   /db_xref="InterPro:IPR004218"
FT                   /db_xref="InterPro:IPR006284"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJ34"
FT                   /protein_id="ACF28989.1"
FT                   /translation="MKVLFIADPMASFKTYKDTTYAMMREMAKRGWRLFHTLSGELSVN
FT                   GGLVTAQASAFEFSGAKNDDDHEWFKAADKVQTALKEFDAVIMRTDPPFDMQYLYSTQL
FT                   LTLAEQQGAKVFNSGRAMRDFNEKLAILNFSRFTAPTLVTTRSADVRAFLKEHGDIIVK
FT                   PLDGMGGMGIFRLTEKDPNIGSILETLMRFDSRTIMAQRYIPEIVHGDKRILIIGGKVV
FT                   PYALARIPQNGETRGNLAAGGRGVAQELDGRDREIAETLAPELKRSGILLAGLDVIGSN
FT                   LTEVNVTSPTGFQEIMKQKSFDVAAMFADAVAAWSVR"
FT   gene            239821..240204
FT                   /locus_tag="NGK_0296"
FT   CDS_pept        239821..240204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0296"
FT                   /product="DagK"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28990"
FT                   /db_xref="GOA:B4RJ35"
FT                   /db_xref="InterPro:IPR000829"
FT                   /db_xref="InterPro:IPR033718"
FT                   /db_xref="InterPro:IPR036945"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJ35"
FT                   /protein_id="ACF28990.1"
FT                   /translation="MEPSSYAAEKKGKSGIRRVINAFGYSIDGIAAAYRYEAAFRQVLW
FT                   LNALLVCAAFFWVSETAVRLPLIIASFVSVIVELFNTAVEAAVDHTSTEKHELAKRAKD
FT                   AGSAAQLVAMLMLAAVWLSALFG"
FT   gene            240336..240809
FT                   /locus_tag="NGK_0297"
FT   CDS_pept        240336..240809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0297"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28991"
FT                   /db_xref="InterPro:IPR007410"
FT                   /db_xref="InterPro:IPR036182"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJ36"
FT                   /protein_id="ACF28991.1"
FT                   /translation="MKKLLAAVMMAGLAGAVSAAGVHVEDGWARTTVEGMKMGGAFMKI
FT                   HNDEAKQDFLLGGSSPVADRVEVHTHINDNGVMRMREVKGGVPLEAKSVTELKPGSYHV
FT                   MFMGLKKQLKEGDKIPVTLKFKNAKAQTVQLEVKTAPMPAMNHGHHHGEAHQH"
FT   gene            240886..242037
FT                   /locus_tag="NGK_0298"
FT   CDS_pept        240886..242037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0298"
FT                   /product="Probable tRNA
FT                   (5-methylaminomethyl-2-thiouridylate)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28992"
FT                   /db_xref="GOA:B4RJ37"
FT                   /db_xref="InterPro:IPR004506"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023382"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJ37"
FT                   /protein_id="ACF28992.1"
FT                   /translation="MLKSAFKNRRFQAILRMNTTSNTSNIIVGLSGGVDSSVTAALLKQ
FT                   QGYQVRGVFMQNWENDDNDEYCSIKQDSFDAIAVADIVGIDIDIVNFAAQYKDKVFAYF
FT                   LQEYSAGRTPNPDVLCNAEIKFKCFLDYAVGQGADTIATGHYARKEVRNGVHYLLKGLD
FT                   RNKDQSYFLYRLKPFQLERAIFPLGGLEKPEVRRLAAEFNLPTAAKKDSTGICFIGERP
FT                   FREFLQKYLPTDNGKMVTPEGKTIGEHVGLMFYTLGQRKGLGIGGAGEPWFVAAKDLTK
FT                   NELIVVQGHDHPLLYTRSLVMNDLSFTLPERPKAGRYTCKTRYRMADAPCELCYLDDET
FT                   AELVFDEPQWAVTPGQSAVLYDVDICLGGGIIQTTDKPVIITR"
FT   gene            242108..243778
FT                   /locus_tag="NGK_0299"
FT   CDS_pept        242108..243778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0299"
FT                   /product="putative long-chain-fatty-acid--CoA-ligase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28993"
FT                   /db_xref="GOA:B4RJ38"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJ38"
FT                   /protein_id="ACF28993.1"
FT                   /translation="MEKIWLESYEKGVSAEIDITQYNSVSDVFRQSVEKFARLPAFQNM
FT                   GKTLTYAETGKLATDFASYLQNVLKLPRGERVAIMMPNVLQYPIALFGILQAGLVAVNT
FT                   NPLYTPRELEHQLKDSGATAIIVLENFANTLELVLPRTQIKHVIVASVGEMFGLLKGSL
FT                   INFIIRKIKKMVPEYRIRETVSFQTALKEGAKHVFQPVALNREDTALLQYTGGTTGVAR
FT                   GAVLSHGNICANMLQAKEWIKNQLREGKETVIAALPLYHIFALTVNLMIFANAGSKIVL
FT                   IANPRDMKGFIGELKKQRVNVFIGVNTLFNAMVNRPDFAEVDFSGLRLTLGGGMATQKA
FT                   VAEKWKKITGTPIVEAYGLTEASPGVCCNPLNIESYSGSIGLPVPSTEVELRDANGKEV
FT                   PVGQPGELWVKGPQVMQGYWNRPEETAKAIDACGFLETGDIAVMDEKGRLKLVDRKKDL
FT                   VVVSGFNVYPNEIEEFIAHHEKVMEVACIGVPDEKTGEALKVFVVKKDPSLTKEELTAF
FT                   CRTGLTAYKVPKDIEFRDELPKSNVGKILRRELRQSAGK"
FT   gene            243765..243893
FT                   /locus_tag="NGK_0300"
FT   CDS_pept        243765..243893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0300"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28994"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJ39"
FT                   /protein_id="ACF28994.1"
FT                   /translation="MPGNKEKIPSENSRPPFRRHPSVCKNRALHVKITHSNTGIPS"
FT   gene            243890..245524
FT                   /locus_tag="NGK_0301"
FT   CDS_pept        243890..245524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0301"
FT                   /product="CTP synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28995"
FT                   /db_xref="GOA:B4RJ40"
FT                   /db_xref="InterPro:IPR004468"
FT                   /db_xref="InterPro:IPR017456"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033828"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4RJ40"
FT                   /protein_id="ACF28995.1"
FT                   /translation="MTKFIFVTGGVVSSLGKGIAAASIAAILESRGLNVTMLKLDPYIN
FT                   VDPGTMSPFQHGEVFVTDDGAETDLDLGHYERFIDSTMTRRNSFSTGQVYENVIAKERR
FT                   GDYLGGTVQVIPHITDEIKRRIHEGAAGYDVAIVEIGGTVGDIESLPFLEAIRQMRSQL
FT                   GRNNTLFAHLSYVPYIAAAGEIKTKPTQHTVKEMLSIGLQPDILICRMDRKMPADERRK
FT                   IALFCNVEERAIVGSYDVDSIYECPEMLHDQGIDNIITEQLQLNVQQADLTAWKKIVHA
FT                   VKNPKHTVKIAMVGKYVDLTESYKSLIEALKHAGIHTETDVQITFVDSESIEKNKGDVS
FT                   VLKDMDAILVPGGFGSRGVEGKIAAVRYARENNVPYLGICLGMQIALIEYARDVAGLKG
FT                   ANSTEFDLKCAAPVVALIDEWQTADGSVETRDESADLGGTMRLGAQEVELKAGSLAVKI
FT                   YGSGHIRERHRHRYEVNNNYVSALEQAGLVIGGVSAGRERLVETIELPNHPWFFACQFH
FT                   PEFTSNPRKGHPLFTAFVKAALNNKKA"
FT   gene            complement(245532..245678)
FT                   /locus_tag="NGK_0302"
FT   CDS_pept        complement(245532..245678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0302"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28996"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJ41"
FT                   /protein_id="ACF28996.1"
FT                   /translation="MLSSYFEGNISANLVQTQIKLMAFMIPDLRKCRLKVFVRLSDGIL
FT                   IIK"
FT   gene            245666..246319
FT                   /locus_tag="NGK_0303"
FT   CDS_pept        245666..246319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0303"
FT                   /product="IS1016 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28997"
FT                   /db_xref="InterPro:IPR024445"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJ42"
FT                   /protein_id="ACF28997.1"
FT                   /translation="MKITHCKLKKEVQKEPLRSFVPEVTARSAADILGIHPDSAALFYR
FT                   KIRTVANHRLALAADEVFEGPAGPGGSCFGVRRKGRRGRGAAGKAVVFGIPKRNGRTYT
FT                   VAADNAEPETLPPAVKKKIMPDGIVYADSPGSRGKLDAGGFTRCRINRSKEFADRRNHI
FT                   NGIGNFWNQAKRALRKYNGIDRKPFPPLLRECEFRFNFGTPPRQLKILRDRCGI"
FT   gene            complement(246316..246498)
FT                   /locus_tag="NGK_0306"
FT   CDS_pept        complement(246316..246498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0306"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29000"
FT                   /db_xref="GOA:B4RJ43"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJ43"
FT                   /protein_id="ACF29000.1"
FT                   /translation="MQKQYPFETVAVCVLPNHIHAIWTLPPDDADYSLLRRLIKTKFSA
FT                   YSPHTKNLGAVLDYP"
FT   gene            complement(246476..246619)
FT                   /locus_tag="NGK_0304"
FT   CDS_pept        complement(246476..246619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0304"
FT                   /product="Protein of unknown function DUF1568"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28998"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJ44"
FT                   /protein_id="ACF28998.1"
FT                   /translation="MARYRRNFIAGGTFFFTVKPAAPKSRLLVGHIGFACGLYGCAKTI
FT                   SL"
FT   gene            246684..246815
FT                   /locus_tag="NGK_0305"
FT   CDS_pept        246684..246815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0305"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ACF28999"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJ45"
FT                   /protein_id="ACF28999.1"
FT                   /translation="MDLMFPNDIGGRLKALASTKLKVETANRQSSNRVRTAHTQWAG"
FT   gene            complement(246812..247945)
FT                   /locus_tag="NGK_0307"
FT   CDS_pept        complement(246812..247945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0307"
FT                   /product="DNA cytosine methyltransferase M.NgoMIII"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29001"
FT                   /db_xref="GOA:B4RJJ7"
FT                   /db_xref="InterPro:IPR001525"
FT                   /db_xref="InterPro:IPR018117"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR031303"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJJ7"
FT                   /protein_id="ACF29001.1"
FT                   /translation="MKSLEIFSGAGGLAKGLELAGFQHASFIELNKDACNSLRSNFNPK
FT                   LVYQGDVADFDLSSQEGIEVIAGGPPCQPFSLGGKHLAHEDRRDMFPHAVRYVEYYRPK
FT                   AFIFENVKGLLRKSFADYFEYILLRLTYPNLGILQNEDWKGHLTRLKEIEFNLYKGIKY
FT                   KVSYQLLNAADYGVPQKRERVVIVGIRADLDIDWKFPKRTHSEDRLNWEKYVTGEYWEK
FT                   HNEPKRFNKDIAEKLQKKYGIFEPEKKPWQTVRDTLSDIPHPLGNHKITGHEYRDGARI
FT                   YPGHTGSGIDEPSKTIKAGGHGVPGGENMIRYDDGTVRYFTSYEAKLLQTFPEEFVISG
FT                   AWGEAMRQIGNAVPVKLSEILGKHLMGVLSEKSSLHN"
FT   gene            complement(247949..248590)
FT                   /locus_tag="NGK_0308"
FT   CDS_pept        complement(247949..248590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0308"
FT                   /product="restriction endonuclease R.NgoMIII"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29002"
FT                   /db_xref="GOA:B4RJJ8"
FT                   /db_xref="InterPro:IPR018575"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJJ8"
FT                   /protein_id="ACF29002.1"
FT                   /translation="MNNNFDRSKHIYHNEAFVELVKDAIRFFHGTPVHTLPPPKQFKGA
FT                   GVYAIYYIGNNPLYKQYADWNRLSYNAPIYVGKAVPKGWRQARNSDNALNQSTELFHRL
FT                   KEHSRSIAAVSDLDPSDFMCRFVIFEGAGSDMIGTIEAALIKLHKPLWNSCVDGFGNHD
FT                   PGKGRYEQAKSDWDVLHSGRVWADRLNGIPNSYESILENINTHLEIIKRK"
FT   gene            complement(248608..251610)
FT                   /locus_tag="NGK_0309"
FT   CDS_pept        complement(248608..251610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0309"
FT                   /product="excinuclease ABC subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29003"
FT                   /db_xref="GOA:B4RJJ9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR004602"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041102"
FT                   /db_xref="InterPro:IPR041552"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJJ9"
FT                   /protein_id="ACF29003.1"
FT                   /translation="MSSFYSNILNSDIITESAAFRRQMPSERGFRRHPRKCYNIGFPLF
FT                   FQAASIMCNHHPRHSHDNDTIRIRGARTHNLKNIDLDIPRHKLVVVTGLSGSGKSSLAF
FT                   DTLYAEGQRRYVESLSAYARQFLQMMDKPDVDLIEGLSPAISIEQKSTSHNPRSTVGTV
FT                   TEIHDYLRLLYARVGTPYCPEHKLPLSSQTVSQMVDAVLKLPEDTRVMILGPAVRERKG
FT                   EFVDFFADLQAQGFARVRVDGEVYQLDEVPKLEKNIKHNIDVVIDRVKVKADIKQRLAE
FT                   SFETALRHGNERALAMEMDSGEEHWFSARFACPVCSYSLPELEPRLFSFNNPMGSCPTC
FT                   DGLGNTNFFDPEKVVAHPELSLATGAIDGWDKRNQFYFQMIQSLAHHYKFDVNVAWETL
FT                   PEKVKKVVLHGSGKEVIDFTYLSERGTTFNRSHAFEGIIPNLERRYRETDSETVREKLR
FT                   EYQNHRACPSCGGARLRKEARYVYVGGEPLHEVSAWPLTKTHRFFETLDLDGNKKQIAE
FT                   KILKEITERLGFLINVGLDYLNLSRSAETLSGGEAQRIRLASQIGSGLTGVMYVLDEPS
FT                   IGLHQRDNDRLLATLKRLRDLGNSVIVVEHDEDAIREADFVVDMGPGAGEHGGNVLIAD
FT                   TPENVAKCEKSVTGQYLGGKKSIAVPSERTPVNPDRMLVLKGARGNNLKNVTLELPLGL
FT                   ITCITGVSGSGKSTLINDTLAKITARELNRAQEEPAPYDDIRGLEHLDKVINVDQSPIG
FT                   RTPRSNPATYTGLFTPIRELFAGVPLSRERGYNVGRFSFNVKGGRCEACQGDGVIKVEM
FT                   HFLPDVYVPCEVCHGKRYNRETLEIQYKGKNISQVLDMTVEEAREFFDAVPTVSRKLQT
FT                   LMDVGLGYIRLGQSATTLSGGEAQRVKLALELSKRDTGRTLYILDEPTTGLHFADIALL
FT                   LEVIGRLKGKGNSIVIIEHNLDVIKTADWIVDLGPEGGDGGGKVIAKGSPEEVAKVKGS
FT                   YTGKYLKVVLK"
FT   gene            251611..252390
FT                   /locus_tag="NGK_0310"
FT   CDS_pept        251611..252390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0310"
FT                   /product="phosphatidylserine decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29004"
FT                   /db_xref="GOA:B4RJK0"
FT                   /db_xref="InterPro:IPR003817"
FT                   /db_xref="InterPro:IPR033175"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4RJK0"
FT                   /protein_id="ACF29004.1"
FT                   /translation="MNRLYPHPIIAREGWPIIGGGLALSLLVSMCCGWWSLPFWVFTVF
FT                   ALQFFRDPAREIPQNPEAVLSPVDGRIVVVERARDPYRDVDALKISIFMNVFNVHSQKS
FT                   PADCTVTKVVYNKGKFVNADLDKASTENERNAVLATTASGREITFVQVAGLVARRILCY
FT                   TQAGAKLSRGERYGFIRFGSRVDVYLPVDAQAQVAIGDKVTGVKTVLARLPLTDSQADP
FT                   VSQAASVETAANPSAEQQQIEAAAAKIQAAVQDVLKD"
FT   gene            252830..252958
FT                   /locus_tag="NGK_0311"
FT   CDS_pept        252830..252958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0311"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29005"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJK1"
FT                   /protein_id="ACF29005.1"
FT                   /translation="MFLVFAIFPNKLIKKKKRFSECRLKTFFVCLSDFKTSRLRRR"
FT   gene            complement(252930..255224)
FT                   /locus_tag="NGK_0312"
FT   CDS_pept        complement(252930..255224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0312"
FT                   /product="putative TonB-dependent receptor protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29006"
FT                   /db_xref="GOA:B4RJK2"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJK2"
FT                   /protein_id="ACF29006.1"
FT                   /translation="MRREAKMAQITLKPIVLSILLINTPLLAQAHETEQSVGLETVSVV
FT                   GKSRPRATSGLLHTSTASDKIISGDTLRQKAVNLGDALDGVPGIHASQYGGGASAPVIR
FT                   GQTGRRIKVLNHHGETGDMADFSPDHAIMVDTALSQQVEILRGPVTLLYSSGNVAGLVD
FT                   VADGKIPEKMPENGVSGEAGLRLSSGNLEKLTSAGINIGLGKNFVLHTEGLYRKSGDYA
FT                   VPRYRNLKRLPDSHADSQTGSIGLSWVGEKGFIGAAYSDRRDRYGLPAHSHEYDDCHAD
FT                   IIWQKSLINKRYLQLYPHLLTEEDIDYDNPGLSCGFHDGDGAHAHTHNGKPWIDLRNKR
FT                   YELRAEWKQPFPGFEALRVHLNRNDYHHDEKAGDAVENFFNNKTHNARIELRHQPIGRL
FT                   KGSWGVQYLGQKSSALSAIPETVQQPMLIDNNVRHYSFFGVEQANWDNFTLEGGVRVEK
FT                   QKASIRYDKALIDRENYYNQPLPDLGAHRQTARSFALSGNWYFTPHHKLSLTASHQERL
FT                   PSTQELYAHGKHVATNTFEVGNKHLNKERSNNIELALGYEGDRWQYNLAAYRNRFGNYI
FT                   YAQTLNDGRGPKSIEDDSEMKLVRYNQSGADFYGAEGEIYFKPTPRYRIGVSGDYVRGR
FT                   LKNLPSLPGREDPYGKRPFIAQDDQNAPRIPAARLGFHLKTSLTDRIDANLDYYRVFAQ
FT                   NKLARYETRTPGHHMLNLGANYRRNTRYGEWNWYVKADNLLNQSVYAHSSFLSDTPQMG
FT                   RSFTGGVNVKF"
FT   gene            255617..256207
FT                   /locus_tag="NGK_0313"
FT   CDS_pept        255617..256207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0313"
FT                   /product="anthranilate synthase component II"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29007"
FT                   /db_xref="GOA:B4RJK3"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJK3"
FT                   /protein_id="ACF29007.1"
FT                   /translation="MLLFIDNYDSFTYNIVQYFAELGQEVAVRRNDDITLEEIEALNPQ
FT                   YLVIGPGPCSPKEAGISVEAMRHFAGRLPIMGVCLGHQTIGEAFGGDVVRAKTLMHGKV
FT                   SPVSHSGKGMFKGLPNPVTCTRYHSLVIERGTLPDCLEITAWTEDGEIMGVRHKEYAVE
FT                   GVQFHPEALLTERGHDMLNNFLVEFQNFKPQKI"
FT   gene            256253..257299
FT                   /locus_tag="NGK_0314"
FT   CDS_pept        256253..257299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0314"
FT                   /product="putative anthranilate phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29008"
FT                   /db_xref="GOA:B4RJK4"
FT                   /db_xref="InterPro:IPR000312"
FT                   /db_xref="InterPro:IPR005940"
FT                   /db_xref="InterPro:IPR017459"
FT                   /db_xref="InterPro:IPR035902"
FT                   /db_xref="InterPro:IPR036320"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJK4"
FT                   /protein_id="ACF29008.1"
FT                   /translation="MNGGQKMITPQQAIERLISNNELFYDEMTDLMRQMMSGKVPPEQI
FT                   AAILTGLRIKVETVSEITAAAAVMCEFASKVPLEDADGLVDIVGTGGDGAKTFNISTTS
FT                   MFVAAAAGAKVAKHGGRSVSSSSGAADVMEQMGANLNLTPEQIAQSIRQTGIGFMFAPN
FT                   HHSAMRHVAPVRRSLGFRSIFNILGPLTNPAGAPNQLLGVFHTDLCGILSRVLQQLGSK
FT                   HVLVVCGEGGLDEITLTGKTRVAELKDGKISEYDIRPEDFGIETRRNLDEIKVANTQES
FT                   LLKMNEVLDGKEGAARDIVLLNTAAALYAGNIAASLSDGISAAREGIDSGRAKAKKEEF
FT                   VGFTRQFA"
FT   gene            complement(257513..257962)
FT                   /locus_tag="NGK_0315"
FT   CDS_pept        complement(257513..257962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0315"
FT                   /product="IS1106 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29009"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:B4RIY0"
FT                   /protein_id="ACF29009.1"
FT                   /translation="MNTFFRQTAQAMTAKHIGRFPLSELDQVIDWQPIEQYLIRQKTRY
FT                   LRDRRGRPAHPLSSMFKAVLPGQWHSLSDPELEHSLITRIGFNLFCRFDEPGIPGCSTL
FT                   CRYRKFRYARAAYFGLLKVGAQSHLKAMCLNLLKAANRLSAPAAA"
FT   gene            complement(258106..259224)
FT                   /locus_tag="NGK_0316"
FT   CDS_pept        complement(258106..259224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0316"
FT                   /product="Histone deacetylase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29010"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="InterPro:IPR023801"
FT                   /db_xref="InterPro:IPR037138"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJK6"
FT                   /protein_id="ACF29010.1"
FT                   /translation="MPLTRLFLKLYALLRLFLGKNAQTAWIFHPACTGHDPGANHPDSP
FT                   DRILCIEQALRRAGIWQHLQTVEAEEISDTRLALVRSSKYLNRLESCLPEDGKICRLDD
FT                   DTVISKNSLSAARFSAGSAVQAVDMVMKRKAWHAFCAARPPGHHAKSGKAGGFCLLNNV
FT                   AAGVMHAIAEYRLKRIAVIDFDVHYGDGTAEIFKDDPRILFFNLFETDLFPFPENNGMP
FT                   DGGNMVHLPLPSGTGSRTFREAVRRQWLPRLAAFKPELVLLSAGFDAHRLDESGRLNLH
FT                   EADFAWLTHKIIQTASSCPGKIVSVLEGGYTLEPLAQSAAEHIRVLAGLGKSDAATAYQ
FT                   KTLNPTKKRFAKPKTGQVRQPTQSDRYDINAV"
FT   gene            259355..259621
FT                   /locus_tag="NGK_0317"
FT   CDS_pept        259355..259621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0317"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29011"
FT                   /db_xref="GOA:B4RJK7"
FT                   /db_xref="InterPro:IPR003849"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJK7"
FT                   /protein_id="ACF29011.1"
FT                   /translation="MNQAVAQFAPLVLIMVVFYFLIMRPQQKKFKAHQAMLAALKAGDK
FT                   VVLAAGFKGKVTRVGEQFFTVDIGQGTKIEVEVERNAIAAKVD"
FT   gene            259830..261686
FT                   /locus_tag="NGK_0318"
FT   CDS_pept        259830..261686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0318"
FT                   /product="protein export protein SecD"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29012"
FT                   /db_xref="GOA:B4RJK8"
FT                   /db_xref="InterPro:IPR005791"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="InterPro:IPR027398"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJK8"
FT                   /protein_id="ACF29012.1"
FT                   /translation="MMNRYPLWKYLLIVFTIAVAAVYSLPNLFGETPAVQVSTNRQAII
FT                   INEQTQSKVDAALKNAGIQTDGMFVVDNSLKVRFKDTETQLKARDVIENTLGEGYITAL
FT                   NLLADSPEWMAKIKANPMFLGLDLRGGVHFTMQVDMKAAMQKTFERYSGDIRRELRREK
FT                   IRSGTVRQAENSLTVPLQDAGDVQKALPQLLKLFPEATLNSEGSNIVLALSEEAVNKVR
FT                   SDAVKQNITTLHNRVNELGVAEPIIQQSGLDRIVVQLPGVQDTAKAKDIIGRTATLEVR
FT                   MVEDDPAKLREALEGNVPSGYELLSSGGEHPETLLISKQVELTGDNINDAQPSFDQMGA
FT                   PAVSLSLDSAGGSIFGELTAANVGKRMAMVLIDQGKSEVVTAPVIRTAITGGRVEISGS
FT                   MTTAEANDTSLLLRAGSLAAPMQIVEERTIGPSLGKENIEKGFHSTLWGFAIVAAFMVV
FT                   YYRLMGFFSTIALSANILFLIGILSAMQATLTLPGMAALALTLGMAIDSNVLINERIRE
FT                   ELRAGVPPQQAINLGFQHAWATIVDSNLTSLIAGIALLVFGSGPVRGFAVVHCLGILTS
FT                   MYSSVVVFRALVNLWYGRRRKLQNISIGAVWKPEAETAAGKE"
FT   gene            261690..262625
FT                   /locus_tag="NGK_0319"
FT   CDS_pept        261690..262625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0319"
FT                   /product="protein export protein SecF"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29013"
FT                   /db_xref="GOA:B4RJK9"
FT                   /db_xref="InterPro:IPR005665"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJK9"
FT                   /protein_id="ACF29013.1"
FT                   /translation="MELFKIKRDIPFMSYGKLTTFISLVTFIAAVFFLVARGLNFSVEF
FT                   TGGTVMEVQYQQGADVNKMRERLDTLKMGDVQVQALGTNKHIMIRLPNKEGVTSAQLSN
FT                   QVMDLLKKDSPDVTLRQVEFIGPQVGEELVNNGLMALGFVVIGIIIYLSMRFEWRFAVS
FT                   AIIANMHDIVIILGCFAFFQWEFSLTVLAGILAVLGYSVNESVVVFDRIRENFRKPAMR
FT                   GHTVPEVIDNAITATMSRTIITHGSTEAMVVSMLVFGGAALHGFSMALTIGIVFGIYSS
FT                   VLVASPLLLMFGLSRDNIAKEAKQKEEIVV"
FT   gene            262830..263099
FT                   /locus_tag="NGK_0320"
FT   CDS_pept        262830..263099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0320"
FT                   /product="putative 30S ribosomal protein S15"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29014"
FT                   /db_xref="GOA:B4RJL0"
FT                   /db_xref="InterPro:IPR000589"
FT                   /db_xref="InterPro:IPR005290"
FT                   /db_xref="InterPro:IPR009068"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4RJL0"
FT                   /protein_id="ACF29014.1"
FT                   /translation="MALTVEQKAQIVKDFQRKEGDTGSSEVQVALLTFRINDLTPHFKA
FT                   NPKDHHSRRGLLKMVSQRRRLLAYLRRTQPDTYRALITRLGLRK"
FT   gene            263241..263447
FT                   /locus_tag="NGK_0321"
FT   CDS_pept        263241..263447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0321"
FT                   /product="Spermidine/putrescine ABC transporter,
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29015"
FT                   /db_xref="GOA:B4RJL1"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJL1"
FT                   /protein_id="ACF29015.1"
FT                   /translation="MLPVRFTRVSDGIRRCDSRQQSNSFLSPIRKSVLPVLVFLLEYCH
FT                   YDRNHSVFSQTLSANPRFGEKVW"
FT   gene            263473..264501
FT                   /locus_tag="NGK_0322"
FT   CDS_pept        263473..264501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0322"
FT                   /product="Spermidine/putrescine ABC transporter,
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29016"
FT                   /db_xref="GOA:B4RJL2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005893"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJL2"
FT                   /protein_id="ACF29016.1"
FT                   /translation="MNIYQNEIFALLGSSGSGKSTLLRMLAGMESPNQGKIILDGQDIT
FT                   KLAPYDRPINMMFQSYALFPHMTVEQNIAFGLKQDKMPKGEIDARVEEMLRLVQMTKFA
FT                   KRKPHQLSGGQQQRIALARSLAKRPKILLLDEPLGALDKKLRQQTQLELVNTLEQVGVT
FT                   CIMVTHDQEEAMTMATRIAIMSDGQLQQVGTPSDVYDYPNSRFTAEFIGETNIFDGVVI
FT                   ENHADYAVIECEGLENHVRIDHGLGGPSEQDLWVSIRPEDIDLYKEKPEYLGDYNWAKG
FT                   TVKEIAYLGSFAIYHIKLANGRVVKSQVPAPYWYVRNITPPTWDETVYISWPENQPTPL
FT                   FR"
FT   gene            264517..265482
FT                   /locus_tag="NGK_0323"
FT   CDS_pept        264517..265482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0323"
FT                   /product="Spermidine/putrescine ABC transporter, permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29017"
FT                   /db_xref="GOA:B4RJL3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJL3"
FT                   /protein_id="ACF29017.1"
FT                   /translation="MNLNKLKNKLFRRPGQRAVIAVPYIWLLVLFLIPFAIVLKISSAE
FT                   QEIAIPPFTPLTTIDEDLGRLNIAVSYQNYADIFQNFWHTLNPFGDSENSNIYLMTYWS
FT                   SIKTALTTTVICLLVGYPTAYAISRANPSVRNGLLLAIMLPFWTSFLLRVYAWMGLLGH
FT                   NGIINNLLIKMGIIREPLDLFYNAFSLNLVMVYAYLPFMILPLYTQLVKLDSRLLEAAS
FT                   DLGAGPVKSFLTITLPLSKTGIIAGSMLVFVPAVGEFVIPELVGGSENLMIGKVLWQAF
FT                   FDQNNWPLASAVAVVMVALLVVPIALFQHYENRELEEGAK"
FT   gene            265482..266369
FT                   /locus_tag="NGK_0324"
FT   CDS_pept        265482..266369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0324"
FT                   /product="Spermidine/putrescine ABC transporter, permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29018"
FT                   /db_xref="GOA:B4RJL4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJL4"
FT                   /protein_id="ACF29018.1"
FT                   /translation="MQKSKLSWFLKLMLALSLAFLYIPLVVLVIYSFNESKLVTVWGGF
FT                   STKWYGALLENDTILEAAWLSLRIAVVSSLAAVVLGTLAGYAMARIKRFRGSTLFAGMI
FT                   SAPMVMPDVITGLSMLLLIIQVQIFLQGSEWLQHLYFDRGFFTIFLGHTTLCMAYITVV
FT                   IRSRLVELDQSLEEAAMDLGARPLKIFFVITLPLIAPAIASGFLLGITLSLDDLVITSF
FT                   LSGPGSSTLPQVIFSKIKLGLDPQMNVLATILIGIIGTLVIIVNYWMMRQATKRNREAA
FT                   EAYRQEKLAAEKAN"
FT   gene            266496..267791
FT                   /locus_tag="NGK_0325"
FT   CDS_pept        266496..267791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0325"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29019"
FT                   /db_xref="GOA:B4RJL5"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJL5"
FT                   /protein_id="ACF29019.1"
FT                   /translation="MIRPDFQEYLPSYYFSSVNPHTVYPKLQCRLKAETCIIGGGLSGL
FT                   CTALPLAEHGHEAVVLEAARIGFGASGRSGGQVISDYACGMGEIEKQVGLEQAQWFWQQ
FT                   SLQAVELVDERVRKHAIDCDWQRGYATVAVRPQHWEELQQWHEHAQRHYGASHYQLWDK
FT                   AELKQQLDSDMYQGAQFDPLSGHLHPLNYTLGVASAAAEAGAQIFEQSPMTRIEPYQNG
FT                   WLVYTPEGSVECKNVVYAVNTYVGLNPIFRPLERKAIAVSTFIIATEPLGARTKGLIRN
FT                   NMAVCDNRHILDYYRLSADGRLLFGGKDNEFIDNPARMTELVRQDMLKVFPQLADVRIE
FT                   YSWGGECDITANLVPHFGRLTSNVFYTQGYSGHGMAITGIAGLAVAEAILGDECRLKPF
FT                   EQLRQPNIILQPFLRKLGSFLGSKYYQWKDSR"
FT   gene            complement(267885..269351)
FT                   /locus_tag="NGK_0326"
FT   CDS_pept        complement(267885..269351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0326"
FT                   /product="putative transporter, ammonium"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29020"
FT                   /db_xref="GOA:B4RJL6"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJL6"
FT                   /protein_id="ACF29020.1"
FT                   /translation="MRYFHIQTRDLFHAQGGTSAKSPRRSGRACAHPGQAPTPPFRKTG
FT                   PTIKETLIKMKKHIWAASLLPASLSAEPLNWWKPYSAVNSGDTAWVMTAAALVLLMTLP
FT                   GLALFYGGMVRKKNLLSTMMHSFSIATLVGILWVAVGYSLAFTPGNAFIGGLGRVFLSG
FT                   MQIDAAARMLTVSPNAPTVPEPVFMFFQMTFAIISTAIITGAFAERMKYSAMMLFSGIW
FT                   FLLVYVPGAHWVWGGGFMSKGGVLDYAGGTVVHINAGIAGLVAALVLGRRIGYGREAMP
FT                   PHNMAMTLIGAAMLWFGWFGFNAGSALAADAAAGMAMAVTQVSAVFGAAGWLACEKIAG
FT                   HKPSALGLASGAVSGLVGITPAAGFTGPSGAAAIGILTAAACFVSVTVVKHKLRYDDSL
FT                   DAFGIHGFGGLVGGILTGIFFDNRIFGGDAAVWQQLWIQVKDGFIMAAYSGLMSWAILK
FT                   AVGKICGGLRVGKDVEREGLDLNIHGEHVE"
FT   gene            complement(269524..269652)
FT                   /locus_tag="NGK_0327"
FT   CDS_pept        complement(269524..269652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0327"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29021"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJL7"
FT                   /protein_id="ACF29021.1"
FT                   /translation="MQNRLERIPTGNENRCGNLIQGCAEPRPFLYKFYFLFPIRNF"
FT   gene            complement(269804..271063)
FT                   /locus_tag="NGK_0328"
FT   CDS_pept        complement(269804..271063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0328"
FT                   /product="transcription termination factor Rho"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29022"
FT                   /db_xref="GOA:B4RJL8"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004665"
FT                   /db_xref="InterPro:IPR011112"
FT                   /db_xref="InterPro:IPR011113"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036269"
FT                   /db_xref="InterPro:IPR041703"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJL8"
FT                   /protein_id="ACF29022.1"
FT                   /translation="MHVSELQTLHISKLLELAEEHGIENANRFRKQDLVFAIVRQMMKK
FT                   GEGFTCSGTLEILPDGFGFLRSADTSYLAGPDDIYVSPTQIRRFNLHTGDTIEGSVRVP
FT                   KDNERYFALVRLDSINGDHPEVCRHKILFENLTPLFPTEQLKLERDLKSEENLTGRAID
FT                   LISPIGKGQRALLVAPPKIGKTVMLQNIAHAVTANYPEVELIVLLIDERPEEVTEMSRS
FT                   VRGEVVSSTFDEPAQRHVQVAEMVLEKAKRMVEHKKDVVILLDSITRLARAYNTVVPAS
FT                   GKILTGGVDANALHRPKRFFGAARNVEEGGSLTIIATALVETGSRMDDVIYEEFKGTGN
FT                   MELHLDRRMAEKRLFPAININKSGTRREELLVPNDQLQRMWLLRKFLHPMDEIEATEFL
FT                   NGKIKASKNNDDFFELMRGK"
FT   gene            271137..271283
FT                   /locus_tag="NGK_0329"
FT   CDS_pept        271137..271283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0329"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29023"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJL9"
FT                   /protein_id="ACF29023.1"
FT                   /translation="MLGEGGIVGSRRVGVKYYRGRGIDRKCRLNGAAWKKYPRAFQAWG
FT                   YGN"
FT   gene            complement(271284..273668)
FT                   /locus_tag="NGK_0330"
FT   CDS_pept        complement(271284..273668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0330"
FT                   /product="phosphoenolpyruvate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29024"
FT                   /db_xref="GOA:B4RJM0"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR002192"
FT                   /db_xref="InterPro:IPR006319"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJM0"
FT                   /protein_id="ACF29024.1"
FT                   /translation="MADNYVIWFENLRMTDVERVGGKNASLGEMISQLTEKGVRVPGGF
FT                   ATTADAYRAFLAHNGLNERISAALAKLDVEDVSELARVGKEIRQWILDTPFPEQLDAEI
FT                   EAAWNKMVTDADGADISVAVRSSATAEDLPDASFAGQQETFLNINGLDNVKKAMRHVFA
FT                   SLYNDRAISYRVHKGFEHDIVALSAGVQRMVRSDSGASGVMFTLDTESGYNQVVFVTSS
FT                   YGLGENVVQGAVNPDEFYVFKPTLKAGKPAILRKTMGSKHIKMIFTDKAEAGKSVTNVE
FT                   VPEEDRNRFSITDEEITELAHYALTIEKHYGRPMDIEWGRDGLDGKLYILQARPETVKS
FT                   QEEGSRNLRRYAINGEKTVLCEGRAIGQKVGQGKVRLIKDASEMDSVEAGDVLVTDMTD
FT                   PDWEPVMKRASAIVTNRGGRTCHAAIIARELGIPAVVGCGNATELLENGQEVTVSCAEG
FT                   DTGFIYAGLLDVQITDVALDNMPKAPVKVMMNVGNPELAFSFANLPSEGIGLARMEFII
FT                   NRQIGIHPKALLEFDKQDDELKAEIIRRIAGYASPVDFYVDKIAEGVATLAASVYPRKT
FT                   IVRMSDFKSNEYANLVGGSVYEPHEENPMLGFRGAARYVAESFKDCFALECKALKRVRD
FT                   EMGLTNVEIMIPFVRTLGEAEAVVKALKENGLERGKNGLRLIMMCELPSNAVLAEQFLQ
FT                   YFDGFSIGSNDMTQLTLGLDRDSGLVSESFDERNPAVKVMLHLAISACRKQNKYVGICG
FT                   QGPSDHPDFAKWLVGEGIESVSLNPDTVIETWLYLANELNK"
FT   gene            273673..273936
FT                   /locus_tag="NGK_0331"
FT   CDS_pept        273673..273936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0331"
FT                   /product="Myo-inositol transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29025"
FT                   /db_xref="GOA:B4RJM1"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJM1"
FT                   /protein_id="ACF29025.1"
FT                   /translation="MSNPKYVKKETNPLAYFKRFVPPLSRFYLSGQPLRRLKNSGFRLC
FT                   SGLKPMAGILFFSGISFVKQMVLNRLMFYAVFFLFLFFGILF"
FT   gene            274023..274676
FT                   /locus_tag="NGK_0332"
FT   CDS_pept        274023..274676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0332"
FT                   /product="IS1016 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ACF31271"
FT                   /db_xref="InterPro:IPR024445"
FT                   /db_xref="UniProtKB/TrEMBL:B4RIV1"
FT                   /protein_id="ACF31271.1"
FT                   /translation="MKITHCKLKKEVQKEPLRSFVPEVTARSAADILGIHPDSAALFYR
FT                   KIRTVTNHRLALAADEVFERPAGPGGSCFGVRRKGRRGRGAAGKAVVFGIPKRNGRAYT
FT                   VAEDDAEPETLPPAVKKKIMPDGIVYADSPGSRGKSDAGGFTRCRINRSKEFADRRNHI
FT                   NGIGNFWNQAKRALRKYNGIDRKPFPPLLRECEFRLNFGTPSRQLKILRDRCGI"
FT   gene            274802..275623
FT                   /locus_tag="NGK_0333"
FT   CDS_pept        274802..275623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0333"
FT                   /product="Putative phosphotransferase NGO0202"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29026"
FT                   /db_xref="GOA:B4RJM3"
FT                   /db_xref="InterPro:IPR005177"
FT                   /db_xref="InterPro:IPR026530"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4RJM3"
FT                   /protein_id="ACF29026.1"
FT                   /translation="MSSPRQVFYISDRTGLTAENIGEALLNQFGNLSFKRHTHPFVDTP
FT                   EKARAVVEKVNRSRQENGQRPIAFVSVVDDEIRRIIKGADAFQINFFETFLGLLEKELN
FT                   TEATVSGQGHHSIGNTKRYDARMEAVNFSLNHDDGVSDKNLQEADVILMGVSRSGKTPT
FT                   CLYLALQYGIRAANYPLIPDDLESADLPRMVKPYKDKLFGLTIQPERLQAIRQERRPNS
FT                   AYARIDTCRSEVADAQSMFRRHGIPFANTTDKSVEELAVHILQACKLKRRF"
FT   gene            complement(275709..276419)
FT                   /locus_tag="NGK_0334"
FT   CDS_pept        complement(275709..276419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0334"
FT                   /product="putative phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29027"
FT                   /db_xref="GOA:B4RJM4"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJM4"
FT                   /protein_id="ACF29027.1"
FT                   /translation="MPSETFRPTLYKKGKHMIQAVLFDLDGTLADTALDLGGALNTQLA
FT                   RHGLPEKSMDEIRTQASHGAAGLLKLGANITPEHPDYTAWRTEYLEEYDSRYAQDTTLF
FT                   DGVNELIAELGRRGIKWGIITNKPMRFTDKLVPKLGFAVPPATVVSGDTCGEPKPSIKP
FT                   MLHACGKIHADPQHTLYVGDAERDIQAGRNAGMKTVLAEWGYISDEDDTGSWQADFHIR
FT                   TPLDLLECLDKIQP"
FT   gene            complement(276409..277236)
FT                   /locus_tag="NGK_0335"
FT   CDS_pept        complement(276409..277236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0335"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29028"
FT                   /db_xref="InterPro:IPR007402"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR011197"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJM5"
FT                   /protein_id="ACF29028.1"
FT                   /translation="MKPDIYALPERALLSGDPDEKGRLTDEAFAAVQNADGAEANAPPA
FT                   DFPRAGRPDKPVLVAPSQLTPRKMNTAEGYAAMLHAITHIEFNAVNLALDAAYRFRTLP
FT                   FQFVRDWVRVAKEEVYHFRLMRERLRAFGFDYGDFEAHNHLWDMAYKTAYDPLLRMALV
FT                   PRVLEARGLDVTPGIRAKVEQRGDSATCGVLDIIYRDEVGHVAIGNRWYQHLCRERGLE
FT                   PVALFRSLIARYDMFIFRGYVNIEAREKAGFSRFELDMLEDFEQGLKQNKHAV"
FT   gene            277472..278242
FT                   /locus_tag="NGK_0336"
FT   CDS_pept        277472..278242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0336"
FT                   /product="LolA"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29029"
FT                   /db_xref="GOA:B4RJM6"
FT                   /db_xref="InterPro:IPR004564"
FT                   /db_xref="InterPro:IPR018323"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJM6"
FT                   /protein_id="ACF29029.1"
FT                   /translation="MARLLFPSGQKNQPSENAVCKMQTARNAARMIVLPRRYFAPHPSR
FT                   QGKIMMKPHNLFQFLAVCSLTVAVASAQAGAVDALKQFNNDADGISGSFTQTVQSKKKT
FT                   QTAHGTFKILRPGLFKWEYTLPYKQTIVGDGQTVWLYDVDLAQVTKSSQDQAIGGSPAA
FT                   ILSNKTALESSYTLKEDGSSNGIDYVRATPKRNNAGYQYIRIGFKGGNLAAMQLKDSFG
FT                   NQTSISFGGLNTNPQLSRGAFKFTPPKGVDVLSN"
FT   gene            complement(278295..278423)
FT                   /locus_tag="NGK_0337"
FT   CDS_pept        complement(278295..278423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0337"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29030"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJM7"
FT                   /protein_id="ACF29030.1"
FT                   /translation="MALGAARFALNGKNSRGATVNFHGFAVPLPDRAVMRDIVPPA"
FT   gene            278455..279654
FT                   /locus_tag="NGK_0338"
FT   CDS_pept        278455..279654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0338"
FT                   /product="Spermidine/putrescine ABC transporter,
FT                   periplasmic spermidine/putrescine-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29031"
FT                   /db_xref="GOA:B4RJM8"
FT                   /db_xref="InterPro:IPR001188"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJM8"
FT                   /protein_id="ACF29031.1"
FT                   /translation="MQAARPSLQCFLFLNERSKTMKKTLVAAAILSLALTACGGGSDTA
FT                   AQTPSAKPEAEQSGKLNIYNWSDYVDPETVAAFEKETGIKMRSDYYDSNETLEAKVLTG
FT                   KSGYDLTAPSIANVGRQIKAGAYQKIDKAQIPHYGNIDKDLLKMMEAVDPGNEYAVPYF
FT                   WGINTLAINTRQVQKALGTDKLPENEWDLVFKPEYTAKLKSCGISYFDSAIEQIPLALH
FT                   YLGKDPNSENPEDIKAAVDMMKAVRGDVKRFSSSGYIDDMAAGNLCAAIGYGGDLNIAK
FT                   TRAEEAANGVEIKVLTPKTGVGVWVDSFMIPRDAQNVANAHRYIDYTLRPEVAAKNGSF
FT                   VTYAPASRPARELMDEKYTSDASIFPTKELMEKSFIVSPKSAESVKLGVKLWQGLKAGK
FT                   "
FT   gene            280023..280781
FT                   /locus_tag="NGK_0339"
FT   CDS_pept        280023..280781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0339"
FT                   /product="putative sugar transferase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29032"
FT                   /db_xref="GOA:B4RJM9"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJM9"
FT                   /protein_id="ACF29032.1"
FT                   /translation="MSEARNTGIKNSNGKYIAFIDSDDFINCQVLLDFLGKDDSDMPDV
FT                   VFLNAVKYDKGRVSYFGEDYQPEKILNQSKVEVLKGLCRFRKFPGSAWNKIIKRELIIR
FT                   EKLFFEKGIYSEDIEWSMRLFNAATTFSYLDGCYYYYRQGRKDSITGTVSEKGIKSLLY
FT                   ILEKNAKMEFNRDISSYLYSFLSYEYLVLLFIMTSKNIACDSDIKRRAYHLRFMLLKSN
FT                   KLIYKLIFPIITLFGVDITGRILKAIRGNI"
FT   gene            280822..281352
FT                   /locus_tag="NGK_0340"
FT   CDS_pept        280822..281352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0340"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29033"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJN0"
FT                   /protein_id="ACF29033.1"
FT                   /translation="MNAIRTFQNRMPEIHETCMIDEACVVIGEVSLAEDVSVWPCAVLR
FT                   GDVNSITVGARSNIQDGSVLHVSHKTAAKPEGSPLVIGEDVTVGHKVMLHGCRIGNRVL
FT                   VGMGSTVLDDAVIEDDVMIGAGSLVPPRKRLEGGYLYIGSPVRQVRLLTDEEKAFLKYS
FT                   AAHYVKLSKQYGM"
FT   gene            complement(281520..283115)
FT                   /locus_tag="NGK_0341"
FT   CDS_pept        complement(281520..283115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0341"
FT                   /product="peptide chain release factor 3"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29034"
FT                   /db_xref="GOA:B4RJN1"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004548"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR032090"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR038467"
FT                   /db_xref="InterPro:IPR041732"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4RJN1"
FT                   /protein_id="ACF29034.1"
FT                   /translation="MSQEILDQVRRRRTFAIISHPDAGKTTLTEKLLLFSGAIQSAGTV
FT                   KGKKTGKFATSDWMDIEKQRGISVASSVMQFDYKDHTVNLLDTPGHQDFSEDTYRVLTA
FT                   VDSALMVIDAAKGVEAQTIKLLNVCRLRDTPIVTFMNKYDREVRDSLELLDEVEDILQI
FT                   RCAPVTWPIGMGKNFKGVYHILNDEIYLFEAGGERLPHEFGIIKGINNPELEQRFPLEI
FT                   QQLRDEIELVQAASNEFNLDEFLAGELTPVFFGSAINNFGIQEILNSLIDWAPAPKPRD
FT                   ATMRMVGPDEPKFSGFIFKIQANMDPKHRDRIAFLRVCSGKFERGMKMKHLRINREIAA
FT                   SSVVTFMSHNRELAEEAYAGDIIGIPNHGNIQIGDSFSEGEQLAFTGIPFFAPELFRSV
FT                   RIKNPLKIKQLQKGLQQLGEEGAVQVFKPMSGADLILGAVGVLQFEVVTSRLANEYGVE
FT                   AVFDSASIWSARWVSCDDKKKLAEFEKANAGNLAIDAGGNLAYLAPNRVNLGLTQERWP
FT                   DIVFHETREHSVKL"
FT   gene            complement(283222..283617)
FT                   /locus_tag="NGK_0342"
FT   CDS_pept        complement(283222..283617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0342"
FT                   /product="putative phosphoribosyl-AMP cyclohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29035"
FT                   /db_xref="GOA:B4RJN2"
FT                   /db_xref="InterPro:IPR002496"
FT                   /db_xref="InterPro:IPR026660"
FT                   /db_xref="InterPro:IPR038019"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4RJN2"
FT                   /protein_id="ACF29035.1"
FT                   /translation="MDKNLLEAVKFDEKGLVCAIAQDAETKRVLMVAWMNAEALQKTVE
FT                   TGFAHYYSRSRQKQWMKGEESGHTQKVRELRLDCDGDTIVMLIAQNGGIACHTGRESCF
FT                   YKKWNGGAWETADAVLKDEKEIYGSTH"
FT   gene            complement(283648..284415)
FT                   /locus_tag="NGK_0343"
FT   CDS_pept        complement(283648..284415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0343"
FT                   /product="Imidazole glycerol phosphate synthase subunit
FT                   hisF"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29036"
FT                   /db_xref="GOA:B4RJN3"
FT                   /db_xref="InterPro:IPR004651"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4RJN3"
FT                   /protein_id="ACF29036.1"
FT                   /translation="MALAKRIIPCLDVKDGRVVKGVNFIGLRDAGDPVEAAKRYNGEGA
FT                   DELTFLDITASSDNRDTILHIIEEVAGQVFIPLTVGGGVRTVADIRRLLNAGADKVSIN
FT                   TAAVTRPDLINEAAGFFGSQAIVAAVDAKAVNPENTRWEIFTHGGRNPTGLDAVEWAVE
FT                   MQKRGAGEILLTGMDRDGTKQGFNLPLTRAVAEAVDIPVIASGGVGNVRHLIEGITEGK
FT                   ADAVLAAGIFHFGEIAIREAKRTMREAGIEVRL"
FT   gene            complement(284428..285165)
FT                   /locus_tag="NGK_0345"
FT   CDS_pept        complement(284428..285165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0345"
FT                   /product="putative phosphoribosylformimino-5-aminoimidazole
FT                   carboxamide ribonucleotide isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29038"
FT                   /db_xref="GOA:B4RJN4"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR006063"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023016"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4RJN4"
FT                   /protein_id="ACF29038.1"
FT                   /translation="MLLIPAIDLKEGRCVRLKQGLMEEATVFSDSPADTALHWFEQGAR
FT                   RLHLVDLNGAFAGVPQNLPAIKDILAAVAKDIPVQLGGGMRDLKTIGQYLDLGLNDVII
FT                   GTAAVKNPDLVREACKAFPGRIIVGLDAKDGMAAIDGWATVTGHHVIDLAKRFEDDGVN
FT                   SIIYTDIGRDGMMSGVNIDATVKLAQSVRIPVIASGGLTGLDDIPALCAAEKHGVAGAI
FT                   TGRAIYEGSIDFAQAQQLADSLD"
FT   gene            complement(285198..285836)
FT                   /locus_tag="NGK_0344"
FT   CDS_pept        complement(285198..285836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0344"
FT                   /product="Imidazole glycerol phosphate synthase subunit
FT                   hisH"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29037"
FT                   /db_xref="GOA:B4RJN5"
FT                   /db_xref="InterPro:IPR010139"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJN5"
FT                   /protein_id="ACF29037.1"
FT                   /translation="MQTAIIDYGMGNLHSVLKSVRTAGQLAGKNTKIFLSGDPDRVSRA
FT                   DKVIFPGQGAMPDCMAALTRGGLDEAVKDALKNKPFFGICVGAQLLFDHSEEGNTDGLG
FT                   WFGGKVRRFARDLRDPQGCRLKVPHMGWNTVRQTQNHPLFQGIPQNTRFYFVHSYYFAP
FT                   ENPETILGESDYPSPFACIVGKDNVFATQFHTEKSHDAGLTMLKNFLNW"
FT   gene            complement(285966..287468)
FT                   /locus_tag="NGK_0347"
FT   CDS_pept        complement(285966..287468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0347"
FT                   /product="putative phosphotransacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29040"
FT                   /db_xref="GOA:B4RJN6"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR004614"
FT                   /db_xref="InterPro:IPR042112"
FT                   /db_xref="InterPro:IPR042113"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJN6"
FT                   /protein_id="ACF29040.1"
FT                   /translation="MAKVLVVPVSAGLNTSAAAQAFAKALDAQVFQAVDATAETLLAQG
FT                   KSDDWFDALVGKVAALDAANLVIEGIAPDADKIYLAGKNVELALSLDAAAVFAVRSDNT
FT                   DADALAHQLNLAKQFFAAAPGVLEGFVVDGAAASVAEAAAEKTGLTFFGSSDALKDVSV
FT                   LAGREAKRLSPAQFRYNLIDFARQAGKRIVLPEGAEPRTVQAAAICHEKGIARCVLLAK
FT                   REEVEAVAKERGISLPDSLEIIDPASLVEQYVEPMCELRKSKGLTPEDARKQLQDTVVL
FT                   GTMMMAQNDVDGLVSGAVHTTANTIRPALQLIKTAPGASLVSSVFFMLLPNQVLVFGDC
FT                   AVNPNPTAQQLADIAIQSADSAKAFGIDPKVAMISYSTVNSGSGPDVDTVIEATKLARE
FT                   KRPDLAIDGPLQYDAATVPGVGKSKAPGSPVAGQATVLVFPDLNTGNCTYKAVQRSANV
FT                   LSVGPLLQGLRKPVNDLSRGALVEDIVFTIALTAVQAKQMEG"
FT   gene            287484..287621
FT                   /locus_tag="NGK_0346"
FT   CDS_pept        287484..287621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0346"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29039"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJN7"
FT                   /protein_id="ACF29039.1"
FT                   /translation="MLRCAAYVVGRGGIWAETAACVPCVPCLAWGAQVEYSKQILFPTR
FT                   "
FT   gene            complement(287653..288711)
FT                   /locus_tag="NGK_0348"
FT   CDS_pept        complement(287653..288711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0348"
FT                   /product="Fe(3+) ions import ATP-binding protein fbpC"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29041"
FT                   /db_xref="GOA:B4RJN8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015853"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041230"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJN8"
FT                   /protein_id="ACF29041.1"
FT                   /translation="MTAALHIGHLSKSFQNTPVLNDISLSLDPGEILFIIGASGCGKTT
FT                   LLRCLAGFEQPDSGEISLSGKTIFSKNTNLPVRERRLGYLVQEGVLFPHLTVYRNIAYG
FT                   LGNGKGRTAQERQRIEAMLELTGISELAGRYPHELSGGQQQRVALARALAPDPELILLD
FT                   EPFSALDEQLRRQIREDMIAALRANGKSAVFVSHDREEALQYADRIAVMKQGRILQTAS
FT                   PHELYRQPADLDAALFIGEGIVFPAALNADGTADCRLGRLPVQSGAPAGTRGTLLIRPE
FT                   QFSLHPHSAPAASIHAVVLKTTPKARHTEISLRAGQTVLTLNLPSAPTLSDGISAVLHL
FT                   DGPALFFPGNTL"
FT   gene            complement(288732..290261)
FT                   /locus_tag="NGK_0349"
FT   CDS_pept        complement(288732..290261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0349"
FT                   /product="ABC transporter, permease protein, iron related"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29042"
FT                   /db_xref="GOA:B4RJN9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJN9"
FT                   /protein_id="ACF29042.1"
FT                   /translation="MKNTMSPKKIPIWLTGLILLIALPLTLPFLYVAMRSWQVGINRAV
FT                   ELLFRPRMWDLLSNTLTMMAGVTLISIVLGIACALLFQRYRFFGKTFFQTAITLPLCIP
FT                   AFVSCFTWISLTFRVEGFWGTVMIMSLSSFPLAYLPVEAALKRISLSYEEVSLSLGKSR
FT                   LQTFFSAILPQLKPAIGSSVLLIALHMLVEFGAVSILNYPTFTTAIFQEYEMSYNNNTA
FT                   ALLSAVLTAVCGIVVFGESIFRGKAKIYHSGKGVARPYPVKTLKLPGQIGAIVFLSSLL
FT                   ILGIIIPFGVLIHWMMVGTSGTFALVSVFDAFIRSLSVSALGAILTILCALPLVWASVR
FT                   YRNFLTVWIDRLPFLLHAVPGLVIALSLVYFSINYTPAVYQTFIVVILAYFMLYLPMAQ
FT                   TTLRTSLEQLPKGMEQVGATLGRGHFFIFRTLVLPSILPGITAAFALVFLKLMKELTAT
FT                   LLLTADDVHTLSTAVWEYTSDAQYAAAAPYALMLVLFSGIPVFLLKKYAFK"
FT   gene            complement(290317..291312)
FT                   /locus_tag="NGK_0350"
FT   CDS_pept        complement(290317..291312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0350"
FT                   /product="Major ferric iron-binding protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29043"
FT                   /db_xref="GOA:B4RJP0"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006061"
FT                   /db_xref="InterPro:IPR026045"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJP0"
FT                   /protein_id="ACF29043.1"
FT                   /translation="MKTSIRYALLAAALTAATPALADITVYNGQHKEAAQAVADAFTRA
FT                   TGIKVKLNSAKGDQLAGQIKEEGSRSPADVFYSEQIPALATLSAANLLEPLPASTINET
FT                   RGKGVPVAAKKDWVALSGRSRVVVYDTRKLSEKDLEKSVLNYATPKWKNRIGYVPTSGA
FT                   FLEQIVAIVKLKGEAAALKWLKGLKEYGKPYAKNSVALQAVENGEIDAALINNYYWHAF
FT                   AREKGVQNVHTRLNFVRHRDPGALVTYSGAAVLKSSQNKDEAKKFVAFLAGKEGQRALT
FT                   AVRAEYPLNPHVVSTFNLEPIAKLEAPQVSATTVSEKEHATRLLEQAGMK"
FT   gene            291438..291698
FT                   /locus_tag="NGK_0351"
FT   CDS_pept        291438..291698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0351"
FT                   /product="Twin-arginine translocation pathway signal"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29044"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJP1"
FT                   /protein_id="ACF29044.1"
FT                   /translation="MFVLTCIFSVHRARKAEAAGNAWRNVGKGGILICRNAGEPLPLKR
FT                   RLNKVAGIVLPSRQIQFVGILPILFIQTVRQRGGFVVEMFC"
FT   gene            complement(291703..292044)
FT                   /locus_tag="NGK_0352"
FT   CDS_pept        complement(291703..292044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0352"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29045"
FT                   /db_xref="InterPro:IPR025402"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJP2"
FT                   /protein_id="ACF29045.1"
FT                   /translation="MTDTDTQADRFEQMMRQAVDKLFEQHDGKLESMDGREQELVLIWR
FT                   AEADIGNGGILQFVCNWGLPAAEKTCSVLKKIGAVHSAMLIHRAADALGKEIRHLQSEG
FT                   KNLKEMWDI"
FT   gene            complement(292102..292410)
FT                   /locus_tag="NGK_0353"
FT   CDS_pept        complement(292102..292410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0353"
FT                   /product="argininosuccinate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29046"
FT                   /db_xref="GOA:B4RJP3"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR029419"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJP3"
FT                   /protein_id="ACF29046.1"
FT                   /translation="MRAAVMQGFATATDLADYLVKKGMPFRDAHEVVAQAVRHADEAGV
FT                   DLSELPLEALQGFSKLISDDVYGVLTPEGSLNARNHLGGTAPEQVRLQVKRWREMSA"
FT   gene            complement(292395..293477)
FT                   /locus_tag="NGK_0354"
FT   CDS_pept        complement(292395..293477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0354"
FT                   /product="argininosuccinate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29047"
FT                   /db_xref="GOA:B4RJP4"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJP4"
FT                   /protein_id="ACF29047.1"
FT                   /translation="MHDKTWSGRFNEPVSELVKQYTASIGFDQRLAEWDIQGSLAHAQM
FT                   LTRSGVLSENDLTDIRRGMSEILEEIRSGKIEWPLDLEDVHMNIERRLTDKIGDAGKRL
FT                   HTGRSRNDQVATDIRLWLRDQITVIQNLIQNLQTALLDLAEQNAETVMPGFTHLQVAQP
FT                   VSFGHHLLAYVEMLGRDFERMADCRKRVNRMPLGAAALAGTTYPIQREITAELLGFEQI
FT                   CQNSLDAVSDRDFAIEFTAAASLVMVHLSRLSEELILWMSPRFGFIDIADRFCTGSSIM
FT                   PQKKNPDVPELVRGKSGRVIGHLIGLITLMKSQPLAYNKDNQEDKEPLFDTADTLIDTL
FT                   RIYADMMRGVTVNPAICAPP"
FT   gene            complement(293496..294365)
FT                   /locus_tag="NGK_0355"
FT   CDS_pept        complement(293496..294365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0355"
FT                   /product="UTP--glucose-1-phosphate uridylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29048"
FT                   /db_xref="GOA:B4RJP5"
FT                   /db_xref="InterPro:IPR005771"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJP5"
FT                   /protein_id="ACF29048.1"
FT                   /translation="MKPIKKAVFPVAGMGTRFLPATKANPKEMLPIVDKPLIQYAVEEA
FT                   VEAGCTEMVFVTGRNKRSIEDHFDKAYELETKLEMRHKDKLLEHVRNILPPNITCLYIR
FT                   QAEALGLGHAVLCARAAIGDEPFAVILADDLIDAPKGALKQMVEVYGRSGNSILGVETV
FT                   EPSQTGSYGIVETEQLKQFQRITGIVEKPKPEDAPSNLAVVGRYILTPRIFDLLTGLPR
FT                   GAGNEIQLTDGIAKLLDHEFVLAHPFEGTRYDCGSKLGYLEATVAYGLKHPETGEPFRR
FT                   LLEKYRTE"
FT   gene            complement(294393..294992)
FT                   /locus_tag="NGK_0356"
FT   CDS_pept        complement(294393..294992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0356"
FT                   /product="Nucleoside-triphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29049"
FT                   /db_xref="GOA:B4RJP6"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJP6"
FT                   /protein_id="ACF29049.1"
FT                   /translation="MSEKPEKIVLASGNAGKLKEFGNLFKPYGITVLPQSPFGIPECPE
FT                   PYPTFVENALAKARHAAGHSGLPALADDSGICAAALNGAPGIHSARYAGSNPKSDTANN
FT                   LKLAAELAGKADKSCSYVCVLVFVRHKDDPRPIIAEGIWHGQWHDTPLGQNGFGYDPYF
FT                   YLPEHGKTAAELDSEVKNRESHRAQALADLIRKLAL"
FT   gene            complement(294985..295218)
FT                   /locus_tag="NGK_0357"
FT   CDS_pept        complement(294985..295218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0357"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29050"
FT                   /db_xref="GOA:B4RJP7"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJP7"
FT                   /protein_id="ACF29050.1"
FT                   /translation="MNRRKIYLLSVALFTLAFMLPVLLGAYLLTAGSKAFAVASFLFAF
FT                   GALFGQIGALALYLRHKSLRAAPSSSQGNRYV"
FT   gene            complement(295326..295907)
FT                   /locus_tag="NGK_0358"
FT   CDS_pept        complement(295326..295907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0358"
FT                   /product="inorganic pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29051"
FT                   /db_xref="GOA:B4RJP8"
FT                   /db_xref="InterPro:IPR008162"
FT                   /db_xref="InterPro:IPR036649"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJP8"
FT                   /protein_id="ACF29051.1"
FT                   /translation="MCYTFKLQTFPNKGNQMADFNQILTPGDVDGGIINVVNEIPAGSN
FT                   HKIEWNRKLAAFQLDRIEPAIFAKPTNYGFIPQTLDEDGDELDVLLVTEQPLATGVFLE
FT                   ARVIGVMKFVDDGEVDDKIVCVPADDRNNGNAYKTLSDLPQQLIKQIEFHFNHYKDLKK
FT                   AGTTKVESWGGAEEAKKVIKESIERWNKQA"
FT   gene            complement(295961..296419)
FT                   /locus_tag="NGK_0359"
FT   CDS_pept        complement(295961..296419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0359"
FT                   /product="dATP pyrophosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29052"
FT                   /db_xref="GOA:B4RJP9"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR003564"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJP9"
FT                   /protein_id="ACF29052.1"
FT                   /translation="MPMAKPLKYPVSALVVLYSGDGGILLIERTHPKGFWQSVTGSLEP
FT                   GETVAQTARREVWEETGILLEDGQLQDRHDSTVYEIYHHWRHRYPKGVFENREHVFRAE
FT                   IPRDTPVVLQPEEHVSYGWFGLEEAAEKVFSPSNRRAILELGRFLGKR"
FT   gene            296630..296706
FT                   /locus_tag="NGK_trnaPro2"
FT   tRNA            296630..296706
FT                   /locus_tag="NGK_trnaPro2"
FT                   /product="tRNA-Pro"
FT   gene            296969..298855
FT                   /locus_tag="NGK_0360"
FT   CDS_pept        296969..298855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0360"
FT                   /product="MafB1"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29053"
FT                   /db_xref="InterPro:IPR008106"
FT                   /db_xref="InterPro:IPR029501"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJQ0"
FT                   /protein_id="ACF29053.1"
FT                   /translation="MGISRKISLILSILAVCLPMHAHASDLANDPFIRQVLDRQHFEPD
FT                   GKYHLFGSRGELAERSGHIGLGNIQSHQLGNLMIQQAAIKGNIGYIVRFSDHGHEVHSP
FT                   FDNHASHSDSDEAGSPVDGFSLYRIHWDGYEHHPADGYDGPQGGGYPAPKGARDIYSYD
FT                   IKGVAQNIRLNLTDNRSTGQRLADRFHNAGAMLTQGVGDGFKRATRYSPELDRSGNAAE
FT                   AFNGTADIVKNIIGAAGEIVGAGDAVQGISEGSNIAVMHGLGLLSTENKMARINDLADM
FT                   AQLKDYAAAAIRDWAVQNPNAAQGIEAVSNIFMAAIPIKGIGAVRGKYGLGGITAHPVK
FT                   RSQMGAIALPKGKSAVSDNFADAAYAKYPSPYHSRNIRSNLEQRYGKENITSSTVPPSN
FT                   GKNVKLADQRHPKTGVPFDGKGFPNFEKHVKYDTKLDIQELSGGGIPKAKPVFDAKPRW
FT                   EVDRKLNKLTTREQVEKNVQETRRRSQSSQFKAHAQREWENKTGLDFNHFIGGDINKKG
FT                   TVTGGHSLTRGDVRVIQQTSAPDKHGVYQATVEIKKPDGSWEVKTKKGGKVMTKHTMFP
FT                   KDWDEARIRAEVTSAWESRIMLKDNKWQGTSKSGIKIEGFTEPNRTAYPIYE"
FT   gene            300424..300540
FT                   /locus_tag="NGK_0361"
FT   CDS_pept        300424..300540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0361"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29054"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJQ1"
FT                   /protein_id="ACF29054.1"
FT                   /translation="MSIDPPVSKEKALKALEKYPEIYHKFKWFFPFVELPLL"
FT   gene            complement(300580..302037)
FT                   /locus_tag="NGK_0362"
FT   CDS_pept        complement(300580..302037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0362"
FT                   /product="putative transport protein, potassium"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29055"
FT                   /db_xref="GOA:B4RJQ2"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004772"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJQ2"
FT                   /protein_id="ACF29055.1"
FT                   /translation="MHKILPIAHVLSRLGMLFSFILLIPAALSYAFSDGAYTAFATTAT
FT                   VTLSGSCIVRLATLRFRRELRPRDGFTLVLMLWLAFAAMAAMPMYLYFPNMGFTDAFFE
FT                   SMSGLTTTGATVIPHVDGLAPSVNFWRHMLNWLGGMGIIVLAVAILPMLGVGGTQLFKA
FT                   EIPGIDKESKMSPRISQVAKKLWFGYTLITILAAACLHFAGMGWFDAVCHALATLSLGG
FT                   FSTHDASIGYYNSPLIEAVIIVFTIFGGINFASHFAALNSRSLKTYWKDEECRTMLLLL
FT                   SGSILAAALYLWHTGHYAGFGESLRYTAFNFVSIGLANGLSNTDFAQWPLLISLWMFFL
FT                   ANILASSGSTGGGIKTIRALVLFKFSLREMMVLLHPKAVRTVKISGKAIPDRLALTVMS
FT                   FIFIYFMTVVLFSFLLMASGMEFTTAFTAVIACITNAGPGLGEVGPAGNYAGLDVMQKW
FT                   ICVTAMLLGRLEIFTVFILFTPAYWKK"
FT   gene            complement(302052..302882)
FT                   /locus_tag="NGK_0363"
FT   CDS_pept        complement(302052..302882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0363"
FT                   /product="putative bis(5'-nucleosyl)-tetraphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29056"
FT                   /db_xref="GOA:B4RJQ3"
FT                   /db_xref="InterPro:IPR004617"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4RJQ3"
FT                   /protein_id="ACF29056.1"
FT                   /translation="MAHYAIGDIQGCFDELTALLGKIGFNHGTDTLWLTGDIVNRGPKS
FT                   LETLQFCIRHENSVQIVLGNHDLYLLAVGCGEGALKRSDTIEPILKHPDGGKMLDWLRA
FT                   QPLLIREGGRVMIHAGILPQWRIAKAESLAGEAEAELRGKKYVKFFSKMYGNKPAAWDE
FT                   GLEGYARLRFIVNAFTRMRALTFKNELDFDYKSTVKKMPPYLRPWFKAPDRQNLDHTII
FT                   FGHWSSLGYTNADNVISLDTGALWGGQLTAVNLETEEITQVQAAGGIDWKSFAK"
FT   gene            complement(302959..303348)
FT                   /locus_tag="NGK_0364"
FT   CDS_pept        complement(302959..303348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0364"
FT                   /product="Ribonuclease, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29057"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJQ4"
FT                   /protein_id="ACF29057.1"
FT                   /translation="MSKTVIHTDKAPAAIGAYSQAVRAGGTVYMSGQIPLDPATMTVVG
FT                   NGDFHTEARQVFQNLQAVAEAAGGSLDDIVKLNAYLTDLGNFAVFNEVMAEFITEPFPA
FT                   RAAVGVASLPKGVQVEAEAVLVLNA"
FT   gene            complement(303495..304022)
FT                   /locus_tag="NGK_0365"
FT   CDS_pept        complement(303495..304022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0365"
FT                   /product="outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29058"
FT                   /db_xref="GOA:B4RJQ5"
FT                   /db_xref="InterPro:IPR003394"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJQ5"
FT                   /protein_id="ACF29058.1"
FT                   /translation="MKKALAALIALALPAAALAEGASGFYVQADAAHAKASSSLGSAKG
FT                   FSPRISAGYRINDLRFAVDYTRYKNYKQAPSTDFKLYSIGASVIYDFDTQSPVKPYFGA
FT                   RLSLNRASAHLGGSDSFSKTSAGLGVLAGVSYAVTPNVDLDAGYRYNYIGKVNTVKNVR
FT                   SGELSAGVRVKF"
FT   gene            304124..304327
FT                   /locus_tag="NGK_0366"
FT   CDS_pept        304124..304327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0366"
FT                   /product="Periplasmic binding protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29059"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJQ6"
FT                   /protein_id="ACF29059.1"
FT                   /translation="MPQDTRRHPAALPTAKPLTRALPLNGGITRRMGETCKRFGKNRKG
FT                   GAAAFVRLLQAQAYGFLCAALP"
FT   gene            complement(304319..304477)
FT                   /locus_tag="NGK_0367"
FT   CDS_pept        complement(304319..304477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0367"
FT                   /product="Beta-glucosidase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29060"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJQ7"
FT                   /protein_id="ACF29060.1"
FT                   /translation="MFFISANKSAAARVKPAPNAAGKYAYRWETQPHPPPGVSDGTAAA
FT                   GNVRRLR"
FT   gene            complement(304465..305640)
FT                   /locus_tag="NGK_0368"
FT   CDS_pept        complement(304465..305640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0368"
FT                   /product="coproporphyrinogen III oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29061"
FT                   /db_xref="GOA:B4RJQ8"
FT                   /db_xref="InterPro:IPR004559"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010723"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJQ8"
FT                   /protein_id="ACF29061.1"
FT                   /translation="MHTISFPNRTRLTALPPLSLYIHIPWCIKKCPYCDFNSHSLKNGL
FT                   PEAAYIDALLTDLQLELPNIWGRPVETIFFGGGTPSLFQAESIDRLLSGVRSLLRLQPE
FT                   AEITLEANPGTFEIEKFQGFKDAGITRLSIGVQSFNDDMLSRLGRVHNGKEALTAIDTA
FT                   LKLFDKVNIDLMYSLPNQTVQTALDDVQTAIATDATHISAYHLTMEPNTPFGHTPPKGL
FT                   PQDEAALDIEDAVHGTLEGAGFIHYETSAFAKPTMQCRHNLNYWQFGDYLGIGAGAHGK
FT                   ISYPDRIERTVRRRHPNDYLALMQSQPGEAVERKTVAAEDLPFEFMMNALRLTDGVPAA
FT                   MLQERTGVPAAKIMVQIETARQKGLLETDPTVFRPTEKGRLFLNDLLQCFL"
FT   gene            complement(305697..308168)
FT                   /locus_tag="NGK_0369"
FT   CDS_pept        complement(305697..308168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0369"
FT                   /product="putative DNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29062"
FT                   /db_xref="GOA:B4RJQ9"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR001679"
FT                   /db_xref="InterPro:IPR004149"
FT                   /db_xref="InterPro:IPR004150"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013839"
FT                   /db_xref="InterPro:IPR013840"
FT                   /db_xref="InterPro:IPR018239"
FT                   /db_xref="InterPro:IPR033136"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="InterPro:IPR041663"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4RJQ9"
FT                   /protein_id="ACF29062.1"
FT                   /translation="MNPTAQRIHELTDLLNRYAYEYYTLDAPSIPDAEYDRLFRELEAL
FT                   ERNHPELKLPDSPTQRVGGEPLAGFAEVRHEVPMLSLTNAFSPQDENGVFDHAEMYAFD
FT                   QRVRDGLDGGNPEYVIEPKFDGLAISLLYRDGVLVQAATRGDGTTGEDVTRNVKTVSNI
FT                   PLRLHGENVPELIEVRGEVLMLKADFAGLNKRQAENGQKPFANPRNAAAGSLRQLDSRI
FT                   TAQRKLHFFPYSIARQQGGFEAEEHIQELAYFQELGFSLPNGNFGCFKNIGEVLAFYEH
FT                   MQQKRPELPYEIDGMVVKVNSLAQQRELGFISRAPRWAVAHKFPAEEALTIVEAIDVQI
FT                   GRTGAVTPVARLQPVFVGGVTVTNATLHNQDEVSRKDVRVGDTVVVRRAGDVIPEVVRV
FT                   IFERRPMQETAVAVSDGIGHQQDDLFAETPSAKQTESVPLHKPYRLPARCPICRSEIER
FT                   EEGEAVARCSGGMLCQAQRAQGLIHFASRKAMDIDGLGEKQIEQLVAQDLVRHFADLYR
FT                   IDIPTLQKMKETADKGSSENENGDAETVSGDLSKYNTQNGKKQPTKWAQNILAGIESGK
FT                   TPELARFLFALGIRHVGERTAKTLAQAFGTLERVRRAPEPVLACLPDIGTVVARSIAHF
FT                   FAQAEQQAMIDELLAAGVAPQAQAVSLPAAQYAGPQRWITRLPGFKISENKAQALWELA
FT                   GQSIEGLQNDKALPADWQAWRSKAQNTALLENLKTFFAQMPSEDEAAQGSDGINKAVAG
FT                   KTFVLTGTLPTFKRDQAQALIEAAGGKVSGSVSKKTDYVVAGEAAGSKLEKANALGVSV
FT                   LSEAELLTLLC"
FT   gene            complement(308302..309597)
FT                   /locus_tag="NGK_0370"
FT   CDS_pept        complement(308302..309597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0370"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29063"
FT                   /db_xref="GOA:B4RJR0"
FT                   /db_xref="InterPro:IPR007449"
FT                   /db_xref="InterPro:IPR036765"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJR0"
FT                   /protein_id="ACF29063.1"
FT                   /translation="MIAMIYIVLFLAAVLAVVAYNMYQENQYRKKVRDQFGHSDKDALL
FT                   NSKTSHVRDGKPSGGPVMMPKPQPAVKKPAKPQDSAMRNLQEQDAVYIAKQKQAKASPF
FT                   KTEIETALEEIGIIGNSAHTVSEPQTGHSAPKPADAPAKPVPVPQTPAKPLITLKELSK
FT                   VELPWFDMRFDFISYIALTEAKELHALPRLSNRCRYQIVGCTMDDHFQIAEPIPGIRYQ
FT                   AFIVGIQAVSRNGLASQEELSAFNRQADAFAQSMGGQTLHTDLAAFIEVASALDAFCAR
FT                   VDQTIAIHLVSPTSISGVELRSAVTGVGFVLEDDGAFHYTDTSGSTMFSICSLNNEPFT
FT                   NALLDNQSYKGFSMLLDIPHSPAGEKTFDDLFMDLAVRLSGQLNLNLVNDKMEEVSTQW
FT                   LKDVRTYVLARQSEMLKVGIEPGGKTALRLFS"
FT   gene            complement(309782..310354)
FT                   /locus_tag="NGK_0371"
FT   CDS_pept        complement(309782..310354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0371"
FT                   /product="AmpD"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29064"
FT                   /db_xref="GOA:B4RJR1"
FT                   /db_xref="InterPro:IPR002502"
FT                   /db_xref="InterPro:IPR036505"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJR1"
FT                   /protein_id="ACF29064.1"
FT                   /translation="MDNHAGAHWQNGWLQSIRHTPSPNFSPRETGETVSLIVLHNISLP
FT                   PFEYGTDAVEKLFANRLDPDGHPFFSLIHTLHVSSHFLIARDGETVQFVSCGDMAYHAG
FT                   ASSFRGREKCNAFSIGIELEGCDFEPFAEAQYRSLETLLAALCRRYPITAVTGHQDIAP
FT                   GRKTDPGHFFDWRRIREKGFPVDRNAV"
FT   gene            310438..311433
FT                   /locus_tag="NGK_0372"
FT   CDS_pept        310438..311433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0372"
FT                   /product="Periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29065"
FT                   /db_xref="GOA:B4RJR2"
FT                   /db_xref="InterPro:IPR003770"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJR2"
FT                   /protein_id="ACF29065.1"
FT                   /translation="MLKKMLKWTAVFLTVSAAVFAALLFVPKDNGRAYRIKIAKNQGIS
FT                   SVGRKLAEDRIVFSRHVLTAAAYVLGVHNRLHTGTYRLPSEVSAWDILQKMRGGRPDSV
FT                   TVQIIEGSRFSHMRKVIDATPDIGHDTKGWSNEKLMAEVAPDAFSGNPEGQFFPDSYEI
FT                   DAGGSDLQIYQTAYKAMQRRLNEAWAGRQDGLPYKNPYEMLIMASLIEKETGHEADRDH
FT                   VASVFVNRLKIGMRLQTDPSVIYGMGAAYKGKIRKADLRRDTPYNTYTRGGLPPTPIAL
FT                   PGKAALDAAAHPSGEKYLYFVSKMDGTGLSQFSHDLTEHNAAVRKYILKK"
FT   gene            311493..312113
FT                   /locus_tag="NGK_0373"
FT   CDS_pept        311493..312113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0373"
FT                   /product="thymidylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29066"
FT                   /db_xref="GOA:B4RJR3"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4RJR3"
FT                   /protein_id="ACF29066.1"
FT                   /translation="MKPQFITLDGIDGAGKSTNLAVIKAWFERRGLPVLFTREPGGTPV
FT                   GEALREILLNPETKAGLRAETLMMFAARMQHIEEVILPALSDGIHVVSDRFTDATFAYQ
FT                   GGGRGMPSEDIEILEHWVQGGLRPDLTLLLDVPLEVSMARIGQAREKDRFEQEQADFFM
FT                   RVRGVYLDRAAACPERYAVIDSNRSLDEVRNSIEKVLDGHFGC"
FT   gene            312335..313615
FT                   /locus_tag="NGK_0374"
FT   CDS_pept        312335..313615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0374"
FT                   /product="Malate oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29067"
FT                   /db_xref="GOA:B4RJR4"
FT                   /db_xref="InterPro:IPR001891"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR015884"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJR4"
FT                   /protein_id="ACF29067.1"
FT                   /translation="MENSLKEAALKFHELPVPGKISVTPTKSLATDKDLALAYSPGVAA
FT                   PCMEIHADPQNAYKYTGKGNLVAVISNGTAVLGLGDIGALAGKPVMEGKGVLFKKFAGV
FT                   DVFDIEIDEKDPQKLVDIIAALEPTFGGINLEDIKAPECFYIERELRKRCKIPVFHDDQ
FT                   HGTAIITAAAVLNALRYTGRKIEEATLVCSGAGAAAIACLNQLLDLGLKRENVTVCDSK
FT                   GVIYQTREDKDRMDESKKFYAVEDNGRRVLADAVKGKDIFLGLSGANLLTPEMLNTMNE
FT                   KPIVFAMANPNPEILPPLAKETRPDVVIGTGRSDFPNQVNNVLCFPFIFRGALDVGATT
FT                   INEEMKRACVYALADLAMEEVTEEVVAAYGKKFEFGAEYLIPTPFDSRLLPRVATAAAK
FT                   AAMESGVATRPIADLEAYAAKLGEWKL"
FT   gene            313770..313931
FT                   /locus_tag="NGK_0375"
FT   CDS_pept        313770..313931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0375"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29068"
FT                   /db_xref="GOA:B4RJR5"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJR5"
FT                   /protein_id="ACF29068.1"
FT                   /translation="MTTGQWVLTMIVFMIPLVNIVMFFVWAFGRGNPNRANFCKALFLF
FT                   TLLVRLSV"
FT   gene            313978..315048
FT                   /locus_tag="NGK_0376"
FT   CDS_pept        313978..315048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0376"
FT                   /product="tetraacyldisaccharide 4'-kinase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29069"
FT                   /db_xref="GOA:B4RJR6"
FT                   /db_xref="InterPro:IPR003758"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJR6"
FT                   /protein_id="ACF29069.1"
FT                   /translation="MCRLILLRRFVSNMPNFFKFHTVIERHWQKPYPVLSFLLKPLSGL
FT                   FAKIAAKWRADFLSGKRQSEKLSVPVVVVGNIHAGGTGKTPIAAALVSGLQEKGVKVGI
FT                   ISRGYGRKSKAVYVLNAASRAEDAGDEPLLLFRKTGAPTAVGSSRVEAGRALLAAHPEL
FT                   ELIVADDGLQHYALQRDVEIAVFPAADTGRTDLDLLPNGNLREPLSRLESVDAVVVGGR
FT                   AADGFMPSEHLFGSRIEAGAVYRLNRPSEKLDISTLSGKRVAAVAGIARPQRFFDTLTH
FT                   MGIRLDQTVALPDHADIFNRDLPPADVVLVTEKDAVKFSDGICTDNVWVLPVCAIIEPD
FT                   LAEFVLERLEGVPKAV"
FT   gene            315248..315787
FT                   /locus_tag="NGK_0377"
FT   CDS_pept        315248..315787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0377"
FT                   /product="Periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29070"
FT                   /db_xref="InterPro:IPR018637"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJR7"
FT                   /protein_id="ACF29070.1"
FT                   /translation="MDMKLKTLLLPFAALALCANAFAAPPGDASLARWLDTQNFDRDIE
FT                   KNMIEGFNAGFKPYADKALAEMPEAKKDQAAEAFNRYRENVLKDLITPEVKQAVRNTLL
FT                   KNAREIYTQEEIDGMIAFYGSPVGQSVVAKNPRLIKKSMSEIAVSWTALSGKIARHHLP
FT                   EFTEELRRIICGGIVD"
FT   gene            316009..316191
FT                   /locus_tag="NGK_0378"
FT   CDS_pept        316009..316191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0378"
FT                   /product="UPF0434 protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29071"
FT                   /db_xref="InterPro:IPR005651"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4RJR8"
FT                   /protein_id="ACF29071.1"
FT                   /translation="MEKKFLDILVCPVTKGRLEYHQDKQELWSRQAKLAYPIKDGIPYM
FT                   LENEARALSEEELKA"
FT   gene            316188..316949
FT                   /locus_tag="NGK_0379"
FT   CDS_pept        316188..316949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0379"
FT                   /product="3-deoxy-D-manno-octulosonate
FT                   cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29072"
FT                   /db_xref="GOA:B4RJR9"
FT                   /db_xref="InterPro:IPR003329"
FT                   /db_xref="InterPro:IPR004528"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4RJR9"
FT                   /protein_id="ACF29072.1"
FT                   /translation="MTEFVVLIPARLDSSRLPGKALADIHGKPMVVRVAEQAAKSKAAR
FT                   VVVATDHPDIQTACQAHGIEVVMTSNRHESGTTRLAEAAAALKLPPHLIVVNVQGDEPL
FT                   IAPELIDRTAEVLVENNVQMATAGHELHDFDELMNPNAVKVVLDKNGNAIYFSRAPIPY
FT                   PRDAMRAGKREMPSETAVLRHIGIYAYRVGFLQRYAEMSVSPLETIESLEQLRVLWHGY
FT                   PIAVETAKEAPAAGVDTQEDLDRVRAVFQTV"
FT   gene            316972..317268
FT                   /locus_tag="NGK_0380"
FT   CDS_pept        316972..317268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0380"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29073"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJS0"
FT                   /protein_id="ACF29073.1"
FT                   /translation="MQQHIEKWQHLSREEQKILAEVWGLVQNDDQEVHYEMLKLNAPDE
FT                   VSGEFWFRMAETLSTLPPNRSLDLRMNGGRLSTAVSILSVMIEDNPDIPQLWA"
FT   gene            317290..317487
FT                   /locus_tag="NGK_0381"
FT   CDS_pept        317290..317487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0381"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29074"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJS1"
FT                   /protein_id="ACF29074.1"
FT                   /translation="MVHGHKARADGLVQQPDKAAEANEEEYLTKALSQNLLSTLDASLA
FT                   RFPEDAWFQEIKQDAQKHFA"
FT   gene            317465..317581
FT                   /locus_tag="NGK_0382"
FT   CDS_pept        317465..317581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0382"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29075"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJS2"
FT                   /protein_id="ACF29075.1"
FT                   /translation="MHKSILLEDVAVRNISIQEEKKCLIGYNQGKSYFISKD"
FT   gene            317644..317736
FT                   /locus_tag="NGK_trnaSer1"
FT   tRNA            317644..317736
FT                   /locus_tag="NGK_trnaSer1"
FT                   /product="tRNA-Ser"
FT   gene            317968..318795
FT                   /locus_tag="NGK_0383"
FT   CDS_pept        317968..318795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0383"
FT                   /product="TrpA"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29076"
FT                   /db_xref="GOA:B4RJS3"
FT                   /db_xref="InterPro:IPR002028"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018204"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJS3"
FT                   /protein_id="ACF29076.1"
FT                   /translation="MYFTAYLPIGWKRQMSRIRQAFAALDGGKALIPYIAVGDPDIRTT
FT                   LALMHGMVASGADILELGVPFSDPMADGPVIQRAAERALANGISLRDVLDVVRKFRETD
FT                   TQTPVVLMGYLNPIHKMGYREFAQEAAKAGVDGVLTVDSPIETIGSLYRELKDNEVDCI
FT                   FLIAPTTTEDRIKTIAELAGGFVYYVSLKGVTGAASLDTDEVSRKIEYLRQYIDIPIGV
FT                   GFGISNAESARKIGRVADAIIVGSRIVKEIENNAGNEAAAVGALVKELKDAVR"
FT   gene            318832..319704
FT                   /locus_tag="NGK_0384"
FT   CDS_pept        318832..319704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0384"
FT                   /product="acetyl-CoA carboxylase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29077"
FT                   /db_xref="GOA:B4RJS4"
FT                   /db_xref="InterPro:IPR000438"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="InterPro:IPR041010"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJS4"
FT                   /protein_id="ACF29077.1"
FT                   /translation="MSWLDKILPPKIKNRGKDGSSNVPEGLWRKCPSCSATVYSTELQQ
FT                   NNQVCPKCNHHNPLSARQRLNLLLDEEGREEVAGNVKPTDPLKFKDSKKYPDRLSAARK
FT                   LTGEDDALVVMKGMMNGLPVVVAAFEFRFIGGSMGSVVGERFVQGVRRAVADNCPFVCV
FT                   AASGGARMQEGVNSLMQMTKTSAALHLLTEKRLPFISVLTDPTMGGVSASFAFLGDVVL
FT                   AEPNALIGFAGPRVIEQTVRETLPEGFQRAEFLLEKGAIDQIVDRRDMKRRISDLITLL
FT                   CRQDKVSAT"
FT   gene            complement(319764..320375)
FT                   /locus_tag="NGK_0385"
FT   CDS_pept        complement(319764..320375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0385"
FT                   /product="cryptic protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29078"
FT                   /db_xref="InterPro:IPR014861"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJS5"
FT                   /protein_id="ACF29078.1"
FT                   /translation="MRRAILLILTLTVGTSLAAGFSQKDTPINTRYRETPEEAAAREFK
FT                   EHTAELPPLPDAHSDGWFDIYVDENYGKQPKILLDSLQIMPAPDGSIRYILNIRSDKGY
FT                   DNLTAEGIFCALSSIGFGNGKLSSYKVFGYGDTVNSRWIQPRNAEWKPIGGTLGRNDAL
FT                   RAVLYQAFCEGGVPADTQGLVQRLKERAGRYAPSMKPHDK"
FT   gene            320483..320707
FT                   /locus_tag="NGK_0386"
FT   CDS_pept        320483..320707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0386"
FT                   /product="UPF0033 protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29079"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJS6"
FT                   /protein_id="ACF29079.1"
FT                   /translation="MNSETLDVTGLKCPLPILRAKKALAQMRQGEVLTVLATDGGAPGD
FT                   FEAFCRQTGHVLLDSSEQDGVFTLVVKHK"
FT   gene            complement(320741..320905)
FT                   /locus_tag="NGK_0387"
FT   CDS_pept        complement(320741..320905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0387"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29080"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJS7"
FT                   /protein_id="ACF29080.1"
FT                   /translation="MSDSGKLGNRFETTLSQDAGTPKQIDGYACKILMPYTGLPVLGIT
FT                   RSKHKCRQQ"
FT   gene            320975..321124
FT                   /locus_tag="NGK_0388"
FT   CDS_pept        320975..321124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0388"
FT                   /product="Lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29081"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJS8"
FT                   /protein_id="ACF29081.1"
FT                   /translation="MWTLERDGGIYYLSLTRDSCSVKAERADSAALLEHFSGLVRQPPK
FT                   NANI"
FT   gene            complement(321125..321805)
FT                   /locus_tag="NGK_0389"
FT   CDS_pept        complement(321125..321805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0389"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ACF31272"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJS9"
FT                   /protein_id="ACF31272.1"
FT                   /translation="MPPNRIGKNRLDMSGGIRMPVCMKSPNILIVRQPPFAMRPNRCGW
FT                   RAKKTAAYKGQDPAKVTHYLTRPAGFSDCQRVCPDETGFDRRLFRPYARSLKGQMAKAR
FT                   ISGKRYRRLSLVSAQVGNRPIAPMVCQNTVAGVFFEARFQQCLLPALAQKSVIISDNAR
FT                   FRRMGALRGTAEKLGHKVLPPAPYSPEPNPIEKVWANIKRYLRTVLSDYARFDDALLSY
FT                   FDFN"
FT   gene            complement(321827..321946)
FT                   /locus_tag="NGK_0390"
FT   CDS_pept        complement(321827..321946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0390"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ACF31273"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJT0"
FT                   /protein_id="ACF31273.1"
FT                   /translation="MLIRYITDNAKTPAKPQQRLTCQETRFTCGFALKNKQAA"
FT   gene            322167..322367
FT                   /locus_tag="NGK_0391"
FT   CDS_pept        322167..322367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0391"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29082"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJT1"
FT                   /protein_id="ACF29082.1"
FT                   /translation="MNIELRAEQSVQAPFETRQISYAWRESGSPEETVLTAQTADSPDL
FT                   PVQAVLNLTHRSHNGKPLILP"
FT   gene            322428..323462
FT                   /locus_tag="NGK_0392"
FT   CDS_pept        322428..323462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0392"
FT                   /product="dihydroorotase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29083"
FT                   /db_xref="GOA:B4RJT2"
FT                   /db_xref="InterPro:IPR002195"
FT                   /db_xref="InterPro:IPR004721"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4RJT2"
FT                   /protein_id="ACF29083.1"
FT                   /translation="MQTLTIIRPDDMHLHLRDGDALKAVAPYTARQMGRAVIMPNLKPP
FT                   VVSVADALAYKARIMAALPEGSAFEPLMTLYLTDQATPELVREAKAAGIVAFKLYPAGA
FT                   TTNSDSGVTDLFKLIPVLEEMAKQGILFLVHGEVTDPEIDIFDREAAFIGRVMKPVLAQ
FT                   VPNLKVVFEHITTAEAARLVLEAGDNVAASVTPQHLLLNRNDLLVGGVRPHHFCLPVLK
FT                   RETHRQALVAAVTGEKAHKFFLGTDSAPHAKSAKENACGCAGMFSAMTAIELYAEVFEK
FT                   AGALDKLEAFASENGARFYGIPENADTITLVKQSQTVPASVPYGDGELVPMRAGGEIGW
FT                   TVQY"
FT   gene            complement(323541..323966)
FT                   /locus_tag="NGK_0393"
FT   CDS_pept        complement(323541..323966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0393"
FT                   /product="transcription antitermination protein NusB"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29084"
FT                   /db_xref="GOA:B4RJT3"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR011605"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4RJT3"
FT                   /protein_id="ACF29084.1"
FT                   /translation="MKTARRRSRELAVQAVYQSLINRTAAPEIAKNIREMSDFAKADEE
FT                   LFNKLFFGTQTNAADYIQKIRPLLDRDEKDLNPIERAVLLTACHELSAMPETPYPVIIN
FT                   EAIEVTKTFGGTDGHKFVNGILDKLAAQIRPDEPKRR"
FT   gene            complement(324044..324520)
FT                   /locus_tag="NGK_0394"
FT   CDS_pept        complement(324044..324520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0394"
FT                   /product="riboflavin synthase subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29085"
FT                   /db_xref="GOA:B4RJT4"
FT                   /db_xref="InterPro:IPR002180"
FT                   /db_xref="InterPro:IPR034964"
FT                   /db_xref="InterPro:IPR036467"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4RJT4"
FT                   /protein_id="ACF29085.1"
FT                   /translation="MNTIAPNLDGKHLRIGIVQARFTNEIGSQMLKVCCRTLQELGVAD
FT                   ENITVATVPGALEIPIALMNFASSEKFDALIAIGVVIRGETYHFELVANESGAGIGRVA
FT                   LDYNIPIANAVLTTENDAQAIERIGEKASDAAKVAVECANLVNLLLEEQFEDEE"
FT   gene            complement(324567..324890)
FT                   /locus_tag="NGK_0395"
FT   CDS_pept        complement(324567..324890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0395"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29086"
FT                   /db_xref="InterPro:IPR018689"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJT5"
FT                   /protein_id="ACF29086.1"
FT                   /translation="MNAFAQALSSALDRCIATNTVAKQNRPVGFLYREAPVFENDSGWR
FT                   FFSGDETDEYTDDPDNFSIVSLADITKTNPETAALLSQPEGSAWELAEDGTFQTVADWQ
FT                   PQD"
FT   gene            complement(324887..325030)
FT                   /locus_tag="NGK_0396"
FT   CDS_pept        complement(324887..325030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0396"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29087"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJT6"
FT                   /protein_id="ACF29087.1"
FT                   /translation="MRFHTPKIQKHLKAANGAHCTTKPPPSADNAGIVVKSASFPPNVF
FT                   PQ"
FT   gene            325058..325777
FT                   /locus_tag="NGK_0397"
FT   CDS_pept        325058..325777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0397"
FT                   /product="ribonuclease III"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29088"
FT                   /db_xref="GOA:B4RJT7"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR011907"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4RJT7"
FT                   /protein_id="ACF29088.1"
FT                   /translation="MKDDVLKRQAHTAIQKKLGYAFRDMSLLRRALTHRSHHAKHNERF
FT                   EFVGDSILNYTVARMLFDAFPKLTEGELSRLRASLVNEGVLAEMAAEMNVGDGLYLGAG
FT                   ELKSGGFRRPSILADAMEAMFAAVSFDADFNTAEKVVRHLFAERVRRADFQNQAKDGKT
FT                   ALQEALQARRFALPKYRIEEQIGHANDSMFVISCDLGELGFVCRAKGTSRKAAEQEAAK
FT                   EALKWLEEKLPLKKKKK"
FT   gene            325806..326747
FT                   /locus_tag="NGK_0398"
FT   CDS_pept        325806..326747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0398"
FT                   /product="GTP-binding protein Era"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29089"
FT                   /db_xref="GOA:B4RJT8"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005662"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030388"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJT8"
FT                   /protein_id="ACF29089.1"
FT                   /translation="MDMKANMDIETFLAGERAAGGYRCGFVAIVGRPNVGKSTLMNHLI
FT                   GQKISITSKKAQTTRNRVTGIYTDDTAQFVFVDTPGFQTDHRNALNDRLNQNVTEALGG
FT                   VDVVVFVVEAMRLTDADRVVLKQLPKHTPVILVINKIDKDKAKDRYALEAFVAQVRAEF
FT                   EFAAAEAVSAKHGLRIANLLELLKPYLPESVPMYPEDMVTDKSARFLAMEIVREKLFRY
FT                   LGEELPYAMNVEVEQFEEGDGLNRIYIAVLVDKESQKAILIGKGGERLKKISTEARLDM
FT                   EKLFDNKVFLKVWVKVKSGWADDIRFLRELGL"
FT   gene            326900..327064
FT                   /locus_tag="NGK_0399"
FT   CDS_pept        326900..327064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0399"
FT                   /product="lactoferrin binding protein B precursor"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29090"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJT9"
FT                   /protein_id="ACF29090.1"
FT                   /translation="MRKLNYYGIALLPLMLASCGGNFGVQPVVESTPTAYPVTFKSKDV
FT                   PTSPLPSLR"
FT   gene            327103..329088
FT                   /locus_tag="NGK_0400"
FT   CDS_pept        327103..329088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0400"
FT                   /product="lactoferrin binding protein B precursor"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29091"
FT                   /db_xref="InterPro:IPR001677"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR035313"
FT                   /db_xref="InterPro:IPR035316"
FT                   /db_xref="InterPro:IPR038197"
FT                   /db_xref="InterPro:IPR038669"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJU0"
FT                   /protein_id="ACF29091.1"
FT                   /translation="MRLLRRNTAFHREDGTAIPDSKQAEEKLSFKEGDVLFLYGSKGNK
FT                   LQQLKSEIHKRDSDVEIRTSEKENKKYNYKFVDAGYVYTKNGKDEIEQNSGGKRFTHRF
FT                   GYDGFVYYSGERPSQSLPSAGTVQYSGNWQYMTDAKRHRTGKAVASDDLGYITFYGNDI
FT                   GATSYAAKDADDREKHPAEYTVDFDKKILKGELIKNQYVQKRNDPKEPKKPLTIYNITA
FT                   DLNGNRFTGSAKVNTEVKTRHADKEYLFFHTDADQRLEGGFFGDNGEELAGRFISNDNG
FT                   VFGVFAGKQKTNASGTNPAMPFGKHTKILDSLKISVDEATDENPRPFEVSTMPDFGHPD
FT                   KLLVEGREIPLVSKEKTIDLADGRKMTVSACCDFLTYVKLGRIKTERPAVKPKAQDEED
FT                   SGINNGEESEDEEIAEESEDEVSEDDNGEDEDEIVEEEADEAEEIEEEAEEEEPEEESP
FT                   EEGNGVSDGIPPAPEALKGRDIDLFLKGIRTAEADIPKTGTAHYTGTWEARIGEPIQWD
FT                   NKADKAAKAEFDVDFGNKSISGTLTEQNGVEPAFRIENGVIEGNGFHATARTRDNGINL
FT                   SGNGSTNPQSFKADNLLVTGGFYGPQAAELGGTIFNKDGKSLGITEDIENEVENEADVG
FT                   EQLEPEVKPQFGVVFGAKKDNKEVEK"
FT   gene            329085..331916
FT                   /locus_tag="NGK_0401"
FT   CDS_pept        329085..331916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0401"
FT                   /product="lactoferrin receptor precursor"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29092"
FT                   /db_xref="GOA:B4RJU1"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR010948"
FT                   /db_xref="InterPro:IPR010949"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJU1"
FT                   /protein_id="ACF29092.1"
FT                   /translation="MNKKHGFPLTLTALAIATAFPAYAAQAGAAALDAAQSQSLKEVTV
FT                   RAAKVGRRSKEATGLGKIVKTSETLNKEQVLGIRDLTRYDPGVAVVEQGNGASGGYSIR
FT                   GVDKNRVAVSVDGVAQIQAFTVQGSLSGYGGRGGSGAINEIEYENISTVEIDKGAGSSD
FT                   HGSGALGGAVAFRTKEAADLISDGKSRGIQAKTAYGSKNRQFMKSLGAGFSKDGWEGLL
FT                   IRTERQGRETRPHGDIADGVEYGIDRLDAFRQTYDIKRKTTEPFFLVEGENTLKPVAKL
FT                   AGYGIYLNRQLNRWVKERIEQNQPLSAEEEAQVREAQARHENLSAQAYTGGGRILPDPM
FT                   DYRSGSWLAKLGYRFGGRHYVGGVFEDTKQRYDIRDMTEKQYYGTDEAEKFRDKSGVYD
FT                   GDDFRDGLYFVPNIEEWKGDKNLVKGIGLKYSRTKFIDEHHRRRRMGLLYRYENEKYSD
FT                   NWADKAVLSFDKQGVATDNNTLKLNCAVYPAVDKSCRASADKPYSYDSSDRFHYREQHN
FT                   VLNASFEKSLKNKWTKHHLTLGFGYDASKAISRPEQLSHNAARISESTGFDEKNQDKYR
FT                   LGKPEVVEGSVCGYIETLRSRKCVPRKINGSNIHISLNDRFSIGKYFDFSLGGRYDRKN
FT                   FTTSEELVRSGRYADRSWNSGIVFKPNRHFSVSYRASSGFRTPSFQELFGIDIYHDYPK
FT                   GWQRPALKSEKAANREIGLQWKGDFGFLEISSFRNRYTDMIAVADQKTKLPDSAGRLTE
FT                   IDIRDYYNAQNMSLQGINILGKIDWNGVYGKLPEGLYTTLAYNRIKPKSVSNRPDLSLR
FT                   SYALDAVQPSRYVLGFGYDQPEGKWGANIMLTYSKGKNPDELAYLAGDQKRYSAGRVTS
FT                   SWKTADVSAYLNLKKRLTLRAAIYNIGNYRYVTWESLRQTAESTANRHGGDSNYGRYAA
FT                   PGRNFSLALEMKF"
FT   gene            331937..332062
FT                   /locus_tag="NGK_0402"
FT   CDS_pept        331937..332062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0402"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29093"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJU2"
FT                   /protein_id="ACF29093.1"
FT                   /translation="MICTPKVGLNRQLIKVQVFLIQYKQDFRRHSRAGGNPDIQC"
FT   gene            complement(332390..333016)
FT                   /locus_tag="NGK_0403"
FT   CDS_pept        complement(332390..333016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0403"
FT                   /product="N-(5'-phosphoribosyl)anthranilate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29094"
FT                   /db_xref="GOA:B4RJU3"
FT                   /db_xref="InterPro:IPR001240"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4RJU3"
FT                   /protein_id="ACF29094.1"
FT                   /translation="MRKIRTKICGITTPEDALYAAHAGADALGLVFYPQSPRAIDIIKA
FT                   QKIAAALPPFVSVVALFINESAQNIRRILAEVPIHIIQFHGDEDDAFCRQFDRPYIKAI
FT                   RVQTASDIRNAATRFPNAQALLFDAYHPSEYGGTGHRFDWTLLAEYSGKPWVLAGGLTP
FT                   ENVGEAVRITGAEAVDVSGGVEASKGKKDPAKVAAFIATANRLSR"
FT   gene            complement(333075..333566)
FT                   /locus_tag="NGK_0404"
FT   CDS_pept        complement(333075..333566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0404"
FT                   /product="transcription elongation factor GreB"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29095"
FT                   /db_xref="GOA:B4RJU4"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR006358"
FT                   /db_xref="InterPro:IPR018151"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028624"
FT                   /db_xref="InterPro:IPR036805"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJU4"
FT                   /protein_id="ACF29095.1"
FT                   /translation="MSTETKNYITPAGWQALKDELYQLVNKERPEIVQIVNWAAGNGDR
FT                   SENGDYLYGKRRMREIDRRIRFLTKRLEAAVVVDPELREATDQVFFGATVGLLRGDGRE
FT                   QTVKIVGVDEIDTAQNKISWISPLARCLIKAREGDEVVLNTPEGREEIEILSVEYIKID
FT                   "
FT   gene            complement(333666..335210)
FT                   /locus_tag="NGK_0405"
FT   CDS_pept        complement(333666..335210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0405"
FT                   /product="amidophosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29096"
FT                   /db_xref="GOA:B4RJU5"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR035584"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJU5"
FT                   /protein_id="ACF29096.1"
FT                   /translation="MCGVLGLVSHEPVNQLLYDGLQMLQHRGQDAAGIATAEGGTFHMH
FT                   KGKGMVSEVFRTRNMRDLTGNAGIAHVRYPTAGNAGSSAEAQPFYVSSPFGIVLAHNGN
FT                   LTNTAELYENVCNKHLRHINTGSDSEVLLNVFAHELRREVSKNADPHRLNADNIFNAVA
FT                   EVHRLVRGAYGVVAMIAGYGMLAFRDPYGIRPLALGSQTDSEGRKSYAVASESVAFNAL
FT                   AYDLERDIRPGEAVFVGFNGTIIARQCSDRAKLSPCLFEYVYFARPDSVIDGVSVYQSR
FT                   LDMGVSLAEKIKRELPVDGIDVVMPIPDTSRPSAMELAVHLNKPYREGLIKNRYIGRTF
FT                   IMPGQSTRKKSVRQKLSPMETEFAGKSVLLVDDSIVRGTTSREIVEMVRAAGARKVYIA
FT                   SAAPEVRYPNVYGIDMPTREELIANGRSAAEIAAEIGADGIVFQDLGDLEAVVKALNPK
FT                   IESFDSSCFNGIYQTGDIDDAYLDRLSAEKSGCGGLKIHPSRMEHSISISDAGDEE"
FT   gene            complement(335233..335394)
FT                   /locus_tag="NGK_0406"
FT   CDS_pept        complement(335233..335394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0406"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29097"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJU6"
FT                   /protein_id="ACF29097.1"
FT                   /translation="MAFQTAYLIYAVRNAFSFLDTPRQTKRTCLTLHKYCQQFGQKAAV
FT                   CFIIPFHP"
FT   gene            complement(335404..335901)
FT                   /locus_tag="NGK_0407"
FT   CDS_pept        complement(335404..335901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0407"
FT                   /product="putative bacteriocin production protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29098"
FT                   /db_xref="GOA:B4RJU7"
FT                   /db_xref="InterPro:IPR003825"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJU7"
FT                   /protein_id="ACF29098.1"
FT                   /translation="MNSLPIADLLASAVIAACIVISTMRGVIAEAGSMVAWVVSFFFAK
FT                   LFAAPFADLAFASFQPRLFALALSFISLFVIACLIQKMLRSLLTGAVSAVGLGFANRIL
FT                   GGVFGALKGVLIVTLLIMLASKTDLPDTEEWQQSYTVPFFVSLSEAVLNHTDNAPESLD
FT                   DD"
FT   gene            complement(335894..336934)
FT                   /locus_tag="NGK_0408"
FT   CDS_pept        complement(335894..336934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0408"
FT                   /product="Tpc"
FT                   /note="tetrapac protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29099"
FT                   /db_xref="GOA:B4RJU8"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR011930"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJU8"
FT                   /protein_id="ACF29099.1"
FT                   /translation="MSENKQNEVLTGYEQLKRRNRRRLVTASSLVAASCILLAAALSSD
FT                   PADSNPAPQAGETGATESQTANTAQTPALKSAAENGETAADKPQDLAGEDKPSAADSEI
FT                   SEPENVGAPLVLINDRLEDSNIKGLEESEKLQQAETAKTEPKQAKQRAAEKVSATADST
FT                   DTVAVEKPKRTAEPKPQKAERTAEAKPKAKETKTAEKVADKPKTAAEKTKPDTAKSDSA
FT                   VKEAKKADKAEGKKTAEKDRSDGKKHETAQKTDKADKTKTAEKEKSGKAGKKAAIQAGY
FT                   AEKERALSLQRKMKAAGIDSTITEIMTDNGKVYRVKSSNYKNARDAERDLNKLRVHGIA
FT                   GQVTNE"
FT   gene            complement(336948..338222)
FT                   /locus_tag="NGK_0409"
FT   CDS_pept        complement(336948..338222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0409"
FT                   /product="FolC protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29100"
FT                   /db_xref="GOA:B4RJU9"
FT                   /db_xref="InterPro:IPR001645"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJU9"
FT                   /protein_id="ACF29100.1"
FT                   /translation="MKTLQDWLSHLETAHSGGLIDMGLERVSEVKKRMNLTPQCPVVVV
FT                   AGTNGKGSVCAYLTQIYKQAGFKTGTLTSPHLLHYNERIAINAEPVSDDTIIASFERIE
FT                   AARGEISLTYFEFNALAAVDIFIREQVDVMILEVGLGGRLDAVNAFDGDCAVVTSVDLD
FT                   HQAFLGDTVEQVGFEKAGVFRSGKPAICGQNPAPASLVAHAEAIGAKLLMVQRDFEFHA
FT                   MENIQWNYRFRPQHSDGPARNRNALPFPALRGAYQLSNAACALTVLECLDDRLPVDIGA
FT                   IKRGLLLVENPGRFQVLPGRPLTVLDVGHNPHAARALRRNLINLAYAQKRTAVFSMLSD
FT                   KDIDGVSETVKDQFDEWYIAPLDVPRGMTADALKAKLEQHHIENIQTFAAVRDAYRAAA
FT                   SKAGEDDRIVVFGSFHTVADVMSVL"
FT   gene            complement(338253..338693)
FT                   /locus_tag="NGK_0410"
FT   CDS_pept        complement(338253..338693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0410"
FT                   /product="folI"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29101"
FT                   /db_xref="GOA:B4RJV0"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJV0"
FT                   /protein_id="ACF29101.1"
FT                   /translation="MRAFQTALRPSRILNILTVSLHSASIAVCLTWFYGRMMWFGLAAL
FT                   AASYAYSLRITNLKRRHAITAITIDRDGRAEIVSGKDKTAATLAGSSMVTPYALFLQWD
FT                   TGGKTVRQCIMPDMTDKESYRRLKVWVLWRQPKKTAETDTSD"
FT   gene            complement(338698..339057)
FT                   /locus_tag="NGK_0411"
FT   CDS_pept        complement(338698..339057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0411"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29102"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJV1"
FT                   /protein_id="ACF29102.1"
FT                   /translation="MYFVDRTAAVLKPTARFLEWLKSTDENMPDLTIEQLRADCSVFLV
FT                   PQFDEPEAVVSYFDERYRQIFEAELAGWDIDKDKWPQDMGLKAFWEFFDIEIHDMVLDM
FT                   EEADLNITPVFDNMM"
FT   gene            complement(339130..339858)
FT                   /locus_tag="NGK_0412"
FT   CDS_pept        complement(339130..339858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0412"
FT                   /product="Amino acid permease ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29103"
FT                   /db_xref="GOA:B4RJV2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJV2"
FT                   /protein_id="ACF29103.1"
FT                   /translation="MIKFKNVHKHFKDLHVINGVNLEIKKGEVVVVCGPSGSGKSTLIR
FT                   TVNQLESIESGEIWVDGVNVADPKTDLNKIREEVGFVFQSFNLYPHLTVLDNITLAPMK
FT                   VKGQNAEQAEKKAMELLERVGLAHKKDAFPSQLSGGQQQRVAIARGLAMEPRVMLFDEP
FT                   TSALDPEMVGEVLKVMKDLAESGMTMMCVTHEMGFAREVADRVIFVDKGQILEDETPEA
FT                   FFTNPKHERAKQFLQQVMTH"
FT   gene            complement(339900..340469)
FT                   /locus_tag="NGK_0413"
FT   CDS_pept        complement(339900..340469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0413"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29104"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJV3"
FT                   /protein_id="ACF29104.1"
FT                   /translation="MNCRQAALKPFITVYKRINHKIHKRIPDFSFNRPSEQTMKYTAAL
FT                   LTFLLTACMNPNDAFFQNRRYQMPEAQLNGSNAVFHYGYSQNPDHDLLVDQVRVPDAYR
FT                   ASFARDWIAKEQGYRKNDCVLEKAESGGVTYYTCDAEKGFNGTRFVIYVVNMKNDKGYV
FT                   KVYRGMNKPNQEELTKLVADLNKFYP"
FT   gene            complement(340466..341035)
FT                   /locus_tag="NGK_0414"
FT   CDS_pept        complement(340466..341035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0414"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29105"
FT                   /db_xref="GOA:B4RJV4"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJV4"
FT                   /protein_id="ACF29105.1"
FT                   /translation="MESNLQKTERLIREINRLHAQYSQDYFETGKVRKINLSHTLKNVP
FT                   TEHILSYRLNLHEAVNDYLAFADTRGIDFFYRVKTAESIHDKINRYLARGTQYPTNNIL
FT                   NDIFGARLIWPSETVAGILEKLDGWKTEYGLKNWYLRDAGGYIGIHIYFKNSSNFYYPW
FT                   ELQVWDEKDAKANIENHMAYKRNFVR"
FT   gene            complement(341050..341829)
FT                   /locus_tag="NGK_0415"
FT   CDS_pept        complement(341050..341829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0415"
FT                   /product="putative dimethyladenosine transferase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29106"
FT                   /db_xref="GOA:B4RJV5"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4RJV5"
FT                   /protein_id="ACF29106.1"
FT                   /translation="MKEHKARKRFGQNFLQDTRIIGDIVNAVRPQADDVVIEIGPGLAA
FT                   ITEPLAKKLNRLHVVEIDRDIVCRLKTLPFADKLVIHEGDVLQFDFNGISGKKKIVGNL
FT                   PYNISTPLLFKLAEVADDVADMHFMLQKEVVERMVAAPKSNDYGRLGVMLQYFFDMELL
FT                   IDVPPESFDPAPKIDSAVVRMIPVKHRIGKADDFEHFAKLVKLAFRQRRKTIRNNLKEL
FT                   ADDDDLQAVGISPQDRAEHIAPEKYVALSNYLADKAV"
FT   gene            complement(341973..342137)
FT                   /locus_tag="NGK_0416"
FT   CDS_pept        complement(341973..342137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0416"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29107"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJV6"
FT                   /protein_id="ACF29107.1"
FT                   /translation="MGFDFKQIFRHVQSSNRQSGRQPVCTKPPNTASLQTALSRPAVFG
FT                   YNADIKRIL"
FT   gene            342150..342734
FT                   /locus_tag="NGK_0417"
FT   CDS_pept        342150..342734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0417"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29108"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJV7"
FT                   /protein_id="ACF29108.1"
FT                   /translation="MLPPKAAVMMMGTFPPKEDKRAMQFHYPNFQNDMWRVYGLVFFND
FT                   AAHFRMPSHGEAAHSEKAFDAEKIKAFLHERGIASCPTVLKAAREHGNASDKFLKVVET
FT                   VDLAAVLAKIPDCRHICTTGGKATEILLDIQGGGIKMPKTGETVPFPFAGRDLTLTRLP
FT                   STSRAYPLSLAKKAAAYRAFFEMAGLCEKQL"
FT   gene            342817..344019
FT                   /locus_tag="NGK_0418"
FT   CDS_pept        342817..344019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0418"
FT                   /product="tryptophan synthase subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29109"
FT                   /db_xref="GOA:B4RJV8"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR006653"
FT                   /db_xref="InterPro:IPR006654"
FT                   /db_xref="InterPro:IPR023026"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4RJV8"
FT                   /protein_id="ACF29109.1"
FT                   /translation="MKNYHAPDEKGFFGEHGGLYVSETLIPALKELEQAYNEAKNDPEF
FT                   WAEFRRDLKHYVGRPSPVYHAARLSEHLGGAQIWLKREDLNHTGAHKVNNTIGQALLAR
FT                   RMGKKRVIAETGAGQHGVASATVAARFGMTCDVYMGADDIQRQMPNVFRMKLLGANVIG
FT                   VDSGSRTLKDAMNEAMREWVARVDDTFYIIGTAAGPAPYPEMVRDFQCVIGNEAKAQMQ
FT                   EAIGRQPDVAVACVGGGSNAIGLFYPYIEEENVRLVGVEAGGLGVDTPDHAAPITSGAP
FT                   IGVLHGFRSYLMQDENGQVLGTHSVSAGLDYPGIGPEHSHLHDIKRVEYTVAKDDEALE
FT                   AFDLLCRFEGIIPALESSHAVAWAVKNAPKMGKDQVILVNLSGRGDKDINTVAKLKGIE
FT                   L"
FT   gene            complement(344095..348876)
FT                   /locus_tag="NGK_0419"
FT   CDS_pept        complement(344095..348876)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0419"
FT                   /product="IgA-specific metalloendopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29110"
FT                   /db_xref="GOA:B4RJV9"
FT                   /db_xref="InterPro:IPR000710"
FT                   /db_xref="InterPro:IPR004899"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012332"
FT                   /db_xref="InterPro:IPR030396"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJV9"
FT                   /protein_id="ACF29110.1"
FT                   /translation="MKAKRFKINAISLSIFLAYALTPYSEAALVRDDVDYQIFRDFAEN
FT                   KGKFFVGATDLSVKNKRGQNIGNALSNVPMIDFSVADVNKRIATVVDPQYAVSVKHAKA
FT                   EVHTFYYGQYNGHNDVADKENEYRVVEQNNYEPHKAWGASNLGRLEDYNMARFNKFVTE
FT                   VAPIAPTDAGGGLDTYKDKNRFSSFVRIGAGRQLVYEKGVYHQEGNEKGYDLRDLSQAY
FT                   RYAIAGTPYKDINIDQTMNTEGLIGFGNHNKQYSAEELKQALSQDALTNYGVLGDSGSP
FT                   LFAFDKQKNQWVFLGTYDYWAGYGKKSWQEWNIYKKEFADKIKQHDNAGTVKGNGEHHW
FT                   KTTGTNSHIGSTAVRLANNEGDANNGQNVTFEDNGTLVLDQNINQGAGGLFFKGDYTVK
FT                   GANNDITWLGAGIDVADGKKVVWQVKNPNGDRLAKIGKGTLEINGTGVNQGQLKVGDGT
FT                   VILNQKADADKKVQAFSQVGIVSGRGTLVLNSSNQINPDNLYFGFRGGRLDANGNDLTF
FT                   EHIRNVDEGARIVNHNTDHASTITLTGKSLITNPNSLSVHSIQNDYDEDDYSYYYRPRR
FT                   PIPQGKDLYYKNYRYYALKSGGSVNAPMPENGVAENNDWVFMGYTQEEAKKNAMNHKNN
FT                   QRISGFSGFFGEENGKGHNGALNLNFNGKSAQNRFLLTGGANLNGKISVTQGNVLLSGR
FT                   PTPHARDFVNKSSARKDAHFSKNNEVVFEDDWINRTFKAAEIAVNQSASFSSGRNVSDI
FT                   TANITATDNAKVNLGYKNGDEVCVRSDYTGYVTCNTGNLSDKALNSFDATRINGNVNLN
FT                   QNAALVLGKAALWGKIQGQGNSRVSLNQHSKWHLTGDSQVHNLSLADSHIHLNNASDAQ
FT                   SANKYHTIKINHLSGNGHFHYLTDLAKNLGDKVLVKESASGHYQLHVQNKTGEPNQEGL
FT                   DLFDASSVQDRSRLFVSLANHYVDLGALRYTIKTENGITRLYNPYAGNRRPVKPAPSPA
FT                   ANTASQAQKATQTDGAQIAKPQDIVVAPPSPQANQAEEAKRQQAKAEQVKRQQAEAGRK
FT                   SAELSAKQRAGEEERRQTAQSQPQRRKRRAAPQDYMAVSQDRPKRRGHRSVQQNNVEIA
FT                   QAQAELARRQQEERKAAELLAKQRAEAEREAQALAARRKAEAEEAKHQAAELAHRQEAK
FT                   RKAAESAKRKAEEEEHRQTAQSQPQRRKRRAAPQDYMAVSQDRPKRRGRRSTLPAPPSP
FT                   SFDSSAYAAPRALHNPDWYENDYEEIPLDALEDEDVSESVDTSDKQPQDNTELHEKVEA
FT                   VSLQPRAAQPRTQAAAQADAVSTNTNSALSDAMASTQSILLDTGASLTRHIAQKSRADA
FT                   EKNSVWMSNTGYGRDYASAQYRRFSSKRTQTQIGIDRSLSENMQIGGVLTYSDSQHTFD
FT                   QAGGKNTFVQANLYGKYYLNDAWYVAGDIGAGSLRSRLQTQQKANFNRTSIQTGLTLGN
FT                   TLKINQFEIVPSAGIRYSRLSSADYKLGDDSVKVSSMAVKTLTAGLDFAYRFKVGNLTV
FT                   KPLLSAAYFANYGKGGVNVGGKSFAYKADNQQQYSAGAALLYRNVTLNVNGSITKGKQL
FT                   EKQKSGQIKIQIRF"
FT   gene            complement(349032..349178)
FT                   /locus_tag="NGK_0420"
FT   CDS_pept        complement(349032..349178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0420"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29111"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJW0"
FT                   /protein_id="ACF29111.1"
FT                   /translation="MQTKSLSIIRDNGKLSIVIPAKAGIQRQKAAEIYRKEPNHKNRLP
FT                   TFA"
FT   gene            349202..351481
FT                   /locus_tag="NGK_0421"
FT   CDS_pept        349202..351481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0421"
FT                   /product="ComA"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29112"
FT                   /db_xref="GOA:B4RJW1"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR004477"
FT                   /db_xref="InterPro:IPR004797"
FT                   /db_xref="InterPro:IPR035681"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJW1"
FT                   /protein_id="ACF29112.1"
FT                   /translation="MTVLWLCFIIVCFLYREWGDVFRRWFLPCWVVGVAVSFALSVVPH
FT                   WPFWLAAFAVLAVLARRFAFAGLMLCVLAGAAYGVFRTEAALSSQWRAEAVSGVPLTVE
FT                   VTDMPRSDGRRVQFAAKAVDSGGRTFDLLLSDYKRREWAVGSRWRITARVHPVVGELNL
FT                   RGLNREAWALSNGVGGVGTVGADRVLLHGGSGWGIAVWRSRISRNWRQADADGGLSDGI
FT                   GLMRALSVGEQSALRPGLWQAFRPLGLTHLVSISGLHVTMVAVLFAWLAKRLLACSPRL
FT                   PARPRAWVLAAGCAGALFYALLAGFSVPTQRSVLMLAAFAWAWRRGRLSAWATWWQALA
FT                   AVLLFDPLAVLGVGTWLSFGLVAALIWACAGRLYEGKRQTAVRGQWAASVLSLVLLGYL
FT                   FASLPLVSPLVNAVSIPWFSWVLTPLALLGSVVPFAPLQQAGAFLAEYTLRFLVWLADV
FT                   SPEFAVAAAPLPLLVLAVCAALLLLLPRGLGLRPWAVLLLAGFVSYRPEAVPENEAAVT
FT                   VWDAGQGLSVLVRTANRHLLFDTGTVAAAQTGIVPSLNAAGVRRLDKLVLSHHDSDHDG
FT                   GFQAVGKIPNGGIYAGQPEFYEGARHCAEQRWQWDGVDFEFLRPSERKNIDDNGKSCVL
FT                   RVVAGGAALLVTGDLDTKGEESLVGKYGGNLYSQVLVLGHHGSNTSSSGVFLNAVSPEY
FT                   AVASSGYANAYKHPTEAVQNRVRAHGIKLLRTDLSGALQFGLGRGGVKAQRLRVYKFYW
FT                   QKKPFE"
FT   gene            complement(351551..352354)
FT                   /locus_tag="NGK_0422"
FT   CDS_pept        complement(351551..352354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0422"
FT                   /product="ComL, competence lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29113"
FT                   /db_xref="GOA:B4RJW2"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR017689"
FT                   /db_xref="InterPro:IPR039565"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJW2"
FT                   /protein_id="ACF29113.1"
FT                   /translation="MKKILLTVSLGLALSACATQGTADKDAQITQDWSVEKLYAEAQDE
FT                   LNSSNYTRAVKLYEILESRFPTSRHARQSQLDTAYAYYKDDEKDKALAAIERFRRLHPQ
FT                   HPNMDYALYLRGLVLFNEDQSFLNKLASQDWSDRDPKANREAYQAFAELVQRFPNSKYA
FT                   ADATARMVKLVDALGGNEMSVARYYMKRGAYIAAANRAKKIIGSYQNTRYVEESLAILE
FT                   LAYKKLDKPQLAADTRRVLETNFPKSPFLTHAWQPDDMPWWRYWH"
FT   gene            352353..353477
FT                   /locus_tag="NGK_0423"
FT   CDS_pept        352353..353477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0423"
FT                   /product="RluD"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29114"
FT                   /db_xref="GOA:B4RJW3"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJW3"
FT                   /protein_id="ACF29114.1"
FT                   /translation="MQNTSFDNESDYSDDSDFASASGTENRIGLTVPPELAGGRLDAVL
FT                   AKLLPDYSRSRLTSWIKEGAVIVNDKPSQPKDKMIGGEQICVTVRPSEENLAFVPEPMD
FT                   LDIVYEDDTVIVVNKPAGLVVHPAAGNWTGTLLNGLLAHCPELSQIPRAGIVHRLDKET
FT                   SGLMVVAKTLPAQNSLVRQLQERTVKRIYRAVANGIVPFDGKIETQIGRDPHNRLKMAA
FT                   VKFGGKPAVTHVKVLERYLAHSYIECSLGTGRTHQIRVHMREANHPLAGDPVYGNPRHP
FT                   CGDTVKEAVKSLGARQALHAYRLSFTHPESGETVSFEAPIPDDIYHLLSVLRLEAGLDS
FT                   SLSNEEEWQDKFGADDDDDWNEDDYDVEVVYVRE"
FT   gene            353484..353633
FT                   /locus_tag="NGK_0424"
FT   CDS_pept        353484..353633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0424"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29115"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJW4"
FT                   /protein_id="ACF29115.1"
FT                   /translation="MKGGANAGSRTGAAGQSSPPISNKGRLKGPGRNRRFRLPRSDGIM
FT                   MKGV"
FT   gene            complement(353630..354448)
FT                   /locus_tag="NGK_0425"
FT   CDS_pept        complement(353630..354448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0425"
FT                   /product="transporter"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29116"
FT                   /db_xref="GOA:B4RJW5"
FT                   /db_xref="InterPro:IPR002657"
FT                   /db_xref="InterPro:IPR004710"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJW5"
FT                   /protein_id="ACF29116.1"
FT                   /translation="MGIIMFGMGLTLKPSDFDILFKHPKAVIIGVIAQFAIMPATAWLP
FT                   SKLLNLPAEIAVGVILVGCCPGGTASNVMTYLARGNVALSVAVTSVSTLISPLLTPAIF
FT                   LMLAGEMLEIQAAGMLMSIVKMVLLPIVLGLIVHKVLGSKTEKPTDALPLVSVAAIVLI
FT                   IGAVVGASKGKIMESGLLIFAVVVLRNGIGYLLGFFAAKWTGLPYDAQKTLAIEVGMQN
FT                   SGLAAALAAAHFAAAPVVAVPGALFSVWHNISGSLLATYWAAKAGKHKKP"
FT   gene            354483..354629
FT                   /locus_tag="NGK_0426"
FT   CDS_pept        354483..354629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0426"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29117"
FT                   /db_xref="GOA:B4RJW6"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJW6"
FT                   /protein_id="ACF29117.1"
FT                   /translation="MSGAKKAAAAKSEVQRENVFPIKLLILLRIFIIMRCVFVFKGRQA
FT                   YTP"
FT   gene            complement(354654..355013)
FT                   /locus_tag="NGK_0427"
FT   CDS_pept        complement(354654..355013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0427"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29118"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJW7"
FT                   /protein_id="ACF29118.1"
FT                   /translation="MRRKGLINCLRGKWMLVFSSFPHRREFGDSGLFSNVRVWILAGAG
FT                   MMPLYTFSELYMLQQGTAHQAPHCVLPERGCPPIRFYRYKQTGFNRKGMGIKSISDTSR
FT                   AMPSENQSPLSDGIV"
FT   gene            355031..355810
FT                   /locus_tag="NGK_0428"
FT   CDS_pept        355031..355810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0428"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29119"
FT                   /db_xref="InterPro:IPR003730"
FT                   /db_xref="InterPro:IPR011324"
FT                   /db_xref="InterPro:IPR038371"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJW8"
FT                   /protein_id="ACF29119.1"
FT                   /translation="MKTITETLNLAPKGKNFLTADWPAPANVKTLITTRNGGVSQGAYQ
FT                   SLNLGTHVGDDPETVRRNREIVQQQVGLPVAYLNQIHSTIVVNAAEALDGTPDADASVD
FT                   DTGKAVCAVMTADCLPVLFCDRAGTAVAAAHAGWSGLAGGVLQNTIAAMKVPPVEIMAY
FT                   LGPAISADAFEVGQDVFDAFCTSMPEAAAAFEPIGGGKFLADLYALARLILKREGVGGV
FT                   YGGTHCTVLERDIFFSYRRDGATGRMASLIWLDGNAV"
FT   gene            355863..356342
FT                   /locus_tag="NGK_0429"
FT   CDS_pept        355863..356342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0429"
FT                   /product="Rare lipoprotein B, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29120"
FT                   /db_xref="GOA:B4RJW9"
FT                   /db_xref="InterPro:IPR007485"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJW9"
FT                   /protein_id="ACF29120.1"
FT                   /translation="MNKIFLTAAALMLGACGFHLKGADGISPPLTYRSWHIEGGQALQF
FT                   PLETALYQASGRVDDAAGAQMTLRIDSVSQNKETYTVTRAAVINEYLLILTVEAQVLKR
FT                   GEPVGKPMTVSVRRILDYADNEILGKQEEEETLWAEMRQDVAEQIVRRLTFLKAE"
FT   gene            356344..357342
FT                   /locus_tag="NGK_0430"
FT   CDS_pept        356344..357342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0430"
FT                   /product="DNA polymerase III subunit delta"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29121"
FT                   /db_xref="GOA:B4RJX0"
FT                   /db_xref="InterPro:IPR005790"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR010372"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJX0"
FT                   /protein_id="ACF29121.1"
FT                   /translation="MAAHIGRIDTDAPLKPLYVIHGEEELLRIEAVDALRAAAKKQGYL
FT                   NREAYTADASFDWNELLQTAGSAGLFADLKLLELHIPNGKPGKNGGEALQDFAARLPED
FT                   TVTLVLLPKLEKTRLQSKWFAALAAKGEVWEAKPVGAAALPQWIRGRLDKIGLGIEADA
FT                   LALFAERVEGNLLAARQEIDKLALLYPKGHAVNIDEAQTAVANVARFDAFQLAGAWMKG
FT                   DVPRVCRLLDGLEEEGEEPVLLLWAVAEDVRTLIRLAAALKQGQSIQSVRNSLRLWGDK
FT                   QTLAPLAVKRISVVRLLDALKTCAQIDRIIKGAEDGDAWTVFKQLVVSLAE"
FT   gene            357463..357882
FT                   /locus_tag="NGK_0431"
FT   CDS_pept        357463..357882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0431"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29122"
FT                   /db_xref="GOA:B4RJX1"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJX1"
FT                   /protein_id="ACF29122.1"
FT                   /translation="MDNKTKLRLGGLILLTTAVLSLIIVLIVDSWPLAILLAAVIVAAA
FT                   AGGFVWTSRRQQRQFIERLKKFDIDPEKGRINEANLRRMYHSGGQHQKDAITLICLSQK
FT                   CSVDEAHAMFKKRPTRQEINQMAAKQSRGQKRPHR"
FT   gene            357907..358473
FT                   /locus_tag="NGK_0432"
FT   CDS_pept        357907..358473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0432"
FT                   /product="Membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29123"
FT                   /db_xref="GOA:B4RJX2"
FT                   /db_xref="InterPro:IPR010432"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJX2"
FT                   /protein_id="ACF29123.1"
FT                   /translation="MPSEVCWRFRRHIPIEKMMILKTAPLKRRFAAILYEMLLVGAATC
FT                   LAALLAGIAAIFLNPVSIAVSALVTSILIMGAWWLYFRANWHGQGQTLAMRTWKIGLCD
FT                   LNGIQPSLHLLRLRFIWACIFIVFIPMLAYAGLRHFLGIPPKGAAGAALVWLILPWGFA
FT                   LLNPDRQFLYDFLAGTRLVDVKEQS"
FT   gene            complement(358564..359448)
FT                   /locus_tag="NGK_0433"
FT   CDS_pept        complement(358564..359448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0433"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29124"
FT                   /db_xref="InterPro:IPR005229"
FT                   /db_xref="InterPro:IPR013527"
FT                   /db_xref="InterPro:IPR013551"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJX3"
FT                   /protein_id="ACF29124.1"
FT                   /translation="MSSGNIRIHSMTGFANAAAECGSKRINLDIRAVNHRFLDIQIRMP
FT                   DDLRHLENGIREQISSHLARGKVECKIQIQDAENGNQSLELNRVLVGQLAEINKNLRKH
FT                   YDLAKLGVADILRFPGVLASQKENTEALAKTIVELADKALKDFTAARRREGKKLGEHLL
FT                   QRIKNMEEIIDALSEIFPALVEAHKEKIRTRLAEAVGSIDNDRLQQEFALFIQKSDIDE
FT                   EFSRLRTHIAEVRRIVTEHKGSSGKRLDFLMQELNREANTLGSKSIATECTQASVELKV
FT                   LIEQMREQVQNIE"
FT   gene            complement(359486..359650)
FT                   /locus_tag="NGK_0434"
FT   CDS_pept        complement(359486..359650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0434"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29125"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJX4"
FT                   /protein_id="ACF29125.1"
FT                   /translation="MQKSFWQKTHSLFGFWRFCLIHFPSLQQQKRVIPIYRCEIFNFSH
FT                   PKTLAAIQM"
FT   gene            359976..360122
FT                   /locus_tag="NGK_0435"
FT   CDS_pept        359976..360122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0435"
FT                   /product="UPF0114 protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29126"
FT                   /db_xref="GOA:B4RJX5"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJX5"
FT                   /protein_id="ACF29126.1"
FT                   /translation="MLQTFINSANLSEKQLMWQCLVHVCFLILAIAMAWADKIVYGTTH
FT                   KPH"
FT   gene            complement(360181..361053)
FT                   /locus_tag="NGK_0436"
FT   CDS_pept        complement(360181..361053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0436"
FT                   /product="RNA polymerase sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29127"
FT                   /db_xref="GOA:B4RJX6"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR012759"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJX6"
FT                   /protein_id="ACF29127.1"
FT                   /translation="MPQMNNAFALPAIQSGNGSLEQYIHTVNSIPMLSQEEETRLAERR
FT                   IKGDLNAAKQLILSHLRVVVSIARGYDGYGLNQADLIQEGNIGLMKAVKRYEPGRGARL
FT                   FSFAVHWIKAEIHEFILRNWRLVRVATTKPQRKLFFNLRSMRKNLNVLSPKEAQDIADD
FT                   LGVKLSEVLEMEQRMTGHDIAIMADNSDDEDSFAPIDWLADHDSEPSRQLSKQAHYALQ
FT                   TEGLQNALAQLDDRSRRIVESRWLQDDGGLTLHQLAAEYGVSAERIRQIEAKAMQKLRG
FT                   FLTEEAEAV"
FT   gene            complement(361308..362846)
FT                   /locus_tag="NGK_0437"
FT   CDS_pept        complement(361308..362846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0437"
FT                   /product="apolipoprotein N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29128"
FT                   /db_xref="GOA:B4RJX7"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR004563"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJX7"
FT                   /protein_id="ACF29128.1"
FT                   /translation="MFSKLDKYWQHPALYWPLLILFAAATPFAFAPYYHFWLMPLIFGA
FT                   FVRLIELRPRFAASSAYLFGLTAYTAQFYWIHTALHDVSGLPDLYAVPLTFLLPAYLAL
FT                   YPALCFWLWKKFTLPQGIKTGLVLPILWTLTEFARERFLTGFGWGAIGYSQITPDSPLA
FT                   GFAPLGGIHMVTLATAFLGVWLVLAIDNTARSGKRLLPAILIAALLAAGYTAQQTDFTR
FT                   PDGSRSTVALLQGNIAQTLKWREDQVIPTIQKYYEQVGKTTADIVILPETAIPIMRQNL
FT                   PENILAQFAEQAQNNGSALAVGISQYTSDGNGYENAVINLTGYQENNQDGIPYYAKNHL
FT                   VPFGEYKPLPLLTTPLYKMMDMPLSDFRKGGGKQSAMMMKNQKIAFNICYEDGFGDELI
FT                   AAAKDATLLANVSNMAWYGKSNAMYQHLQQSQARAMELGRYMVRATNTGATAIISPKGN
FT                   IIAQAQPDTETVLEGHIKGYIGETPYMKTGSSWWLMGILTLAALILFIFRNKEH"
FT   gene            complement(362915..363679)
FT                   /locus_tag="NGK_0438"
FT   CDS_pept        complement(362915..363679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0438"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29129"
FT                   /db_xref="GOA:B4RJX8"
FT                   /db_xref="InterPro:IPR008526"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJX8"
FT                   /protein_id="ACF29129.1"
FT                   /translation="MRRISGFFMAFASLFTLPDYITAVLDDVALMTKAAAKKTAGVAGD
FT                   DLAPNANRVTGVSAERELPIVWPVAKGSFANKPVLVSAALLLSAFLPQLITPLLTAGGI
FT                   YLCFEGVEKLLHKFLHRHDAHDDGGETAVNEQAKIKGAIRTDFILSAEIIIIALCVVEQ
FT                   YSLMTRSLVMAAIGIGMTVLVYGIVAVIVKLDDLGMLLMRRPQPRPFARFPARATLERW
FT                   LDRVFRQPRCRAAFRFDCLRPALSLMNRFGRH"
FT   gene            363850..365580
FT                   /locus_tag="NGK_0439"
FT   CDS_pept        363850..365580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0439"
FT                   /product="cell volume regulation protein CvrA"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29130"
FT                   /db_xref="GOA:B4RJX9"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR030151"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJX9"
FT                   /protein_id="ACF29130.1"
FT                   /translation="MDWMNSLFLLGGALLFLSVVSTTLSARLGMPLLLVFLAVGMLAGE
FT                   EGVGGIAFNNVVMANFISQLALAVILLDGGLRTQLSSFRIALKPASVLASWGVFATVLP
FT                   LGLFATFYLGLDWKFGVLMAAIVGSTDAGAVFSLLRNSGVRLNERVQATLEIESGANDP
FT                   MAVFLVTALITMIMQPAESGAAAFVRMLALQIGFGLLTGWAGGKILAKLVRRLNLAEGL
FT                   YALMIVSGGLLVFAFTNTIGGSGFLAVYLAGIIVGNQRNRATEHVLRVMDGLAWLAQAT
FT                   LFVMLGLLVSPAGVLDRAAEALAIAAFLMLVARPLAVFGGLWKFNYSLREKAYISWLGL
FT                   RGAVPISLAMMPLVMGVPNSHLLFDVAFAVVVLSLLIQGTTIPVMARLLKVAMPNKPEP
FT                   KDTHDIWLAEKEIVRMSAFKVVAESEAEGHHPDTVEPISDSFDARCFALIRNGSRIEMQ
FT                   SDTVLQAEDLAWYILPDGKVDKMAKYFTETGIGVRENFDFFGEFVVSPAARSGDLALAY
FT                   GLKLEAGEEGLSLAELFDKRSDSQEPVEGDRIDIGGFMLTAKEVDGGGNIGSMGLKVPR
FT                   "
FT   gene            complement(365577..366131)
FT                   /locus_tag="NGK_0440"
FT   CDS_pept        complement(365577..366131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0440"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29131"
FT                   /db_xref="GOA:B4RJY0"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJY0"
FT                   /protein_id="ACF29131.1"
FT                   /translation="MQPYYRFGKKTFHPLRKINNKVSNIKETPMNTTRLPTAFILCCLC
FT                   AAASAADNSTMTKGQKVYESNCVACHGKKGEGRGTAFPPLFRSDYIMNKPHVLLHSMVK
FT                   GINGTIKVNGKTYNGFMPATAISDADIAAVATYIMNAFDNGGGSVTEKDVKQAKGKKNQ
FT                   TDKMPSETGNPASDGIQIKPF"
FT   gene            complement(366235..367317)
FT                   /locus_tag="NGK_0441"
FT   CDS_pept        complement(366235..367317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0441"
FT                   /product="ferrochelatase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29132"
FT                   /db_xref="GOA:B4RJY1"
FT                   /db_xref="InterPro:IPR001015"
FT                   /db_xref="InterPro:IPR019772"
FT                   /db_xref="InterPro:IPR033644"
FT                   /db_xref="InterPro:IPR033659"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJY1"
FT                   /protein_id="ACF29132.1"
FT                   /translation="MPSEAASDGILPPYPTCTIFQKPIMLPFLPEPSLSYTQQNRTAVL
FT                   LLNLGTPDAPTAQAVRPYLKSFLTDRRIVELPKWLWYPILHGLVLTFRPKKSAHAYEKI
FT                   WFKEGSPLEVYTARQAAALAERMPDLIVRHAMTYGNPSIADVLAELKSQGVGRLLAIPL
FT                   YPQYAASSSGAAVDKVCEQLLLQRNQMSVRTISRFYDDAGYIDAMKNHILRYWAEHGRG
FT                   KKLMLSFHGVPQKHYDLGDPYPDECRHTAKLLAEALELTEDEYTVSFQSQFGRAKWVTP
FT                   STQDLFGKLPKQGVTELDVFCPGFLADCLETMEEIALTGREQFYEAGGKNYRYIPCLND
FT                   NPDWIDALVALAEENLGGWR"
FT   gene            complement(367327..368442)
FT                   /locus_tag="NGK_0442"
FT   CDS_pept        complement(367327..368442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0442"
FT                   /product="queuine tRNA-ribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29133"
FT                   /db_xref="GOA:B4RJY2"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004803"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4RJY2"
FT                   /protein_id="ACF29133.1"
FT                   /translation="MLKFTLHKKDGLARRGTLELNHGKIETPVFMPVGTYGSVKAMNPQ
FT                   NLHDIKAQIILGNTYHLWLRPGLEVVEQFGGLHGFIGWDKPILTDSGGFQVFSLSDMRK
FT                   LTEEGCTFKSPINGDKLFLSPEISMKIQTVLNSDIAMQLDECTPGETTREQARKSLQMS
FT                   LRWAERSKKAFEDLKNPNALFGIVQGAMYEDLREESLRGLEEFDFPGLAVGGLSVGEPK
FT                   PEMYRMLHAVGPILPEHKPHYLMGVGTPEDLVYGVAHGIDMFDCVMPTRNARNGWLFTR
FT                   FGDLKIKNAKHKLDKRPIDESCTCYACQNFSRAYLHHLHRAGEILGAQLNTIHNLHFYQ
FT                   VIMAEMREAVEQGKFADWQAQFHENRARGVD"
FT   gene            368621..368697
FT                   /locus_tag="NGK_trnaVal1"
FT   tRNA            368621..368697
FT                   /locus_tag="NGK_trnaVal1"
FT                   /product="tRNA-Val"
FT   gene            368717..370663
FT                   /locus_tag="NGK_0443"
FT   CDS_pept        368717..370663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0443"
FT                   /product="putative threonyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29134"
FT                   /db_xref="GOA:B4RJY3"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002320"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR033728"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJY3"
FT                   /protein_id="ACF29134.1"
FT                   /translation="MPLFFNLSERLMLNITLPDCSVRQYESPVTVAQIAASIGAGLAKA
FT                   AVAGKVNGKLVDACDPIVEDSAVQIITPKDQEGIEIIRHSCAHLVGHAVKQLYPNAKMV
FT                   IGPVIEEGFYYDIATEKPFTPEDVAAIEARMKELIAQDYDVVKIMTPRAEAIKIFQERG
FT                   EEYKLRLIEDMPEVEAMGIYHHQEYVDMCRGPHVPNTRFLKNFKLTKLAGAYWRGDSNN
FT                   EMLQRIYGTAWATKDELKDYIQRIEEAEKRDHRKLGKQLDLFHLQDEAPGMVFWHPKGW
FT                   ALWQTIEQHMRKELNAAGYKEVKTPQIMDKTFWEKSGHWDNYKDNMFVTSSEKREYAVK
FT                   PMNCPGHVQIFNNGLRSYRDLPMRLAEFGSCHRNEPSGALHGLMRVRGFVQDDAHIFCT
FT                   EDQIVSEARAFNELLVRIYKQFGFHDVSVRLSLRPEKRAGSDDVWDKAEQGLREALTAC
FT                   GVEWGELPGEGAFYGPKIEYHVKDALGRSWQCGTLQLDFVLPERLDAEYVTENNDRARP
FT                   VMLHRAILGSLERFVGILIENHAGSFPLWLAPVQMVIMNITENQADYCREVAAKLQAAG
FT                   FRAELDLRNEKIGYKIRDNSQYRFPYQIVIGDKEKQENKVAVRRKAEDLGSLDLDDFIA
FT                   QLQQEITDALVNH"
FT   gene            370798..371202
FT                   /locus_tag="NGK_0444"
FT   CDS_pept        370798..371202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0444"
FT                   /product="translation initiation factor 3"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29135"
FT                   /db_xref="GOA:B4RJY4"
FT                   /db_xref="InterPro:IPR001288"
FT                   /db_xref="InterPro:IPR019813"
FT                   /db_xref="InterPro:IPR019814"
FT                   /db_xref="InterPro:IPR019815"
FT                   /db_xref="InterPro:IPR036787"
FT                   /db_xref="InterPro:IPR036788"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJY4"
FT                   /protein_id="ACF29135.1"
FT                   /translation="MAEGQDVDLVEISPTAKPPVCKLMDYGKYKYQQAKKRDEAKKNQK
FT                   QVQIKEIKFRPGTDEGDYQIKMRNINRFLADGDKVKVTLRFRGREMAHQQLGAQLLERV
FT                   KEDLAEVAQIESFPKMEGRQMVMMIAPKKK"
FT   gene            371268..371546
FT                   /locus_tag="NGK_0445"
FT   CDS_pept        371268..371546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0445"
FT                   /product="putative 50S ribosomal protein L35"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29136"
FT                   /db_xref="GOA:B4RJY5"
FT                   /db_xref="InterPro:IPR001706"
FT                   /db_xref="InterPro:IPR018265"
FT                   /db_xref="InterPro:IPR021137"
FT                   /db_xref="InterPro:IPR037229"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJY5"
FT                   /protein_id="ACF29136.1"
FT                   /translation="MALWVQVFETDVLKPPNALSDNEWSFPMPKMKTKSSAKKRFKVLG
FT                   NGGVKRAHAFKRHILTKKTTKNKRQLRGTSMVNDRDLASVAKMLPYA"
FT   gene            371559..371918
FT                   /locus_tag="NGK_0446"
FT   CDS_pept        371559..371918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0446"
FT                   /product="putative 50S ribosomal protein L20"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29137"
FT                   /db_xref="GOA:B4RJY6"
FT                   /db_xref="InterPro:IPR005813"
FT                   /db_xref="InterPro:IPR035566"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4RJY6"
FT                   /protein_id="ACF29137.1"
FT                   /translation="MPRVKRGVTARARHQKIFALAKGYRGRRKNVYRVAKQAVMKAGQY
FT                   AYRDRRQRKRQFRQLWIVRINAGARENGLSYSKFMNGLKRASIEIDRKVLADLAVFDKA
FT                   AFAQLVEKAKAALAA"
FT   gene            371963..372082
FT                   /locus_tag="NGK_0447"
FT   CDS_pept        371963..372082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0447"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29138"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJY7"
FT                   /protein_id="ACF29138.1"
FT                   /translation="MRKFYVIDFLSLKSIFLNKFALKYRKFIQWIGREENKVV"
FT   gene            372093..373148
FT                   /locus_tag="NGK_0448"
FT   CDS_pept        372093..373148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0448"
FT                   /product="phenylalanyl-tRNA synthetase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29139"
FT                   /db_xref="GOA:B4RJY8"
FT                   /db_xref="InterPro:IPR002319"
FT                   /db_xref="InterPro:IPR004188"
FT                   /db_xref="InterPro:IPR004529"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR022911"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJY8"
FT                   /protein_id="ACF29139.1"
FT                   /translation="MSGYTGGLVVSGGISLIDRLDIMENVNRIVAEGIAAVEAAQDFNA
FT                   LEQIKARYLGKTGELTGLLKTLGQMSPEERKTIGAHINECKNRFQTAFNAKRDALNEAK
FT                   LQARLAAEALDITLPGRAQEGGSLHPVTLTLQRVVELFHGMGFEVADGPEIEDDFHNFQ
FT                   ALNIPANHPARAMQDTFYVENGDVLRTHTSPIQIRYMLDKKEPPIRIIAPGRVYRVDSD
FT                   ATHSPMFHQAEGLWVEEGVTFADLKAVFTDFIRRFFERDDLQVRFRPSFFPFTEPSAEI
FT                   DIMGENGKWLEVGGCGMVHPNVLKNVNIDPEKYTGFAFGIGLDRFAMLRYNVNDLRLFF
FT                   DNDLNFLKQFE"
FT   gene            373165..373578
FT                   /locus_tag="NGK_0449"
FT   CDS_pept        373165..373578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0449"
FT                   /product="putative very-short-patch-repair endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29140"
FT                   /db_xref="GOA:B4RJY9"
FT                   /db_xref="InterPro:IPR004603"
FT                   /db_xref="InterPro:IPR007569"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJY9"
FT                   /protein_id="ACF29140.1"
FT                   /translation="MDKLTPEQRKKCMQSNKSTGTKPELVLAKAMWALGLRYRKNSGSI
FT                   FGKPDFSFKKYKVAVFVDGEFWHGKDWEQKKAVIKGNREFWIAKIERNIQRDIEVTGRL
FT                   KAEGWTVLRFWSNDVVKNTTCCAEKVKEIIQTR"
FT   gene            373580..373918
FT                   /locus_tag="NGK_0450"
FT   CDS_pept        373580..373918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0450"
FT                   /product="methylase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29141"
FT                   /db_xref="GOA:B4RJZ0"
FT                   /db_xref="InterPro:IPR001525"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJZ0"
FT                   /protein_id="ACF29141.1"
FT                   /translation="MIYKNKIKEDGQDERLKEKAAQYRLFENNDTFQTALKPKFTFIDL
FT                   FAGIGGFRIAMQNLGGEYVFSSEWDEKAKLTYEANFGEVPFGDITLEEIKQYIPKQFDV
FT                   LCGFTLSK"
FT   gene            373896..374177
FT                   /locus_tag="NGK_0451"
FT   CDS_pept        373896..374177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0451"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29142"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJZ1"
FT                   /protein_id="ACF29142.1"
FT                   /translation="MGLPYQNKDFRNMRLSDYILNNKININNLSDKQVQEIIDYFSSEI
FT                   DDWLLASEKELKDYDVYLYKLVLDGQQYVQGIRKSVLYDFLMENQKDS"
FT   gene            374183..374932
FT                   /locus_tag="NGK_0452"
FT   CDS_pept        374183..374932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0452"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29143"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJZ2"
FT                   /protein_id="ACF29143.1"
FT                   /translation="MKKWTRDETLVALYLYYIIPFQKVSKDNPVIQEYAEILGRTPSAL
FT                   GMKIGNLGRLDPTLKVKNISGLSNGSKMDVVVWNEFSGDWEQLNKEFEGVISQYQSNDE
FT                   NSNIEIESPEIPKGRERFARISVRVNQGFFRSSVLAAYNNQCCITGLKQPELLVASHIK
FT                   PWGEDKDNRLNPRNGLCLNALHDKAFDRGLLGIDENFKIIFSPLLAKTEGFDDLFKPYE
FT                   NRMIRLPERLNPSLEFLKFHRENIFQS"
FT   gene            375023..377386
FT                   /locus_tag="NGK_0453"
FT   CDS_pept        375023..377386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0453"
FT                   /product="phenylalanyl-tRNA synthetase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29144"
FT                   /db_xref="GOA:B4RJZ3"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004532"
FT                   /db_xref="InterPro:IPR005121"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="InterPro:IPR005147"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR020825"
FT                   /db_xref="InterPro:IPR033714"
FT                   /db_xref="InterPro:IPR036690"
FT                   /db_xref="InterPro:IPR041616"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJZ3"
FT                   /protein_id="ACF29144.1"
FT                   /translation="MQFSYSWLKTQANPDLSADKLEHLLTMAGLEVEEIDTAAPAFSGV
FT                   VVAEVKSVEKHPDADRLNVTQVDAGTGELVQIVCGAPNVKPGIKVPCSLPVAVLPGNFK
FT                   IKPTKMRGVPSNGMLCSTNELGLPDDGVDGLHILPEDAPVGTNIREYLDLDDMLFTLKI
FT                   TPNRADCLSVKGIAREVSALTQCAFTPVEIQTAPIGSEKKQAVRIDAPADCGRFISRVI
FT                   ENVNAKAATPDWMKQRLERSGIRSISALVDIGNYVMLEIGQPMHVFDADKLSGSLIVRR
FT                   AQNGETLACLNEKTVTLADNTLVVADEKGALSLAGLMGGAASAVSDGTQNIVLEAAWFE
FT                   PEIIVGKSRQYGFGSDSSFRFERGVDYRLQADAIERATELVLQICGGAAGEMVEAQGKL
FT                   PEAKQVGLRLGRLKTVLGVDIPAEQVETILQHLGLQPEKTAEGFRITAPSFRFDIEIEA
FT                   DLIEEIGRVYGYENIPDDYTSGRLKMSELPETRRPRFAVYNEMAARGYREVISYAFVDE
FT                   QWELDFAANAAPIRLQNPLAAQYAVMRSTLIGGLVEILQNNLNRKQNRVRVFEIACVFG
FT                   KGSDGRFVQNERIGGLWYGAAMPEQWGEKTRNADFYDIKADVENLLKNKAVEFVKTGHP
FT                   ALHPGRAANIVSDGKVIGFVGELHPKWLQKYDLPQAPLVFEIDMAAVLECGKTRYRAVS
FT                   KFQPVRRDLAFVMPEVMNHDDLLLVLKGAANKLVQEISVFDVYRGTGLPEGMKSVAVKV
FT                   ILQDMENTLTDEAVEPLIGKLIGVATEAGARLRS"
FT   gene            377460..377762
FT                   /locus_tag="NGK_0454"
FT   CDS_pept        377460..377762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0454"
FT                   /product="IfhA"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29145"
FT                   /db_xref="GOA:B4RJZ4"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR005684"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4RJZ4"
FT                   /protein_id="ACF29145.1"
FT                   /translation="MTLTKAELADILVDKVSNVTKNDAKEIVELFFEEIRSTLASGEEI
FT                   KISGFGNFQLRDKPQRPGRNPKTGEEVPITARRVVTFHASQKLKGMVEHYYDKQR"
FT   gene            377746..378054
FT                   /locus_tag="NGK_0455"
FT   CDS_pept        377746..378054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0455"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29146"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJZ5"
FT                   /protein_id="ACF29146.1"
FT                   /translation="MTNNVDLTIPAKRYFTLDELCGLLQISPYGFAQWQHDHGVVVGYG
FT                   GERYTRLDVVKLLKLKSTFAPYAEGAESGSDGNRPVTLQEIGDGLKDLLEDLDKELC"
FT   gene            378230..378715
FT                   /locus_tag="NGK_0456"
FT   CDS_pept        378230..378715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0456"
FT                   /product="Membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29147"
FT                   /db_xref="GOA:B4RJZ6"
FT                   /db_xref="InterPro:IPR007313"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJZ6"
FT                   /protein_id="ACF29147.1"
FT                   /translation="MRFFGIGFLVLLFLEIMSIVWVADWLGGGWTLFLMAATFAAGVLM
FT                   LRHTGLSGLLLAGAAVKSSGKVSVYQMLWPIRYTVAAVCLMSPGFVSSVLAVLLLLPFK
FT                   GGAVLQAGGAENFFNMNQSGRKEGFFHDDDIIEGEYTVEEPYGGNRSRNAIEHKKDE"
FT   gene            379349..380650
FT                   /locus_tag="NGK_0457"
FT   CDS_pept        379349..380650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0457"
FT                   /product="Adenosylmethionine-8-amino-7-oxononanoate
FT                   aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29148"
FT                   /db_xref="GOA:B4RJZ7"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR005815"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJZ7"
FT                   /protein_id="ACF29148.1"
FT                   /translation="MPSEHQHTSSLLNFDRTHLLHPYTSMTDPLPVYPVKRAEGVFIEL
FT                   ADGTRLIDGMSSWWCAIHGYNHPVLNQAVENQMKQMAHVMFGGLTHEPAVELGKLLVGI
FT                   LPQGLDRIFYADSGSVSVEVALKMAVQYQQARGLTAKQNIATVRRGYHGDTWNAMSVCD
FT                   PETGMHHIFGSALPQRYFVDNPKNRFDDEWDGADLQPVRALFEAHHVDIAAFILEPVVQ
FT                   GAGGMYFYHPQYLRGLRDLCDEFDIVLIFDEIATGFGRTGKMFACEHAEVVPDIMCIGK
FT                   GLSGGYMTLAAAITSQKVTETISRGEAGVFMHGPTFMANPLACAVACASVKLLLSQDWQ
FT                   ANIRRIESILKGRLKAAWDIRGVKDVRVLGAIGVIELEKGVDMARFQADCVAQGIWVRA
FT                   FGRLVYLMPPYIISDGILTKLADKTVQILKEHSK"
FT   gene            380647..381294
FT                   /locus_tag="NGK_0458"
FT   CDS_pept        380647..381294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0458"
FT                   /product="dithiobiotin synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29149"
FT                   /db_xref="GOA:B4RJZ8"
FT                   /db_xref="InterPro:IPR004472"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4RJZ8"
FT                   /protein_id="ACF29149.1"
FT                   /translation="MKGVYFVSGIDTDIGKTVATGMLAKQLLQQGKSVITQKPVQTGCQ
FT                   DIAEDIAVHRKIMGIPMQEADEQRLTMPEIFSHPASPHLAARLDGRGLDLDKIRTATQE
FT                   LAAQYEVVLVEGAGGLMVPLTEKLLTIDHIQQQAYPVILVTSGRLGSINHTLLSFVVLK
FT                   QYGIRLHSLVFNHIHDSRDAHVAQDSLNYLQCRLKADFPEAEWMELAKTGAV"
FT   gene            381309..381785
FT                   /locus_tag="NGK_0459"
FT   CDS_pept        381309..381785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0459"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29150"
FT                   /db_xref="GOA:B4RJZ9"
FT                   /db_xref="InterPro:IPR007440"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJZ9"
FT                   /protein_id="ACF29150.1"
FT                   /translation="MEHLFGKWLPDLPAPVSDGIDLPMSRLLKARSLTAALCALPHTFS
FT                   VELLKLGEAETEYGRRRVRDVLLKLDGTAVVQARSACSVGSAFWQNILDCGTRPLGERL
FT                   FQADLEGARSAFEFAVSSEGCGRYFAARRSRFSHQGEEMLLTEYFLPELKRFIG"
FT   gene            382306..383196
FT                   /locus_tag="NGK_0460"
FT   CDS_pept        382306..383196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0460"
FT                   /product="putative 4-hydroxybenzoate octaprenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29151"
FT                   /db_xref="GOA:B4RK00"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006370"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4RK00"
FT                   /protein_id="ACF29151.1"
FT                   /translation="MNLKSPLFLRLSDRLDVYIRLMRADKPIGTLLLLWPTYWALWLAS
FT                   DGIPDLAVLAAFTIGTFLMRSAGCVINDFADRDFDGAVERTKNRPFAQGRVKKKEALLL
FT                   TAFLCLLAALCLIPLNHLTWLMSLPALFLALTYPFTKRFFPIPQFYLGLAFSFGIPMAF
FT                   AAVGNSVPVEAWILFAANVLWTLAYDTVYAMADKEDDLKIGIKTSAVTFGRYDIAAVML
FT                   CHGGFTLLMAVLGAVIGAAWAYWTAIPIVLLLQYRQYAAIKSRVRQICFETFLANNRIG
FT                   WVWFAAIFAHTFFAK"
FT   gene            383381..383830
FT                   /locus_tag="NGK_0461"
FT   CDS_pept        383381..383830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0461"
FT                   /product="PTS system, nitrogen regulatory IIA protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29152"
FT                   /db_xref="GOA:B4RK01"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR006320"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:B4RK01"
FT                   /protein_id="ACF29152.1"
FT                   /translation="MSLIGEILPLSHIVLDMEVGSKKRLFEEAGLLLERESSLSHADVF
FT                   ECLFAREKLGSTGLGQGVAIPHGRHASVKQATGAFIRTREPVGFDAPDGKPVSLVFILL
FT                   VPENATGEHLEVLSKLAGKFSQKSIRESLMTVASAEEARAILTEE"
FT   gene            383834..384796
FT                   /locus_tag="NGK_0462"
FT   CDS_pept        383834..384796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0462"
FT                   /product="HPr kinase/phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29153"
FT                   /db_xref="GOA:B4RK02"
FT                   /db_xref="InterPro:IPR003755"
FT                   /db_xref="InterPro:IPR011104"
FT                   /db_xref="InterPro:IPR011126"
FT                   /db_xref="InterPro:IPR028979"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4RK02"
FT                   /protein_id="ACF29153.1"
FT                   /translation="MPSISVRRLFDDNQYKLQLAWAAGNSGADNRIGVEADKPVLALVG
FT                   HLNFIHPNQIQVVGLAESEYLNRLESGETGYQFGDLFDISMSLVIVANDLPVSPGLRDY
FT                   CHKNDIPLLTSKLESPYLMDVLRIYLQRTLAASSVKHGVFLDVFEIGVLITGHSGLGKS
FT                   ELALELISRGHSLIADDAVELFRIGPETLEGRCSPMLRDFLEVRGLGILNIRHIFGETS
FT                   IRPKKILQLIINLVEADDEYMKQLDRLSIRTETESILNVNVRSVTLPVAVGRNLAVLVE
FT                   AAVRNYILQLRGKDSTREFLERHQTQLKENEQNHENRPD"
FT   gene            384777..385631
FT                   /locus_tag="NGK_0463"
FT   CDS_pept        384777..385631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0463"
FT                   /product="UPF0042 protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29154"
FT                   /db_xref="GOA:B4RK03"
FT                   /db_xref="InterPro:IPR005337"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4RK03"
FT                   /protein_id="ACF29154.1"
FT                   /translation="MKIVLISGLSGSGKSVALRQMEDLGYFCVDNLPLEMLPSLVSYHI
FT                   ERADETELAVSVDVRSGIDIAQAREQIAYLRGLGHRVEVLFVEAEEAVLVRRFSETRRG
FT                   HPLSNQDMTLLESLKKEREWLFPLKEIAYCIDTSKMNAQQLRHAVRQWLKVERTGLLVV
FT                   LESFGFKYGVPNNADFMFDMRSLPNPYYDPELRPYTGMDKPVWDYLDGQPLAQEMVDGI
FT                   ERFVTRWLPRLEDESRSYVTVAIGCTGGQHRSVYIVEKLARRLKGRYELLIRHRQAQNL
FT                   SGR"
FT   gene            complement(385645..385776)
FT                   /locus_tag="NGK_0464"
FT   CDS_pept        complement(385645..385776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0464"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29155"
FT                   /db_xref="UniProtKB/TrEMBL:B4RK04"
FT                   /protein_id="ACF29155.1"
FT                   /translation="MARSAIAFLALFIWPGNHWIAMSVLSSQYLKCRLKRRTGFQTA"
FT   gene            385787..386653
FT                   /locus_tag="NGK_0465"
FT   CDS_pept        385787..386653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0465"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29156"
FT                   /db_xref="GOA:B4RK05"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR016478"
FT                   /db_xref="InterPro:IPR019991"
FT                   /db_xref="InterPro:IPR023179"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B4RK05"
FT                   /protein_id="ACF29156.1"
FT                   /translation="MVIEMLDARMPASSENPLLAQLSKGKPKLKILNKQDLADPERTKV
FT                   WLDHYNSRPDTRAIALDSSETGAHGKITQACRAMIPHRQGIDKPLRVLICGIPNVGKST
FT                   LINGMIGKKSAKTGNEPGITKAEQRLFLADDFWLYDTPGMLWPKIIVEESGYNLAAGGA
FT                   VGRNALDEEEVALELLDYLRRHYLPMLQERYQADKDPSSHWDDNSWLEWIAKKRGAVLS
FT                   GGRVNYQKAAENILTDFREGKIGRITLETPNQWETWLKKARQKEAELKAIREARKAERK
FT                   GQKPSEA"
FT   gene            386754..387356
FT                   /locus_tag="NGK_0466"
FT   CDS_pept        386754..387356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0466"
FT                   /product="Segregation and condensation protein B"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29157"
FT                   /db_xref="GOA:B4RK06"
FT                   /db_xref="InterPro:IPR005234"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B4RK06"
FT                   /protein_id="ACF29157.1"
FT                   /translation="MTDKISPDALIEAALLTQTEPLTEKSMRELCVPPLSQDKLIDVLA
FT                   QLKTRWQDRALQLVHTQEGWRFQIVQTAFERLGSLQEQRAPRYSRAVMETLAIIAYQQP
FT                   VTRGDIEGIRGVAVSQNVMQTLQDRGWIEVIGHRDTLGKPALWATTATFLSDLRLDGLE
FT                   ELPPLTELGELVLPDLIEMPPTDEEEPETVPSDTLPN"
FT   gene            387558..389213
FT                   /locus_tag="NGK_0467"
FT   CDS_pept        387558..389213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0467"
FT                   /product="RecN"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29158"
FT                   /db_xref="GOA:B4RK07"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR004604"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B4RK07"
FT                   /protein_id="ACF29158.1"
FT                   /translation="MRDFVIVENLNLDFQSGFTVLTGETGAGKSITLDAIGLLLGDKAD
FT                   YSQVRSGAKEAQLSALFDISHLPALKAELREQGLLDEGGEELSIRRIIDAKGKSRSFIN
FT                   NQAATLAQLKAVGGQLIDIHGQNDHHSLNQEAAQRELLDAFVGGRVQAETVRQLYQNWA
FT                   NAKKALQEAQEHADAVIIERERLEWQFNELNQLDIKQGEWEALSQSHDSLAHSAELLQA
FT                   AEEVGSKIDGDNGIQRHIYQCQKLLANLQNIEPRFAESLNMLASIEAELGEISANMRDV
FT                   AGHSDINPNELAAQEQRMGELMGMARKYRIEPEELPAKLAEIEERLQSLQAAADLDALE
FT                   HNVAHNFAEYQEAAHILSAMRHQAAGRLSSETTEHMQHLAMKGARFDIVLLPSSPTAHG
FT                   LEQVQFQVAANKGNPPRPLNKVASGGELARISLALQVVASQYTQVPTLIFDEVDTGIGG
FT                   GVAEMVGKALRALGRKHQVLAVTHLPQVASCGENHWRVRKHSEGEQTVSEISILDEIQR
FT                   IEEVARMLGGEVITDTTRQHAAELLQLASKNSLF"
FT   gene            389324..389400
FT                   /locus_tag="NGK_trnaArg1"
FT   tRNA            389324..389400
FT                   /locus_tag="NGK_trnaArg1"
FT                   /product="tRNA-Arg"
FT   gene            389418..389492
FT                   /locus_tag="NGK_trnaGlu1"
FT   tRNA            389418..389492
FT                   /locus_tag="NGK_trnaGlu1"
FT                   /product="tRNA-Glu"
FT   gene            389875..390024
FT                   /locus_tag="NGK_0468"
FT   CDS_pept        389875..390024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0468"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29159"
FT                   /db_xref="UniProtKB/TrEMBL:B4RK08"
FT                   /protein_id="ACF29159.1"
FT                   /translation="MDSKGNLLGIPYSLFWEENVMGVFDILPSGLVCLFEYDFLWSGRH
FT                   AAKA"
FT   gene            complement(390021..391640)
FT                   /locus_tag="NGK_0469"
FT   CDS_pept        complement(390021..391640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0469"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29160"
FT                   /db_xref="GOA:B4RK09"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR017610"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B4RK09"
FT                   /protein_id="ACF29160.1"
FT                   /translation="MDNLVWDGIPDIRTLDQTIRKHAHPLNLIVCLPDNQIPDFQTAQD
FT                   ASDSECRLKHRLDQATQCLQFDSINLIEHILPDVRFWLVPPSRTRRLHEHFHHISWQTE
FT                   AIPQTESKSDKPWFALPQTSERKKPEHVLVIGAGIAGASTAHALASHGISVTVLEARKA
FT                   AQAASGNRQGLLYAKISPHDTGQTELLLAGYGYTKRLLGHILPDSDTWGGNGIIHLNYS
FT                   RTEQQRNHELGLQKHHNHLYRSITSAEAEKIAGIPLNTPYAEPLCGLYWQHGVWLNPPA
FT                   FVRTLLSHPLIELYENTTLTGISHDGEKWIASTPNGTFTATHIIYCTGAHSPCLPETNL
FT                   AALPLRQIRGQTGLTPSTPFSEQLRCAVSGESYISPSWHGLHCYGASFIPNSSNTGWNE
FT                   AEEASNRQALAHLNPALAESLFAANPNPQKHQGHAAIRCDSPDHLPVVGALGDIAAMRQ
FT                   TYAKLALDKNYRIDTTCPYLPNAYTNTAHGTRGLATAPICAAAVAAEILGLPHLFSQRL
FT                   RHALHPNRTVIRAIVRRQNLIP"
FT   gene            391736..392128
FT                   /locus_tag="NGK_0470"
FT   CDS_pept        391736..392128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0470"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29161"
FT                   /db_xref="InterPro:IPR010376"
FT                   /db_xref="InterPro:IPR038492"
FT                   /db_xref="UniProtKB/TrEMBL:B4RK10"
FT                   /protein_id="ACF29161.1"
FT                   /translation="MYAEPRCFLNNIPVEIRLLKNRAVLVLTYGDEPKNLPAEFLRVYS
FT                   PSAEVRGHGVGQDVLQTGKADVQITDLQPVGQYALKISFSDGHDSGLYDWAYLHRLAYG
FT                   YDAMWQEYLDKLAAAGASRFEKQSDC"
FT   gene            392171..392908
FT                   /locus_tag="NGK_0471"
FT   CDS_pept        392171..392908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0471"
FT                   /product="Ubiquinone/menaquinone biosynthesis
FT                   methyltransferase ubiE"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29162"
FT                   /db_xref="GOA:B4RK11"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR023576"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4RK11"
FT                   /protein_id="ACF29162.1"
FT                   /translation="MGGQKTHFGFSTVNEDEKAGKVAEVFHSVAKNYDIMNDVMSAGLH
FT                   RVWKHFTIHTAHLKKGDKVLDIAGGTGDLSRGWAKRVGKEGEVWLTDINSSMLTVGRDR
FT                   LLNEGMILPVSLADAEKLPFPDNYFNLVSVAFGLRNMTYKDAALKEMYRVLKPGGTLLV
FT                   LEFSKIYKPLEGAYDFYSFKLLPVMGRLIAKDADSYQYLAESIRMHPDQETLKQMMLDA
FT                   GFDSVDYHNMSAGIVALHKGVKF"
FT   gene            393128..393607
FT                   /locus_tag="NGK_0472"
FT   CDS_pept        393128..393607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0472"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29163"
FT                   /db_xref="UniProtKB/TrEMBL:B4RK12"
FT                   /protein_id="ACF29163.1"
FT                   /translation="MPESIFKQISSDILRLHRDSVYSLLATSGCNCQVHEAAYVNIDGK
FT                   YYIALSCEPEVGEVETGILLIEDESRNLRLSWVGSARELDRKDNAYKRALSALSRKLGR
FT                   CKDKLHTAVQPFLLELVPEKGRFSVGDEEVWISRNDLVRALYPVGYSMRQAVLQI"
FT   gene            393618..393749
FT                   /locus_tag="NGK_0473"
FT   CDS_pept        393618..393749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0473"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29164"
FT                   /db_xref="UniProtKB/TrEMBL:B4RK13"
FT                   /protein_id="ACF29164.1"
FT                   /translation="MVCVPFAPLSQGAIFFARVLAAKEKCRLKPVFGRHPRAELPVR"
FT   gene            complement(393735..394229)
FT                   /locus_tag="NGK_0474"
FT   CDS_pept        complement(393735..394229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0474"
FT                   /product="HppK"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29165"
FT                   /db_xref="GOA:B4RK14"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:B4RK14"
FT                   /protein_id="ACF29165.1"
FT                   /translation="MNNRHFAVIALGSNLDNPAQQIRGALDALSSHPDIRLEQASSLYM
FT                   TAPVGYDNQPDFINAVCTVSTTLDGIALLAELNRIEADFGRERSFRNAPRTLDLDIIDF
FT                   DGISSDDPRLTLPHPRAHERSFVIRPLAEILPDFILGKYGKVVELSKRLGNQGIRLLPD
FT                   R"
FT   gene            complement(394239..394613)
FT                   /locus_tag="NGK_0475"
FT   CDS_pept        complement(394239..394613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0475"
FT                   /product="Regulator"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29166"
FT                   /db_xref="GOA:B4RK15"
FT                   /db_xref="InterPro:IPR007360"
FT                   /db_xref="UniProtKB/TrEMBL:B4RK15"
FT                   /protein_id="ACF29166.1"
FT                   /translation="MQYLIVKYSHQIFVTITILVFNIRFFLLWKNPEKPLVGFWKALPH
FT                   LNDTMLLFTGLWLMKITHFSPFNAPWLGTKILLLFAYIALGMVMMRARPRSTKFYTVYL
FT                   LAMCCIACIVYLAKTKVLPF"
FT   gene            complement(394667..394843)
FT                   /locus_tag="NGK_0476"
FT   CDS_pept        complement(394667..394843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0476"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29167"
FT                   /db_xref="InterPro:IPR010719"
FT                   /db_xref="UniProtKB/TrEMBL:B4RK16"
FT                   /protein_id="ACF29167.1"
FT                   /translation="MLIAVLYPGHENGKQEAEAVGQWAKNLPQEQFAVLRYGFTNRKNS
FT                   PPYLLAFEKLRQK"
FT   gene            complement(394874..395227)
FT                   /locus_tag="NGK_0477"
FT   CDS_pept        complement(394874..395227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0477"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29168"
FT                   /db_xref="InterPro:IPR010719"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B4RK17"
FT                   /protein_id="ACF29168.1"
FT                   /translation="MKNILPFAHCLLREALPEGGNALDGTAGNGHDTLFLAQTAGNRGK
FT                   VWAFDIQPQALNNTRCRLQEAGYSNVRLILDGHENLKQYIPEPLDAAVFNFGWLPGGDK
FT                   NLTTDKETSIPAL"
FT   gene            complement(395318..395593)
FT                   /locus_tag="NGK_0479"
FT   CDS_pept        complement(395318..395593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0479"
FT                   /product="Hfq"
FT                   /note="host factor-I protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29170"
FT                   /db_xref="GOA:B4RK18"
FT                   /db_xref="InterPro:IPR005001"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniProtKB/TrEMBL:B4RK18"
FT                   /protein_id="ACF29170.1"
FT                   /translation="MLQDPFLNALRKEHVPVSIYLVNGIKLQGQVESFDQYVVLLRNTS
FT                   VTQMVYKHAISTIVPARSVNLQHENKPQAAPASTLVQVETVQQPAE"
FT   gene            complement(395601..395732)
FT                   /locus_tag="NGK_0478"
FT   CDS_pept        complement(395601..395732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0478"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29169"
FT                   /db_xref="UniProtKB/TrEMBL:B4RK19"
FT                   /protein_id="ACF29169.1"
FT                   /translation="MPGGKPPKHKKIGNFSYSRLQFDTHRASARFHNHNSGVKKYDS"
FT   gene            complement(395740..396678)
FT                   /locus_tag="NGK_0480"
FT   CDS_pept        complement(395740..396678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0480"
FT                   /product="putative D-alanyl-D-alanine-endopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29171"
FT                   /db_xref="GOA:B4RK20"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="UniProtKB/TrEMBL:B4RK20"
FT                   /protein_id="ACF29171.1"
FT                   /translation="MSIRTLKRLPSSLLLGLCLSLPSAHLFADNDILGQFLEQNMLTSS
FT                   DPIEIFAESTIYPADTQAITGGLILSSQSALVVNNKTGQILYQKNADRIMPIASISKLM
FT                   SAMVVLDANLDMNETVTITPDEIDRLKGTGSRLAIGTALTRKELLHLSLMSSENRATHA
FT                   LGRTYPGGMGAFVAAMNRKAQSLGMYGSRFYEPTGLNFQNVSTAKDLSLMVNAAAQYPQ
FT                   IRTNSTSNYASVQTKNGQQNYKNSNALVREGMWNIELQKTGYIREAGRSMVVKANIQNQ
FT                   PVTIVLLNSPTSATRVNDARKIESWMLQQRS"
FT   gene            396999..397439
FT                   /locus_tag="NGK_0481"
FT   CDS_pept        396999..397439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0481"
FT                   /product="Bacterioferritin comigratory protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29172"
FT                   /db_xref="GOA:B4RK21"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B4RK21"
FT                   /protein_id="ACF29172.1"
FT                   /translation="MDMKYEFTLPSSSGADFHSAEHLPLVVYFYPKDSTPGCTTEGLDF
FT                   NARLEQFEALGYTVVGISRDGVKAHQNFCAKQGFRFELLSDKDETVCRLFDVIKLKKLY
FT                   GKESLGIERSTFVLNKDGEIVREWRKVKVAGHAQEVLETLSR"
FT   gene            397491..398366
FT                   /locus_tag="NGK_0482"
FT   CDS_pept        397491..398366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0482"
FT                   /product="XerD"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29173"
FT                   /db_xref="GOA:B4RK22"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR011932"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/TrEMBL:B4RK22"
FT                   /protein_id="ACF29173.1"
FT                   /translation="MENGLIDRLLETLWLDRRLSRNTLDSYRRDLEKIARRLSLCGRTL
FT                   KDADEADLAAAVYVDGEQRSSQARALSACKRLYVWMEREGMRADNPTRLLKPPKIDRNI
FT                   PTLITEQQISRLLAAPDTDTPHGLRDKALLELMYATGLRVSEAVGLNFGNVDLDRGCIT
FT                   TLGKGDKQRMVPMGQESAYWVERYYTEARPLLLKGRSCDALFVSQKKTGISRQLAWMIV
FT                   KEYAGRAGIGHISPHSLRHAFATHLVRHGLDLRVVQDMLGHADLNTTQIYTHVANVRLH
FT                   SVVKEHHSRN"
FT   gene            398538..398738
FT                   /locus_tag="NGK_0483"
FT   CDS_pept        398538..398738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0483"
FT                   /product="putative ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29174"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:B4RK23"
FT                   /protein_id="ACF29174.1"
FT                   /translation="MFVCICNAVTDHQIKETIAAGATTMGDLQSQLGVASCCGCCGELA
FT                   ASFLTAHNAQPTVTAGINVQA"
FT   gene            complement(398722..398847)
FT                   /locus_tag="NGK_0484"
FT   CDS_pept        complement(398722..398847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0484"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29175"
FT                   /db_xref="UniProtKB/TrEMBL:B4RK24"
FT                   /protein_id="ACF29175.1"
FT                   /translation="MVYLGKNNVFEEDDTQVLPKTAKMPSEQFRRHFQNRFTLER"
FT   gene            398874..399137
FT                   /locus_tag="NGK_0485"
FT   CDS_pept        398874..399137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0485"
FT                   /product="Thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29176"
FT                   /db_xref="InterPro:IPR008554"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B4RK25"
FT                   /protein_id="ACF29176.1"
FT                   /translation="MCKLTDKETRMKLTLMFREYCSLCHKMRDALKPFQDEYGFGLEVV
FT                   DVDENPVLEEKYNELIPVLLAGDEEICHWFLDEDRLKQFLER"
FT   gene            complement(399508..400359)
FT                   /locus_tag="NGK_0486"
FT   CDS_pept        complement(399508..400359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0486"
FT                   /product="putative reductase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29177"
FT                   /db_xref="GOA:B4RK26"
FT                   /db_xref="InterPro:IPR005913"
FT                   /db_xref="InterPro:IPR029903"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B4RK26"
FT                   /protein_id="ACF29177.1"
FT                   /translation="MTGSKSQLAHCLRDRLPEDWETIATDSASLDITDADAVCNMVKSF
FT                   QPDAIVNTAAYTAVDKAEGDAAAAFAVNASAVYNLALAAHRAHARFIHISTDYVFDGKG
FT                   KIPHQESDFTNPSNVYGQSKTAGELLALSANPDSLILRTSWLFSEYGDNFVRTMLNLAR
FT                   ERSPLSAVHNQIGCPTYAGDLSAAIIRLLQQSNPVRGIYHYAGGKSVSWYEFARHIFQT
FT                   ALQQDASFPVPELKAVSDEGSAAAAPRPAYSILDCRKIENDFGIKPSDWQKALAQVVSK
FT                   LL"
FT   gene            400468..401427
FT                   /locus_tag="NGK_0487"
FT   CDS_pept        400468..401427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0487"
FT                   /product="Phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29178"
FT                   /db_xref="GOA:B4RK27"
FT                   /db_xref="InterPro:IPR001636"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="UniProtKB/TrEMBL:B4RK27"
FT                   /protein_id="ACF29178.1"
FT                   /translation="MGIVLRRLRLEYRFAIQTCRVGIFKIFSGGCEMSEIGLVKIYSGK
FT                   VRDLYEIDDKRMLMVASDRLSAFDVILDAPVPGKGEILTQISNFWFKKLAHIMPNHFTG
FT                   DTVYDVLPENEAKALEKRAVVAKKLTPVKVEAIVRGYLAGSGWKDYQKTGSVCGIRLPE
FT                   GMREAQQLPEVIFTPSTKAAVGDHDENISFEECGRIIGKELAEEVRDKAVRLYTEAAEY
FT                   AKSRGIIICDTKFEFGLDEEGTLTLMDEVLTPDSSRFWPADQYEVGINPPSFDKQFVRD
FT                   WLEQSGWNKKAPAPKVPADVIRKTVEKYQEALTLLTQD"
FT   gene            401459..401674
FT                   /locus_tag="NGK_0488"
FT   CDS_pept        401459..401674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0488"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29179"
FT                   /db_xref="UniProtKB/TrEMBL:B4RK28"
FT                   /protein_id="ACF29179.1"
FT                   /translation="MFQTAFLLYQYWILRMVAFIIRNCFQRPKCRLKACLQPAARSETL
FT                   TMHIRILVCIISVLAVRYFERNNDVQ"
FT   gene            401664..403784
FT                   /locus_tag="NGK_0489"
FT   CDS_pept        401664..403784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0489"
FT                   /product="polyribonucleotide nucleotidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29180"
FT                   /db_xref="GOA:B4RK29"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR012162"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR015848"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4RK29"
FT                   /protein_id="ACF29180.1"
FT                   /translation="MFNKYVKTFQYGNQTVTLETGEIARQAAAAVKVSMGDTVVFVAVT
FT                   TNKEVKEGQDFFPLAVDYLERTYAAGKIPGGFFKREGKQSEKEILTSRLIDRPIRPLFP
FT                   EGFYHDIQIVAMVVSVDPEIDSDIPAMLGASAALVLSGVPFAGPIGAARVGYINGVYVL
FT                   NPTKAELAKSQLDLVVAGTSKAVLMVESEAKILPEDVMLGAVVYGHDQMQVAINAINEF
FT                   ADEVNPEVWDWKAPETNEELVAKVRGIAGETIKEAFKIRQKQARSAKLDEAWNAVKEAL
FT                   ITEETDTLAANEIKGIFKRLEADVVRSQILDGQPRIDGRDTRTVRPLNIQTGVLPRTHG
FT                   SALFTRGETQALAVATLGTSRDEQIIDALSGEYTDRFMLHYNFPPYSTGEVGRMGAPKR
FT                   REIGHGRLAKRALLAVLPKPEDFSYTMRVVSEITESNGSSSMASVCGGCLSLLSAGVPL
FT                   KAHVAGIAMGLILEGNKFAVLTDILGDEDHLGDMDFKVAGTTEGVTALQMDIKIQGITK
FT                   EIMQIALAQAKEARLHILDQMKAAVAGPQELSAHAPRLFTMKISQDKIRDVIGKGGETI
FT                   RSITAETGTEINIAEDGTITIAATTQEAGDAAKKRIEEITAEVEVGKVYEGTVVKILDN
FT                   NVGAIVSVMPGKDGLVHISQIAHERVRNVGDYLQVGQVVNVKALEVDDRGRVRLSIKAL
FT                   LDAPVREENAAE"
FT   gene            complement(403857..404525)
FT                   /locus_tag="NGK_0490"
FT   CDS_pept        complement(403857..404525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0490"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29181"
FT                   /db_xref="GOA:B4RK30"
FT                   /db_xref="InterPro:IPR039447"
FT                   /db_xref="UniProtKB/TrEMBL:B4RK30"
FT                   /protein_id="ACF29181.1"
FT                   /translation="MNHDITFLTLFLLGFFGGTHCIGMCGGLSSAFALQLPPHINRFWL
FT                   ILLLNTGRISSYTAIGLMLGLIGQLGISLDQTRVLQNILYTASNLLLLFLGLYLSGISS
FT                   LAAKIEKIGKPIWRNLNPILNRLLPIKSIPACLAVGILWGWLPCGLVYSASLYALGSGS
FT                   ATTGGLYMLAFALGTLPNLLAIGIFSLQLKKIMQNRYIRLCTGLSVSLWALWKLAVLWL
FT                   "
FT   gene            complement(404522..404836)
FT                   /locus_tag="NGK_0491"
FT   CDS_pept        complement(404522..404836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0491"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29182"
FT                   /db_xref="UniProtKB/TrEMBL:B4RK31"
FT                   /protein_id="ACF29182.1"
FT                   /translation="MSRLFLLLFPWATLAACTRNIPASPAVSNCAHLHNRTVLYFDAHG
FT                   KPADSTAKGGFYRTVEIHDTNRILIQDFNSTGNALVKPYWSDCRKLSVFPDKHLTMSHP
FT                   "
FT   gene            404973..405824
FT                   /locus_tag="NGK_0492"
FT   CDS_pept        404973..405824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0492"
FT                   /product="DapF"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29183"
FT                   /db_xref="GOA:B4RK32"
FT                   /db_xref="InterPro:IPR001653"
FT                   /db_xref="InterPro:IPR018510"
FT                   /db_xref="UniProtKB/TrEMBL:B4RK32"
FT                   /protein_id="ACF29183.1"
FT                   /translation="MKTLKFTKMHGLGNDFMVIDAVSQDFTPEDVPIAAWADRFRGVGF
FT                   DQLLVVGCSETEGVDFRYRIFNADGSEVGQCGNGARCFARFVADKGLTDKKEICVETAK
FT                   GIIFPKLSDNGMVTVNMGKPKFMPSEIPFVPESGEGDDACIYGVHLESGIQPVSCVNMG
FT                   NPHAVIVVDDVECAPVRETGSRIEPHRQFPERVNVGFMQVVGRTAIRLRVFERGVGETQ
FT                   ACGTGACAAVVAGIRLGLLDEGKTVEVVLPGGTLYIEWACGGDVMMTGPAETVFEGELA
FT                   YS"
FT   gene            405821..406426
FT                   /locus_tag="NGK_0493"
FT   CDS_pept        405821..406426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0493"
FT                   /product="Integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29184"
FT                   /db_xref="GOA:B4RK33"
FT                   /db_xref="UniProtKB/TrEMBL:B4RK33"
FT                   /protein_id="ACF29184.1"
FT                   /translation="MILLHLDFLSALLYAAVFLFLIFRAGMLQWFWASIALWLGISVLG
FT                   VKLMPGMWGMTRAAPLFIPHFYLTLGSIFFFIGYWNRKTDGNGWQADPEHPLLGLFAVS
FT                   NVSMTLAFVGICALVHYCFSGTVQVFVFAALLKLYALKPVYWFVLQFVLMAVAYVHRCG
FT                   IDRQPPSTFGGSQLRLGVLAAMLMQVAVTAMLLAEIGR"
FT   gene            406622..407554
FT                   /locus_tag="NGK_0494"
FT   CDS_pept        406622..407554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0494"
FT                   /product="Cysteine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29185"
FT                   /db_xref="GOA:B4RK34"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005856"
FT                   /db_xref="InterPro:IPR005859"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:B4RK34"
FT                   /protein_id="ACF29185.1"
FT                   /translation="MKIANSITELIGNTPLVKLNRLTKGLKAEVAVKLEFFNPGSSVKD
FT                   RIAEAMIEAAEKAGKINKNTVIVEATSGNTGIGLAMVCAARGYKLAITMPESMSKERKM
FT                   LLRTFGAELILTPAAEGMAGAIAKAQSLVDAHPDTYFMPRQFDNEANPEVHRKTTAEEI
FT                   WNDTDGKVDVFVAGVGTGGTITGVGEVLKKYKPEVKVVAVEPEASPVLSGGEKGPHPIQ
FT                   GIGAGFIPTVLNTEIYDSITKVPNEAAFETARAMAEKEGILAGISSGAAVWSALQLAKQ
FT                   PENEGKLIVVLLPSYGERYLSTPLFADLA"
FT   gene            407612..407959
FT                   /locus_tag="NGK_0495"
FT   CDS_pept        407612..407959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0495"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29186"
FT                   /db_xref="UniProtKB/TrEMBL:B4RK35"
FT                   /protein_id="ACF29186.1"
FT                   /translation="MPENAFLHIYRKRRLCFNQVLAPPHCLREIFFIRVLSGRTDFAPT
FT                   ENSRPARKVSRLSGRSRGFGLQTAYFRNGGTFAGGAAAIWGREGILWSVTEKNMPHHCW
FT                   CWVARCSDWAA"
FT   gene            407938..408558
FT                   /locus_tag="NGK_0496"
FT   CDS_pept        407938..408558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0496"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29187"
FT                   /db_xref="GOA:B4RK36"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B4RK36"
FT                   /protein_id="ACF29187.1"
FT                   /translation="MFGLGSLIVRSVPVGPYAIAFWRLLISVLVFWFLARFFGQKFPKN
FT                   RKTVRYALTAGVFLAFDLALWHESIHAVGPGISTLLNSLQIFFLSAIGVFFFGERLGRL
FT                   QAASLMSAVVGVAMIAGAEFGYNGNAVWGFASGLVSGLMLALSMVFVRKTHEVEQVALF
FT                   PSMMILSLGGAASPIVPALLMDGGALYPTTWKDSGLVLVYGAW"
FT   gene            408552..408770
FT                   /locus_tag="NGK_0497"
FT   CDS_pept        408552..408770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0497"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29188"
FT                   /db_xref="GOA:B4RK37"
FT                   /db_xref="UniProtKB/TrEMBL:B4RK37"
FT                   /protein_id="ACF29188.1"
FT                   /translation="MVMQCFAWAMVAYAIPLLSLSLTGLLLLSEPVAALFIDYFGLGKT
FT                   IEGVQWAGVVLTLSAIYLGSLKQPSEL"
FT   gene            408816..408965
FT                   /locus_tag="NGK_0498"
FT   CDS_pept        408816..408965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0498"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29189"
FT                   /db_xref="UniProtKB/TrEMBL:B4RK38"
FT                   /protein_id="ACF29189.1"
FT                   /translation="MDWQAVKTGKTKHADNGAERKMPSEALSDGIGAGRIKKAASAGMA
FT                   MQLK"
FT   gene            409028..409201
FT                   /locus_tag="NGK_0499"
FT   CDS_pept        409028..409201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0499"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29190"
FT                   /db_xref="UniProtKB/TrEMBL:B4RK39"
FT                   /protein_id="ACF29190.1"
FT                   /translation="MGFHTNGNNRLFTCRRIKSTDDLNTGKSYAARTHHFSRQSICAAH
FT                   IDNAGKAVHIVD"
FT   gene            complement(409401..410405)
FT                   /locus_tag="NGK_0500"
FT   CDS_pept        complement(409401..410405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0500"
FT                   /product="Lep"
FT                   /note="signal peptidase I"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29191"
FT                   /db_xref="GOA:B4RK40"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019533"
FT                   /db_xref="InterPro:IPR019757"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:B4RK40"
FT                   /protein_id="ACF29191.1"
FT                   /translation="MSGAAAALLAGIILYFKSDKKRQENGEWSSGLEYAYILTAVGVFA
FT                   ALSLFMSFTAVFLIFVVLCGTAWGVYKYRLKTHPEISESSHFGDYFGSFFPTVLVLFLI
FT                   RSFIAEPFQIPSSSMRPGLIKGDFILVGKFSYGLRVPVLNNVFIPTGKIERGDVVVFNY
FT                   PLQPEMTYIKRIVGIPGDIVEYRDKVLTVNGKPASDIPDGTYRYPDDTDPSEIHNTDMF
FT                   RSGLDGKSFNILKKEGQPAVSLPVLGKYTSDIMSENGYSIDQSGLNHCQYADDGSGFVC
FT                   KVPEGRYFAMGDNRDNSADSRYWGFVDDKLVVGKAMFILMNFGDFGRAGTAIR"
FT   gene            complement(410566..412359)
FT                   /locus_tag="NGK_0501"
FT   CDS_pept        complement(410566..412359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0501"
FT                   /product="GTP-binding protein LepA"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29192"
FT                   /db_xref="GOA:B4RK41"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006297"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR013842"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035654"
FT                   /db_xref="InterPro:IPR038363"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4RK41"
FT                   /protein_id="ACF29192.1"
FT                   /translation="MKNIRNFSIIAHIDHGKSTLADRFIQYCGGLDLREMSTQVLDSMD
FT                   IEKERGITIKAQTAALNYKARDGQVYQLNLIDTPGHVDFSYEVSRSLSACEGALLVVDA
FT                   SQGVEAQTVANCYTAIDLGVEVVPVLNKIDLPAADPERVEQEIEDIIGIDAVGAVQCSA
FT                   KSGIGVEDVLEEIVAKIPAPTGDENAPLQAVIVDSWFDNYVGVVMLIRVKNGTIKLKDK
FT                   VRFMSTKAETQVEQLGVFTPKSVQKQELKAGEVGFLITGVKELGQAKVGDTVTLVANPA
FT                   TEPLPGFQEVQSQVFAGLYPVESHDYEALRDALEKLQLNDASLKFEPEVSQALGFGFRC
FT                   GFLGLLHLEIVQERLEREFDMDLITTAPTVVYEVVLKSGEKIEVENPSKLPDIGSIETI
FT                   LEPIITATILVPQEYVGNVMTLCNQKRGVQVNMQYMGRQVMLTYDLPMNEVVMDFFDKL
FT                   KSTSRGYASLDYHFKEFQPSDLIKLDIMVNGEKVDALSLIVHRQSAVHKGRELASKMRE
FT                   LIPRQMFDIAVQAAIGSRIIARENVKALRKNVLAKCYGGDITRKKKLLEKQKAGKRRMK
FT                   QVGNVEIPQSAFLAILQVSDK"
FT   gene            complement(412501..413313)
FT                   /locus_tag="NGK_0502"
FT   CDS_pept        complement(412501..413313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0502"
FT                   /product="putative nucleoside phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29193"
FT                   /db_xref="GOA:B4RK42"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010049"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:B4RK42"
FT                   /protein_id="ACF29193.1"
FT                   /translation="MLSETVSDGTDKPPPLNPAVLACIIRRSIRNSQQVSNMSLKTVAV
FT                   IGAMEQEIELLREMMENVKAVSFGRFSAYEGELAGKRIVLALSGIGKVNAAVATAWLIR
FT                   QFAPDCVINTGSAGGLGKGLKVGDVVIGTETEHHDVDVTAFGYARGQVPQLPARFASDG
FT                   ILIETAKRAARTFEGAEVEQGLIVSGDRFVHSSEGVAEIRKHFPEVKAVEMEAAAIAQT
FT                   CHQLETPFVIIRAVSDSADEKADISFEEFLKTAAASSAKMVAEIVKSL"
FT   gene            413370..414500
FT                   /locus_tag="NGK_0503"
FT   CDS_pept        413370..414500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0503"
FT                   /product="Twitching motility protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29194"
FT                   /db_xref="GOA:B4RK43"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR006321"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B4RK43"
FT                   /protein_id="ACF29194.1"
FT                   /translation="MFTDENMTAKEELFAWLRHMNKNKGSDLFVTTHFPPAMKLDGKIT
FT                   RITDEPLTAEKCMEIAFSIMSAKQAEEFSSTNECNFAISLPDTSRFRVNAMIQRGATAL
FT                   VFRAITSKIPKFESLNLPPALKDVALKKRGLVIFVGGTGSGKSTSLASLIDYRNENSFG
FT                   HIITIEDPIEFVHEHKNCIITQREVGVDTENWMAALKNTLRQAPDVILIGEIRDRETMD
FT                   YAIAFAETGHLCMATLHANSTNQALDRIINFFPEERREQLLTDLSLNLQAFISQRLVPR
FT                   DGGKGRVAAVEVLLNSPLISELIHNGNIHEIKEVMKKSTTLGMQTFDQHLYQLYEKGEI
FT                   SLQDALKNADSAHDLRLAVQLRSRRAQSSDPDLELL"
FT   gene            414534..415511
FT                   /locus_tag="NGK_0504"
FT   CDS_pept        414534..415511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0504"
FT                   /product="DNA polymerase III subunit delta"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29195"
FT                   /db_xref="GOA:B4RK44"
FT                   /db_xref="InterPro:IPR004622"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B4RK44"
FT                   /protein_id="ACF29195.1"
FT                   /translation="MIYPWHQEQWRQIAEHWTSRPNAWLFVGKKGTGKTAFARFAAKAL
FT                   LCETPAPGCKPCGECMSCHLFGRGSHPDFYEITPLADEPENGRKLLRIKIDAVREIIDN
FT                   VYLTSVRGGLRVILIHPAESMNVQAANSLLKVLEEPPPQVVFLLVSHAADKVLPTIKSR
FT                   CRKKVLPAPSHGEALAYLRDRGVAEPEERLAFHSGAPLFQEEGELRELRAKLLEILAEP
FT                   RLLKILDYAALFDKEKLPLAVFVGWMQKWLVDLGLCLQHMKPVYYPAYEDRLLQTASGF
FT                   RPRNVFAAEDMLKQLAPYGFHTLNVKMQIEHLLINYLELKKENR"
FT   gene            415515..415865
FT                   /locus_tag="NGK_0505"
FT   CDS_pept        415515..415865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0505"
FT                   /product="putative type 4 pilus biogenesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29196"
FT                   /db_xref="GOA:B4RK45"
FT                   /db_xref="InterPro:IPR009875"
FT                   /db_xref="UniProtKB/TrEMBL:B4RK45"
FT                   /protein_id="ACF29196.1"
FT                   /translation="MSDGQNIPAKMMSLQLKDMNLLYSSYMPFLEHGGLFVQTDDVFSI
FT                   GDDILLAVEILNFPKLFLPTKVAWINPASTSSKPKGVGLAFTKHENCLKVKDQIEVELG
FT                   STISGSRPTFTM"
FT   gene            415870..416649
FT                   /locus_tag="NGK_0506"
FT   CDS_pept        415870..416649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0506"
FT                   /product="Mg-dependent DNase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29197"
FT                   /db_xref="GOA:B4RK46"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR015991"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B4RK46"
FT                   /protein_id="ACF29197.1"
FT                   /translation="MHIIDSHCHLNFEGLKERLPEVLSNMEANGVGQALAISVSRESFS
FT                   EVFAVAEAHEHIYCTIGVHPDSKEAEEFSIAEMVEAAAHPKVVGIGETGLDYYWCKGDL
FT                   SWQHKRFADHIEAANQTGLPVIVHTRDAAADTLAILKECKTNSGVIHCFSEDVGFARAA
FT                   MDLGLYISFSGIVTFKNAPLVQEAAKYVPDDRILVETDAPFLAPVPKRGRQNEPAFVRH
FT                   TAEHIAKLRNQTLEQVAAYTTENFYRLFKKVPDMRVV"
FT   gene            complement(416686..416910)
FT                   /locus_tag="NGK_0507"
FT   CDS_pept        complement(416686..416910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0507"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29198"
FT                   /db_xref="UniProtKB/TrEMBL:B4RK47"
FT                   /protein_id="ACF29198.1"
FT                   /translation="MPYIAQYQCCERQYSHSSTILLSGKWHRAYPPPLSSFFTSRLPPL
FT                   AMQNLEAEFAMPVRNVLAGSRQQRGHAYG"
FT   gene            416991..417302
FT                   /locus_tag="NGK_0508"
FT   CDS_pept        416991..417302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0508"
FT                   /product="GrlA"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29199"
FT                   /db_xref="GOA:B4RK48"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR004480"
FT                   /db_xref="InterPro:IPR014434"
FT                   /db_xref="InterPro:IPR033658"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B4RK48"
FT                   /protein_id="ACF29199.1"
FT                   /translation="MASIHDQIKEVVTTHRVVLFMKGTKQFPQCGFSSRAVQILNAAGC
FT                   TDYVAVNVLENPEVRQGIKEYSDWPTIPQLYVNGEFVGGSDILMEMYEAGELQELLKA"
FT   gene            417302..417418
FT                   /locus_tag="NGK_0509"
FT   CDS_pept        417302..417418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0509"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29200"
FT                   /db_xref="UniProtKB/TrEMBL:B4RK49"
FT                   /protein_id="ACF29200.1"
FT                   /translation="MDSAMPSERVSDGIFFSGKLKKSIMTRLKITLEHRDER"
FT   gene            417408..418034
FT                   /locus_tag="NGK_0510"
FT   CDS_pept        417408..418034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0510"
FT                   /product="uracil phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29201"
FT                   /db_xref="GOA:B4RK50"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005765"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR034332"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4RK50"
FT                   /protein_id="ACF29201.1"
FT                   /translation="MNVNVINHPLVRHKLTLMREADCSTYKFRTLTTELARLMAYEASR
FT                   DFEIEKYLIDGWCGQIEGDRIKGKTLTVVPILRAGLGMLDGVLDLIPTAKISVVGLQRD
FT                   EETLKPISYFEKFVDSMDERPALIIDPMLATGGSMVATIDLLKEKGCRNIKALVLVAAP
FT                   EGVKAVNDAHPDVTIYTAALDSRLNENGYIIPGLGDAGDKIFGTR"
FT   gene            418057..418377
FT                   /locus_tag="NGK_0511"
FT   CDS_pept        418057..418377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0511"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29202"
FT                   /db_xref="InterPro:IPR016755"
FT                   /db_xref="UniProtKB/TrEMBL:B4RK51"
FT                   /protein_id="ACF29202.1"
FT                   /translation="MNFQDYLATFPSIDHLGGLDVQDAEGKTVHHIPAVQGKLGSLKLY
FT                   NALAERFDGKLGKEAAEQGLIWFAEHVADARAHPGKHPNIDLLENVVQSGETLLLKPLA
FT                   AQ"
FT   gene            418546..419193
FT                   /locus_tag="NGK_0512"
FT   CDS_pept        418546..419193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0512"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29203"
FT                   /db_xref="GOA:B4RK52"
FT                   /db_xref="InterPro:IPR003220"
FT                   /db_xref="UniProtKB/TrEMBL:B4RK52"
FT                   /protein_id="ACF29203.1"
FT                   /translation="MSGVTKELDILKQLFENLSDTDKQAFLTSVSSKEQVKKVIEPRKV
FT                   TKCPHCQSTHFVKNGKDCGNQRFLCRDCKKSFVEQTGTILYNTQKDIEVWEKYIHCMIE
FT                   KYPLRKCAEICKINLATAFTWRHKILDALQNMMNEVELDGIVQADETYSTISYKGHHKN
FT                   FNLPRPAHKRGTRATKRGISKEQVCVPCGINLDGKSVARISNLGKPSLKNIN"
FT   gene            419217..420041
FT                   /locus_tag="NGK_0513"
FT   CDS_pept        419217..420041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0513"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29204"
FT                   /db_xref="GOA:B4RK53"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B4RK53"
FT                   /protein_id="ACF29204.1"
FT                   /translation="MFALAASNMILRGDGKANLHQSSCFMTDFQDLIKNPKPETGLKRP
FT                   NVGFLNPPYAQSKSDAELHELYFVKEMLDMLAEGGTGIAIIPVSCVIAPSKAKSEIVKY
FT                   HRLKAVMSMPSELFYPVGTVTCIVVFEAHKPHFQTVVIDPDTQEEISTKKACRKTWFGY
FT                   WRDDGFEKTKHLGRIDLYDRWQGIKARWLEHYLNNEVHTGESVTAFVTDNDEWVAEAYL
FT                   ETDYSKITRADFEQVVREFALFQLLGAEVGPTENLDNESYEDDDNNDFGDDE"
FT   gene            420041..421009
FT                   /locus_tag="NGK_0514"
FT   CDS_pept        420041..421009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0514"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29205"
FT                   /db_xref="GOA:B4RK54"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:B4RK54"
FT                   /protein_id="ACF29205.1"
FT                   /translation="MVELQEIFDVSYGSKLDLNKMSSFNPTINFVGRSGKNNGVTASVD
FT                   LLKNTKPYPAGLLTVALGGSVLSTFLQNKPFYTAQNVAVLNPKTEMTEQQKLFYCAAIF
FT                   ANAYRFSACGREANRTLRQLFVPSLDEIPSWVESVNLNPSAGVTEPKLKEPLDLPVVRQ
FT                   SKRLDEIFTIQNGIAATKLKEFEQRQKDTVVYIRPASTQARTLRSYIARDSVDEKHIFP
FT                   CHTLFTSTNGEGSHTYSYVSTCEFVANSDVAVLTPIQSDMPIEVKLYYAKCITANRYLF
FT                   SYGRKPKGEKLKSIMLPYFDQQEDFDYICRFIHTLLFSNNL"
FT   gene            421288..421713
FT                   /locus_tag="NGK_0515"
FT   CDS_pept        421288..421713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0515"
FT                   /product="Gly1ORF1 precursor"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29206"
FT                   /db_xref="UniProtKB/TrEMBL:B4RK55"
FT                   /protein_id="ACF29206.1"
FT                   /translation="MMKKMFLSAALLLSAAAQTVWADTVFSCKTDNNKYIEVQKINRNL
FT                   YEYSFGSAAKKEIAIRNSKADLLGRSDRWQGMGSGRRATMKFQNGEFMYTVWTGFDSVT
FT                   HTESSGVVVERRGKEVARVGCTPKTAQANFNDDDFSR"
FT   gene            421731..422495
FT                   /locus_tag="NGK_0516"
FT   CDS_pept        421731..422495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0516"
FT                   /product="uroporphyrinogen-III synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29207"
FT                   /db_xref="GOA:B4RK56"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="InterPro:IPR039793"
FT                   /db_xref="UniProtKB/TrEMBL:B4RK56"
FT                   /protein_id="ACF29207.1"
FT                   /translation="METAKPVMLIVRPSGRAKDDVEVCRRAGWQAEVLSPIEIETDEAS
FT                   LKRLPEMYARADAVFWVSPAAVETAVPYLNLSDGIKAHIAVGQGSRRALARYAGAGVFA
FT                   PEDGNDSEAVLRLPVWNSLPEGARVLSVRGHGGRDFLMNALQEKGFRTEVAEVYFRRHK
FT                   PLNFQNFQTENIAAAYITSTELVQSLFAQLPPQFSRFFKSLLYFTHHPRIAEALKREGV
FT                   CSVETVPTLEAALSYSSISVSDGMVFPGTSNQ"
FT   gene            422507..423841
FT                   /locus_tag="NGK_0517"
FT   CDS_pept        422507..423841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0517"
FT                   /product="Uroporphyrin-III C-methyltransferase HemX,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29208"
FT                   /db_xref="GOA:B4RK57"
FT                   /db_xref="InterPro:IPR007470"
FT                   /db_xref="UniProtKB/TrEMBL:B4RK57"
FT                   /protein_id="ACF29208.1"
FT                   /translation="MGEPENKSSEPVREIQASKEMPSETSSPRKENETEVHIPAAPFIV
FT                   KQSGSNALAACALVLAALGLGASGFLFVQGQNVLKNQELAFNQKIDKAALGESENAALL
FT                   KDNLNRQSAIQSELDRLDSGVKANGEQILMTQKAYRELTKGRADWLVDETETILNLAAQ
FT                   QLVLTGNIQTAVGVLEHIDSRLSRFDQAELLPIKQAVSSDLAELKNRPYVDISGTALRL
FT                   DRLETAVSGLPLILDGVLKPGVQARNEAVSASWWQNVWEKSLGTLKGLVEIRRLENNDA
FT                   MLISPEQAYFVRENLRLRLLDARTALMQRNGEVYQGDLNNAEAAVRQYFDAKSPATQSW
FT                   LKELAELKTLDVRMTADDGLKTSLNAVRAYRDGTRMTAAENQEAEQAASEPANENTASE
FT                   PAAASDVKAIEAPSLPSERKPEQPAKKQPAPEKAGRSPSAKGERA"
FT   gene            423838..425055
FT                   /locus_tag="NGK_0518"
FT   CDS_pept        423838..425055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0518"
FT                   /product="HemY protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29209"
FT                   /db_xref="GOA:B4RK58"
FT                   /db_xref="InterPro:IPR005254"
FT                   /db_xref="InterPro:IPR010817"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:B4RK58"
FT                   /protein_id="ACF29209.1"
FT                   /translation="MKTVVWIVVLFAAAVGLALASGIYTGDVYIVLGQTMLRINLHAFV
FT                   LGSLIAVVVWYFLFKFIIGVLNIPENMRRSGSARKGRKAALALNKAGLAYFEGRFEKAE
FT                   LEASRVLGNKEAGDNRTLALMLGAHAAGQMENIELRDRYLAEIAKLPEKQQLSRYLLLA
FT                   ESALNRRDYEAAEANLHAAAKMNANLTRLVRLQLRYAFDRGDALQVLAKTEKLSKAGAL
FT                   GKSEMERYQNWAYRRQMADAADAAALKTCLKRIPDSLKNGELSVSVAEKYERLGLYADA
FT                   VKWVKQHYPHNRRPELLEAFVESVRFLGEREQQKAIDFADSWLKEQPDNALLLMYLGRL
FT                   AYGRKLWGKAKGYLEASIALKPSIPARLVLAKVFDETAQSQKAEAQRNLVLASVAGENR
FT                   PSAETR"
FT   gene            425130..426194
FT                   /locus_tag="NGK_0519"
FT   CDS_pept        425130..426194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0519"
FT                   /product="putative uroporphyrinogen decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29210"
FT                   /db_xref="GOA:B4RK59"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="InterPro:IPR006361"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4RK59"
FT                   /protein_id="ACF29210.1"
FT                   /translation="MTLLKNDTFLRALLKQPVEYTPIWMMRQAGRYLPEYKATRAKAGS
FT                   FLDLCKNTGLATEVTIQPLERFDLDAAILFSDILTVPDAMGLGLYFAEGEGPKFAHALQ
FT                   HESDIAKLHVPDMEKLQYVFDAVTSIRKALDGRVPLIGFSGSPFTLACYMVEGGGSKEF
FT                   RTIKTMMYSRPDLLYKILDTNAQAVTAYLNAQIDAGAQAVQIFDTWGGVLSDAAFKEFS
FT                   LKYIRQIVAGLKRESEGRRVPVIVFAKGGGLWLESMVQIGADALGLDWTCNIGEARRRV
FT                   GNQVALQGNFDPSALFGTPESIRTEVARILTGYGHGSGHVFNLGHGINQHADPEHAKIL
FT                   VDTVHELSRQYHGG"
FT   gene            complement(426257..428146)
FT                   /locus_tag="NGK_0520"
FT   CDS_pept        complement(426257..428146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0520"
FT                   /product="Putative stress-sensitive restriction system
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29211"
FT                   /db_xref="InterPro:IPR018310"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B4RK60"
FT                   /protein_id="ACF29211.1"
FT                   /translation="MLRTYLNQLTPPELADSVKNTVDGFMEKLSQTEPKIAQNVLLLGN
FT                   VQSGKTAQVLGVLSALADDGDHKVFLYLTTDSVDLQDQTVKRAKANLKNFIVLSEADDR
FT                   SFMEVMKAENPILVVIKKNARVLKRWRNLFASQSSLKGYPLVIVDDEADAASLNTNSDK
FT                   PAKDASTINKLLNDIKNSCCQSLFIQLTATPQSLLLQHEESDWQPEFIHFFEAGEKYIG
FT                   GNFVFSDPPSYIVRFIDSELDDMKDESGEIAEGAKQALLSFLITCAEFALCDKANCNFA
FT                   LHPSYKIQDHQAFSKKIQAFLNDLVQAVNNGEDLAGSFKESYLDLQKTKPDIHHFDEIY
FT                   EKLTALLENKQISTLVVNSQTETDFDLEKGFNIIIGGNVIGRGLTIPKLQTVYYSRTAK
FT                   KPNADTFWQHSRIFGYDRDKSLLRLYIPFDVYYFFVQLNQANNLIIGQAKNSGGNIQVI
FT                   YPKNINPTRKNVLKFDSINQIVGGVNYFPLHPNEDNLSEINKILPSILKDEIQSDLYQI
FT                   DIEDLFLVLDKLGRYVPDDWNKEKFIAGVEALKAQRPSFKTYVLIKTGRKLSRATGTML
FT                   SEDDRKLGEKYPNDLFLTLYQVVGNKDKGWQGKDFWLPNIKLPHNGLVYQSAK"
FT   gene            complement(428147..429184)
FT                   /locus_tag="NGK_0521"
FT   CDS_pept        complement(428147..429184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0521"
FT                   /product="restriction endonuclease R.NgoVII"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29212"
FT                   /db_xref="GOA:B4RK61"
FT                   /db_xref="InterPro:IPR019065"
FT                   /db_xref="UniProtKB/TrEMBL:B4RK61"
FT                   /protein_id="ACF29212.1"
FT                   /translation="MNTVFSNIANAKITEKSLNAVWMDLFKSADEVLMATGYVSNDAVV
FT                   ELHKILELNDHIQKIDLLVGMHYLEGFSHLQYDSLCKLNDFLRHEKRGAVYVSPFVKFH
FT                   GKMYSFKNYQKINGLIGSANLTCFWDSTERTYETMLHLNGKPAQILQADIQSTIHKLGK
FT                   NIQEVERPSKFIEHNSHLENCLGVQKIAPEQIRQLFAQTSEYHFSIPAKTEEKSNLNVF
FT                   FGEGRRDKRGFVKPRPWYEVELIVSKDITSQEGYPVLKSFTVITDDGWQFQCKTSGDYS
FT                   KNFRSENDLKTLGKWIKGRLESHGCLQNNEKITHETLREYGNDHFELRSTDNPDVWLLS
FT                   FKGKN"
FT   gene            complement(429181..430224)
FT                   /locus_tag="NGK_0522"
FT   CDS_pept        complement(429181..430224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0522"
FT                   /product="site-specific DNA-methyltransferase M.NgoVII"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29213"
FT                   /db_xref="GOA:B4RK62"
FT                   /db_xref="InterPro:IPR001525"
FT                   /db_xref="InterPro:IPR018117"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B4RK62"
FT                   /protein_id="ACF29213.1"
FT                   /translation="MDLGFHQAGCETVWANDFSHWACESFRKNIGDVIVEGDIEQINPN
FT                   DPTIPDCDIILGGFPCQDFSMIWKQPGLEGERGNLYKSFLRFVNAKKPKVFVAENVKGL
FT                   LTANKKKAIQQIITDFENCGYYVQAKLYNFAEFGVPQFRERVLIVGVRLDTGFDFRHPE
FT                   PTHNETGENGLKPYVTAGQAISNIPQNASNNELLKISDKTRRMLELIPEGGNFTDIPKD
FT                   HPLYVKGMISHVYRRMHRNEPSKTIIAAGGGGTWGYHFPEPRAFTNRERARLQSFPDDF
FT                   EFVGSTTEVRRQIGNAVPPQGVVELAKSILPIFSDNYEKVDLHEKLVEEKEILFHDRLS
FT                   KIRGGKQ"
FT   gene            430712..432091
FT                   /locus_tag="NGK_0523"
FT   CDS_pept        430712..432091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0523"
FT                   /product="RadA"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29214"
FT                   /db_xref="GOA:B4RK63"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/TrEMBL:B4RK63"
FT                   /protein_id="ACF29214.1"
FT                   /translation="MAKTLKTLYQCTECGGTSPKWQGKCPHCGEWNTLQESFAAPEPKN
FT                   ARFQSWAADASTVQSLSAVTAAEVPRNPTGMGELDRVLGGGLVDGAVILLGGDPGIGKS
FT                   TLLLQTIAKMAQSRKVLYVSGEESAQQVALRSQRLELHAEGVNLLAEIRMEAIQAALKQ
FT                   HQPEVVVIDSIQTMYSDQITSAPGSVSQVRECAAQLTRMAKQMGIAMILVGHVTKDGAI
FT                   AGPRVLEHMVDTVLYFEGDQHSNYRMIRAIKNRFGAANELGVFAMTENGLKGVSNPSAI
FT                   FLASYRDDTPGSCVLVTQEGSRPLLVEIQALVDDAHGFTPKRLSVGLEQNRLAMLLAVL
FT                   NRHGGIACFDQDVFLNAVGGVKIGEPAADLAVILAMLSSFRNRPMPEKTVVFGEIGLSG
FT                   EVRPVARGQERLKEAEKLGFKRAIVPKANMPRNAKEFPNLKIHGVSSLQEAIDICRDSR
FT                   E"
FT   gene            432129..432284
FT                   /locus_tag="NGK_0524"
FT   CDS_pept        432129..432284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0524"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29215"
FT                   /db_xref="UniProtKB/TrEMBL:B4RK64"
FT                   /protein_id="ACF29215.1"
FT                   /translation="MVCGGLKQEGIPATDKICGKVACDMAKRIRPSSLRRRESGIVRFG
FT                   NDWKSR"
FT   gene            complement(432366..432746)
FT                   /locus_tag="NGK_0525"
FT   CDS_pept        complement(432366..432746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0525"
FT                   /product="Periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29216"
FT                   /db_xref="InterPro:IPR005180"
FT                   /db_xref="InterPro:IPR016796"
FT                   /db_xref="InterPro:IPR035923"
FT                   /db_xref="UniProtKB/TrEMBL:B4RK65"
FT                   /protein_id="ACF29216.1"
FT                   /translation="MTTHTLTSKYSFDETVSRLETAIKSKGMDIFAVIDHQEAARRNGL
FT                   TMQPAKVIVFGTPKAGTPLMVKDPAFALQLPLRVLVTETDGKVRTAYTDTRALIVGSRI
FT                   SFDEVANTLANAEKLIQKTVGE"
FT   gene            432763..432942
FT                   /locus_tag="NGK_0526"
FT   CDS_pept        432763..432942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0526"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29217"
FT                   /db_xref="UniProtKB/TrEMBL:B4RK66"
FT                   /protein_id="ACF29217.1"
FT                   /translation="MGGLSAGCAEAVEMQSADAAIRGSMCFIVFPYRFVYRASDGAARA
FT                   APDAVPRAGTPYAV"
FT   gene            complement(432970..433329)
FT                   /locus_tag="NGK_0527"
FT   CDS_pept        complement(432970..433329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0527"
FT                   /product="Putative periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29218"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:B4RK67"
FT                   /protein_id="ACF29218.1"
FT                   /translation="MNIKQLITAALIASAAFATQAAPQKPVSAAQTAQHSAVWIDVRSE
FT                   QEFSEGHLHNAVNIPVDQIVRRIYEAAPDKDTPVNLYCRSGRRAEAALQELKKAGYTNV
FT                   ANHGGYEDLLKKGMK"
FT   gene            complement(433368..436970)
FT                   /locus_tag="NGK_0528"
FT   CDS_pept        complement(433368..436970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0528"
FT                   /product="putative exodeoxyribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29219"
FT                   /db_xref="GOA:B4RK68"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR004586"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:B4RK68"
FT                   /protein_id="ACF29219.1"
FT                   /translation="MSAPIRAFDPLTAPISGTNLIEASAGTGKTYGIAALFTRLIVLEQ
FT                   KSVERVLVVTFTKAATAELKTRLRARLDDVLQVLESKEIAELGDDTLSDGIAAYCAEHH
FT                   EGDTFLPALLEQALQKESRTRLIVRLKAAIGQFDNAAIYTIHGFCQRILRDYAFLCQAP
FT                   FDVELTEEDGDRLLVPAQDFWRERVSGDPVLAALAFKRKAVPQTVLAQIRAYLSRPYLN
FT                   FRRPQADLKQAQRDAETSWQTVCRLLPELEAGFWRIHPDLNGNSYRKNSFGNLFKELAQ
FT                   KSAAGQLPFLDKDTHERLLKLSSDKLEAGLKKGKTPDAAVFAELQKLADFGRDLNALEE
FT                   AEEATMIRLQLDLIEYLNSSLAEMKKSRRERGFDDLLLDVHTALTDNPHAETPARAVAE
FT                   NWEIALIDEFQDTDPLQYEIFQKIFIARNRPLFLVGDPKQAIYSFRGADIYAYLQAAED
FT                   ARHRYTLATNYRSHAALIGSIGALFRLKERPFVLENIGYSEVGAARAESRLSPKRPAVQ
FT                   LRWLHENDNEKANKDVLRRRAADYCADEIAHALNEASGGRLNFKGRPLQSGDIAVLVRT
FT                   HNEAVMISAALKKRQVQSVLLSRESVFASPEAAALSALIGFWLEPRRAGTLRFVLTSGI
FT                   FGYDAQQLHDFNQNESEILHWAESARTALDIWQKYGIFAAMQQFSQTHGIETRLLSRNN
FT                   GRSLTNYFQLLELLAAEDAQNRNPAALHKWLRDQISLAGNNGGDNRAIRLESDEDLVKI
FT                   VTMHASKGLQYPLVYCPFAWDAQDTGPSDWQILHQGANRAELLAKAQLSESEQKQYADE
FT                   EMAERLRLLYVALTRAEEQLNIYAAYSSDTADNPLAYLIEGLPQDSRETVRRTYACEKD
FT                   GITMLKRNWRRVADNAPAGTDFAFTEDAPPPAAYRGNADQAAEFAANSIPERGFRFVRH
FT                   TSFTALSRQTQTPDGGEEDACPSLDAAETSVPAMPSETPTASDGISIHDFPKGTQAGLC
FT                   LHEILEDFKFGQAAAEQETLIADKLKKYGFEEIWLPAVAEMAEACRKTPLTGAYGLSDI
FT                   PPGCRRPEMGFTLHTEDFGLKRLRDWLARDDIRLPEVCRAAAETLDFHTVNGFLNGFID
FT                   MVCQDPDGNICIIDYKSNHLSAYTRQAMDEAVAHQHYYLQALIYAVAAARYFKLRGQPP
FT                   AAVSVRYLFLRGLDGKGGGVWRWDIDAAALEQIK"
FT   gene            complement(437047..438165)
FT                   /locus_tag="NGK_0529"
FT   CDS_pept        complement(437047..438165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0529"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29220"
FT                   /db_xref="GOA:B4RK69"
FT                   /db_xref="InterPro:IPR006314"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:B4RK69"
FT                   /protein_id="ACF29220.1"
FT                   /translation="MVIPNRNGKDMPKPPEAEIKGAGKAAGGTKPKSGIRYANGGFTHA
FT                   VPAKIRLPIRCYNPPETDDTKKEHLMNTPQSAIIPDHAQAGIFIEADFAANRLNDIKAA
FT                   CRASLDALSALKARFPDDILGLTIAFGSKAWATFGHTDEGSEIKPFPEMGNGLAPSTQH
FT                   DMSIHIQSFRQNAAYALAQSVLGAFGDSICVASEEHGLRLYQDRGLDGFVDGTENPQGD
FT                   ETIREVAIIPEGLPDAGGSYVLLQKYLHDLKKWDAVPVAEQEASVGRSKETDDEFSRDV
FT                   RLPDSHLGRVNLKENGVGLKIVRRSLPFGKISGEHGLMFTAYCRTLHNIEAQLLSMFGD
FT                   TDGKTDLLLRHLSAAVSGGYYYAPSVERLQNL"
FT   gene            438240..439067
FT                   /locus_tag="NGK_0530"
FT   CDS_pept        438240..439067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0530"
FT                   /product="Amino acid ABC transporter, periplasmic amino
FT                   acid-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29221"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:B4RK70"
FT                   /protein_id="ACF29221.1"
FT                   /translation="MMLKKFVLGGIAALVLAACGGSEGGSGASSAPAQSAISGSLIERI
FT                   NNKGTVTVGTEGTYAPFTYHDKDGKLTGYDVEVTRAVAEKLGVKVEFKETQWDSMMAGL
FT                   KAGRFDVVANQVGLTSPERQATFDKSEPYSWSGAVLVARNDSNIKSIADIKGVKTAQSL
FT                   TSNYGEKAKAAGAQLVPVDGLAQSLTLIEQKRADATLNDELAVLDYLKKNPNAGVKIVW
FT                   SAPADEKVGSGLIVNKGNDEAVAKFSTAINELKADGTLKKLGEQFFGKDISVQ"
FT   gene            439057..439773
FT                   /locus_tag="NGK_0531"
FT   CDS_pept        439057..439773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0531"
FT                   /product="Amino acid permease integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29222"
FT                   /db_xref="GOA:B4RK71"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B4RK71"
FT                   /protein_id="ACF29222.1"
FT                   /translation="MFNNFLASLPFMTETRADMLISAFWPMVKAGFTVSLPLAIASFVI
FT                   GMIIAVAVALVRIMPSGGIFQKCLLKLVEFYISVVRGTPLLVQLVIVFYGLPSVGIYIN
FT                   PIPAAIIGFSLNVGAYASETIRAAILSVPKGQWEAGFSIGMTYMQTFRRIVAPQAFRVA
FT                   VPPLSNEFIGLFKNTSLAAVVTVTELFRVAQETANRTYDFLPVYIEAALVYWCFCKVLF
FT                   LIQARLEKRFDRYVAK"
FT   gene            439783..440538
FT                   /locus_tag="NGK_0532"
FT   CDS_pept        439783..440538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0532"
FT                   /product="Amino acid ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29223"
FT                   /db_xref="GOA:B4RK72"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:B4RK72"
FT                   /protein_id="ACF29223.1"
FT                   /translation="MIKIRNIHKTFGENTILRGIDLDVGKGQVVVILGPSGSGKTTFLR
FT                   CLNALEMPEDGQIEFDNARPLRIDFSKKTSKHDILALRRKSGMVFQQYNLFPHKTVLEN
FT                   VMEGPVAVQGKPAAQAREEALKLLEKVGLGDKVDLYPYQLSGGQQQRVGIARALAIQPE
FT                   LMLFDEPTSALDPELVQDVLDAMKELAREGWTMVVVTHEIKFTLEVATNVVVMDGGVIV
FT                   EQGSPKELFDHLKHERTRRFLSQIQSAKI"
FT   gene            complement(440594..441976)
FT                   /locus_tag="NGK_0533"
FT   CDS_pept        complement(440594..441976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0533"
FT                   /product="Pgm"
FT                   /note="phosphoglucomutase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29224"
FT                   /db_xref="GOA:B4RK73"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:B4RK73"
FT                   /protein_id="ACF29224.1"
FT                   /translation="MASITRDIFKAYDIRGIVGKTLTDDAAYFIGRAIAAKAAEKGIAR
FT                   IAIGRDGRLSGPELMEHIQRGLTDSGIGVLNVGMVTTPMLYFAAVNECGGSGVMITGSH
FT                   NPPDYNGFKMMLGGDTLAGEAIQELLAIVEKDGFVAADKQGSVTEKDISGAYHDHIVGH
FT                   VKLKRPINIAIDAGNGVGGAFAGKLYKGLGNEVTELFCEVDGNFPNHHPDPSKPENLQD
FT                   LIAALKNGDAEIGLAFDGDADRLGVVTKDGNIIYPDRQLMLFAQDVLNRNPGAKVIFDV
FT                   KSTRLLAPWIKEHGGEAIMEKTGHSFIKSAMKKTGALVAGEMSGHVFFKERWFGFDDGL
FT                   YAGARLLEILSASDNPSEVLDNLPQSISTPELNISLPEGSNGHQVIEELAAKAEFEGAT
FT                   EIITIDGLRVEFPDGFGLMRASNTTPILVLRFEADTQAAIERIQNRFKAVIESNPHLIW
FT                   PL"
FT   gene            complement(442144..442653)
FT                   /locus_tag="NGK_0534"
FT   CDS_pept        complement(442144..442653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0534"
FT                   /product="putative peptidyl-prolyl cis-trans isomerase B"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29225"
FT                   /db_xref="GOA:B4RK74"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:B4RK74"
FT                   /protein_id="ACF29225.1"
FT                   /translation="MIILHTNKGDIKIELDFDKAPVTAKNFEQYVKDGFYDGVIFHRVI
FT                   KGFMIQGGGMDENMNEKETRDPIQNEASNGLPNDKYTIAMARTSDPHSAGAQFFINTAD
FT                   NAFLNFRSKELYGKTVVQDWGYAVFGKVVDGFDVVDAIESVSTKRHGYHDDVPTEPVII
FT                   IKAEAV"
FT   gene            complement(442773..444188)
FT                   /locus_tag="NGK_0535"
FT   CDS_pept        complement(442773..444188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0535"
FT                   /product="putative transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29226"
FT                   /db_xref="GOA:B4RK75"
FT                   /db_xref="InterPro:IPR001898"
FT                   /db_xref="InterPro:IPR031312"
FT                   /db_xref="UniProtKB/TrEMBL:B4RK75"
FT                   /protein_id="ACF29226.1"
FT                   /translation="MNLHAKDKTQHPENVELLSAQKPITDFKGLLTTIISAVVCFGIYH
FT                   ILPYSPDANKGIALLIFVAALWFTEAVHITITALMVPILAVVLGFPDMDIKKAMADFSN
FT                   PIIYIFFGGFALATALHMQRLDRKIAVSLLRLSRGNMKVAVLMLFLVTAFLSMWISNTA
FT                   TAAMMLPLAMGMLSHLDREKEHKTYVFLLLGIAYCASIGGLGTLVGSPPNLIAAKALNL
FT                   DFVGWMKLGLPMMLLILPLMLLSLYVILKPNLNERVEIKAESIPWTLHRVIALLIFLAT
FT                   AAAWIFGSKIKTAFGISNPDTVIALSAAVAVVVFGVAQWKEVARNTDWGVLMLFGGGIS
FT                   LSTLLKTSGASEALGQQVAATFSGAPAFLVILIVAAFIIFLTEFTSNTASAALLVPIFS
FT                   GIAMQMGLPEQVLVFVIGIAASCAFMLPVATPPNAIVFGTGLIKQREMMNVGILLNILC
FT                   VVLVALWAYAVLM"
FT   gene            complement(444417..444779)
FT                   /locus_tag="NGK_0537"
FT   CDS_pept        complement(444417..444779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0537"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29228"
FT                   /db_xref="GOA:B4RK76"
FT                   /db_xref="InterPro:IPR006976"
FT                   /db_xref="UniProtKB/TrEMBL:B4RK76"
FT                   /protein_id="ACF29228.1"
FT                   /translation="MKLPRNRFSLLSALWFAGGIYSLLFKAADTAPPPFPHFDKAAHLA
FT                   LFFAQILLLAKAFKTGKLPIPYRSLIAFAFCFAVGSECAQAWFTATRTGSLGDVLADLT
FT                   GAALALFAARSACRPD"
FT   gene            complement(444776..444982)
FT                   /locus_tag="NGK_0536"
FT   CDS_pept        complement(444776..444982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0536"
FT                   /product="Putative ring dioxygenase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29227"
FT                   /db_xref="GOA:B4RK77"
FT                   /db_xref="UniProtKB/TrEMBL:B4RK77"
FT                   /protein_id="ACF29227.1"
FT                   /translation="MTELKQLIQTESIPVIEETLDFLLYECSIDDAPSAEEVAQWRDIL
FT                   AARGGKFLRLSKICQTWLDEEAA"
FT   gene            complement(445043..445621)
FT                   /locus_tag="NGK_0538"
FT   CDS_pept        complement(445043..445621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0538"
FT                   /product="peptidyl-tRNA hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29229"
FT                   /db_xref="GOA:B4RK78"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4RK78"
FT                   /protein_id="ACF29229.1"
FT                   /translation="MSNTIKMVVGLGNPGKEYEQTRHNAGFWFLDELAWKWKASFKEEK
FT                   KFFGEVARAALPDGDVWLLKPATFMNRSGQAVAALAQFYKIKPEEILVVHDELDIPCGR
FT                   IKFKLGGGNGGHNGLKDIQAKLGTADYYRLRLGIGHPGDRNLVVGYVLNKPSAEHRRQI
FT                   DDAVAKSLQAVPDIISGKWEEATRFLHSK"
FT   gene            complement(445674..445952)
FT                   /locus_tag="NGK_0539"
FT   CDS_pept        complement(445674..445952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0539"
FT                   /product="Protein rnfH"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29230"
FT                   /db_xref="InterPro:IPR005346"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="InterPro:IPR037021"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4RK79"
FT                   /protein_id="ACF29230.1"
FT                   /translation="MLEIEIVYGLPDRQVLKTMQLAEGTTVRTAALQSGLDGIFENLNL
FT                   HSAPLGIFGKAVKDDTPLRDGDRIEVYRPLLIDPKEARRKRVQNQEE"
FT   gene            complement(445945..446382)
FT                   /locus_tag="NGK_0540"
FT   CDS_pept        complement(445945..446382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0540"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29231"
FT                   /db_xref="InterPro:IPR005031"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:B4RK80"
FT                   /protein_id="ACF29231.1"
FT                   /translation="MPVKKVEKNILVLHGADKMFELVDKVEDYPHFLPWYSKTEVIGRS
FT                   GNELKARLFMDYMRVRQSFATHNRNIPGREIRMELLEGPFKTLRGTWKFIDLGDDMCKI
FT                   EFNLEYDFSNAVLSALISPVFNHLSATLVEAFVKEADRRYA"
FT   gene            complement(446598..448565)
FT                   /locus_tag="NGK_0541"
FT   CDS_pept        complement(446598..448565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0541"
FT                   /product="cell division protein FtsH"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29232"
FT                   /db_xref="GOA:B4RK81"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:B4RK81"
FT                   /protein_id="ACF29232.1"
FT                   /translation="MGNTFKSILVWVALGIGLMAAFNALDGKKEDNGQIEYSQFIRQVN
FT                   NGEVSGVNIEGSVVSGYLIKGERTDKSTFFTNAPLDDNLIKTLLDKNVRVKVTPEEKPS
FT                   ALAALFYSLLPVLLLIGAWFYFMRMQTGGGGKGGAFSFGKSRARLLDKDANKVTFADVA
FT                   GCDEAKEEVQEIVDYLKAPNRYQSLGGRVPRGILLAGSPGTGKTLLAKAIAGEAGVPFF
FT                   SISGSDFVEMFVGVGASRVRDMFEQAKKNAPCIIFIDEIDAVGRQRGAGLGGGNDEREQ
FT                   TLNQLLVEMDGFESNQTVIVIAATNRPDVLDPALQRPGRFDRQVVVPLPDIRGREQILN
FT                   VHSKKVPLDESVDLLSLARGTPGFSGADLANLVNEAALFAGRRNKVKVDQSDFEDAKDK
FT                   IYMGPERRSMVMHEDEKRATAYHESGHAIVAESLPFTDPVHKVTIMPRGRALGLTWQLP
FT                   ERDRISMYKDQMLSQLSILFGGRIAEDIFVGRISTGASNDFERATQMAREMVTRYGMSD
FT                   KMGVMVYAENEGEVFLGRSVTRSQNISEKTQQDIDAEIRRILDEQYQVAYKILDENRDK
FT                   METMCKALMEWETIDRDQVLEIMAGKQPSPPKDYSHNLRENADAAEDNAPHAPTREKTE
FT                   APAPADTASTESGQQPENKA"
FT   gene            complement(448629..449249)
FT                   /locus_tag="NGK_0542"
FT   CDS_pept        complement(448629..449249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0542"
FT                   /product="putative cell division protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29233"
FT                   /db_xref="GOA:B4RK82"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR015507"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4RK82"
FT                   /protein_id="ACF29233.1"
FT                   /translation="MAVRSKSSKAWLHEHINDHYVHMAQKDGYRARAAYKLLEINEKDK
FT                   IIKPGTVLADLGSAPGSWSQVAAKLTGTSGTVFALDILPMEAIGGVSFIQGDFRENDVL
FT                   AQFETLLDNRPLDLVICDMAPNMSGNAVSDQARSFYLCELALDFASQHLKTGGSFLVKV
FT                   FQGAGYQEYMAAMREIFGTVQTRKPEASRNRSSEIYLLGKNKR"
FT   gene            449323..449643
FT                   /locus_tag="NGK_0543"
FT   CDS_pept        449323..449643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0543"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29234"
FT                   /db_xref="GOA:B4RK83"
FT                   /db_xref="InterPro:IPR001890"
FT                   /db_xref="InterPro:IPR017924"
FT                   /db_xref="InterPro:IPR035920"
FT                   /db_xref="UniProtKB/TrEMBL:B4RK83"
FT                   /protein_id="ACF29234.1"
FT                   /translation="MLHYPFYSNSRKMADTKLNTKEILELKARAHHLHPVVMVGQQGLT
FT                   DAVIKETDAALTAHELIKVRVFGDDRAERIEICNTLCEAVDAQPVRHIGKLLVLWRKNI
FT                   EA"
FT   gene            449653..449799
FT                   /locus_tag="NGK_0544"
FT   CDS_pept        449653..449799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0544"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29235"
FT                   /db_xref="UniProtKB/TrEMBL:B4RK84"
FT                   /protein_id="ACF29235.1"
FT                   /translation="MVVLLLFFQWAACCPSARHFGVPKPFPVKTDFDYRSMPSASCGGF
FT                   RMI"
FT   gene            449827..450828
FT                   /locus_tag="NGK_0545"
FT   CDS_pept        449827..450828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0545"
FT                   /product="delta-aminolevulinic acid dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29236"
FT                   /db_xref="GOA:B4RK85"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR030656"
FT                   /db_xref="UniProtKB/TrEMBL:B4RK85"
FT                   /protein_id="ACF29236.1"
FT                   /translation="MQFPYRNVPASRMRRMRRDDFSRRLMREHMLTADDLIYPVFVLEG
FT                   AAREEDVPSMPGVKRQSLDRLLFTAEEAVKLGIPMLALFPVVTANKTGRAQEAYNPEGL
FT                   VPSTVRALRERFPELGIMTDVALDPYTVHGQDGLTDENGYVMNDETVEVLVKQALCHAE
FT                   AGTQVVAPSDMMDGRIGAIREALEDAGHIHTRIMAYSAKYASAFYGPFRDAVGSSGNLG
FT                   KADKKTYQMDPANTDEALHEVALDIQEGADMVMVKPGLPYLDVVRRVKDEFGVPTYAYQ
FT                   VSGEYAMLQAAVANGWLDGGKVVLESLLAFKRAGADGILTYYAIEAAKMLKR"
FT   gene            complement(450892..452049)
FT                   /locus_tag="NGK_0546"
FT   CDS_pept        complement(450892..452049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0546"
FT                   /product="putative lyase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29237"
FT                   /db_xref="GOA:B4RK86"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B4RK86"
FT                   /protein_id="ACF29237.1"
FT                   /translation="MKFPTRAIHSGYDCDEHNRALMPPIYQNSMFALHEIGENVPYRYS
FT                   RLSNPTRQILEDTVADLEHGAAGFAFSSGMAGIDAVWRTFLRPGDTIVAVADIYGGAYD
FT                   LLVDVYQKWGVNVVFADLGNPDNLDELLKAHNVKLVWLEMPSNPLLRLVDIKALAAKAK
FT                   AADALVGIDNTFATPYLQQPLDMGCDFAFHSATKYLCGHSDVLMGIVVAKTKELAQPLH
FT                   DMMVHTGAIAGPTDCWLVLRGIKTLALRMEAHCKNALEIARRLEAHPAIEKVFHPGLPS
FT                   HEHYALAQAQMPKGIGGVVTVYLKNDTREAANSVIKNMKLVKMTSSLGGVESLVNHCYS
FT                   QSHSGVPHNVKMEMGIRVGLLRFSIGIEDVDDIWNDISAALDTTL"
FT   gene            452153..453025
FT                   /locus_tag="NGK_0547"
FT   CDS_pept        452153..453025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0547"
FT                   /product="UPF0343 protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29238"
FT                   /db_xref="GOA:B4RK87"
FT                   /db_xref="InterPro:IPR003801"
FT                   /db_xref="InterPro:IPR022838"
FT                   /db_xref="UniProtKB/TrEMBL:B4RK87"
FT                   /protein_id="ACF29238.1"
FT                   /translation="MQAGGRQRFFRRHLPAIQYTHLNNYLNIKDKQRMNAIADVQSSRD
FT                   LRNLPINQVGIKDLRFPITLKTAEGTQSTVARLTMTVYLPAEQKGTHMSRFVALMEQHT
FT                   EVLDFAQLHRLTAEMVALLDSRAGKISVSFPFFRKKTAPVSGIRSLLDYDVSLTGEMKD
FT                   GAYGHSMKVMIPVTSLCPCSKEISQYGAHNQRSHVTVSLTSDAEVGIEEVIDYVETQAS
FT                   CQLYGLLKRPDEKYVTEKAYENPKFVEDMVRDVATSLIADKRIKSFVVESENFESIHNH
FT                   SAYAYIAYP"
FT   gene            453222..453887
FT                   /locus_tag="NGK_0548"
FT   CDS_pept        453222..453887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0548"
FT                   /product="putative oxidoreductase, NAD(P)H-flavin"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29239"
FT                   /db_xref="GOA:B4RK88"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="InterPro:IPR033878"
FT                   /db_xref="UniProtKB/TrEMBL:B4RK88"
FT                   /protein_id="ACF29239.1"
FT                   /translation="MTVLSKEQVLSAFKNRKSCRHYDAARKISAEDFQFILELGRLSPS
FT                   SVGSEPWRFVVVQNPEIRQAIKLFSWGMADALDTASHLVVFLAKKNARFDSPFMLESLK
FT                   RRGVTEPDAVEKSLARYQAFQADDIKILDDSRALFDWCCRHTYIALANMMTGAAMAGID
FT                   SCPVEGFNYADMERVLSGQFGLFDAAEWGVSVAATFGYRVQEIVTKARRPLEETVIWA"
FT   gene            complement(453942..454700)
FT                   /locus_tag="NGK_0549"
FT   CDS_pept        complement(453942..454700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0549"
FT                   /product="RNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29240"
FT                   /db_xref="GOA:B4RK89"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:B4RK89"
FT                   /protein_id="ACF29240.1"
FT                   /translation="MNSKISSDHTEDTIRLSKRMAQLGLCSRREADGHIEQGWVTVNGK
FT                   TAVLGQKVSPADRIELNKKAHEQQAARITILLNKPVGYVSAQAEKGYKSAAELITPENC
FT                   WEGDTSRISFDPKHKIGLAPAGRLDIDSVGLLVLTQDGRIAKQLIGENSGSEKEYLVRV
FT                   RGKLDEKGLALLNHGLSLDGDKLRPAKVEWQNEDQLRFVLKQGKKRQIRRMCELVGLRV
FT                   VGLKRIRMGKVKLGRLPPGKWRYLAPGESF"
FT   gene            complement(454725..455615)
FT                   /locus_tag="NGK_0550"
FT   CDS_pept        complement(454725..455615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0550"
FT                   /product="inorganic polyphosphate/ATP-NAD kinase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29241"
FT                   /db_xref="GOA:B4RK90"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017437"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4RK90"
FT                   /protein_id="ACF29241.1"
FT                   /translation="MNSPFHNIGIVTRPNTPDIQDTAHTLITFLKQHGFTVYLDEVGVR
FT                   ECCIYTQDTDGCHIVNKTELGQYCDLVAVLGGDGTFLSAAREITPRAVPIIGINQGHLG
FT                   FLTQIPREYMTDKLLPVLEGKYLAEERILIEAALIREGKTAERALALNDAVLSRGGAGQ
FT                   MIEFEVFVNQEFVYTQRSDGLIVSTPTGSTAYSLAAGGPIMQAGLHAFTLVPICPQSMT
FT                   NRPIAIPDTSEIEILVTQGGDARVHFDGQSFIDVQNLDRIIIRRYHNPLRILHPTDYQY
FT                   FKTLRQKLHWGEQLV"
FT   gene            complement(455635..456201)
FT                   /locus_tag="NGK_0551"
FT   CDS_pept        complement(455635..456201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0551"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29242"
FT                   /db_xref="UniProtKB/TrEMBL:B4RK91"
FT                   /protein_id="ACF29242.1"
FT                   /translation="MSALLPIINRLILQSPDSRSELTSFAGKTLTLNIAGLKLAGRITE
FT                   DGLLSAGNGFADTEITFRNSAIRKILQGGEPGAGDIRLEGDLILGIAVLSLLGSLRSRA
FT                   SDELARIFGTQAGIGSRATDIGHGIKQIGRNIAEQIGGFSREPESANTGNEALADCLDE
FT                   ISRLRDGVERLNERLDRLERDIWID"
FT   gene            complement(456251..457027)
FT                   /locus_tag="NGK_0552"
FT   CDS_pept        complement(456251..457027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0552"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29243"
FT                   /db_xref="GOA:B4RK92"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B4RK92"
FT                   /protein_id="ACF29243.1"
FT                   /translation="MRAVPPPHISITGLGYLGLPLAQKFYRHGSRVAAIKRSLTSDDIN
FT                   LPIHLDTFDLNRTDTFQTALWRHHADKPVWFFLLPPSFLAHYADTVKQWAELARACNVQ
FT                   HLIFTSSTSVYGDKARECNETAAPDPQTESARQILAAEQHLLDNGVPNIDILRLGGLYC
FT                   AERHPVSRLVQKQNIQGGNRPVNIVHRDIAVENLFQTASNPGGRRLKNIIEPRHPTRRE
FT                   FYTEEAAKLGLPAPDFSPDDSVGKIIRTVCDNGLSL"
FT   gene            complement(457082..457726)
FT                   /locus_tag="NGK_0553"
FT   CDS_pept        complement(457082..457726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0553"
FT                   /product="putative TetR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29244"
FT                   /db_xref="GOA:B4RK93"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025722"
FT                   /db_xref="UniProtKB/TrEMBL:B4RK93"
FT                   /protein_id="ACF29244.1"
FT                   /translation="MTRIAKTNTYTRIIDASLALFNEEGERNISTNHIAAHLGISPGNL
FT                   YYHFRNKDEIIVQLFKRYSEALLEYLNEAVLPSDVEDSINYMAGIYDVMWEYRFLFSDV
FT                   NTLLARSAELLGEHNTFTQAKVSPLLVKLLTQLNGLNVINADQTAMNDLAVNMWMVTKY
FT                   WFDFDSSLRGRTKLTEDSKARGVRRTLSLLRPYLLPEHRAEYDRKISNGNP"
FT   gene            complement(457744..458784)
FT                   /locus_tag="NGK_0554"
FT   CDS_pept        complement(457744..458784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0554"
FT                   /product="UDP-N-acetylenolpyruvoylglucosamine reductase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29245"
FT                   /db_xref="GOA:B4RK94"
FT                   /db_xref="InterPro:IPR003170"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR011601"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036635"
FT                   /db_xref="UniProtKB/TrEMBL:B4RK94"
FT                   /protein_id="ACF29245.1"
FT                   /translation="MQPIRYRTDLTPYNTFGLHAQARAFIALKHADELRDIVRLPEFDR
FT                   DTVLWLGGGSNILLMQDYDGLVVHMENKGIREIARSDGMVLIEAQAGEIWHDFVLHTVA
FT                   LGLSGLENLSLIPGTVGASPVQNIGAYGVEAKDVIHSVRCFDLDTETFVTLSNADCRFA
FT                   YRESLFKQEGKGRYVIVSVVFALKTHFVPNLGYGDLAAKVAELSAGREATAKDVSDAVS
FT                   AIRNSKLPDPKVLGNVGSFFKNPVVSAEKAATLLQRHPDMPRYPQPDGSVKLAAGWLID
FT                   QCRLKGFQIGGAAVHDRQALVLANKNNASSDDIWKLAQHVCNTVFTRFQVELHAEPNWL
FT                   PASFSL"
FT   gene            complement(458828..460207)
FT                   /locus_tag="NGK_0555"
FT   CDS_pept        complement(458828..460207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0555"
FT                   /product="multidrug efflux protein NorA"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29246"
FT                   /db_xref="GOA:B4RK95"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:B4RK95"
FT                   /protein_id="ACF29246.1"
FT                   /translation="MLLDLDRFSFSVFLKEIRLLTALALPMLLAQVAQVGIGFVDTVMA
FT                   GGAGKEDLAAVALGSSAFATVYITFMGIMAALNPMIAQLYGAGKTGEAGETGRQGIWFG
FT                   LILGIFGMILMWAAITPFRNWLTLSDYVEGTMAQYMLFTSLAMPAAMVHRALHAYASSL
FT                   NRPRLIMLVSFAAFVLNVPLNYIFVYGKFGMPALGGAGCGVATMAVFWFSALALWIYIA
FT                   KEKFFRPFGLTAKFGKPDWAVFKQIWKIGAPIGLSYFLEASAFSFIVFLIAPFGEDYVA
FT                   AQQVGISLSGILYMIPQSVGSAGTVRIGFSLGRREFSRARYISGVSLVSGWVLAVITVL
FT                   SLVLFRSPLASMYNDDPAVLSIASTVLLFAGLFQPADFTQCIASYALRGYKVTKVPMFI
FT                   HAAAFWGCGLLPGYLLAYRFDMGIYGFWTALIASLTIAAVALVWCLEKYSMELVKSHEA
FT                   V"
FT   gene            complement(460374..460568)
FT                   /locus_tag="NGK_0556"
FT   CDS_pept        complement(460374..460568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0556"
FT                   /product="transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29247"
FT                   /db_xref="UniProtKB/TrEMBL:B4RK96"
FT                   /protein_id="ACF29247.1"
FT                   /translation="MFRKLPCLHENLPSVLSCKHKRLPDPQSDGIFAATHHAAVKTAML
FT                   PSDSESEQPLSDGSMPSSR"
FT   gene            460542..461693
FT                   /locus_tag="NGK_0557"
FT   CDS_pept        460542..461693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0557"
FT                   /product="ATP phosphoribosyltransferase regulatory subunit"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29248"
FT                   /db_xref="GOA:B4RK97"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR004517"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4RK97"
FT                   /protein_id="ACF29248.1"
FT                   /translation="MQTWQLPEHIADVLPTNARQLESAREQLLALFRVHGYELVQPPLM
FT                   EYAHSLLTHIDAGLSLKTILVTDRLSGRQLGIRADITPQVARIDAHLLSANQGINRLCY
FT                   AGPVLHAQPDGLPNMREPLQAGAEMYGFADIRGDIELIDLMLKSMKIADMGKVLLSLGH
FT                   IGIFRALSDAAHLDAGQSATLLALMQDKDTGSVEAQVKAWKLDGMWAKAFSLLPRLYGG
FT                   REVLSDARGRLPDLSAVGGALDELQAVCDAFPDNEIHIDLSELRVDNYHTGLLYAAYAA
FT                   DFHDAVARGGRYDGLGGYFGRARPATGFSFDLRSFIGRLPAVERQPAVLVDAEDAEAAR
FT                   EAVEALREQGQCVVIDYGIGHNVSEELAGRLKKTDGVWQIVKR"
FT   gene            461792..463096
FT                   /locus_tag="NGK_0558"
FT   CDS_pept        461792..463096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0558"
FT                   /product="adenylosuccinate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29249"
FT                   /db_xref="GOA:B4RK98"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4RK98"
FT                   /protein_id="ACF29249.1"
FT                   /translation="MAMAKNVVVIGAQWGDEGKGKIVDWLAEEAGGVVRFQGGHNAGHT
FT                   LVVGGKKTILRLIPSGILHEGLDCFIGSGVVVSPEALLGEIDELNAAGVKNVEGRLKIA
FT                   PTCPLILPYHIALDQAREASRGKGKIGTTGRGIGPAYEDKVARRAIRAADLLHPEKLRE
FT                   KLDAVLAYYNVQLQYLHNAGPVKAEDVMAVIEKVAPRIAPMIADVSRVLNEKNKNGEKL
FT                   LFEGAQGALLDIDYGTYPFVTSSNCLAGAASAGAGVGPQMLDYVLGIVKAYTTRVGSGP
FT                   FPTELFDEVGAGLAERGHEFGSVTGRARRCGWFDAAALKRSIQINGISGMCITKLDVMD
FT                   GVETINICVGYELPGGGKTDILPCGSDAVETCKPIYETMPGWRESTVGVKSYDALPANA
FT                   KAYLKRIEEVCGAPVAIVSTGPDREETIVLHHPFA"
FT   gene            463207..463335
FT                   /locus_tag="NGK_0559"
FT   CDS_pept        463207..463335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0559"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29250"
FT                   /db_xref="UniProtKB/TrEMBL:B4RK99"
FT                   /protein_id="ACF29250.1"
FT                   /translation="MRRIRCGNGYGWCRYGNLMFSVGIYEKTVLLVRTVFCRFKSV"
FT   gene            complement(463332..464171)
FT                   /locus_tag="NGK_0560"
FT   CDS_pept        complement(463332..464171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0560"
FT                   /product="heat shock protein HtpX"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29251"
FT                   /db_xref="GOA:B4RKA0"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR022919"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4RKA0"
FT                   /protein_id="ACF29251.1"
FT                   /translation="MKRIFLFLATNIAVLVVINIVLAVLGINSRGGAGSLLAYSAVVGF
FT                   TGSIISLLMSKFIAKQSVGAEVIDTPRTEEEAWLLNTVEAQARQWNLKTPEVAIYHSPE
FT                   PNAFATGASRNSSLIAVSTGLLDHMTRDEVEAVLAHEMAHVGNGDMVTLTLIQGVVNTF
FT                   VVFLSRIIANLIARNNDGSQSQGTYFLVSMVFQILFGFLASLIVMWFSRQREYRADAGA
FT                   AKLVGAPKMISALQRLKGNPVDLPEEMNAMGIAGDTRDSLLSTHPSLDNRIARLKSL"
FT   gene            complement(464168..464284)
FT                   /locus_tag="NGK_0561"
FT   CDS_pept        complement(464168..464284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0561"
FT                   /product="heat shock protein HtpX"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29252"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKA1"
FT                   /protein_id="ACF29252.1"
FT                   /translation="MQANVLHTFAEPDIHKAATFWDNPQSFKTSHPTKKEHP"
FT   gene            464386..465033
FT                   /locus_tag="NGK_0562"
FT   CDS_pept        464386..465033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0562"
FT                   /product="adenylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29253"
FT                   /db_xref="GOA:B4RKA2"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR007862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4RKA2"
FT                   /protein_id="ACF29253.1"
FT                   /translation="MKALLLGAPGAGKGTQAQFITAAFGIPQISTGDMLRAAIKAGTPL
FT                   GLEAKKIIDEGGLVRDDIIIGMVKERIAQDDCKNGFLFDGFPRTLAQAEAMVEAGVGLD
FT                   AVVEIDVSDSVIVDRMSGRRVHLASGRTYHVTYNPPKTEGKDDVTGEDLIQRDDDKEET
FT                   VKKRLAVYHEQTEVLVDFYSKLEGEHAPKYIKVDGTQAVEAVKAEVLGALGK"
FT   gene            465557..466297
FT                   /locus_tag="NGK_0563"
FT   CDS_pept        465557..466297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0563"
FT                   /product="orotidine 5'-phosphate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29254"
FT                   /db_xref="GOA:B4RKA3"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR014732"
FT                   /db_xref="InterPro:IPR018089"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4RKA3"
FT                   /protein_id="ACF29254.1"
FT                   /translation="MNPLITDFQTPQQRTPVIVALDFANEKDTLGFVRNLDPALCQIKI
FT                   GKELFTATGRSLAESLIHQGFKLFLDLKYHDIPHTVAQACKVAADMGVWMVDMHASGGR
FT                   RMMEAAAEAVAGYGTKPLLIGVTVLTSMEQSDLAEIGLNTAPEEQVIRLAKLAQSSGLD
FT                   GVVCSAQEAAPLRRELGRDFVLVTPGIRLDVAGNNDDQRRIMTPAEALAAGSTYLVMGR
FT                   PVTRAADPVAVLREVNRVANLEAN"
FT   gene            466353..467315
FT                   /locus_tag="NGK_0564"
FT   CDS_pept        466353..467315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0564"
FT                   /product="putative sugar kinase / ADP-heptose synthase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29255"
FT                   /db_xref="GOA:B4RKA4"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011913"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKA4"
FT                   /protein_id="ACF29255.1"
FT                   /translation="MPAKFQQETLKSRFAQAKVLVVGDVMLDRYWFGDVSRISPEAPVP
FT                   VAKIGRIDQRAGGAANVARNIASLGGRAGLLSVTGDDEAAAALDALMVQDGVASYLMRD
FT                   KQIATTVKLRVVARNQQLIRLDFEEHPNREVLEQIKRKYREILPEYDAIIFSDYGKGGL
FT                   SHISDMIDWAKHVGKTVLIDPKGDDYEKYVGATLITPNCAELKEVVGSWKNEGDLTEKA
FT                   QNLRRHLDLTAVLLTRSEEGMTLFSEGEPIYQPTRAQEVYDVSGAGDTVIAGMGLGLAA
FT                   GCTMPEAMYLANTAAGVVVAKLGTAVCSFAELVEALDGQ"
FT   gene            467331..468383
FT                   /locus_tag="NGK_0565"
FT   CDS_pept        467331..468383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0565"
FT                   /product="ADP-L-glycero-D-manno-heptose-6-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29256"
FT                   /db_xref="GOA:B4RKA5"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR011912"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKA5"
FT                   /protein_id="ACF29256.1"
FT                   /translation="MTIQCRLKPSKQRKPNMTIIVTGAAGFIGSNIVKALNQRGITDIV
FT                   AVDNLTKGEKFKNLAECEIAHYLDKHEFIRQVREHILPYQNIEAVFHQGACSDTMNHDG
FT                   LYMMENNYQYTLDLLDWCQDERIPFLYASSAAVYGKGEIFREERELEKPLNVYGYSKFL
FT                   FDQVLRRRMKEGLTAQVVGFRYFNVYGQHEQHKGCMASVAFHHFHQYREHGYVNLFGSN
FT                   DGYGNGEQTRDFVSVEDVAKINLYFFDHPELSGIYNLGTGRSQQFNELAAATVNACRAA
FT                   EGKSELSLKELVEEELIRYIPFPDALKGKYQGFTQADITKLREAGYKEEFFDVKAGVNR
FT                   YVKWMLENLA"
FT   gene            468458..470002
FT                   /locus_tag="NGK_0566"
FT   CDS_pept        468458..470002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0566"
FT                   /product="Type I restriction enzyme EcoR124II M protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29257"
FT                   /db_xref="GOA:B4RKA6"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR004546"
FT                   /db_xref="InterPro:IPR022749"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038333"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKA6"
FT                   /protein_id="ACF29257.1"
FT                   /translation="MMTEMQQRAQLHRQIWKIADEVRGAVDGWDFKQYVLGTLFYRFIS
FT                   ENFTDYMQAGDSSIDYAAMPDSIITPEIKDDAVKVKGYFIYPGQLFCNIAAEAHQNEEL
FT                   NTKLKEIFTAIESSASGYPSEQGIKGLFDDFDTTSSRLGSTVADKNKRLAAVLKGVAEL
FT                   DFGNFEDHRIDLFGDAYEYLISNYAANAGKSGGEFFTPQSVSKLIARLAVHGQEKVNKI
FT                   YDPACGSGSLLLQAKKQFDEHIIEEGFFGQEINHTTYNLARMNMFLHNVNYNKFHIELG
FT                   DTLTNPKLKDSKPFDAVVSNPPYSIDWIGSDDPTLINDDRFAPAGVLAPKSKADFAFIL
FT                   HALNYLSGRGRAAIVSFPGIFYRGGAEQKIRQYLVEGNYVETVIALAPNLFYGTCIAVN
FT                   ILVLSKHKDNTDIQFIDAGGFFKKETNNNVLTEEHIAEIVKLFADKADVPHIAQNAAQQ
FT                   TVKDNGYNLAVSSYVEAEDTREVIDIRQLNAEISETVAKIERLRREIDEVIAEIEA"
FT   gene            470118..470969
FT                   /locus_tag="NGK_0567"
FT   CDS_pept        470118..470969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0567"
FT                   /product="DinD"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29258"
FT                   /db_xref="InterPro:IPR003497"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKA7"
FT                   /protein_id="ACF29258.1"
FT                   /translation="MTTENNAFENAKHIDETGNEYWSARTLQQILEYSEWRNFQRAIDK
FT                   AITACETSGNDKNHHFVETNKMIALGKGGQREVADYRLSRYACYLIVQNGDPSKSVIAA
FT                   GQTYFAVQARRQELQDEAAFRSLGEDKQRLLLCRQLREHNTDLAAAAKDAGVEKPVEYA
FT                   VFQNHGYRGLYGGLDKQGIHSRKGLKKSQRILDHMNASEPAANLFRATQTEEKLRRKNI
FT                   QGKTQANRVHFEVGQKVRQTIEELGGIMPENQPVPEKSIKQLENEEQKRLAATEQHQNG
FT                   KK"
FT   gene            complement(470981..471133)
FT                   /locus_tag="NGK_0568"
FT   CDS_pept        complement(470981..471133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0568"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29259"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKA8"
FT                   /protein_id="ACF29259.1"
FT                   /translation="MFSVSFPLRRDMGRLRGGFQPAMSVCRYFCGLKPVLLSGCLKSCA
FT                   GCFFR"
FT   gene            471136..471327
FT                   /locus_tag="NGK_0569"
FT   CDS_pept        471136..471327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0569"
FT                   /product="Type i restriction enzyme EcoR124II specificity
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29260"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKA9"
FT                   /protein_id="ACF29260.1"
FT                   /translation="MDMQSKAKKLIEMIQTAPVEWKPLGEVLVRTKGTKITAGQMKEMH
FT                   KDNAPLKIFAGGKTFAFS"
FT   gene            complement(471459..471596)
FT                   /locus_tag="NGK_0570"
FT   CDS_pept        complement(471459..471596)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0570"
FT                   /product="Sensor protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29261"
FT                   /db_xref="GOA:B4RKB0"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKB0"
FT                   /protein_id="ACF29261.1"
FT                   /translation="MGWGFYSYLYLVLLFVAFAFLIRYYENSFLVFLRNNKHILYKYVY
FT                   "
FT   gene            471599..471751
FT                   /locus_tag="NGK_0571"
FT   CDS_pept        471599..471751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0571"
FT                   /product="putative type I specificity subunit HsdS"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29262"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKB1"
FT                   /protein_id="ACF29262.1"
FT                   /translation="METQQKIVKILDKFTELEATLEAELALRKRQYRYYRDLLLDFDNQ
FT                   IGGDS"
FT   gene            471723..472346
FT                   /locus_tag="NGK_0572"
FT   CDS_pept        471723..472346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0572"
FT                   /product="Type I restriction-modification system
FT                   specificity determinant"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29263"
FT                   /db_xref="GOA:B4RKB2"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKB2"
FT                   /protein_id="ACF29263.1"
FT                   /translation="MTIKSGGIADGYQCRLKNVVWKTLGEVAEYSKNRICSDKLNEHNY
FT                   VGVDNLLQNREGKKLSGYVPSEGKMTEYIVNDILIGNIRPYLKKIWQADCTGGTNGDVL
FT                   VIRVTDEKVNPKYLYQVLADDKFFAFNMKHAKGAKMPRGSKAAIMQYKIPIPPLPEQEK
FT                   IVAILGKFDTLTHSVSEGLPHEIALRRKQYEYYREQLLAFPKAA"
FT   gene            472577..475675
FT                   /locus_tag="NGK_0573"
FT   CDS_pept        472577..475675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0573"
FT                   /product="putative type I site-specific deoxyribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29264"
FT                   /db_xref="GOA:B4RKB3"
FT                   /db_xref="InterPro:IPR004473"
FT                   /db_xref="InterPro:IPR007409"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR022625"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040980"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKB3"
FT                   /protein_id="ACF29264.1"
FT                   /translation="MNLETKPIAETPNFIVLDQYEKIEQSGSYQSENRLEAELIADLQN
FT                   QGYEYRKDLNSQSRLLENLRAQLQRLNDVAFSDGEWARFLTEYLDRPAENITDKTRKIH
FT                   DDHIYDFAFDDGRLKNIYLLDKKNLARNHVQLINQFEQTGTHANRYDVTVLVNGLPLVQ
FT                   IELKKRGVVVREAFNQVHRYSKESFNSENSLFKFLQIFVISNGTDTRYFANTTKRDKNS
FT                   FDFTMNWARSDNHPIKDLKDFTATFLQKSVLLSVLLHYSVFDANDTLLIMRPYQIAAAE
FT                   RILWKINSSAQAKNWSGPESGGYVWHTTGSGKTLTGFKAARLATESAFIDKVFFVVDRK
FT                   DLDYQTMKEYQRFSPDSVNGSESTAGLKRNLEKDGNKIIVTTIQKLNNLMKSEDNLPVY
FT                   HRQVVFIFDECHRSQFGEAQKNLKKKFKKFCQFGFTGTPIFPENALGAETTAGVFGREL
FT                   HSYVITDAIRDEKVLKFKVDYNDVRPQFKAVEAEQDEKELSAAENRQALLHPERIREIT
FT                   QYILSRFRQKTHRLNAGGKGFNAMFAVSSVDAAKCYYEAFKTQQAGSLHPLKTATIFSF
FT                   AANEEQNAVGEIVDENFEPEAMDSSAKEFLQAVINDYNACFKTNFGTDSKAFQNYYRDL
FT                   AKRVKNREVDLLIVVGMFLTGFDAPTLNTLFVDKNLRYHGLMQAFSRTNRIYDATKTFG
FT                   NIVCFRDLEQATIDAITLFGDKNTKNVVLEKSYEEYMNGYTDSQTGEARRGYLDVAKEL
FT                   HERFPDPDKIETEKDKKDFAKLFGEYLRAENVLQNYDEFAALRELQNVDAADEDAMKAF
FT                   QEKYYLSDEDVQEMRKVPMPSERAVQDYRSAYNDIRDWLRRQKAGEQKEQSKIDWDDVV
FT                   FEVDLLKSQEINLDYILQLVFEHHKKIKGKAELVEEIRRIIRASIGHRAKEGLIVDFIN
FT                   DTDLDKVPDVPAILETFYTYAQEVMRHEAAGLIAAEGLNETAAKRYLTGSLKRGYASEN
FT                   GTELTETLPKMSPLNPQYLTKKQSVFQKIAAFVEKFAGIGADI"
FT   gene            complement(475715..478006)
FT                   /locus_tag="NGK_0574"
FT   CDS_pept        complement(475715..478006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0574"
FT                   /product="ClpA"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29265"
FT                   /db_xref="GOA:B4RKB4"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR013461"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKB4"
FT                   /protein_id="ACF29265.1"
FT                   /translation="MLAPELEQILQQLYREARKAHYEFISLEHLLLVLIEEDAAVPNVL
FT                   KLCGADLKAVSEQLAASVAENTPLIPDHLLDTVETRPTLGFQRVIQRAMVHTQSAGKGL
FT                   AEPLDVLVALMSETDSHAVYFLGLQSVTRFEVLRCIAHGSPDEDEDDGNYFSDGMDDDN
FT                   ENRTKPGKNPLSAYTVNLNAEVKAGRIDPLIGRKHEMERLVQILCRRRKNNPLLVGEAG
FT                   VGKTALADGLAHQIVNDDIPDALKEAEVYALDMGSLLAGTKYRGDFEARVKSVLKQLEK
FT                   IPHAILFIDEIHTIIGAGSTGGGTMDASNLLKPALAKGSLRCIGATTYDEYRTIFDKDH
FT                   ALSRRFQKIDVVEPTVAETVQILRGLKPMFEAFHQVRYTQGALEAAAELSARYINERFL
FT                   PDKAIDVMDEAGAAQRILPKSKQKKVIGKAQIETVIAKVARIPEKTVSHDDKQVLQFLG
FT                   RDLNNMVYGQEDAIDALVSAVKMSRSGLGLPDKPIGSFLFSGPTGVGKTEVAKQLAYSM
FT                   GVPLQRFDMSEYMERHAVSRLIGAPPGYVGFEQGGLLTEAVNKQPHCVLLLDEIEKAHP
FT                   DIFNVLLQVMDAGKLTDNNGKSADFRNVILIMTTNAGAESLSRPSLGFTAKRERGDEMQ
FT                   AINKLFTPEFRNRLDAIIPFAPLSEPIIVKVVDKFLLQLEHRLLDKKVEAEFTPALRKY
FT                   LAEKGFDPQMGARPMHRLIQEKIRKPLADELLFGKLADGGFVRIDWDAAKEEAVLKFKK
FT                   SKVKIKTASA"
FT   gene            complement(478008..478421)
FT                   /locus_tag="NGK_0575"
FT   CDS_pept        complement(478008..478421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0575"
FT                   /product="ATP-dependent Clp protease adapter protein clpS"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29266"
FT                   /db_xref="GOA:B4RKB5"
FT                   /db_xref="InterPro:IPR003769"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR022935"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKB5"
FT                   /protein_id="ACF29266.1"
FT                   /translation="MLRQNVKLCFQKSGKIGESTENTTKMPSERGFQMGHAMTAQHQSD
FT                   TLLHRLNTLPPKRYGVFLLNDDYTTMEFVVEILTEIFMLGQEQAVAVMLSVHHEGKGLC
FT                   GTYTRDIAQTKQQQVMQRAKAEGHPLQCIVEEI"
FT   gene            478555..478758
FT                   /locus_tag="NGK_0576"
FT   CDS_pept        478555..478758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0576"
FT                   /product="cold-shock domain family protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29267"
FT                   /db_xref="GOA:B4RKB6"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKB6"
FT                   /protein_id="ACF29267.1"
FT                   /translation="MATGIVKWFNDAKGFGFITPDEGGEDLFAHFSAINMEGFKTLKEG
FT                   QRVSFDVTTGPKGKQAANIQAA"
FT   gene            complement(479057..480388)
FT                   /locus_tag="NGK_0577"
FT   CDS_pept        complement(479057..480388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0577"
FT                   /product="PmbA protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29268"
FT                   /db_xref="GOA:B4RKB7"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKB7"
FT                   /protein_id="ACF29268.1"
FT                   /translation="MLFNHTASELLDLCRRTLDLAKAAGATAAEADFSESLGQSVSVRL
FT                   GEIEQIEFQQDKSLDITVYVGKRKGRAGTADFSEQALRDTVRAAADIARHTAEDGCAGL
FT                   ADPELMAQHIGDPDLYHEWDLDTEAAVGLAKQCEQAALDTDSRIENSEGAAVQTGHYQY
FT                   VYGNTHGFAAHRQSTHHSISCSVVAADENGMQRDYWYDSACRHPDMDSPETIGQTAARR
FT                   TLRRLGSRSIPTGSYPVLFDTTVSGGLIGHLVGTLSGGALYRQSSFLIDSIGKKVLPDF
FT                   LNLREEPHIPRSFRSSYFDAEGVATAPRFVIQNGIVEGYFLGSYSARKLGMQTTGNAGG
FT                   AHNLYLNHTHETQSDLLKEMGTGLLVTELMGQGANTITGDYSRGAAGFWVENGVIAYPV
FT                   HEITVAGRLQDMYRDIVGVADDALRRSSNKIGSILIAGMTVAGS"
FT   gene            480458..481048
FT                   /locus_tag="NGK_0578"
FT   CDS_pept        480458..481048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0578"
FT                   /product="UPF0307 protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29269"
FT                   /db_xref="InterPro:IPR006839"
FT                   /db_xref="InterPro:IPR023153"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKB8"
FT                   /protein_id="ACF29269.1"
FT                   /translation="MQGVRCKKPSERGGILLKYAIGKNSRIKMFEQEDEWISKTQMKKQ
FT                   MNGLQDLGMELTRLSNDTLKKIGLDEDLYEAVVTYKKITSNGALKRQAQFIGRLMRDTD
FT                   PAPIEAFLAKLRGDDAAHNAFLQRVEQARVRLLADEGALTQFMSDFPNADAGRLRTLVR
FT                   NTKKEQEQDKPPKNFRALFQELKTVMENGGAEI"
FT   gene            481083..481808
FT                   /locus_tag="NGK_0579"
FT   CDS_pept        481083..481808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0579"
FT                   /product="putative thiosulphate sulphur transferase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29270"
FT                   /db_xref="GOA:B4RKB9"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKB9"
FT                   /protein_id="ACF29270.1"
FT                   /translation="MEDKMLFRKTTAAVLAATLILNGCTMMLRGMNNPVSQTITRKHVD
FT                   KDQIRAFGVVAEDNAQLEKGSLVMMGGKYWFAVNPEDSAKLTGLLKAGLDKPFQIVEDT
FT                   PSYARHQALPVKFEAPGSQNFSTGGLCLRYDTGRPDDIAKLKQLEFKAVKLDNRTIYTR
FT                   CVSAKGKYYATPQKLNADYHFEQSVPADIYYTVTEKHTDKSKLFGNILYTPPLLILDAA
FT                   AAVLVLPMALIAAANSSDK"
FT   gene            481877..483577
FT                   /locus_tag="NGK_0580"
FT   CDS_pept        481877..483577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0580"
FT                   /product="RecJ"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29271"
FT                   /db_xref="GOA:B4RKC0"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR004610"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="InterPro:IPR041122"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKC0"
FT                   /protein_id="ACF29271.1"
FT                   /translation="MSVKIQTRPVNTDVFNHLLAAGADPLIARLCASRGVQSPAELDDK
FT                   LASLLPYQSLTNCEAAAGRLADAVERKEKILIVADYDADGATACAVGLDGLAAMGAKVD
FT                   FLVPNRFEHGYGLTPELAEIAAAQGVDLLITVDNGIASIAGVARAQALGLDVIVTDHHL
FT                   PADTVPDCIIVNPNQKGCGFPSKSLAGVGVIFYVLTALRAELRRRNYFSDGIKEPNLGG
FT                   LLDLVALGTVADVVPLDHNNRILVSQGLKRMRSGKMRPGIRALFEVARRDWRKAQPFDM
FT                   GFALGPRINAAGRLDDMSVGIACLLARDDSEAQELAARLNNLNIERREIEQSMLRDALN
FT                   AFPETLPSGQTTLVAYRDDFHQGVVGIVASRLKDRFYRPTIVFAPADNGEVRGSGRSIP
FT                   NLHLRDALDLVSKRHPDLILKFGGHAMAAGLSILEHNIPAFQTAFEEAVREMVCEDDLS
FT                   QTYITDGSLPACDITLEQAQNLACHVWGQGFAPPSFTDEFHVVRQQPLGAEGKHKKAWL
FT                   QKDGCEFEAMFWRCSEDIPEYIRTVYRPVANEWRDNLELQLYIDYWEAA"
FT   gene            complement(483697..483858)
FT                   /locus_tag="NGK_0581"
FT   CDS_pept        complement(483697..483858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0581"
FT                   /product="DEAD/DEAH box helicase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29272"
FT                   /db_xref="GOA:B4RKC1"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKC1"
FT                   /protein_id="ACF29272.1"
FT                   /translation="MPKTISKRRRNYAVRITPPSRRQRVIITDCPLKNQTLLLWRSLKF
FT                   DAPYILRP"
FT   gene            483935..485293
FT                   /locus_tag="NGK_0582"
FT   CDS_pept        483935..485293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0582"
FT                   /product="PcnB"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29273"
FT                   /db_xref="GOA:B4RKC2"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR010206"
FT                   /db_xref="InterPro:IPR025866"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKC2"
FT                   /protein_id="ACF29273.1"
FT                   /translation="MLKKWLNKMLPSGRSSKKAESKTVIPAERHNISAEMLSFAAENVI
FT                   RRLKGAGFQAYVVGGAVRDLLLGIEPKDFDVATDATPEQVHKLFRRSRIIGRRFQIVHV
FT                   MNGAEIIEVTTFRGGAKVHQNAHGRIMKDNTYGSIEEDAMRRDFTCNALYYDPEKEEIL
FT                   DFHNGIADVAARRLVMIGNAAERYQEDPVRILRAIRLSGKLGFELSEETAAPIAESICR
FT                   LKHEPVARLFDEIMKLLFSGHARECLKRLNGFDIPDIHPLLNALRVSDGIAGKMTALAL
FT                   KNTDERLRADKSVSVGFVLAALMWPELDRHWKSNLQQGLKPTPALSDAINTMRETVERG
FT                   WGVPQRFSATMREIWMFQPQFENRKGARPHKLFAQARFRAAYDFLLLRAETGNADRALA
FT                   EWWTAFQTASAEQRTEMTKNEAAARHEKNEGQAKKRRRRRRKPKPKVVGTDWE"
FT   gene            485466..485789
FT                   /locus_tag="NGK_0583"
FT   CDS_pept        485466..485789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0583"
FT                   /product="Periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29274"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKC3"
FT                   /protein_id="ACF29274.1"
FT                   /translation="MKKCILGILTACAAMPAFADRISDLEARLAQLEHRVAVLESGGNT
FT                   VKIDLFGSNSTMYVCSVTPFQKTFEASDRNEGVARQKVRQACNRETSAMFCGDEAIRCR
FT                   KFD"
FT   gene            complement(485894..486847)
FT                   /locus_tag="NGK_0584"
FT   CDS_pept        complement(485894..486847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0584"
FT                   /product="PhoH-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29275"
FT                   /db_xref="GOA:B4RKC4"
FT                   /db_xref="InterPro:IPR003714"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKC4"
FT                   /protein_id="ACF29275.1"
FT                   /translation="MTHTVHLHLEETDNPTLQRLCGSFDSNLDSLAKALDIHISRRFEH
FT                   FTFNGAFAHAGKRALLKLLETAQTRDLNDSIIRLAAVETQTEDAGHQEKNHEHAYYFRT
FT                   KRGSIGGRTPRQNGYIRALLDHDIVFGLGPAGTGKTYLAVAAAVDAMEKHQVERIILVR
FT                   PAVEAGEKLGFLPGDLTQKVDPYLRPLYDALYDLMGFDRVTKLIEKGLIEITPLAYMRG
FT                   RTLNGAYIILDEAQNTTPEQMKMFLTRIGFGAKAVITGDTSQIDLPKNIKSGLKDAREK
FT                   LHGVAGLYFHTFTGEDVVRHPLVQKIVEAYESAEHD"
FT   gene            complement(486873..487430)
FT                   /locus_tag="NGK_0585"
FT   CDS_pept        complement(486873..487430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0585"
FT                   /product="putative glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29276"
FT                   /db_xref="GOA:B4RKC5"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKC5"
FT                   /protein_id="ACF29276.1"
FT                   /translation="MFCTVSHLRRLKGHDVLLTAFARALAQCPQLRLNIGGSGQEEQRL
FT                   KQQAADLGIAHAVTFLGALQPEAILDLMRNSDAFILASRTETFGVVYIEALSQGLPVIA
FT                   IHCGGAESIVSDGNGYLVSVDDADVLAFLKIYEHHADFSAEQLRTDCLATFGEDAVIGR
FT                   LIAVFRQAARNTARKRPKNRLK"
FT   gene            complement(487458..487793)
FT                   /locus_tag="NGK_0587"
FT   CDS_pept        complement(487458..487793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0587"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29278"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKC6"
FT                   /protein_id="ACF29278.1"
FT                   /translation="MRAGLKAFKHYIRENGLPDLIHAHCMNYAGILAQKISEKYGIPYV
FT                   LTEHSSTITRGLIRHHQWQPMEKAAAPASARLAVSRHFAHVLQHKYGCEWQYLPNIPGG
FT                   IFKQTFE"
FT   gene            complement(487778..488080)
FT                   /locus_tag="NGK_0586"
FT   CDS_pept        complement(487778..488080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0586"
FT                   /product="RfaG protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29277"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKC7"
FT                   /protein_id="ACF29277.1"
FT                   /translation="MSEPLHVLVIPLWYPRSEQDVDGIFFQNQAQALQRKGIKTAILAP
FT                   MFRYLRKETASILTGPYGFARYRQSGLDIYAWRSMYFFPAFRLSTSTASAGCAPV"
FT   gene            488212..488916
FT                   /locus_tag="NGK_0588"
FT   CDS_pept        488212..488916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0588"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29279"
FT                   /db_xref="InterPro:IPR007497"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKC8"
FT                   /protein_id="ACF29279.1"
FT                   /translation="MLRSVLAASLLAVSFPAAAEALNYNIVEFSESAGIEVAQDTMSAR
FT                   FQVAAEGRDKNAVNAEFVKKFNNFTRKSKNGSFKTELVSRSAMPRYQYTNGRRIQTGWE
FT                   ERAEFKAEGRDFDALNRFIADVQTDASLEDTDFSVSRERRNEVIDQVSKDAVLRFKARA
FT                   EKLAGVLGASGYKIVKLNFGQIGSHIAGDGAVRAKMLRAMPMAASVNMKGTDSAAPGVE
FT                   EISISINGTVQF"
FT   gene            complement(488982..489548)
FT                   /locus_tag="NGK_0589"
FT   CDS_pept        complement(488982..489548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0589"
FT                   /product="deoxycytidine triphosphate deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29280"
FT                   /db_xref="GOA:B4RKC9"
FT                   /db_xref="InterPro:IPR011962"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4RKC9"
FT                   /protein_id="ACF29280.1"
FT                   /translation="MSIKSDKWIRRMSEEFGMIDPFEPNQIKEADGQRIISYGTSSYGY
FT                   DIRCANEFKIFTNINSTIVDPKNFDPKNFVTVEDDCCIIPPNSFALARTVEYFRIPRNV
FT                   LTVCLGKSTYARCGIIVNVTPFEPEWEGYVTLEFSNTTPLPAKIYAGEGVAQVLFFESD
FT                   EVCETSYKDRNGKYMGQTGVTLPKA"
FT   gene            complement(489643..489999)
FT                   /locus_tag="NGK_0590"
FT   CDS_pept        complement(489643..489999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0590"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29281"
FT                   /db_xref="InterPro:IPR003409"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKD0"
FT                   /protein_id="ACF29281.1"
FT                   /translation="MMFALPAQTAVLSPYQETGCTYEGGIGKDGLPSGKGIWRCRDGRG
FT                   YTGSFKNGKFDGQGVYTVAADREVFLEPFNSDSTKFRNMALSGTFKQGLAHGRFAASQN
FT                   GETLFYYEMRTRHD"
FT   gene            complement(490084..490983)
FT                   /locus_tag="NGK_0591"
FT   CDS_pept        complement(490084..490983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0591"
FT                   /product="recombination associated protein RdgC"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29282"
FT                   /db_xref="GOA:B4RKD1"
FT                   /db_xref="InterPro:IPR007476"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4RKD1"
FT                   /protein_id="ACF29282.1"
FT                   /translation="MWFKQISFYPLNKEKLPEADVLADKLAEAEFTHCQGLDWFSEGFT
FT                   APVSFSPELVFPADFTLRVALKKEEKVLPAGVIRDILEEKVAEIQNNEARNVGRKEKQE
FT                   LKEQITDDLLPRAFTRSSRTEAVFNTRHGYLLVNNAASAKAENILTKLREALGGLEASL
FT                   PNTKQSPSSLMTGWLLQGHCEGGFELDSDCELKGTGDIVPVVKVSKQDLTADEVVQHVK
FT                   NGKTVTRLGLVWREQIAFILTQDFTLKRIQYLDVLQEEAESNGDDAAGLAFASQILMAE
FT                   SVSTMLEELVSYLGGWQD"
FT   gene            complement(491014..492471)
FT                   /locus_tag="NGK_0592"
FT   CDS_pept        complement(491014..492471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0592"
FT                   /product="essential Gc protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29283"
FT                   /db_xref="GOA:B4RKD2"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR016484"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031166"
FT                   /db_xref="InterPro:IPR032859"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4RKD2"
FT                   /protein_id="ACF29283.1"
FT                   /translation="MKPTIALIGRPNVGKSTLFNRLTRTKDALVHDLPGLTRDRHYGHG
FT                   KVGSKPYFVIDTGGFEPVVDSGILHEMAKQTLQAVDEADAVVFLVDGRTGLTPQDKIIA
FT                   DRLRQSPRPVYLAVNKGEGGDRAVLAAEFYELALGEPHVISGAHGDGVYYLIEEILENF
FT                   PEPEAEEADAKHPVFAVIGRPNVGKSTLVNAILGEKRVIAFDMAGTTRDSIHIDFEREG
FT                   KPFTIIDTAGVRRRGKVDEAVEKFSVIKAMQAVEAANVAVLVLDAQQDIADQDATIAGF
FT                   ALEAGRALVVAVNKWDGISEERREQVKRDISRKLYFLDFAKFHFISALKERGIDGLFES
FT                   IQAAYNAAMIKMPTPKITRVLQTAVGRQQPPRAGLVRPKMRYAHQGGMNPPVIVVHGNS
FT                   LHAISDSYTRYLTQTFRKAFNLQGTPLRIQYNVSENPYENAEDKPKKKPLRRVSLSNRI
FT                   EKREGRKEEKNRFKKKTKVSVKKQFSK"
FT   gene            complement(492621..493250)
FT                   /locus_tag="NGK_0593"
FT   CDS_pept        complement(492621..493250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0593"
FT                   /product="Gc protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29284"
FT                   /db_xref="GOA:B4RKD3"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR018704"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR026039"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKD3"
FT                   /protein_id="ACF29284.1"
FT                   /translation="MAAHLEEQQELDNFKYFWKTTGKWLFALLILAALGYLGYTVYQNR
FT                   AASQNQEAAAVLANIVEKAQNKAPQSEINAELSKLQQSYPHSISAAQATLMAAATEFDA
FT                   QRYDVAEGHLKWVLSNQKDSLIQALAAQRLGVVLLQQKKYDAALAALDTPVEADFAPLL
FT                   METKGDVYAAQEKSQEALKNYGQALEKMPQDSVGRELLQMKLDSLK"
FT   gene            complement(493251..494516)
FT                   /locus_tag="NGK_0594"
FT   CDS_pept        complement(493251..494516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0594"
FT                   /product="histidyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29285"
FT                   /db_xref="GOA:B4RKD4"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR015807"
FT                   /db_xref="InterPro:IPR033656"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKD4"
FT                   /protein_id="ACF29285.1"
FT                   /translation="MNDLLPVGQKDFKLTAVFWQAFEDTVNRWTRAYGYQQIRTPIVEQ
FT                   TGLFVRSIGEETDVVGKEMYTFSDSNDSLSLSLRPEGTASCLRAVVEHNLLYNSPQKLW
FT                   YMGPMFRRERPQKGRYRQFHQVGIEALGFEGPDIDAEIIAMSADLWEKLGIREYLTLEI
FT                   NSLGNREERAAHRAALVEYLTRYEAQLDEDSKRRLKTNPLRVLDTKNPDLQEICNAAPR
FT                   LVDYLGEASQNHYARFKAMLDGLGIQYIENSRLVRGLDYYNQTVFEWTTDKLGAQATVC
FT                   GGGRYDGLIEELGGKPAPSIGFAMGIERLLLLVSEYGSLEVNAAPDVYAMHQGEGADLQ
FT                   VMKYAQALRAQGFNVMQHSGYQSLKAQMKKADNSGARFALIVAQDELADGTVTLKDMNG
FT                   AHGQQTVSATDLTDTLQQWKNA"
FT   gene            complement(494513..494668)
FT                   /locus_tag="NGK_0595"
FT   CDS_pept        complement(494513..494668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0595"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29286"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKD5"
FT                   /protein_id="ACF29286.1"
FT                   /translation="MPSENCFRRHFYPSANHLHPHKPLKIRYNRPQFDFSTPFLKWHKK
FT                   SNPSKA"
FT   gene            complement(494674..495330)
FT                   /locus_tag="NGK_0596"
FT   CDS_pept        complement(494674..495330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0596"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29287"
FT                   /db_xref="GOA:B4RKD6"
FT                   /db_xref="InterPro:IPR005074"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKD6"
FT                   /protein_id="ACF29287.1"
FT                   /translation="MEQKRRFAASLLLAAALPLCAHSFPFAEENPIAYGKVKIQSWKAR
FT                   RDFNIVKQDLDFSCGAASVATLLNNFYGQKLTEEEVLEKLGKEQMRASFEDMRRIMPDL
FT                   GFEAKGYALSFEQLAQLKIPVIVYLKYRKDDHFSVLRGVDGNTVLLADPSPGHVSMSRA
FT                   QFLEAWQTREGNLAGKILAVVPKKAEAISNKLFFTHHPKRQTEFAVGQIRQGRAE"
FT   gene            complement(495386..495610)
FT                   /locus_tag="NGK_0597"
FT   CDS_pept        complement(495386..495610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0597"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29288"
FT                   /db_xref="GOA:B4RKD7"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKD7"
FT                   /protein_id="ACF29288.1"
FT                   /translation="MMKNKYILIKAAIGITAISIFYLLTQGSIGKTEEPSYFLMFMFLN
FT                   SLWFEENKTVMAAVTAMIAAHFIFVALSD"
FT   gene            complement(495840..495977)
FT                   /locus_tag="NGK_0598"
FT   CDS_pept        complement(495840..495977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0598"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29289"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKD8"
FT                   /protein_id="ACF29289.1"
FT                   /translation="MELKYCNREAKASVVTFTIYFIILISSKNKIQDYTYRQSFLDCFV
FT                   "
FT   gene            complement(496045..496158)
FT                   /locus_tag="NGK_0599"
FT   CDS_pept        complement(496045..496158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0599"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29290"
FT                   /db_xref="GOA:B4RKD9"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKD9"
FT                   /protein_id="ACF29290.1"
FT                   /translation="MEFYYWDNERFIFIFMFCLFIILFLIIDCRNHWKNNQ"
FT   gene            complement(497705..497908)
FT                   /locus_tag="NGK_0600"
FT   CDS_pept        complement(497705..497908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0600"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29291"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKE0"
FT                   /protein_id="ACF29291.1"
FT                   /translation="MGGQYSSLENFALSVLREKIINNTVSSDEKLLIINDFLSGFLEFD
FT                   PETGEPVGETLKIEQMIDFFLV"
FT   gene            complement(497944..498486)
FT                   /locus_tag="NGK_0601"
FT   CDS_pept        complement(497944..498486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0601"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29292"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKE1"
FT                   /protein_id="ACF29292.1"
FT                   /translation="MKRIFLPALPAILPLSAYADLPLTIEDIMTDKGKWKLETSLTYLN
FT                   SENSRAALAAPVYIQTGATSFIPIPTEIQENGSNTDMLAGTLGLRYGLTGNTDIYGSGS
FT                   YLWHEERKLDGNGKTRNKRMSDISAGISHTFLKDGKNPALISFLESTVYEKSRNKASLI
FT                   KKRGLCPFYNLRINYEY"
FT   gene            498651..499574
FT                   /locus_tag="NGK_0602"
FT   CDS_pept        498651..499574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0602"
FT                   /product="Pseudouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29293"
FT                   /db_xref="GOA:B4RKE2"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKE2"
FT                   /protein_id="ACF29293.1"
FT                   /translation="MKKRNNPLPLLNGVKPSYLVLPHEKQFYGLPLLHFLCIRFPFLGA
FT                   DDWRRRLNSGFVVGSDGAALDEHSLFEPGKTMFYYRETGCESEPRIPFEEKILFVDEHL
FT                   IVVDKPHFLPVIPGGRFLRETLLTRLRLRPELQHLNVEDITPIHRLDKDTAGVMLLSHN
FT                   PATRGAYQTMFQNKTVWKTYEALAPTKTDLPYPLDVVSRLVRGEKFFTTQEAEGVPNAH
FT                   TTVELIENRGEFSLYRLTPHTGKKHQLRVHMMGLGMPLLNDALYPVPSEAGSEDYRKPL
FT                   KLLAKKIAFADPLSGRERVFCSGFCL"
FT   gene            complement(499653..500294)
FT                   /locus_tag="NGK_0603"
FT   CDS_pept        complement(499653..500294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0603"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29294"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKE3"
FT                   /protein_id="ACF29294.1"
FT                   /translation="MLKPETIHIPGPAGILETIHIPSEQVPARGVAVINHPNPLQGGTN
FT                   TNKVIQTAAKALSKLGFHCYLPNLRGVGGSEGTHDYGRGETQDCLAVIDYARAQHPEAP
FT                   EFALSGFSFGGYVATFAAQVRIPDLLLLIGAAVCHYTDRPEPSAVPNVAKTLMIHGAED
FT                   EVVEIEKALKWAEPQDLPVITIAGSTHFFHGKLIVLRDTILRFAPVCLNG"
FT   gene            complement(500349..501140)
FT                   /locus_tag="NGK_0604"
FT   CDS_pept        complement(500349..501140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0604"
FT                   /product="spermidine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29295"
FT                   /db_xref="GOA:B4RKE4"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030374"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKE4"
FT                   /protein_id="ACF29295.1"
FT                   /translation="MARHPYRRLRPAKSGFPEVGISEEGNIRSLHLGSDTVQSSMNLDR
FT                   PSELVLSYSRAMMGWLLFAERLPQHITQIGLGGGSFARWTDTYLPDTRQTAVDINPQVI
FT                   AIARNLFELPFEGGKFEIIEADGAEYIKVFRHNTDIILVDGFDGEQIIDTLVEEPFFRD
FT                   CRNALSSDGIFVTNWWSGDKRYQRFIERLLSVFEGRVLELPAESHGNVAVMAFQSSPKE
FT                   QNIDKLKKRADKLSNAYGLDFHRMLAGLKASNPNNGKHFHL"
FT   gene            501306..501381
FT                   /locus_tag="NGK_trnaThr1"
FT   tRNA            501306..501381
FT                   /locus_tag="NGK_trnaThr1"
FT                   /product="tRNA-Thr"
FT   gene            501523..502314
FT                   /locus_tag="NGK_0605"
FT   CDS_pept        501523..502314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0605"
FT                   /product="3-methyl-2-oxobutanoate hydroxymethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29296"
FT                   /db_xref="GOA:B4RKE5"
FT                   /db_xref="InterPro:IPR003700"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4RKE5"
FT                   /protein_id="ACF29296.1"
FT                   /translation="MITVNTLQKMKAAGEKIVMLTAYESSFAALMDDAGVDVLLVGDSL
FT                   GMAVQGRQSTLPVSLRDMCYHTECVARGAKNAMIVSDLPFGAYQQSKEQAFAAAAELMA
FT                   AGAHMVKLEGGVWMAETTEFLQMRGIPVCAHIGLTPQSVFAFGGYKVQGRGGKAQALLN
FT                   DAKAHDEAGAAVVLMECVPAELAKKVTETVSCPTIGIGAGADCDGQVLVMHDMLGIFPG
FT                   KTAKFVKNFMRGQSSIQAAVRAYVAEVKAKTFPAAEHIFAD"
FT   gene            502304..502480
FT                   /locus_tag="NGK_0606"
FT   CDS_pept        502304..502480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0606"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29297"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKE6"
FT                   /protein_id="ACF29297.1"
FT                   /translation="MQIEQGLLPMPSESRFRRHFVLPCAARIIGAFCRAGSPKDKDYRN
FT                   ANHTYHSRTAHVA"
FT   gene            502494..503273
FT                   /locus_tag="NGK_0607"
FT   CDS_pept        502494..503273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0607"
FT                   /product="pantoate--beta-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29298"
FT                   /db_xref="GOA:B4RKE7"
FT                   /db_xref="InterPro:IPR003721"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR042176"
FT                   /db_xref="PDB:5KWV"
FT                   /db_xref="PDB:5UCR"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKE7"
FT                   /protein_id="ACF29298.1"
FT                   /translation="MAFVPTMGNLHEGHLALVREARKRADNVVVSIFVNRLQFGQGEDF
FT                   DKYPRTLQQDADKLAAEGVAVVFAPDEKELYPNVEQRYNVEPPHLQNELCGKFRPGHFR
FT                   GVATVVSKLFNIVLPDVACFGKKDYQQLAVIKGLTEDLNFDIEIVPVDTGRAADGLALS
FT                   SRNRYLSVGERAEAPRLYRELQAVAESLKQAGLDYAGLERQAADHLTAAGWLVDYVEIR
FT                   RADTLEMARAGDKKLVVLAAARLGTTRLIDNVEVGLP"
FT   gene            503594..505438
FT                   /locus_tag="NGK_0608"
FT   CDS_pept        503594..505438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0608"
FT                   /product="putative periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29299"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKE8"
FT                   /protein_id="ACF29299.1"
FT                   /translation="MIMLPARFTILSVLAAALLAGQAYAAGAADVELPKEVGKVLRKHR
FT                   RYSEEEIKNERARLAAVGERVNRVFTLLGGETALQKGQAGTALATYMLMLERTKSPEVA
FT                   ERALEMAVSLNAFEQAEMIYQKWRQIEPIPGEAQKRAGWLRNVLREGGNQHLDGLEEVL
FT                   AQSDDVQKRRIFLLLVQAAVQQGGVAQKASKAVRRAALKYEHLPEAAVADAVFGVQGRE
FT                   KEKAIEALQRLAKLDTEILPPTLMTLRLTARKYPEILDGFFEQTDTQNLSAVWQEMEIM
FT                   NLVSLRKPDDAYARLNVLLEHNPNANLYIQAAILAANRKEGASVIDGYAEKAYGRGTGE
FT                   QRGRAAMTAAMIYADRRDYAKVRQWLKKVSAPEYLFDKGVLAAAAAAELDGGRAALRQI
FT                   GRVRKLPEQQGRYFTADNLSKIQMLALSKLPDKREALIGLNNIIAKLSAAGSTEPLAEA
FT                   LAQRSIIYEQFGKRGKMIADLETALKLTPDNAQIMNNLGYSLLSDSKRLDEGFALLQTA
FT                   YQINPDDTAVNDSIGWAYYLKGDAESALPYLRYSFENDPEPEVAAHLGEVLWALGERDQ
FT                   AVDVWTQAAHLTGDKKIWRETLKRYGIALPEPSRKPRK"
FT   gene            505470..506159
FT                   /locus_tag="NGK_0609"
FT   CDS_pept        505470..506159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0609"
FT                   /product="outer membrane lipoprotein LolB precursor"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29300"
FT                   /db_xref="GOA:B4RKE9"
FT                   /db_xref="InterPro:IPR004565"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKE9"
FT                   /protein_id="ACF29300.1"
FT                   /translation="MPGSRGIRANGTQFARVLHGTPHPSAGRMTPVKETLMKHTVSASV
FT                   ILLLTACAQLPQNNENLWQPSEHISSFAAEGRLAVKAEGKGSYANFDWTYQPPVETINI
FT                   NTPLGGTLGQLCQDRDGALAVDGKGNVYQAEGTEDLSRQLVGFKLPIQYLHIWAEGRRV
FT                   AGAPYRIRSDGILEQYGWTIGRTADSGGQVRTLQLNNGNLNIRLVFTEIGMPSETETPE
FT                   RCAARTR"
FT   gene            506169..507014
FT                   /locus_tag="NGK_0610"
FT   CDS_pept        506169..507014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0610"
FT                   /product="putative isopentenyl monophosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29301"
FT                   /db_xref="GOA:B4RKF0"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4RKF0"
FT                   /protein_id="ACF29301.1"
FT                   /translation="MNIADGRQAFPAPAKLNLDLRITGRREDGYHNIESIFCLIDLQDT
FT                   VYLKPRDDGKIILHNPVGGIPQEADLSYRAASLLQKYARNLAGVEIWLDKKIPTGAGLG
FT                   GGSSDAATVLLVLNRWWQCGLTQWQLIDLGAALGADVPFFIFGKNAFASGIGEKLIGMD
FT                   IPKQWYVIVKPPVHVSTAKIFTYEGLTRDSASSIMPTFQNLQPFRNDMQAVVFKEYPEV
FT                   WKAYSELSKYGSAMMTGSGACIFAAFQARNSAYNIYRQVSGLYEAYLAEGLSKHPLLSV
FT                   "
FT   gene            507022..507097
FT                   /locus_tag="NGK_trnaGln1"
FT   tRNA            507022..507097
FT                   /locus_tag="NGK_trnaGln1"
FT                   /product="tRNA-Gln"
FT   gene            507110..507185
FT                   /locus_tag="NGK_trnaGln2"
FT   tRNA            507110..507185
FT                   /locus_tag="NGK_trnaGln2"
FT                   /product="tRNA-Gln"
FT   gene            507374..508336
FT                   /locus_tag="NGK_0611"
FT   CDS_pept        507374..508336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0611"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29302"
FT                   /db_xref="GOA:B4RKF1"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="InterPro:IPR037515"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKF1"
FT                   /protein_id="ACF29302.1"
FT                   /translation="MVFTGNANPELAQRVVRHLDISLGNASVSKFSDGEVAVELLENVR
FT                   GRDVFILQPTCAPTNDNLMEILTMADALKRASAGRITTAIPYFGYARQDRRPRSVRVPI
FT                   SAKLVANMLYSAGIDRVLTVDLHADQIQGFFDIPVDNIYATPILLNDIKQQRIENLTVV
FT                   SPDIGGVVRARAVAKSLNADLAIIDKRRPKANVAEVMNIIGDIQGKTCLIVDDMIDTAN
FT                   TLCKAAVALKERGAERVLAYASHAVFSGEAVSRIASSEIDQVVVTDTIPLSEAAKNCDR
FT                   IRQVTIAGLLAETVRRISNEESVSYLFNEEVMTGSMLLP"
FT   gene            508403..508975
FT                   /locus_tag="NGK_0612"
FT   CDS_pept        508403..508975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0612"
FT                   /product="50S ribosomal protein L25"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29303"
FT                   /db_xref="GOA:B4RKF2"
FT                   /db_xref="InterPro:IPR001021"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR020055"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020057"
FT                   /db_xref="InterPro:IPR029751"
FT                   /db_xref="InterPro:IPR037121"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4RKF2"
FT                   /protein_id="ACF29303.1"
FT                   /translation="MTYEIQASVREAQGTGASRRLRREGQIPGILYGEGQEPVAIAVDH
FT                   KTVFYALEKESFHTALIKLSLNGETKDVIVRDFQMHPFRREVQHIDFQAVKADQLVRIR
FT                   VPLHIVNAENSQAVKLQGGRVSLLNTAVEVLALPANIPAFLDLDCAEVVAGDILHLSDI
FT                   KLPEGVESVSLKRNENLAVATVTGKKR"
FT   gene            complement(509101..510426)
FT                   /locus_tag="NGK_0613"
FT   CDS_pept        complement(509101..510426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0613"
FT                   /product="Penicillin-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29304"
FT                   /db_xref="GOA:B4RKF3"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR012907"
FT                   /db_xref="InterPro:IPR015956"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="InterPro:IPR037167"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKF3"
FT                   /protein_id="ACF29304.1"
FT                   /translation="MFIIQCGIIGLLKSQNPKPYAQDGAKARKIRPIRHPKRIIGRLKH
FT                   SHNLEYFMTAHKILPVLLPIILGVSHATAASPAPNRPTVHAAPTLQTPETLTAAHIVID
FT                   LQSRQTLSAKNTNTPVEPAALTQLMTAYLVFKNMKSGNIQSEENLKIPESAWASEGSRM
FT                   FVRPGDTVSTDKLLKGMIALCANDAALTLADRLGNGSIENFVQQMNKEARRLGMKNTVF
FT                   KNPTGLGREGQVSTAKDLALLSEALMRDFPEYYPLFSIKSFKFENIEQNNRNILLYRDN
FT                   NVNGLKAGHTESGGYNLAVSYSGNGRHILVITLGSESAETRASDNSKLLNRALQAFDTP
FT                   KIYPKGKTVAQIQISGGSKKTVRAGFLKEAYITLPHKEAKMAEQILETIQPIPAPVKKG
FT                   QILGKIKIRQNGHTIAEKEIVALENVEKRSRWQRLWTRLTGQ"
FT   gene            510419..511945
FT                   /locus_tag="NGK_0614"
FT   CDS_pept        510419..511945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0614"
FT                   /product="threonine dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29305"
FT                   /db_xref="GOA:B4RKF4"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001721"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005787"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="InterPro:IPR038110"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKF4"
FT                   /protein_id="ACF29305.1"
FT                   /translation="MNTPLPYSDYLIRILTASVYDVAVETPLEPARSLSVRLKNNILLK
FT                   REDLQPVFSFKIRGAYNKMSKLPKDALACGVIAASAGNHAQGVALSAQRLGCRAVIVMP
FT                   ETTPKIKVDAVKSRGGEVVLRGVSYNDAYDYAMELAEQEGLTYIAPFDDPDVIAGQGTV
FT                   GMEIVSQHPDPIRAVFVPIGGGGLAAGVAAFIKQVRPEIKVIGVQTNDSCCMKQSVEAG
FT                   EIVHLKDVGLFSDGTAVKVVGNGTFRLCKELLDEIITVDTDAVCGAVKDIFDDTRSITE
FT                   PAGALALAGLKAYIAREGAENQTLIAVTSGANMNFHRLRHVSERSELGEGNEGIFAVTI
FT                   PEERGSFLKFVNILGNRNITEFNYRYGDDEKAHIFVGLQAAGPQDLAVIGSRLDEAGLP
FT                   NVDLTNNEIAKIHIRYMVGGRTDKVGHERLVSFEFPERPGALARFLNHMQGGWNITLFH
FT                   YRNHGADYGRILVGIDVPPHDAAAFDGFLESLGYSYHEETQNAAYKLFLA"
FT   gene            complement(512001..513077)
FT                   /locus_tag="NGK_0615"
FT   CDS_pept        complement(512001..513077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0615"
FT                   /product="putative ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29306"
FT                   /db_xref="GOA:B4RKF5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005666"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR014769"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKF5"
FT                   /protein_id="ACF29306.1"
FT                   /translation="MSITIQNLNKKRFGNFHALKNINLNVPAGKLVSLLGPSGCGKTTL
FT                   LRIIAGLENADGGQILFDGQDVTAKHVRERKVGFVFQHYALFRHMNVFDNVAFGLTVLP
FT                   KPERPSKGQIRAKVEELLKLVQLSHLAKSYPHQLSGGQRQRIALARALAVEPKLLLLDE
FT                   PFGALDAKVRKELRTWLRDIHHNLGVTSILVTHDQEEALEVSDEIVVMNHGKIEQTGSA
FT                   EAIYRKPENAFVTEFLGEADAFEGRIEKGIWHYNGFAWKLDAQYKWQEQTATGYIRPHE
FT                   WQIAAEHETPMIRAEIEKIHAVGALTHVLVKHGKQDVHITLAGSDAARYPIAEGKKLNL
FT                   IPKQVYVFSQNELIEYSI"
FT   gene            complement(513218..514039)
FT                   /locus_tag="NGK_0616"
FT   CDS_pept        complement(513218..514039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0616"
FT                   /product="putative ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29307"
FT                   /db_xref="GOA:B4RKF6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005667"
FT                   /db_xref="InterPro:IPR011866"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKF6"
FT                   /protein_id="ACF29307.1"
FT                   /translation="MKPYSANPNLTEPRRLRMLLIAAVLGFLLLMLVVPLVAVFYEALK
FT                   GGWDLYLKSLSDPEAWSAVKLTLITALIAVPVNAVLGVAMAWLLTRFDFLGKQLLTTLL
FT                   DLPFSVSPAVAGLMFVLLFGAHTALGSRLEAQGIRIIFAIPGIVLTALFVTFPFAAREI
FT                   IPLMQAQGDSEEQAALILGASGWQMFWRVTLPNIKWTLLYGIILTNARAMGEFGAVSVV
FT                   SGHIRGETNTIPLLVEIFYNEYNFTGAFSLSGVLALLALATLAVQNIITKL"
FT   gene            complement(514228..514992)
FT                   /locus_tag="NGK_0617"
FT   CDS_pept        complement(514228..514992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0617"
FT                   /product="sulfate ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29308"
FT                   /db_xref="GOA:B4RKF7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005667"
FT                   /db_xref="InterPro:IPR011865"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKF7"
FT                   /protein_id="ACF29308.1"
FT                   /translation="MPVASGGFAVCDDGGGNRLGRLSEHDCRAERAGGGAAEFADVVLC
FT                   DADQCVVFGTLVAWVLVRYEFPGKGLANALVDLPFALPTAVTGIALAALYAPNGWIGRF
FT                   FEPLGIKIAFTPVGIWIALVVVSLPFIVRAVQPVLKELSGEYEEAAATLGANRFTTFRR
FT                   VLLPEITPALLTGAGMMFARATGEYGSVIFIAGSIPMISEILPLIITGKLEQFDAQGAS
FT                   AVALFMLLVSFVILFALNVLQWALGRRSGAKG"
FT   gene            515243..515575
FT                   /locus_tag="NGK_0618"
FT   CDS_pept        515243..515575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0618"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29309"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKF8"
FT                   /protein_id="ACF29309.1"
FT                   /translation="MQILSFQADIAERMLEGTEGESVNENAQFVRTDNGYWIAWHEGVA
FT                   ALLAPDTPPGIPCFWVEGAESLEELCAMVERGEFDEVEEFDGDDDAWLEAAKDCGHHGD
FT                   ACACGH"
FT   gene            515911..516414
FT                   /locus_tag="NGK_0619"
FT   CDS_pept        515911..516414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0619"
FT                   /product="Integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29310"
FT                   /db_xref="GOA:B4RKF9"
FT                   /db_xref="InterPro:IPR007269"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKF9"
FT                   /protein_id="ACF29310.1"
FT                   /translation="MILSILSLFFIIRLLFLAVSIKHEKALIAKGAKQYGKTNSTVLAA
FT                   VHTLYYLACFVWVWLSDTAFNGISLIGTLTVMASFVILSLIIKQLGEIWTVKIYILPNH
FT                   QINRSWLFKTFRHPNYFLNIIPELIGIALLCQAWYVLLIGLPIYLLVLFKRIRQEEQAM
FT                   ATLF"
FT   gene            complement(516646..517227)
FT                   /locus_tag="NGK_0620"
FT   CDS_pept        complement(516646..517227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0620"
FT                   /product="Fe-superoxide dismutase SodB"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29311"
FT                   /db_xref="GOA:B4RKG0"
FT                   /db_xref="InterPro:IPR001189"
FT                   /db_xref="InterPro:IPR019831"
FT                   /db_xref="InterPro:IPR019832"
FT                   /db_xref="InterPro:IPR019833"
FT                   /db_xref="InterPro:IPR036314"
FT                   /db_xref="InterPro:IPR036324"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKG0"
FT                   /protein_id="ACF29311.1"
FT                   /translation="MEHKLPQLPYGPDALSPHLSKETLEFHYGKHHQTYITNLNNQIKG
FT                   TEFENLPLEEIVKKSSGGVFNNAAQTWNHTFYWLGFTPKGQGKPAGELAAAIDAKWGSF
FT                   EKFQEAFNACAAGTFGSGWAWLVKTPVGGLDLISTFNAATPLTTENTPLLTCDVWEHAY
FT                   YIDYRNSRPNYLEGFWEIVNWDEVAKRFAA"
FT   gene            517240..517419
FT                   /locus_tag="NGK_0621"
FT   CDS_pept        517240..517419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0621"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29312"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKG1"
FT                   /protein_id="ACF29312.1"
FT                   /translation="MLFLDVVFWQCCCKRIGGSRILPVLSDGNQLNLLCVIIEDCNFGM
FT                   TDWMYHERLRSYAA"
FT   gene            517391..518794
FT                   /locus_tag="NGK_0622"
FT   CDS_pept        517391..518794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0622"
FT                   /product="replicative DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29313"
FT                   /db_xref="GOA:B4RKG2"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007692"
FT                   /db_xref="InterPro:IPR007693"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036185"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKG2"
FT                   /protein_id="ACF29313.1"
FT                   /translation="MNDYAAMPPEGREVGALSLPPHSMEAEQSVLGGLMLENPAWDRIA
FT                   DVVSGEDFYRHEHRLIFRSIAKLINEGRPADVITVQEDLQRNEELEAAGGFEYLITLAQ
FT                   NTPSAANIRRYAEIVRERSIMRQLAEVGTEIARSAYNPQGRDAGRLLDEAENKVFQIAE
FT                   STAKSKQGFLEMPDLLKEVVQRIDMLYSRDNPDEVTGVPTGFADLDKKTSGLQPGDLII
FT                   VAGRPSMGKTAFSINIAEYVAIEKHLPVAVFSMEMGGAQLVMRMLGSVGRLDQSVLKTG
FT                   RLEDEHWGRLNEAVVKLSDAPVYIDETPGLTALELRARARRLARQFNNKLGLIVIDYLQ
FT                   LMAGSGRSDNRASELGEISRSLKALAKELQVPIIALSQLSRTVEQRTDKRPMMSDLRES
FT                   GAIEQDADLIMFMYRDEYYNQDSPMKGLAECIIGKHRNGPVGKVILTWMGQFTKFGNAA
FT                   YIPESAAED"
FT   gene            519325..519714
FT                   /locus_tag="NGK_0623"
FT   CDS_pept        519325..519714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0623"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29314"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKG3"
FT                   /protein_id="ACF29314.1"
FT                   /translation="MLAFGDKNDNKAYDGDATDVFLRSVVLNDTDDSRINYTFNHIAFG
FT                   SSQPKADRVVWTFNQNGTFGYLPDQNLKNNSKFVYSDGYIQIVLTDARAVSDADKKFRS
FT                   AVVLINSSGRVEVCRKNDTRAVCKH"
FT   gene            519746..520360
FT                   /locus_tag="NGK_0624"
FT   CDS_pept        519746..520360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0624"
FT                   /product="putative type IV pilus assembly protein PilV"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29315"
FT                   /db_xref="GOA:B4RKG4"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR013362"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKG4"
FT                   /protein_id="ACF29315.1"
FT                   /translation="MKNNDCLRLKNPQSGMALIEVLVAMLVLTIGILALLSVQLRTVAS
FT                   VREAETQTIVSQITQNLMEGMLMNPTIDSDSNKKNYNLYTGPYTPTPSGGDFKLNNNNL
FT                   ISKKDLAKAQLDRFDYELRNALPDAVAIHYAVCKDSSGGAPTLSGGTFSPNCDNKANGD
FT                   TLIKVLWVNDSAGDSDISRTNLEVSGDNIVYTYQARVGGHE"
FT   gene            520357..521316
FT                   /locus_tag="NGK_0625"
FT   CDS_pept        520357..521316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0625"
FT                   /product="Putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29316"
FT                   /db_xref="GOA:B4RKG5"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKG5"
FT                   /protein_id="ACF29316.1"
FT                   /translation="MKRKMLNVPKGGYDGMKGFTIVEFLVAGLLSVIVLIAVVSSYFTS
FT                   RKLNDAANERLAIQQDLRNAATLIVRDARMAGSFGCFNMSEHTEKDVVSDVAQKNRLFS
FT                   LKMNSTNKVISNGTDNKLIPIAESLNIRYQGFTHRPNALIFQYGIDDVNASADTTVVSS
FT                   CAAISKPGKQILNLEDVKKELKIVGQGKEQNGNIARQRHVVNAYAVGRFGNEEGLFRFQ
FT                   LNEKGEWGNPQLLAKKIKRMRVRYIYVSGCPEDEDAGKEEQFKYTDKFDSSVTPAGVEV
FT                   LLDSGSDAKIAASSDNIIYAYRINATIRGGNVCANRTL"
FT   gene            521295..521906
FT                   /locus_tag="NGK_0626"
FT   CDS_pept        521295..521906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0626"
FT                   /product="Type IV pilus assembly protein PilX"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29317"
FT                   /db_xref="GOA:B4RKG6"
FT                   /db_xref="InterPro:IPR025205"
FT                   /db_xref="InterPro:IPR025746"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKG6"
FT                   /protein_id="ACF29317.1"
FT                   /translation="MRKQNTLTGIPTSDGQRGSALFIVLMVMIVVAFLVVTAAQSYNTE
FT                   QRISANESDRKLALSLAEAALREGEFQVLDLEYAADSKVTFSENCEKGLCTAVNVRTND
FT                   NGNEEAFGNIVVQGKPTVEAVKRSCPAKSGKNSTGLCIDNQGVEYKKGTGNVSKMPRYI
FT                   IEYLGVKNGQNVYRVTAKAWGKNANTVVVLQSYVGNNDEQ"
FT   gene            521908..522381
FT                   /locus_tag="NGK_0627"
FT   CDS_pept        521908..522381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0627"
FT                   /product="Putative type IV pilin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29318"
FT                   /db_xref="GOA:B4RKG7"
FT                   /db_xref="InterPro:IPR000983"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR025922"
FT                   /db_xref="InterPro:IPR038415"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKG7"
FT                   /protein_id="ACF29318.1"
FT                   /translation="MEQKGFTLIEMMIVVAILGIISVIAIPSYQSYIEKGYQSQLYTEM
FT                   VGINNVLKQFILKNPQDNNQIIKSKLETFVLGYKMNPKIAKKYSVSVAFANTEKPRAYR
FT                   LVGVPKAGTGYTLSVWMNSVGDGYKCRNATSAQTYSETLSANTGCEAFSNRKK"
FT   gene            complement(522451..522759)
FT                   /locus_tag="NGK_0628"
FT   CDS_pept        complement(522451..522759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0628"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29319"
FT                   /db_xref="GOA:B4RKG8"
FT                   /db_xref="InterPro:IPR008407"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKG8"
FT                   /protein_id="ACF29319.1"
FT                   /translation="MKDLLSFPSFLLFSCMLAVTCPTRLIGFFALRNRTLSRRAQTVME
FT                   TAPGCVLISVIAPYFVSDKPHELIAIALTAFAACRFSMLFTVLIGVGSSGISGWLMA"
FT   gene            complement(522756..523112)
FT                   /locus_tag="NGK_0629"
FT   CDS_pept        complement(522756..523112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0629"
FT                   /product="AzlC-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29320"
FT                   /db_xref="GOA:B4RKG9"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKG9"
FT                   /protein_id="ACF29320.1"
FT                   /translation="MAFSEIQKRKAAGLPAFNMPFYMGACFILYITWIGFAALGAAVGP
FT                   VFGNVAAWGFGMAFPAVFLVLLRGMWKSFSASRLWFVNLFVASAVYLTVDGAWYVPAGT
FT                   LSGLLSAYFWNGRK"
FT   gene            complement(523126..523407)
FT                   /locus_tag="NGK_0630"
FT   CDS_pept        complement(523126..523407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0630"
FT                   /product="AzlC-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29321"
FT                   /db_xref="InterPro:IPR011606"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKH0"
FT                   /protein_id="ACF29321.1"
FT                   /translation="MLIGLLPWALILGMQGGQKGMGRLEMLLMTGMNFAGGSEFATVNL
FT                   WAEPLPILPIATITFMINSRHILMGGGACHAHERNTAEKSRARAAFYV"
FT   gene            523633..524085
FT                   /locus_tag="NGK_0631"
FT   CDS_pept        523633..524085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0631"
FT                   /product="deoxyuridine 5'-triphosphate nucleotidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29322"
FT                   /db_xref="GOA:B4RKH1"
FT                   /db_xref="InterPro:IPR008181"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4RKH1"
FT                   /protein_id="ACF29322.1"
FT                   /translation="MNIEVEMKVLDERMADFIPAYATEGSAGLDLRACLDEEVVLQPGE
FT                   TFLVPTGLAIYLANPAYTAVLLPRSGLGHKHGIVLGNLVGLIDSDYQGELKVSLWNRGS
FT                   EPFTVKPFERIAQMVIVPVVQAGFKRVEEFVGSSRGEGGFGSTGSH"
FT   gene            524157..525344
FT                   /locus_tag="NGK_0632"
FT   CDS_pept        524157..525344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0632"
FT                   /product="Aminotransferase, class I"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29323"
FT                   /db_xref="GOA:B4RKH2"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019878"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKH2"
FT                   /protein_id="ACF29323.1"
FT                   /translation="MNTLLKQLKPYPFARLREAMQGISAPEGMEAVPLHIGEPKHPTPK
FT                   VITDALTASLRELEKYPLTAGLPELRQACANWLKRRYDGLTVNPDNEILPVLGSREALF
FT                   SFVQTVLNPVSDGLKPVIVSPNPFYQIYEGATLLGGGEIHFANCPAPSFNPDWRSISEE
FT                   VWERTKLVFVCSPNNPSGSVPDLDGWREVFDLQDKYGFIIASDECYSEIYFDGNKPLGC
FT                   LQAAAQSGRSRQKLLMFTSLSKRSNVPGLRSGFVAGDAELLKNFLLYRTYHGSAMSIPV
FT                   QRASIAAWNDEQHVIDNRRLYQEKFERVIPILQQVFDVKLPDASFYIWLKVPDGDDLAF
FT                   ARNLWQKAAIQVLPGRFLARDTEQGNPGEGYVRIALVADVATCVKAAETIVCLYR"
FT   gene            525500..526279
FT                   /locus_tag="NGK_0633"
FT   CDS_pept        525500..526279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0633"
FT                   /product="UPF0246 protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29324"
FT                   /db_xref="InterPro:IPR005583"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4RKH3"
FT                   /protein_id="ACF29324.1"
FT                   /translation="MFFVLSPAKNLNEKDPCPVSEFTQPDLLAESEILMRQLRELAPQQ
FT                   IAELMHVSDKIALLNAERNAAWHTPFTPENAKQAVFMFNGDVYEGMDANTLNTNQIQYL
FT                   QNHVRLLSGLYGLMRPLDLMQPYRLEMGTAFANLRGKNLYEFWGDIITNLLNDTLAQAG
FT                   SNTLVNLASQEYFKSVNTKKLRARLITPIFKDEKNGKYKIISFYAKRARGLMVRYAAEH
FT                   NITDPEMLKNFNYEGYAFNDAASNESEWVFMRSEQIK"
FT   gene            526362..526452
FT                   /locus_tag="NGK_trnaSer2"
FT   tRNA            526362..526452
FT                   /locus_tag="NGK_trnaSer2"
FT                   /product="tRNA-Ser"
FT   gene            526529..526618
FT                   /locus_tag="NGK_trnaSer3"
FT   tRNA            526529..526618
FT                   /locus_tag="NGK_trnaSer3"
FT                   /product="tRNA-Ser"
FT   gene            526727..526849
FT                   /locus_tag="NGK_0634"
FT   CDS_pept        526727..526849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0634"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0634"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29325"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKH4"
FT                   /protein_id="ACF29325.1"
FT                   /translation="MQSCGIFLLHFFMVIYMVNFGQTGIYHNGENHYAAVGKSG"
FT   gene            complement(526846..527052)
FT                   /locus_tag="NGK_0636"
FT   CDS_pept        complement(526846..527052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0636"
FT                   /product="Myb protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0636"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29327"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKH5"
FT                   /protein_id="ACF29327.1"
FT                   /translation="MCPFSAHLLPPFPRLSQREIRIPPQRNCLLPSVLHKRQLPTPSAR
FT                   RVDPQSQPPRPTTYTAYRAASHF"
FT   gene            527032..528009
FT                   /locus_tag="NGK_0635"
FT   CDS_pept        527032..528009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0635"
FT                   /product="Putative Phage integrase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0635"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29326"
FT                   /db_xref="GOA:B4RKH6"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKH6"
FT                   /protein_id="ACF29326.1"
FT                   /translation="MRRKRAHGENVVNKKVRADFAFEKVARDWFVRWSKGRSEKYAGQV
FT                   MRNFERWVFPAIGNLDIRQVRTADVVGCLRVMEARGIVDTLRKTKNSLKMVFAFAFAVG
FT                   SGMMEINPVAQIGSGVFERVKTKNMTALSPSELPRLIDFLEQRNEFAVYAGRVHIHPVT
FT                   RFCIYWLLLTMTRIREAALMEWSELDGEVWRIPAERKKERRGHDVPLSRAMRWVLDQAR
FT                   GLNVNGRFVFESVNFQGHINKESPRVAMRRSGLDTTAHGLRSLARTYLREVLKVYNDVA
FT                   EKLLAHSLGTRTQTAYNRSELWEERKDAPERWGNDVLRLADNGK"
FT   gene            complement(528365..528607)
FT                   /locus_tag="NGK_0637"
FT   CDS_pept        complement(528365..528607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0637"
FT                   /product="putative phage associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0637"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29328"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKH7"
FT                   /protein_id="ACF29328.1"
FT                   /translation="METLAFATAPKKGGIRKSGFGRVILIKSGHIVIHNADGDSFATGY
FT                   GVIAADIVSPDLKTDFDIFFPPESLLRYKKIGKKK"
FT   gene            complement(528829..529512)
FT                   /locus_tag="NGK_0638"
FT   CDS_pept        complement(528829..529512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0638"
FT                   /product="putative phage associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0638"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29329"
FT                   /db_xref="InterPro:IPR016868"
FT                   /db_xref="InterPro:IPR024498"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKH8"
FT                   /protein_id="ACF29329.1"
FT                   /translation="MDKEKVLDKIKKCLALGRSANEHEAAQALRQAQALMEKYKVNAED
FT                   IALSKVSEQKADRKMAFKLAGWQWGVANMIADIFGCKSYQRGKTMMFYGIGNRAETSAY
FT                   AFDVVYRQISADRRKFLKTCRAGKPSHRTYLADRFCGGWIASAWETVKKFEMSDEEKAI
FT                   MDGYKKKEYPDMAEARTRDAKSSILQGSKMEYEALTRGMESGKQVKLHYAVNGTGFVKQ
FT                   IGGQT"
FT   gene            complement(529523..530101)
FT                   /locus_tag="NGK_0639"
FT   CDS_pept        complement(529523..530101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0639"
FT                   /product="putative phage associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0639"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29330"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKH9"
FT                   /protein_id="ACF29330.1"
FT                   /translation="MGIERTASKNRENKMQTVATKPTAKQMLAAKRAAKESTRQERAVK
FT                   RAGTVKNVDRNRLSARSKAQKENIARMLSGAKVSEDEALTCGIMMRLVAAKVRRYCGEH
FT                   PGVFDGAAGSRQLERYIKPSEFHAVEIQPEACKALLQNYPAAAGNLGRRKQKKPRVRKR
FT                   ISPSRMARPNRKQSERRMGKGAKLKYRTN"
FT   gene            complement(530170..530385)
FT                   /locus_tag="NGK_0640"
FT   CDS_pept        complement(530170..530385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0640"
FT                   /product="putative phage associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0640"
FT                   /db_xref="EnsemblGenomes-Tr:ACF31274"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJ76"
FT                   /protein_id="ACF31274.1"
FT                   /translation="MSYLEDVKNALRVIDNLCKEALKEPESLEGYIDEIRDKADEADTS
FT                   LEFLKDVINYGISDLKNVIEVFEDCV"
FT   gene            complement(530437..530928)
FT                   /locus_tag="NGK_0641"
FT   CDS_pept        complement(530437..530928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0641"
FT                   /product="putative phage associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0641"
FT                   /db_xref="EnsemblGenomes-Tr:ACF31275"
FT                   /db_xref="InterPro:IPR008840"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJ77"
FT                   /protein_id="ACF31275.1"
FT                   /translation="MTALTLYRCAADVQAALDYYFDSETEREDTLEAVIGQFEVKAQSV
FT                   IAYIKNQEITEKMLEEHIGRMTGKLKAAKARNQSLKDYLARNMQAAGITEIKADDGTFK
FT                   ASFRKSEAVVILDEAQIPAEFMREAVKTEPDKTAIRKAIESGRQVAGAKIEGRKNLQIR
FT                   "
FT   gene            complement(530925..531149)
FT                   /locus_tag="NGK_0642"
FT   CDS_pept        complement(530925..531149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0642"
FT                   /product="putative phage associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0642"
FT                   /db_xref="EnsemblGenomes-Tr:ACF31276"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJ78"
FT                   /protein_id="ACF31276.1"
FT                   /translation="MQLLRTATEKGNKKMANIDLTQWDGKTIGAAANPEQGYINITIGS
FT                   DDLFINIEQAYAIHAALGEAVAEYEGGAQ"
FT   gene            complement(531247..531933)
FT                   /locus_tag="NGK_0643"
FT   CDS_pept        complement(531247..531933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0643"
FT                   /product="putative phage associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0643"
FT                   /db_xref="EnsemblGenomes-Tr:ACF31277"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJ79"
FT                   /protein_id="ACF31277.1"
FT                   /translation="MSLILSVKDESNFKPCPAGSHHATCIRIIDLGTQLVEYQNEQKRQ
FT                   HKILVQWEIDPEGDPEMLMPDGRPYLISRRYTASLHSKSQLATDLKSWRGRDFTPEERD
FT                   NFDLRNILGKPCLLSIAHQESSDGKTTYANISAISNKMKSYTPKHPDNAVFAFDLSDPD
FT                   WANYGLLNEKLREQIAKSPEYAEAVNGRQPPAPPQKQAQAAEGRTEHPQGNAAPAEDIE
FT                   DDIPFN"
FT   gene            complement(532002..532163)
FT                   /locus_tag="NGK_0644"
FT   CDS_pept        complement(532002..532163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0644"
FT                   /product="putative phage associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0644"
FT                   /db_xref="EnsemblGenomes-Tr:ACF31278"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJ80"
FT                   /protein_id="ACF31278.1"
FT                   /translation="MSFHPETAYTGGGETEPYGPSPEEIKYRQSPETAETRRMTEKQAE
FT                   GHIKSIIR"
FT   gene            532193..532657
FT                   /locus_tag="NGK_0645"
FT   CDS_pept        532193..532657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0645"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0645"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29331"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJ81"
FT                   /protein_id="ACF29331.1"
FT                   /translation="MHPPATGFFFIGIQVPLFQPNLGAQFRNFRLLLSQRHAHCRNTGG
FT                   FSLCRTASASLGESEGIARRQYRRQYRELKRNIPCLHFYFLNLKGFNCAPRPLRMVRTV
FT                   RRRGYLRLKSTKTAAAPTPRLTARHSYARYEFASLPMFSASANHSRSSMA"
FT   gene            complement(533348..533824)
FT                   /locus_tag="NGK_0646"
FT   CDS_pept        complement(533348..533824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0646"
FT                   /product="putative phage associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0646"
FT                   /db_xref="EnsemblGenomes-Tr:ACF31279"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJ82"
FT                   /protein_id="ACF31279.1"
FT                   /translation="MEANKFEVKSLSDLIKVFAGIAADFEAAMGVKRADISTEFDEPQH
FT                   EPQPPVTVAEQKGINDFAIGKEVIIRTYSAGVWFGVLEQKAGNEVILTKARRMYSWWAK
FT                   ESISLSGVARHGIRQDGSQICGELDSVWLEAIEIIPVTGGAAESIRTALEVAQS"
FT   gene            complement(533857..534057)
FT                   /locus_tag="NGK_0647"
FT   CDS_pept        complement(533857..534057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0647"
FT                   /product="putative phage associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0647"
FT                   /db_xref="EnsemblGenomes-Tr:ACF31280"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJ83"
FT                   /protein_id="ACF31280.1"
FT                   /translation="MNELISRINRFGARAKDGQSLLLKVGEICRDAAATWTTRKSESIN
FT                   HTAFTFTVKKDGLKEKVMIVL"
FT   gene            complement(534255..534668)
FT                   /locus_tag="NGK_0648"
FT   CDS_pept        complement(534255..534668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0648"
FT                   /product="putative phage associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0648"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29332"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKI8"
FT                   /protein_id="ACF29332.1"
FT                   /translation="MIHLNVHYCDEIIRHAENDKYSLIGIFPDICHIPTPQAILGRLCL
FT                   SVSFSAEGMDIQTMKTGQIFLEIVRNDDVISALEIPSYDGSDTEENVSFMLHQTISGLP
FT                   VSDNDRIYVRMTTHNHILSESRPLSFSWLPYHS"
FT   gene            complement(534665..535102)
FT                   /locus_tag="NGK_0649"
FT   CDS_pept        complement(534665..535102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0649"
FT                   /product="putative phage associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0649"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29333"
FT                   /db_xref="GOA:B4RKI9"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKI9"
FT                   /protein_id="ACF29333.1"
FT                   /translation="MAACTVSTPTSAIPVTHIKCLRINGQIKCVKPISPNTTPAAEHIE
FT                   HVRKNPRRKAAMDRAAARIADKIALKAGGETFVSLRMKKGFTQSELATAAGLPQPYLSR
FT                   IENSKQSLQDKTVQKLANALGVSPLEVRAAFERRYEYMEQA"
FT   gene            complement(535143..535580)
FT                   /locus_tag="NGK_0650"
FT   CDS_pept        complement(535143..535580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0650"
FT                   /product="putative phage associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0650"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29334"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKJ0"
FT                   /protein_id="ACF29334.1"
FT                   /translation="MELTVHFNAEQDLDRLFEKDEEAVGYLENVIAMIQADSAIFDGLY
FT                   KNRYFREYGEPIGPIDLEVKPILSLWGKDIKVLRVRFDSEEAAGYRIIYAPCHEKQPNG
FT                   TYIRRIDILAVVNKKTDEFDYQAEHPITKRIIKDYEELYSN"
FT   gene            complement(535697..536359)
FT                   /locus_tag="NGK_0651"
FT   CDS_pept        complement(535697..536359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0651"
FT                   /product="Putative lambda repressor protein cI, putative
FT                   phage associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0651"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29335"
FT                   /db_xref="GOA:B4RKJ1"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="InterPro:IPR039554"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKJ1"
FT                   /protein_id="ACF29335.1"
FT                   /translation="MFSGEQLGQAISEAIKRKNVSQKEVADHFGVKQPSVSGWIKNGRI
FT                   DKKHLDKLIDYFSDVVTPSHFGIETFRVLKSNEQSSIRFPRLNAEATCGAGTINDHYIE
FT                   VVDYVTVAAAWAREKLGGNLNKIQVITARGDSMEPTIENGDVMFVDTAVEAFDGDGLYL
FT                   LWYIDGLKAKRLQSTVGGGLMIISDNSSYRTETVRGEDLNAVRIIGRIRGAWRLSQF"
FT   gene            536798..536953
FT                   /locus_tag="NGK_0652"
FT   CDS_pept        536798..536953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0652"
FT                   /product="putative phage associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0652"
FT                   /db_xref="EnsemblGenomes-Tr:ACF31281"
FT                   /db_xref="UniProtKB/TrEMBL:B4RJ88"
FT                   /protein_id="ACF31281.1"
FT                   /translation="MKKQDRNRLSKKDRRLIKKAMLKAAAKGCDEVYRIAPGLKDGFEL
FT                   LGKQPD"
FT   gene            complement(536930..537118)
FT                   /locus_tag="NGK_0653"
FT   CDS_pept        complement(536930..537118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0653"
FT                   /product="putative phage associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0653"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29336"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKJ3"
FT                   /protein_id="ACF29336.1"
FT                   /translation="MPSDLSFILAKELIRSGSIRLSGSTAKGQAGELAVFIRTLHQKPE
FT                   ESEPNTDNEYLIGLLSK"
FT   gene            537291..537518
FT                   /locus_tag="NGK_0654"
FT   CDS_pept        537291..537518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0654"
FT                   /product="putative phage associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0654"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29337"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKJ4"
FT                   /protein_id="ACF29337.1"
FT                   /translation="MNQKQTQCKQIVDYIRNKGCITSLEAYQNLKVTQLAARITDLEGR
FT                   GFVFAKPKYKVGNCKNPVAHYSIAKSGIEP"
FT   gene            537515..537652
FT                   /locus_tag="NGK_0655"
FT   CDS_pept        537515..537652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0655"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0655"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29338"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKJ5"
FT                   /protein_id="ACF29338.1"
FT                   /translation="MSREQRIRGARLPVSAYMQAEGAGKAREALDGRVEKVKGVDDEAV
FT                   "
FT   gene            537636..538700
FT                   /locus_tag="NGK_0656"
FT   CDS_pept        537636..538700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0656"
FT                   /product="putative phage associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0656"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29339"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKJ6"
FT                   /protein_id="ACF29339.1"
FT                   /translation="MMKPSESLRAAGRPIAYYPKLAKPLGGVNAAILFGHFFYWNDKTQ
FT                   YESGIYRTAEEIEIETGLSVQEQRTARAKLRERGVLIETEKRIEHRIYYKLNLDAFDDL
FT                   MLQHSGGGESTAPKCNINSPELQNQHSGGGESTAPKCNINSPELQNQHSGSEESTAVIR
FT                   TEDLTEDLAVYTPLPPNAGNGKGGLNADAFVSADAETCGRETGEPTSPKAESDSNGNGG
FT                   LSGKPKNANVPRRRKTHGVPLQEIADLYNEVLGGRLPSVQVLNDTRKRAIANRWCEMLG
FT                   TAAPNGKVRFGDKETGLAWFAGFFRKVAMNPFWMGENQTGFAVGFDWIFKAGNFVKILE
FT                   WHPPKTNQAARGRA"
FT   gene            538697..540058
FT                   /locus_tag="NGK_0657"
FT   CDS_pept        538697..540058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0657"
FT                   /product="Putative replicative DNA helicase, putative phage
FT                   associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0657"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29340"
FT                   /db_xref="GOA:B4RKJ7"
FT                   /db_xref="InterPro:IPR007693"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR019889"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036185"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKJ7"
FT                   /protein_id="ACF29340.1"
FT                   /translation="MNRIEETEAVQSLASVGAEQNILGGILIEPTAIARCAILTPEKFY
FT                   QAQHRIIFRALLDMAAANEPIDIITLNDKLEARGEAENAGGLAYLIDLNQNTPSAKNIS
FT                   RYVGIVNDRFVERGLLKASAAIEKIAVSKDGGTVAEKLSKAADELAAAGKDAVKRETKT
FT                   FGQTVEDLIGGLDKRLDGVRFGLPTGLMKLDGMTGGLPDGNLIVIAARPSMGKTVLAEN
FT                   IARFALKQGKAVHFQSYEMSAVELARRGMAAECNIPMQNLKTGNLTQSDYANMPIYVSQ
FT                   AKEWKFDVNCDLLNVDELCFLAKEKKLTTGLDLLVVDHLHIMPRAGRDEVAELGNISRR
FT                   LKNLAAELNIPVVLVAQLNRGNTKQADKRPNMADIRGSGAIEQDANIIIMPHRESYYDG
FT                   NENPSIAELIIAKNRDGETGTVVCGWKGQFMKFEEEPDLAWQAPKHDEYDPYSV"
FT   gene            540075..540305
FT                   /locus_tag="NGK_0658"
FT   CDS_pept        540075..540305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0658"
FT                   /product="putative phage associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0658"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29341"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKJ8"
FT                   /protein_id="ACF29341.1"
FT                   /translation="MRETCFYCNHADFKTNTGTPVRGFAKCAKARNAEERAKHYPRTNP
FT                   CAAGAFQTASGAAVAKRTAVLGEYPPAMRRI"
FT   gene            540328..540891
FT                   /locus_tag="NGK_0659"
FT   CDS_pept        540328..540891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0659"
FT                   /product="putative phage associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0659"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29342"
FT                   /db_xref="InterPro:IPR021739"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKJ9"
FT                   /protein_id="ACF29342.1"
FT                   /translation="MGISQPTRDLKNALKRKFERKYGMTVQNTQTETVRTEAAPQQGGN
FT                   TNPGYYKNRAFECVGFAQYLNFNLGNAFKYIWRHKEKGGREDLEKALRYLERQRADAPK
FT                   FKKLKCRRYEKMYAGLKDCGFDGGTEAALLAVISAAYYIRDGEDNFAWAAACVEDLLEK
FT                   MPPEAGRAPHPESPMPPETAGGGI"
FT   gene            540888..541049
FT                   /locus_tag="NGK_0660"
FT   CDS_pept        540888..541049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0660"
FT                   /product="putative phage associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0660"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29343"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKK0"
FT                   /protein_id="ACF29343.1"
FT                   /translation="MTRQPDRRHSRRFRHSRAGGNPVRPVSAVSDKFLPRSGFPDSRFR
FT                   GNDGNRRE"
FT   gene            541275..541424
FT                   /locus_tag="NGK_0661"
FT   CDS_pept        541275..541424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0661"
FT                   /product="putative phage associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0661"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29344"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKK1"
FT                   /protein_id="ACF29344.1"
FT                   /translation="MDTLLSIITALSFAGAATLAVWLLVEASDAVLRRKREGKGEDDFD
FT                   GFGY"
FT   gene            541560..542162
FT                   /locus_tag="NGK_0662"
FT   CDS_pept        541560..542162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0662"
FT                   /product="putative phage associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0662"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29345"
FT                   /db_xref="GOA:B4RKK2"
FT                   /db_xref="InterPro:IPR008822"
FT                   /db_xref="InterPro:IPR036614"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKK2"
FT                   /protein_id="ACF29345.1"
FT                   /translation="MQNLPQQGSPAKARGKTRGGGSRRDDGGKAARIHPRRARRLPDIG
FT                   RRPVDATGRGMRVIRLILPYPVSANRYWRIWRNRAVRSAEAAAYKSVVRRIAQGAGAMP
FT                   SEGFVAVRLRLIPKANKDGGANKTVIDLDNALKVALDALQGVAYHNDRQVRRIAADYAD
FT                   EPVAGGGLAVEVGELEMEQTDAADEGWDFIGQEGWDV"
FT   gene            542155..542460
FT                   /locus_tag="NGK_0663"
FT   CDS_pept        542155..542460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0663"
FT                   /product="putative phage associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0663"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29346"
FT                   /db_xref="InterPro:IPR010774"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKK3"
FT                   /protein_id="ACF29346.1"
FT                   /translation="MSSAIRKAAKGGQCTPNIAGVCNDNPETVVLCRFPGETHGAGLKS
FT                   GGLGAGFGCGCRRGAIDGRGAGLSREDKEFYMRRSQLRTIRRLEALGVVGVKGRLK"
FT   gene            542457..542840
FT                   /locus_tag="NGK_0664"
FT   CDS_pept        542457..542840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0664"
FT                   /product="putative phage associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0664"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29347"
FT                   /db_xref="InterPro:IPR008711"
FT                   /db_xref="InterPro:IPR036619"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKK4"
FT                   /protein_id="ACF29347.1"
FT                   /translation="MNGAEFTLTPQNKKQVMRSIWDSPDGWFENGNLEITIRPRKSKRS
FT                   IEQNRRLWFLYREISEKVFIDGRRFSQDVWHEFLKRKFIGCIEMPNGQLMGISTTKLSV
FT                   REMSEYQEKIISWASMEHGVLWD"
FT   gene            542831..543349
FT                   /locus_tag="NGK_0665"
FT   CDS_pept        542831..543349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0665"
FT                   /product="putative phage associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0665"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29348"
FT                   /db_xref="GOA:B4RKK5"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR016177"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKK5"
FT                   /protein_id="ACF29348.1"
FT                   /translation="MGLTQEVLKELLRYDDNTGKLYWAERPRKYFNSGLHYKSWNTGFS
FT                   GKEVFLYKGRLGYLKLKIFKKQYNAHRLIWLFVYGKHASSIDHINRDKTDNRISNLRDV
FT                   THAENMKNRGKFKNNTSGHTGVYFHKPSKKWQARIMVNRKNKILGLFEHIEDAVKAREA
FT                   ASKDFGFVV"
FT   gene            543456..543836
FT                   /locus_tag="NGK_0666"
FT   CDS_pept        543456..543836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0666"
FT                   /product="putative phage associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0666"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29349"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKK6"
FT                   /protein_id="ACF29349.1"
FT                   /translation="MDLHNAEQVVSREALAETTGLKMSEITKFTKLLVEHGKIYRVTRG
FT                   IFKPAIGFGETRPVSVSVLDSGMGVLEIGDTVLHLNPQEMRSLGALMSGFGQQFSSIQM
FT                   GREFSVLRNYLECSAKNGRLDL"
FT   gene            543836..544375
FT                   /locus_tag="NGK_0667"
FT   CDS_pept        543836..544375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0667"
FT                   /product="putative phage associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0667"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29350"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKK7"
FT                   /protein_id="ACF29350.1"
FT                   /translation="MPRLSDEDWRKVELDYRRGVLSIAEIGRKYNVSAQHVGRVAKERV
FT                   WTRDLNDEVQAKARAMVLSADKNGNAPDYADFNLKQVTDAEAKRVAAVQRRHRNLAENL
FT                   SKSAEQIVAELYGSPEDTFTKARMFQTVAAGFKVLVEIERKSYGMDTAESKISESAKTA
FT                   GIRIEFVGPEDDGKDG"
FT   gene            544356..545630
FT                   /locus_tag="NGK_0668"
FT   CDS_pept        544356..545630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0668"
FT                   /product="putative phage associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0668"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29351"
FT                   /db_xref="GOA:B4RKK8"
FT                   /db_xref="InterPro:IPR006437"
FT                   /db_xref="InterPro:IPR035412"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKK8"
FT                   /protein_id="ACF29351.1"
FT                   /translation="MTGKTVDLKLPAKLDGLFKPCRYKVMYGGRGGGKSHGAASALLAL
FT                   GAQRPLRILCVREIQKSMRDTVHRLLKDKVAQLGLGHFYEITDFEIRGANGTLFVFSGL
FT                   QSHTVDSIKSFEGIDIVWVEEGHGVSKKSWDVLTPTIRKEGSEIWITLNPDMETDETYR
FT                   RFIAMPSEDTWLCEINWRDNPWFPEALNRERLKAQRSMNKEDYGNIWEGRPRMVSEGAV
FT                   YRHEIQDAFHSGRVTLVPYDSSLPVHTVWDLGWNDAMTIGLVQRDLTSVRIIGYIEDTH
FT                   RTLDWYVAELEKLPYRWGTDFLPHDGRTRNFQTGKSTMEILTGLGRKSVFVQNATGIEE
FT                   GIRAARMLFPKVYFDKDKTARLLECLKRYGRQIHAKTGVAMGPLHDEYSHGADMFRYLA
FT                   QAVDLMDTGSNTGYTETPVSDWRLY"
FT   gene            545630..547882
FT                   /locus_tag="NGK_0669"
FT   CDS_pept        545630..547882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0669"
FT                   /product="putative phage associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0669"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29352"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKK9"
FT                   /protein_id="ACF29352.1"
FT                   /translation="MGTDVPETGVLPDKNGEPLTIGEYRLFVGEMMNQPAWRAVADKEM
FT                   DYADGRQLDNELLQKQRELGLPPAVENLITPTLLSVQGYEATIRTDWRVTADGETGGRD
FT                   VADALNFKLNRAERQSRADKACSDAFRGQIACGIGWVEVTRNPNPFEFPYECGVIHRNA
FT                   IHWDMKSYKYDLSDARWLIRRRWLLPERLAQFFPEYAGHFKAMGRGGSDWRISGEMLDG
FT                   GGNTGLADAWGISGRNTVSEEFWFNETTRELAVAEVWYRRWVTADCLRDKKTGRTVEFD
FT                   GANPNHREMAANGAVLFAASVPRMRRAFVVGDLVVRDEPTPYPHQKFPYVPFFGFREDN
FT                   TGIPYGYVRNMKYAQDNLNSTNSKLRWGLSAIRTVRTKGIVDMSDEQFRRNIARVDADI
FT                   VLNKIEAAQPGARFDVSRDFELSAQHWQMLQDSRATIRQISGITPSFMGNRGNATSGRQ
FT                   ESIQVEQSNQSLGLVMDNFRQSRSLVGELLLAMIIEDLGSDEQTVVIEGDAVTQGRTVV
FT                   INRPETDPVTGKAYLSNDLQNIRLKVALEDVPSTNSYRSQQLGAMSEAVKSLPPEYQAA
FT                   VLPFMVSLMDIPFKDKVIEKIKEVRVQETPEQIEARIAQAVQDALAKSGNDIKRRELAL
FT                   KEQRTASEIKEIEARAVQIGVQAAYAAMQAGGQIAAMPQIAPVADAVMQGAGYVRPARG
FT                   DDPGFPVPAMPPETQIPPEGIPEAYGADTGPMTAVPPKSANHAQTGMETPTVSDNL"
FT   gene            548119..549315
FT                   /locus_tag="NGK_0670"
FT   CDS_pept        548119..549315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0670"
FT                   /product="putative phage associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0670"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29353"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKL0"
FT                   /protein_id="ACF29353.1"
FT                   /translation="MGLFEPSAGDFWEMKEKEKKEKARKGAEERERAAAQAHRADAVRR
FT                   TVANYEAGPARYRNVMDLSRNNIEDGARRLRRAGAFERGADAGLGFSGGDKALSPDARA
FT                   GADFARRDTRPTDAGGRTPPPLGFDGNVYRDGKPVRDFDAQRPLVSAGPDALSPEEREL
FT                   YRRATTPYAGALNGQLTAAQLNAARGIVAEHNKNAAVRELGRERLAAAAAENAANREAV
FT                   LQKGRFDAAVKANEGALNREMAQRNADRAFDVQQAELGMKRQGFEMKREADALELEDRK
FT                   RIADLTRAYGFAKSDGQRGEIARQIDALNGKFERQGEKGFDPNVFKTISYEVADPDTGL
FT                   TAKREGIVDLRTGKPLDVEFAGEREKRYAALGFKPNGQKTAGGKIIYENEKGEKRVEQ"
FT   gene            549312..556616
FT                   /locus_tag="NGK_0671"
FT   CDS_pept        549312..556616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0671"
FT                   /product="putative phage associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0671"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29354"
FT                   /db_xref="InterPro:IPR040824"
FT                   /db_xref="InterPro:IPR041639"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKL1"
FT                   /protein_id="ACF29354.1"
FT                   /translation="MSDLVRYDPLEHGRLVGGLKEYRGFTQKDARAAADDTALTRGFKN
FT                   SMRSARMGWNALTGDKEELGRLKAEDMDYRKIQEGRKSQARRELGEAWEKGGGVGGGLS
FT                   NVWGELKKDWREKGLDGALEDVGEMAGAVLEQAPNALVPIATTTAGGILGALAGGNAAV
FT                   GAYAGATLGNTLMEYGGQLDRAAEAAGVDPADKDAVMAFIGRGAPGALKNAAVKGAVVG
FT                   AADMAAMKLGGSILNMGKKAAGKAALEKMGVAAADKAAVAAAKGTPEFAALAKESAKGG
FT                   LGGAARHAAAYATESAGEFAGEYLGTGLANGEWDEKGAALEAFSSLGHSAVGFAGTKAY
FT                   AAVTDPLRPPAGRKAGAQGGIGGNRKAGRPAPEGAQALRAAAQAAADGGAEQGGAGFDT
FT                   AHHDQSHPALRQFADRTKQEEAGRFFSGPADGNTPHAEELARGTEKQPDVSGIPSEDGA
FT                   EFLDTGVMPDGLARQYADMAAKYRAKPSEAVGIDPDDGAVSAAAALAADSGAAVPSAVS
FT                   DDMEARSVADDAPSGRSADADRGGVPSAYGNVRPGGAPRGAASVAPGGSAAAASGGIAR
FT                   VSPLPAGQYFDGLDTRGRKALAKEAGLDIKGVADFGQIAAPVRRKIEQAYHARIEADYQ
FT                   AASEAKQGYLPPPVRMADAVPVPKKGFSVPADALDKESRRRFDALPEGVRRHAQTVADY
FT                   TADGIMRREAGMADMRGHYPEGLAESAGAVRAYRAEHPESADVLDRLNRAVYGYRRNNG
FT                   WSVPLLSREGERLQGVRTALPDDGASEAVVGGGRGLTRALPTEDKGLAQDVRQDVRQGL
FT                   TQGGRGLTPDAGADANAAALQGLPGSAAVASGNAPARRQNLQVRARAEGAAPGLSASEN
FT                   LAGTDGGKRAPVAGKRPDTVLPVLNPQVAASAGRVSPKKRMADAAADRRRPEKAGVPLG
FT                   GGEYRFEHTDRRHIDALAGVPGRPGKGGMPEEFADMAGPSNSDGLVSDGRRYLKGREAE
FT                   TLRAGGLSEAVPSEPGRDYRPTQEARAPARVMARPRDAAADGKPAGRAQPARAKDTPVA
FT                   GKAAAAKNAATEKPSSDKVRNIESGKSHFDGGKGKSAAAQGAATEKPSSDKAAKPETFA
FT                   KTASDNPEEARRKARVLQGGPVYTVKERQAPQGFKALREHAENIKKRLAESIGGLAERV
FT                   DVAAVSETAPDKAQMLLSQRVEGWFDGRTGKITLVAENLTPERAVWAAWHELGHRGFAA
FT                   DGFAKYREELERADGNGLIRRIADAVQEGREGTGDAAASVRSAAVEEAVAELYAAQRTG
FT                   GWAGIENRYGVKVGNGLKRGIAGVLARIGALLRRVLQRLAGKAGGAMSDADVFAMLADL
FT                   HGNVEGARDAPWDGNHRAVMFARAEDGAAERSKSESLEKLRRAETIRISGREVPEGGNL
FT                   REYKRNALEYGKSLRGPYVNKDTGREISLGRSGITEILRHDYKDAEHLQSIAAIPQIIE
FT                   NAVYIDTLPNEDLAKNGDIQGYEYYVSGLNVGGADYTVRAAVAVSRNGNRYYDHKLTKI
FT                   EKGNLLSLLDRVSTTGASESKSPLSGIDDKRLLQILQDKDAGKGGIADFDTEAVRFSRA
FT                   ANIGAAISRITGKKSDLRNALKDRWDASKGIQLQFLGRRQIEDIYGGVLDGLKEYGRLS
FT                   ELFGADANKAVTEADKVVREWGRLKEEDAKALADLMHDATLAKVDADPLMRKDARGRLD
FT                   GIRTALDIADGKIAKARAAVASAGARTARADAAYNKAQRAADKAAYALEKAQEKHGREI
FT                   LADEADMRLRRLFYADSEAKRALRRAGADAAAESRAKTDAVRMLEQARADVKRLEKDEV
FT                   GAQKALEGLALLNRRFAGLPDAAQRVYRKARDDYRAHFGQVRDALAERLARAGQDAETV
FT                   RRLKERFDNELGGVYFPLARFGDYLVVVKDADGNSANVSRAETLSEAEKLRDALKADFG
FT                   PGFKVSPVMKSRDYIRSRDAVGSGFMKELGEAVGRMDLDPAQRARLNDTLTQLYLNSLP
FT                   DTSWAKHGIHRKGVPGFSDDARRAYAQNMGSGANYLAKLRYADRMAEQLDVMQDFVDGR
FT                   KYEEGFDQRQLQRVADEMRKRHEAVMNPNPSKLAQALTGFGFLWMMGMSPASAVVNLSQ
FT                   TAMVAYPVMAAKWGYAGAARELLRASKQIGLRFGEKFNTIEDSLNGDEKAAFRKAADYG
FT                   VIDLSQAHDLAGVANGDPGLAGSAWQKVMDKAAWLFHHAEKFNRQVTFVAAYRLAKRAG
FT                   ADSEAAFEQAKKATYDGHFDYAAQNRPRFMMGNAAKVVFLFKQYSQNILYALGRNAYLA
FT                   FKGDKEARKTLAGLLVSHAMASGILGLPFVSTLLAVASMLGSDDDDPWDAEAALRNMLA
FT                   DTFGDKAGEVLAKGFSRLTPLDVSGRLGLDQLVFPDIQDGLEGKKWAESLVVGSTGAVV
FT                   GAGIGAADGVRTRSSVPRTANTLSLMKSW"
FT   gene            556661..557221
FT                   /locus_tag="NGK_0672"
FT   CDS_pept        556661..557221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0672"
FT                   /product="putative phage associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0672"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29355"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKL2"
FT                   /protein_id="ACF29355.1"
FT                   /translation="MRERIAQLEKGAEKPGVETADGSDNSLFGDFSDEDVKKGVEKLIQ
FT                   EKLAGYEADMKRQEAAKAHYREIYTAHPDADSIVESRELEEWLAGQNPLVRKAFNDALK
FT                   DGTAAEVIGAFDMFKAAKSAAEPEKPAEKPPAGKNTPNTLSDIPAGRDHTASDGPPDYL
FT                   SGNALAEKLASMTEEQVEKFLNS"
FT   gene            557242..558537
FT                   /locus_tag="NGK_0673"
FT   CDS_pept        557242..558537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0673"
FT                   /product="putative phage associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0673"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29356"
FT                   /db_xref="InterPro:IPR025267"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKL3"
FT                   /protein_id="ACF29356.1"
FT                   /translation="MAQKTNTAYGDPQAMMRQAAGLFAMHMQRNSTLNRLAGKMPAGTA
FT                   GAEATLRKQTTQHMPVVRCQDLTRGMGDEIRFNLVNPVSALPIMGDNTAEGRGVGMSLS
FT                   EAGLRVNQARFPVDGGGTMTNQRSPADYRALIRPAAQSLMDRYADQTLLVHMAGARGFH
FT                   DNIEWGVPLAGDPKFNDYAVNPVKAPSKNRHFTASGDAVTGVGQDGGELKIASTDLFTM
FT                   DTVDSMRTVLDQIPLPPPIVKFEGDKAAGDSPLRVWLLSPAQYNRFAADPKFRQLQASA
FT                   IARASQANQNPLFLGDAGLWNGFILVKMPRPIRFYAGDEMKYCADKFSEAESGLKIPAS
FT                   FADKFAVDRSVILGGQAVLEAFANTGKHGGMPFFWSEKELDHGNRVETLVGTIRGVAKT
FT                   RFAVDVGGGAKEITDYGVTVVDTVVPLHGGIR"
FT   gene            558607..559065
FT                   /locus_tag="NGK_0674"
FT   CDS_pept        558607..559065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0674"
FT                   /product="putative phage associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0674"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29357"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKL4"
FT                   /protein_id="ACF29357.1"
FT                   /translation="MRNNGGNRFGGVPYGNLAAEHYRIVAKQDGAILGADAYGPPKDGD
FT                   VLALGVLEQGFRLDDAQIIVKTAMSSGITADVGFAYADGADDAHVPQDAAYFASGADFA
FT                   SAGRIRCQSAKLVTLPKQALLTVTLKGAENKKAADIDILIYGEKFGQL"
FT   gene            559071..559556
FT                   /locus_tag="NGK_0675"
FT   CDS_pept        559071..559556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0675"
FT                   /product="putative phage associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0675"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29358"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKL5"
FT                   /protein_id="ACF29358.1"
FT                   /translation="MKRRPGICLCGVAVFDNAVRTAAGGWMDKVFIKYIGGRAVWRDRI
FT                   YHTGLVFEDGQVREVSAGAAAKLLRHGDVFAAVPGKRVEKADDTEALEKAGASELERET
FT                   AAFDAVQDVILQINRMGKDELELYAKANYGQGLDKRKSAENLRGDVVRMVRQFGIAQ"
FT   gene            559553..559828
FT                   /locus_tag="NGK_0676"
FT   CDS_pept        559553..559828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0676"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0676"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29359"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKL6"
FT                   /protein_id="ACF29359.1"
FT                   /translation="MNLKALIARFRVLANDKAEPYFWSDEEVSGWLNDAVHEACLRGRL
FT                   LHSDDAFVTDVEKGRPLYAYAAGGLRRVMRMKSTVSVLCPTASRCA"
FT   gene            559819..560226
FT                   /locus_tag="NGK_0677"
FT   CDS_pept        559819..560226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0677"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0677"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29360"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKL7"
FT                   /protein_id="ACF29360.1"
FT                   /translation="MCLKLVSPEAADVCAPGWRDGAQTGLPVYAVQGDGKLTLAPAPDR
FT                   DGRLFAGGYCLPRDMAGDGDEPEINSIHHRNLVYWALAEAFSIPDAETFDPQRSESARR
FT                   RFELYFGLPADSDLRRITREDAPHLNRHFWI"
FT   gene            560229..560378
FT                   /locus_tag="NGK_0678"
FT   CDS_pept        560229..560378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0678"
FT                   /product="putative phage associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0678"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29361"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKL8"
FT                   /protein_id="ACF29361.1"
FT                   /translation="MSAEEFCRKQIAYWLNESRKASDNADLKAFEFAGREPADYREMLK
FT                   RYAA"
FT   gene            complement(560415..561260)
FT                   /locus_tag="NGK_0679"
FT   CDS_pept        complement(560415..561260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0679"
FT                   /product="putative phage associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0679"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29362"
FT                   /db_xref="InterPro:IPR003497"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKL9"
FT                   /protein_id="ACF29362.1"
FT                   /translation="MNAVQVLNFQQNSVRTVADNKGELWFLANDVCEILGYTNPRRTVD
FT                   LHCKSRGVTKRYTPTASGEQEMTYINEPNLYRLIIKSRKPAAEAFEEWVMETVLPAIRK
FT                   TGGYQITPKTTADDRTGLRRAVAALVGRKGIDYSSAYSMIHQRFNVESVEDLPAGKLPE
FT                   AVAYVHALTLHTGLTGEVLDAPPKAEPKLPIDGNSLADIAAMVYYGTWMIESGKDISAP
FT                   LKQLGCRQAVTMWTVWHETRSILKRSAAALEVLRGYADKDASDRIAACLEGIYGKATVR
FT                   "
FT   gene            complement(561420..561587)
FT                   /locus_tag="NGK_0680"
FT   CDS_pept        complement(561420..561587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0680"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0680"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29363"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKM0"
FT                   /protein_id="ACF29363.1"
FT                   /translation="MVNEKLAENRKRYEQKRVIKKVSFNAETEKELLEYAQNLDFSQWV
FT                   KSIIKEKIKK"
FT   gene            561821..561970
FT                   /locus_tag="NGK_0681"
FT   CDS_pept        561821..561970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0681"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0681"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29364"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKM1"
FT                   /protein_id="ACF29364.1"
FT                   /translation="MDTFKVNHSPQQNQRKMPSEGLSDGIKKPPSLRLGGGRAILRTLF
FT                   GFVL"
FT   gene            complement(562067..562273)
FT                   /locus_tag="NGK_0682"
FT   CDS_pept        complement(562067..562273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0682"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0682"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29365"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKM2"
FT                   /protein_id="ACF29365.1"
FT                   /translation="MTQPEQKRTALNQGGFALRRKRQDSTKFYFIDLNTFISYKNLIYH
FT                   KNSHIQKSWSNYCITLLEGCRVM"
FT   gene            complement(562381..562527)
FT                   /locus_tag="NGK_0683"
FT   CDS_pept        complement(562381..562527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0683"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0683"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29366"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKM3"
FT                   /protein_id="ACF29366.1"
FT                   /translation="MPSETKVQTAFSHQNVPADKTRLPRIPDPNRIKRSNGFGHYGKSP
FT                   SQK"
FT   gene            complement(562547..562849)
FT                   /locus_tag="NGK_0684"
FT   CDS_pept        complement(562547..562849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0684"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0684"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29367"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKM4"
FT                   /protein_id="ACF29367.1"
FT                   /translation="MKTVPTILTGILLATALPASAHGMHKSKPLAMDELPPICQQYFKR
FT                   TETCYNKAGNKADFARNNTKFLFQALPAADLGQRKQMCQIAMDSFAEKTRNLNCE"
FT   gene            complement(563146..565371)
FT                   /locus_tag="NGK_0685"
FT   CDS_pept        complement(563146..565371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0685"
FT                   /product="putative isocitrate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0685"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29368"
FT                   /db_xref="GOA:B4RKM5"
FT                   /db_xref="InterPro:IPR004436"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKM5"
FT                   /protein_id="ACF29368.1"
FT                   /translation="MTQKSTIVYTHTDEAPALATQSLLPIVQAFARHADIDVKTADISL
FT                   SGRILAAFPEYLTEAQRVPDALAELGELVKQPGANVIKLPNISASVPQLTAAIKELQSK
FT                   GFAVPDYPADPQTDEEKAVRERYDRIKGSAVNPVLREGNSDRRAPKAVKNFAKKNPHSM
FT                   GAWAKDSKTHVATMQSGDFFHNEQSVTVPDATSVSIVFTDKQGNKKELREPVALKAGEI
FT                   IDAAVMSKKALLAFLAEQVKDAKAKGVLFSLHMKATMMKVSDPIIFGHAVKVFFAPVFE
FT                   KFGGKLAAAGVNVNNGFGNLIANLDKLDADTRAAVEAEIAAVYAANPDLAMVDSDKGIT
FT                   NLHVPSDVIVDASMPAMIRNSGRMWDKNGKAQDTKAVIPDSSYAGVYQATIDFCREHGA
FT                   FDPTTMGTVPNVGLMAQAAEEYGSHNKTFEIEADGQVQVIDAAGNVLMQHDVEAGGIWR
FT                   MCQTKDAPVKDWVQLAVNRARLSNTPAVFWLDENRPHDKSLLAKVKAYLAELDTNGLDI
FT                   RVLAPEEAAKFSLGRLKNGEDTISVTGNVLRDYLTDLFPILELGTSAKMLSIVPLMNGG
FT                   GMFETGAGGSAPKHVQQFLEENHLRWDSLGEFLALAVSFEHLAQKTGNAKAQVLADTLD
FT                   AATEKLLLNDKSPKRKAGELDNRGSHFYLTLYWAQELAAQDKDAELKAAFAPLAAALTA
FT                   DEAKIVEELSAVQGKAVDIGGYYAANPEKAAQAMRPSATFNQVLNAL"
FT   gene            complement(565438..565611)
FT                   /locus_tag="NGK_0686"
FT   CDS_pept        complement(565438..565611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0686"
FT                   /product="serine/arginine repetitive matrix 2"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0686"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29369"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKM6"
FT                   /protein_id="ACF29369.1"
FT                   /translation="MPNIKINFTENVPPHIRHNAADAAAKRGKAISPFLSRRRVQTRQD
FT                   RTKREQSRQNMP"
FT   gene            565701..566837
FT                   /locus_tag="NGK_0687"
FT   CDS_pept        565701..566837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0687"
FT                   /product="Lst"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0687"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29370"
FT                   /db_xref="InterPro:IPR012477"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKM7"
FT                   /protein_id="ACF29370.1"
FT                   /translation="MGLKKVCLTVLCLIVFCFGIFYTFDRVNQGERNAVSLLKDKLFNE
FT                   EGKPVNLIFCYTILQMKVAERIMAQHPGERFYVVLMSENRNEKYDYYFNQIKDKAERAY
FT                   FFYLPYGLNKSFNFIPTMAELKVKSMLLPKVRRIYLASLEKVSIAAFLSTYPDAEIKTF
FT                   DDGTNNLIRESSYLGDEFYVNGAIKRNFARMMIGDWSIAKTRNASDEHYTIFKGLKNIM
FT                   DDGRRKMTYLPLFDASELKAGDETGGTVRILLGSPDKEMKEISEKAAKNFNIQYVAPHP
FT                   RQTYGLSGVTALNSPYVIEDYILREIKKNPHTRYEIYTFFSGAALTMKDFPNVHVYALK
FT                   PASLPEDYWLKPVYALFRQADIPILAFDDKNQSHGKSK"
FT   gene            complement(566980..567438)
FT                   /locus_tag="NGK_0688"
FT   CDS_pept        complement(566980..567438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0688"
FT                   /product="putative C-type cytochrome"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0688"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29371"
FT                   /db_xref="GOA:B4RKM8"
FT                   /db_xref="InterPro:IPR002321"
FT                   /db_xref="InterPro:IPR010980"
FT                   /db_xref="InterPro:IPR012127"
FT                   /db_xref="InterPro:IPR015984"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKM8"
FT                   /protein_id="ACF29371.1"
FT                   /translation="MKTQISLAATALALFLSACGNGGAPAQPKGEISENRTAAFKSMMP
FT                   DFSRMGKMVKGEEPYDVEKFKQAAAAFAESSKKPFTLFESDPQGNGRALPAVWSDGAKF
FT                   EAEKTKFAAAVEKLNAAAQTGKLDEIKAAYGETGASCKSCHDSFRAPE"
FT   gene            567557..568378
FT                   /locus_tag="NGK_0689"
FT   CDS_pept        567557..568378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0689"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0689"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29372"
FT                   /db_xref="GOA:B4RKM9"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKM9"
FT                   /protein_id="ACF29372.1"
FT                   /translation="MAVLITGASAGFGEAMCRTFVGAGYRVIGAARRADRLQALADELG
FT                   ALFYPLEMDVSCRESVENVLNGIPDEFSDIDCLINNAGLALGLDTADKADFEDWETMIQ
FT                   TNVLGLTFLTRKILPQMVERGGGYVMNLGSIAGNYAYAGSNVYGATKAFVRQFSLNLRA
FT                   ELADKNIRVTNIEPGLCGNTEFSNVRFKGDNERVAGVYEGVEFIRPEDIAETALWLYRR
FT                   PAHMNVNTIEIMPVAQTFAGMKVIKTAVPEVREDFEKQSMSLFSRIRSWFK"
FT   gene            complement(568429..568998)
FT                   /locus_tag="NGK_0690"
FT   CDS_pept        complement(568429..568998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0690"
FT                   /product="putative acyl-CoA hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0690"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29373"
FT                   /db_xref="GOA:B4RKN0"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR033120"
FT                   /db_xref="InterPro:IPR040170"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKN0"
FT                   /protein_id="ACF29373.1"
FT                   /translation="MRICPAPDLVCLKWVKLRTSRLPVSGRGAGPIYISIKQGNFMQHE
FT                   EGNRQRPQGELLLRTVAMPRDTNPNQDIFGGWIMSQMDLGGGILAAEIARGRIVTVAVQ
FT                   EMNFIRPVKVGNVVCCYGHCVRVGNTSLQLKVEVWVKTLMNDCVTEDRHLVTEAVFTYV
FT                   AIDAEGNPRPIPKEGNPKLSGLLPTP"
FT   gene            569454..569591
FT                   /locus_tag="NGK_0691"
FT   CDS_pept        569454..569591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0691"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0691"
FT                   /db_xref="EnsemblGenomes-Tr:ACF31282"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKN1"
FT                   /protein_id="ACF31282.1"
FT                   /translation="MNRWASVRHSHQSNISTVFIESIESAPFDNLTLCNRTVIPTEVGI
FT                   "
FT   gene            complement(569608..569754)
FT                   /locus_tag="NGK_0692"
FT   CDS_pept        complement(569608..569754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0692"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0692"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29374"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKN2"
FT                   /protein_id="ACF29374.1"
FT                   /translation="MTRSPFTGAGQVRGNTRTAIADNTAISKPVIPAQAGIRTPDAAGI
FT                   YRK"
FT   gene            complement(569796..570506)
FT                   /locus_tag="NGK_0693"
FT   CDS_pept        complement(569796..570506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0693"
FT                   /product="OpaD"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0693"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29375"
FT                   /db_xref="GOA:B4RKN3"
FT                   /db_xref="InterPro:IPR003394"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKN3"
FT                   /protein_id="ACF29375.1"
FT                   /translation="MQADLAYAAERITHDYPEPTGTGKNKISTVSDYFRNIRTHSIHPR
FT                   VSVGYDFGGWRIAADYARYRKWNNNKYSVSIKELKRRKNSTSGGGSQLNIKHRKTEHQE
FT                   NGTFHAVSSLGLSAVYDFRPNDKFKPYIGVRVAYGHVRHGIDSTKKITGTLTAYPNDAD
FT                   AAATVYPDGHPQKNTYQKSNSSRRLGFGAMAGVGIDVAPGLTLDAGYRYHNWGRLENTR
FT                   FKTHEASLGVRYRF"
FT   gene            complement(570654..570770)
FT                   /locus_tag="NGK_0694"
FT   CDS_pept        complement(570654..570770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0694"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0694"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29376"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKN4"
FT                   /protein_id="ACF29376.1"
FT                   /translation="MSRGGATPYRFLLIRHIVLKHRPEPDIIRPSTSVKIFF"
FT   gene            complement(571005..572522)
FT                   /locus_tag="NGK_0695"
FT   CDS_pept        complement(571005..572522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0695"
FT                   /product="putative serotype-1-specific antigen"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0695"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29377"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKN5"
FT                   /protein_id="ACF29377.1"
FT                   /translation="MSIWQIPTNPAQTKPYTSKGGLQLGDKGTLYTRLGKLLKVDGTAI
FT                   TDGKLYMSARGKGAGYLNSTGRHVPFLSAAKIGQDYSFFKNIETDGGLLASLDSVEKTA
FT                   GSEGDTPSYYVRRGNAARTASAAAHSAPAGLKHAVEQGGSNLENLMVELDASESSATPE
FT                   TVETAVADRTDMPGIRLRRTTFRTAAAVQHANTADGVRIFNSLAATVYADSAAAHADMQ
FT                   GRRLKAVSDGLDHNGTGLRVIAQTQQDGGTWKQGGVEGKMRGSTQTIGIAAKTGENTTA
FT                   AATLGIGRSTWSENSANAKTDSISLFAGIRHDVGDIGYLKGLFSYGRYKNSISRSTGAD
FT                   EYAEGSVNGTLMQLGALGGVNVPFAATGDLTVEGGLRHDLLKQDAFAEKGSALGWSGNS
FT                   LTEGTLVGLAGLKLSQPLSDKAVLSATAGVERDLNGRDYAVTGGFTGAAAATGKTGARN
FT                   MPHTRRVAGLGVDVEFGNGWNGLARYSYTGSKQYGNHSGQIGVGYRF"
FT   gene            complement(573234..573443)
FT                   /locus_tag="NGK_0696"
FT   CDS_pept        complement(573234..573443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0696"
FT                   /product="putative outer membrane peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0696"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29378"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKN6"
FT                   /protein_id="ACF29378.1"
FT                   /translation="MSAAIRNAWVKLGERGVRIVNNSFGTTSRAGTADHFQIANSEEQY
FT                   RQTLLDYSGGDKTDEGIRLMQQSD"
FT   gene            complement(573443..573688)
FT                   /locus_tag="NGK_0697"
FT   CDS_pept        complement(573443..573688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0697"
FT                   /product="autotransporter serine protease (AusP)"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0697"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29379"
FT                   /db_xref="GOA:B4RKN7"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKN7"
FT                   /protein_id="ACF29379.1"
FT                   /translation="MRKEAPEDRGGKDIEASLDNEAVIETEAKPTDIRHVKEIGHIDVV
FT                   SHIIGGRSVDGRPAGGIAPDATLHIMNTHDGTKNEK"
FT   gene            complement(573669..573881)
FT                   /locus_tag="NGK_0698"
FT   CDS_pept        complement(573669..573881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0698"
FT                   /product="autotransporter serine protease (AusP)"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0698"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29380"
FT                   /db_xref="GOA:B4RKN8"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKN8"
FT                   /protein_id="ACF29380.1"
FT                   /translation="MTNIKNMINLKPAIEAGYTGRGVEVGIVDTGESVGSISFPELYGR
FT                   KEHGYNENYKNKLQKLYGVYAEGSA"
FT   gene            complement(573878..574156)
FT                   /locus_tag="NGK_0699"
FT   CDS_pept        complement(573878..574156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0699"
FT                   /product="putative serotype-1-specific antigen"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0699"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29381"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKN9"
FT                   /protein_id="ACF29381.1"
FT                   /translation="MALAVATTLSACLGGGGGGTSAPDFNAGGTGIGSNSRATIAESAA
FT                   VSYAGIKNEMCKDRSMLCAGRDDVAVTDRDAKIKAPESAYQRLFKPK"
FT   gene            complement(574343..574690)
FT                   /locus_tag="NGK_0700"
FT   CDS_pept        complement(574343..574690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0700"
FT                   /product="MafI protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0700"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29382"
FT                   /db_xref="InterPro:IPR024445"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKP0"
FT                   /protein_id="ACF29382.1"
FT                   /translation="MRKSRLSRYKQNKLIELFVAGVTARTAAEPDSIVYTDCYRSYDVL
FT                   DAGEFSHFRINHSTHFAERQNHINGIGNFWNRAKRHLRKFDGIPKEHFEPYLKECERRF
FT                   NNSEIKVLVPF"
FT   gene            complement(574842..575165)
FT                   /locus_tag="NGK_0701"
FT   CDS_pept        complement(574842..575165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0701"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0701"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29383"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKP1"
FT                   /protein_id="ACF29383.1"
FT                   /translation="MFLDDVNVFLDDLNTNPITDEWYMSNFADKHIKILESYEAFDILK
FT                   QFVDYMIEEHDEKSEYEIMEILRQLKYQADTNEKFYTNTQKQKIVELYKQEISQDILNE
FT                   IFR"
FT   gene            complement(575168..575302)
FT                   /locus_tag="NGK_0702"
FT   CDS_pept        complement(575168..575302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0702"
FT                   /product="MafB-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0702"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29384"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKP2"
FT                   /protein_id="ACF29384.1"
FT                   /translation="MSDTKNGWLAKDGWVKRVQNINKVEIHYIENTRTGEKTDFKFKD"
FT   gene            complement(575514..575693)
FT                   /locus_tag="NGK_0703"
FT   CDS_pept        complement(575514..575693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0703"
FT                   /product="MafB5"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0703"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29385"
FT                   /db_xref="InterPro:IPR008106"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKP3"
FT                   /protein_id="ACF29385.1"
FT                   /translation="MSLLQDSAFAVKDGINSARQWADAHPNITATAQTALAVAEAAGTV
FT                   WRGKKVELNPTKWD"
FT   gene            complement(576112..576237)
FT                   /locus_tag="NGK_0704"
FT   CDS_pept        complement(576112..576237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0704"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0704"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29386"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKP4"
FT                   /protein_id="ACF29386.1"
FT                   /translation="MVYRENIRNDKIMKAIHCQIIIIILDILSNEKKYFSQCKPL"
FT   gene            complement(577159..578565)
FT                   /locus_tag="NGK_0705"
FT   CDS_pept        complement(577159..578565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0705"
FT                   /product="MafB2"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0705"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29387"
FT                   /db_xref="InterPro:IPR008106"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKP5"
FT                   /protein_id="ACF29387.1"
FT                   /translation="MNLPIQKFMMLFAAAISLLQIPISHANGLDARLRDDMQAKHYEPG
FT                   GKYHLFGNGRGSVKNRVCAVQTFDATAVGPILPITHERTGFEGIIGYETHFSGHGHEVH
FT                   SPFDNHDSKSTSDFSGSVDGGFTVYQLHRTGSEIHPADGYDGPQGGGYPEPQGARDIYS
FT                   YHIKGTSTKTKINTVPQAPFSDRWLKENAGAASGFLSRADEAGKLIWENNPNQNWWGNR
FT                   MDDVRGIIQGAVNPFLTGFQGVGIGAITDSAVSPVTDTAAQQTLQGINDLGNLSPEAQL
FT                   AAASLLQDSAFAVKDGINSARQWADAHPNITATAQTALAVAEAAGTVWRGKKVELNPTK
FT                   WDWVKNTGYKKPAARHMQTVDGEMAGGNRPLESKNTVTTNNFFENTGYTEKVLRQASNG
FT                   DYHGFPQSVDAFSENGTVIQIVGGDNIVRHKLYIPGSYKGKDGNFEYIREADGKINHRL
FT                   FVPNQQLPEK"
FT   gene            578685..578819
FT                   /locus_tag="NGK_0706"
FT   CDS_pept        578685..578819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0706"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0706"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29388"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKP6"
FT                   /protein_id="ACF29388.1"
FT                   /translation="MGRSYPYDCRMVGYLYPTKIFDASIVSEMPLLENVGFENPTYGC"
FT   gene            complement(578807..578923)
FT                   /locus_tag="NGK_0707"
FT   CDS_pept        complement(578807..578923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0707"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0707"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29389"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKP7"
FT                   /protein_id="ACF29389.1"
FT                   /translation="MAIYDLNEIVTRAALGIYKGKWRNMDFEQVLQNIVQQP"
FT   gene            complement(579473..580342)
FT                   /locus_tag="NGK_0708"
FT   CDS_pept        complement(579473..580342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0708"
FT                   /product="MafB5"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0708"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29390"
FT                   /db_xref="InterPro:IPR008106"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKP8"
FT                   /protein_id="ACF29390.1"
FT                   /translation="MDDIRGIVQGAVNPFLTGFQGLGVGAITDSAVNPVTYAAARKTLQ
FT                   GIHNLGNLSPEAQLAAASLLQDSAFAVKDGINSARQWADAHPNITATAQTALAVAEAAT
FT                   TVWRGKKVELNPTKWDWVKNTGYKKPAARHMQTLDGEMAGGNKPAKQATPNGKAGVSTQ
FT                   QSLQNSLVPQKNYTHTTYNGGSAITDGKYITDPLSMVRHKPDASSLDKIDSKSLFKSDV
FT                   DAEKATLDAARYADKHNLWDSQNKAKVPTNDVVGYTDGKPTHIINIYRRKPNKDGIRPV
FT                   HGTPGKER"
FT   gene            581385..581513
FT                   /locus_tag="NGK_0709"
FT   CDS_pept        581385..581513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0709"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0709"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29391"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKP9"
FT                   /protein_id="ACF29391.1"
FT                   /translation="MNNILNRNFYGFTRISITNCYNFYFIKVYCCIIKIEIASWEI"
FT   gene            complement(581532..581984)
FT                   /locus_tag="NGK_0710"
FT   CDS_pept        complement(581532..581984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0710"
FT                   /product="MAFB alternative C-terminus"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0710"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29392"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKQ0"
FT                   /protein_id="ACF29392.1"
FT                   /translation="MQTKALGTVDEIGNTVQQVGKQTSGQKTSGGNPAIDSDPYSPSSV
FT                   SARIEAGKVRSDLQIKDILSNTTQRSKTKGPAVQYDKVGDYNDALNDFNSLNVRNVQTR
FT                   PNGTITGNLPDGRAVNVRNDSSGGEPTLEITISNNRKIKIRYGNTR"
FT   gene            complement(582512..582871)
FT                   /locus_tag="NGK_0711"
FT   CDS_pept        complement(582512..582871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0711"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0711"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29393"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKQ1"
FT                   /protein_id="ACF29393.1"
FT                   /translation="MMTEPHGYPSNNLPVKIINDIIYATQLVEDLVLGKIKIVDFLKSY
FT                   NNFYYWLGFDELPQSEKIKFLNYLNILSIHKEIQDKTVNRVYTDCFDIDKLHSLDRITT
FT                   NECINGIKKSIKKTN"
FT   gene            complement(583064..584593)
FT                   /locus_tag="NGK_0712"
FT   CDS_pept        complement(583064..584593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0712"
FT                   /product="adhesin MafB"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0712"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29394"
FT                   /db_xref="InterPro:IPR008106"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKQ2"
FT                   /protein_id="ACF29394.1"
FT                   /translation="MNLPIQKFMMLFAAAISLLQIPISHANGLDARLRDDMQAKHYEPG
FT                   GKYHLFGNGRGSVKNRVCAVQTFDATAVGPILPITHERTGFEGIIGYETHFSGHGHEVH
FT                   SPFDNHDSKSTSDFSGSVDGGFTVYQLHRTGSEIHPADGYDGPQGGGYPPPGGARDIYS
FT                   YYVKGTSTKTKINTVPQAPFSDRWLKENAGAASGFFSRADEAGKLIWENNPDKNWRANR
FT                   MDDVRGIIQGAANPFLTGFQGLGVGAITDSAVNPVTYAAAQQTLQGIHDLGNVSPAAQL
FT                   AAASLLQDSAFAVKDSINSAKQWADAHPNITATAQTALAVAEAAATVWRGKKVKLNPTK
FT                   WDWVKNTGYKKPAARPMQTVDGEMAGKNKPPKPSTQQHSTHSDNNIGLPAPYVKPDTSI
FT                   SPTGTIQDRIRWTKSKFPTEKSLNGHFKAHGKEFGDITIEDYQKMASDLLSKQTSDKIL
FT                   GYQTEHRRVRYDINNNIYVLANPKTFKIKTMFKPDLGKEYYDGEFKKDMGN"
FT   gene            complement(584633..585595)
FT                   /locus_tag="NGK_0713"
FT   CDS_pept        complement(584633..585595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0713"
FT                   /product="adhesin MafA"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0713"
FT                   /db_xref="EnsemblGenomes-Tr:ACF31283"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKQ3"
FT                   /protein_id="ACF31283.1"
FT                   /translation="MRARLLIPILFSVFILSACGTLTGIPSHGGGKRFAVEQELVAASA
FT                   RAAVKDMDLQALHGRKVALYIATMGDQGSGSLTGGRYSIDALIRGEYINSPAVRTDYTY
FT                   PRYETTAETTSGGLTGLTTSLSTLNAPALSRTQSDGSGSRSSLGLNIGGMGDYRNETLT
FT                   TNPRDTAFLSHLVQTVFFLRGIDVVSPANADTDVFINIDVFGTIRNRTEMHLYNAETLK
FT                   AQTKLEYFAVDRTNKKLLIKPKTNAFEAAYKENYALWMGPYKVSKGIKPTEGLMVDFSD
FT                   IRPYGNHTGNSAPSVEADNSHEGYGYSDEAVRQHRQGQP"
FT   gene            complement(585665..586042)
FT                   /locus_tag="NGK_0714"
FT   CDS_pept        complement(585665..586042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0714"
FT                   /product="putative IS1016 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0714"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29395"
FT                   /db_xref="InterPro:IPR024445"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKQ4"
FT                   /protein_id="ACF29395.1"
FT                   /translation="MRKSRLSRYKQNKLIELFVAGVTARTAAEPDSIVYTDCYRRYDVL
FT                   DAGEFSHFRINHSTHFAERQNHINGIGNFWNRAKRHLRKFDGIPKEHFEPYLKECERRF
FT                   NNSEIKVQISILKQLVKSSLS"
FT   gene            complement(586150..586344)
FT                   /locus_tag="NGK_0715"
FT   CDS_pept        complement(586150..586344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0715"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0715"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29396"
FT                   /db_xref="InterPro:IPR007423"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKQ5"
FT                   /protein_id="ACF29396.1"
FT                   /translation="MKHKLASWWKTIKLTANLMAGVPDYENYVAQQRKHNPNAPVMNKL
FT                   QFQDYCRKRRCGANGGRCC"
FT   gene            complement(586334..588415)
FT                   /locus_tag="NGK_0716"
FT   CDS_pept        complement(586334..588415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0716"
FT                   /product="CstA"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0716"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29397"
FT                   /db_xref="GOA:B4RKQ6"
FT                   /db_xref="InterPro:IPR003706"
FT                   /db_xref="InterPro:IPR025299"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKQ6"
FT                   /protein_id="ACF29397.1"
FT                   /translation="MKSLKTFLIWGIVVLVGLASFTTLALSRGEQVSAVWMVTAAISVY
FT                   CIAYRFYSLYIANRVMRLDPNRLTPAERHNDGLDYVPTHKGVLFGHHFAAIAGAGPLVG
FT                   PVLAAQMGYLPGTLWIIFGVVFAGAVQDMTVLFVSMRRDGKSLGDIVKQELGTVPGVIA
FT                   SIGILMIMVIIMAVLALIVVKALVHSPWGTFTIAATMPIALFMGIYTRHIRPGKIGEIS
FT                   IVGFILLMLAVIYGEDVAKSSIGHWFDLDGIQLTWAIMIYGFVASVLPVWLLLTPRDYL
FT                   STFLKIGTIAALALGIVIVNPALQMPAVTHFIDGSGPVFSGALFPFLFITIACGAVSGF
FT                   HALISSGTTPKMLENETHVRMIGYGGMLMESFVAIMALAAAASLDPGVYFAMNSPAALI
FT                   GTDANTAAEVITTKLNFPVDAATLLHTAKEVGENTILSRTGGAPTLAVGMAHIMSRLIP
FT                   GEAMMAFWYHFALLFEALFILTAVDAGTRVARFMIQDLGSIFYKPFGNTDSIPANLIAT
FT                   FFAVALWGYFLYTGVTDPLGGINSLWPLFGIANQMLAGVALIMCAVVLIKMKRDRYVWV
FT                   ALVPAVGVLLVTCYAGLQKLFHNDPRASFLAHAGKYSDALAKNEVLAPAKDIGEMAQII
FT                   FNDKINAGLTILFLSVVVTVAAYGLRTALKARKVGWPTAKEIPAVYRDGKQPEEQSEA"
FT   gene            588889..589011
FT                   /locus_tag="NGK_0717"
FT   CDS_pept        588889..589011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0717"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0717"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29398"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKQ7"
FT                   /protein_id="ACF29398.1"
FT                   /translation="MSSCVLKHIFFLLGSFYEYQVFRADRIGFVFGGLCRAGSV"
FT   gene            complement(589079..589816)
FT                   /locus_tag="NGK_0718"
FT   CDS_pept        complement(589079..589816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0718"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0718"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29399"
FT                   /db_xref="InterPro:IPR009888"
FT                   /db_xref="InterPro:IPR037891"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKQ8"
FT                   /protein_id="ACF29399.1"
FT                   /translation="MDTDNETLGTTVLQALANSRTFVYDSSEDQDFFDTEKFRQRYEDW
FT                   VANLCGNLGYKTRRALFKNMMSGDIWLHNGCLKISPSRHVKPEAWDAIDADDVILSLDN
FT                   SPEEIGAGLKLALSRCRQDKPRTKRKIIRHARKPPEPADGQNKTGIKNRPKNPDGGSNR
FT                   LPRLTGAAGSFDRIAVGIGKAEKGFAAFLVPLGSVSEQTVFGGIAFAGCGNVGREDGTP
FT                   AVQPQRDFAAVQIADAHRQTVLA"
FT   gene            590017..590241
FT                   /locus_tag="NGK_0719"
FT   CDS_pept        590017..590241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0719"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0719"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29400"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKQ9"
FT                   /protein_id="ACF29400.1"
FT                   /translation="MLLIYCTLSKGCITFLSKDYYRIKSIFLKRQGCARAIFKHRPDVA
FT                   LPDRMLQTASEGFAVLEYEDDNVREIDGI"
FT   gene            590238..591707
FT                   /locus_tag="NGK_0720"
FT   CDS_pept        590238..591707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0720"
FT                   /product="putative succinate semialdehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0720"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29401"
FT                   /db_xref="GOA:B4RKR0"
FT                   /db_xref="InterPro:IPR010102"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKR0"
FT                   /protein_id="ACF29401.1"
FT                   /translation="MKAVIPYTGGYEMNEYSQLIKHPDISLSPISDGIGVGNPATGEIL
FT                   AYVRNTGSDKLKNLIQKAAAAQKLWAAKTALERADILWRWYFLVKENKEALARLMTMEQ
FT                   GKSLTEARGEIDYAASFVRWFAEEARRIDGDVLTSVKASQKLVVLKQPVGVTAAITPWN
FT                   FPSAMIARKAAPALAVGCAMIVKPASLTPLSAYALAVLAYEAGVPQDLLPVVSGRASEI
FT                   SHEFATNPTVRKISFTGSTEVGAKIFAGSAADIKKLSLELGGNAPFIVFDDADLDKAVE
FT                   GALASKFRNSGQTCVCTNRVYVQSGIYDVFCRKLSEKAAALKLGDGLDEGVNQGPLIEE
FT                   KAVEKVEQHIADALSKGAVCLTGGKRSALGGTFFEPTVLSGVTAQMAVAREETFGPLCP
FT                   VFRFETEAEVIEAANNTEYGLAAYLFTSDTARQWRVGEVLEYGMVGINTGLISNEAAPF
FT                   GGVKRSGLGREGSKYGADEYLELKYLCIDAG"
FT   gene            591818..592603
FT                   /locus_tag="NGK_0721"
FT   CDS_pept        591818..592603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0721"
FT                   /product="FimB"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0721"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29402"
FT                   /db_xref="GOA:B4RKR1"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKR1"
FT                   /protein_id="ACF29402.1"
FT                   /translation="MMENGKTFPRWRFALKSAGWHLLISLLVAGLAALLVFKVWYPYPY
FT                   AELTGGLSLYQLVVAVDIVCGPLLTLILASPKKKTKARMVDFSMVGIIQLAALAYGLHS
FT                   VSLARPVVEAFEQDRMTIVTAAEVVVEDLHKAPEGLQSLSWFGIRRIALKEPEDADEKN
FT                   KTLDLSLKGIEPSMRPDRWLPYSDKEAEKIRKHLKPLKVLADARKTTVADILKQAGLAE
FT                   GEELYYLPFTSSRQKEWIVITDKEGNTKGYAPIDGFIIP"
FT   gene            592731..592922
FT                   /locus_tag="NGK_0722"
FT   CDS_pept        592731..592922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0722"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0722"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29403"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKR2"
FT                   /protein_id="ACF29403.1"
FT                   /translation="MKHFKISPCRPNILSDGMAFCHCPDKLLNCLNYFDRRYTHMKDPE
FT                   QSSKPARRFLCVPSVQAA"
FT   gene            592971..594527
FT                   /locus_tag="NGK_0723"
FT   CDS_pept        592971..594527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0723"
FT                   /product="Conserved hypothetical integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0723"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29404"
FT                   /db_xref="GOA:B4RKR3"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKR3"
FT                   /protein_id="ACF29404.1"
FT                   /translation="MDFSWLAEPHTWIGFATLLVLEVVLGIDNLVFVAILANKVQPARR
FT                   DRARITGLGLAVVIRIIMLAFMAHIITLTEPLFQIGGLAVSGKDMIMLAGGIFLLYKAT
FT                   TELHERLEGHNRFTVADNQKKHAPFWGVVAQILILDAVFSIDSVITAVAMVDHIVVAMG
FT                   AVVVAMVVMISASKLLTEFVDRHPTVVMLCLGFLLMIGFSLIAEAFHFHIPKGYLYAAI
FT                   GFSILIELFNQISQRNSRKNDYIGSSWRKRTAENVLGMMGIRESVLADAGGESVDDAHF
FT                   EENEKSMIRSVLTLAERPIMGVMIPRRDIERLDISQSREEQYAQLQNTPYSRLLVVGKA
FT                   GVDEPLGYINKKDLLSQLLETGGLDIQTALRQPLVLPDGTTALGALELFRQSSADYALV
FT                   VDEFGAVLGMVTMKDLLEAIAGEFPEEFEREEEPAVQGNPDESLTVEGALEYVELASQL
FT                   NLPQQEEDTDFHTVAGLIMEELQTIPDVGDFADFHGWRFEVVEKEGQRIERVKITKLPE
FT                   E"
FT   gene            594544..595290
FT                   /locus_tag="NGK_0724"
FT   CDS_pept        594544..595290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0724"
FT                   /product="SurE"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0724"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29405"
FT                   /db_xref="GOA:B4RKR4"
FT                   /db_xref="InterPro:IPR002828"
FT                   /db_xref="InterPro:IPR030048"
FT                   /db_xref="InterPro:IPR036523"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4RKR4"
FT                   /protein_id="ACF29405.1"
FT                   /translation="MNVLISNDDGYLAEGIAILARVASEFANVRVVAPERDRSGVSNSL
FT                   TLDRPLQLKQAQNGFCYVNGTPTDCIHVGQFALPDFKPDVVFSGINRGANMGDDTLYSG
FT                   TVAAATEAYLMGMPAVAFSLNDASGRYWATAEKALWTLLAHFFKKPPSAPVLWNVNIPA
FT                   VAPEDVRGIKITRLGRRHHEQNIVPSRNPRGEQIYWIGPVGEVSDREEGTDFGECGAGF
FT                   ITVTPLQIDLTAYPDMAETAAFWHTD"
FT   gene            595275..596405
FT                   /locus_tag="NGK_0725"
FT   CDS_pept        595275..596405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0725"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0725"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29406"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKR5"
FT                   /protein_id="ACF29406.1"
FT                   /translation="MAYGLTVFQIPSGFALEKNAHFYYDIPHSGYISEHEGYLMLKQTT
FT                   LLAACTAVAALLGGCATQQPAPVIAGNSGMQTVSSAPVYNPYGATPYNAAPAANDAPYV
FT                   PPVQTAPVYSPPAYVPPSAPAVSGTYVPSYAPVDINAATHTIVRGDTVYNISKRYHISQ
FT                   DDFRAWNGMTDNTLSIGQIVKVKPAGYAAPKTAAVESRPAVPAAAQTPVKPAAQPPVQS
FT                   APQPAAPAAENKAVPAPAPAPQSPAASPSGTRSVGGIVWQRPTQGKVVADFGGGNKGVD
FT                   IAGNAGQPVLAAADGKVVYAGSGLREYGNLVIIQHNSSFLTAYGHNQKLLVGEGQQVKR
FT                   GQQVALMGNTDASRTQLHFEVRQNGKPVNPNSYIAF"
FT   gene            complement(596420..596560)
FT                   /locus_tag="NGK_0726"
FT   CDS_pept        complement(596420..596560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0726"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0726"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29407"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKR6"
FT                   /protein_id="ACF29407.1"
FT                   /translation="MQTDEIKQIPKHSQTNLYAPSLRNDLKTQPPKQKCRLKTFQTAFL
FT                   T"
FT   gene            complement(596803..597285)
FT                   /locus_tag="NGK_0727"
FT   CDS_pept        complement(596803..597285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0727"
FT                   /product="putative acyl-CoA hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0727"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29408"
FT                   /db_xref="GOA:B4RKR7"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR033120"
FT                   /db_xref="InterPro:IPR040170"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKR7"
FT                   /protein_id="ACF29408.1"
FT                   /translation="MTQQRQLPSHELIMSELMMPDTANFSGNVHGGELLLLLDQVAYSC
FT                   ASRYSGNYCVTLSVDKVLFKEPIHIGDLVTFYAAVNYTGRTSMEIGIRVEAQNIRTGEI
FT                   RHTNSCYFTMVAVKDGKPVPVPPLEILTDRQRCRYEKAKKRREISLQASGDVSCGC"
FT   gene            complement(597438..597653)
FT                   /locus_tag="NGK_0728"
FT   CDS_pept        complement(597438..597653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0728"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0728"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29409"
FT                   /db_xref="GOA:B4RKR8"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKR8"
FT                   /protein_id="ACF29409.1"
FT                   /translation="MHGSVTLRPFPTFPIENKMSEQPEKHHASPIEDERKKPVYRMGRA
FT                   VAGFMLAVWAGVLALVFFLVFRFWLS"
FT   gene            complement(597673..598134)
FT                   /locus_tag="NGK_0729"
FT   CDS_pept        complement(597673..598134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0729"
FT                   /product="putative RecX-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0729"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29410"
FT                   /db_xref="GOA:B4RKR9"
FT                   /db_xref="InterPro:IPR003783"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4RKR9"
FT                   /protein_id="ACF29410.1"
FT                   /translation="MKPQKSLRARAMDILSRQEVSRIGLKRKLAPHAESEEELENVLNE
FT                   FAERNWQSDLRYAEAYIRSKSRKHGSLRLKQALAQQGIDEKTSRNLLPDRSSEKQAAIA
FT                   VLRKKFKHPAANLKEKQKQARFLAYRGFDADTVQTALKHAWDENWEDSC"
FT   gene            complement(598207..598917)
FT                   /locus_tag="NGK_0730"
FT   CDS_pept        complement(598207..598917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0730"
FT                   /product="phosphoglycolate phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0730"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29411"
FT                   /db_xref="GOA:B4RKS0"
FT                   /db_xref="InterPro:IPR006346"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR037512"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKS0"
FT                   /protein_id="ACF29411.1"
FT                   /translation="MNAAIEHVQAVAFDLDGTLCDSVPDLAAAAEAMLEQLGMKPLPAK
FT                   VVESYVGDGIGKLVHRVLTNDRDREADSELWEKGFVSYMKYYRDHLSVFTRPYPETEAG
FT                   LALLKSLGIPLVIITNKNEILAAELLKQLGLADYFSLILGGDSLPEKKPSPLPLRHAAE
FT                   VLGIDAANMLMVGDSRNDIIAAKAAGCLSVGVTFGYGDMTLLSQDDTTRPDRIIGALPE
FT                   IYENLRPQKNKDEE"
FT   gene            complement(598952..599191)
FT                   /locus_tag="NGK_0731"
FT   CDS_pept        complement(598952..599191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0731"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0731"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29412"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKS1"
FT                   /protein_id="ACF29412.1"
FT                   /translation="MILFFKPHSIRLKKAARIRKANVQLNKDIVIILFFKNLIGTSPGF
FT                   QTLARPRHKIRKHRPKNLLRLLIIYTLEALCKRC"
FT   gene            complement(599233..599373)
FT                   /locus_tag="NGK_0732"
FT   CDS_pept        complement(599233..599373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0732"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0732"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29413"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKS2"
FT                   /protein_id="ACF29413.1"
FT                   /translation="MTCFRAISNGLRVSFATASDILLPFRKKIFRGVHFAHYYNQFPDK
FT                   T"
FT   gene            599514..599765
FT                   /locus_tag="NGK_0733"
FT   CDS_pept        599514..599765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0733"
FT                   /product="glutamate dehydrogenase, NAD-specific"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0733"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29414"
FT                   /db_xref="GOA:B4RKS3"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR033524"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKS3"
FT                   /protein_id="ACF29414.1"
FT                   /translation="MNLDEVKALSIWMTIKCCVAGIPYGGGKGGVTLDPRDYSEAELER
FT                   IARAYAEAIAPLIGEKNRYSRPRCEHQRQNYVVDGGCL"
FT   gene            599752..600531
FT                   /locus_tag="NGK_0734"
FT   CDS_pept        599752..600531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0734"
FT                   /product="glutamate dehydrogenase, NAD-specific"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0734"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29415"
FT                   /db_xref="GOA:B4RKS4"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR033922"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKS4"
FT                   /protein_id="ACF29415.1"
FT                   /translation="MDAYENVVKHSAPGVFTGKPVEFGGSLARTEATGYGVNLAAVQAL
FT                   EKLGKDVKGATYAIQGFGNVGYHTGYYAHQSGAKVVTVSTVDVAIYNENGLDMEALFKE
FT                   FQEKGFITNKAGYGKEITNAELLALDMDVLAPCALENQLTSENAGKVRAKIVVEGANGP
FT                   TTPEADVILRQNGVLVVPDILANCGGVVVSYFEWVQNLQGYYWEFDEVQEKEIVVLRRA
FT                   FRDIWNLAQEYDVDLRTASYMMSIRRVEKAMKLRGWY"
FT   gene            complement(600591..601397)
FT                   /locus_tag="NGK_0735"
FT   CDS_pept        complement(600591..601397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0735"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0735"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29416"
FT                   /db_xref="InterPro:IPR019613"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKS5"
FT                   /protein_id="ACF29416.1"
FT                   /translation="MKKTLTLLAVSALFATSAHAHRVWVETAHTHGGEYLKADLGYGEF
FT                   PELEPIAKDRLHIFSKPMQLVTEKGKENMIQRGTYNYQYRSNRPVKDGSYLVTAEYQPT
FT                   FRSKNKAGWKQAGIKEMPDASYCEQTRMFGKNIVNVGHESADTAIITKPVGQNLEIVPL
FT                   DNPANIHVGERFKVRVLFRGEPLPNATVTATFDGFDTSDRSKTHKTEAQAFSDTTDGKG
FT                   EVDIIPLRQGFWKASVEYKADFPDQSLCQKQANYTTLTFQIGHSHH"
FT   gene            complement(601434..601574)
FT                   /locus_tag="NGK_0736"
FT   CDS_pept        complement(601434..601574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0736"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0736"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29417"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKS6"
FT                   /protein_id="ACF29417.1"
FT                   /translation="MKYCYLIKQVASAQTSASFSEKFKSIQKDSFQAANPSSHDTYFVI
FT                   A"
FT   gene            601589..601798
FT                   /locus_tag="NGK_0737"
FT   CDS_pept        601589..601798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0737"
FT                   /product="4-oxalocrotonate tautomerase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0737"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29418"
FT                   /db_xref="GOA:B4RKS7"
FT                   /db_xref="InterPro:IPR004370"
FT                   /db_xref="InterPro:IPR014347"
FT                   /db_xref="InterPro:IPR018191"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKS7"
FT                   /protein_id="ACF29418.1"
FT                   /translation="MPYVNIKVTGGKEAPTAAQKAELIGGVIELLARVLGKNPETTVVV
FT                   IDEVDTDNWDIGGKSVSERRKEGR"
FT   gene            601887..603101
FT                   /locus_tag="NGK_0738"
FT   CDS_pept        601887..603101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0738"
FT                   /product="aspartate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0738"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29419"
FT                   /db_xref="GOA:B4RKS8"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKS8"
FT                   /protein_id="ACF29419.1"
FT                   /translation="MDKFPKSAKLDHVCYDIRGPVHKKALQLEEEGNKILKLNIGNPAP
FT                   FGFEAPDEILVDVIRNLPTSQGYCDSKGLYSARKAIVHYYQNKGLRDITVNDVYIGNGV
FT                   SELIAMSMQALLNDGDEILIPAPDYPLWTAAATLAGGTVRHYLCDEENGWFPNLADMEA
FT                   KITSKTKAIVVINPNNPTGAVYSKEILLEIAELARKHGLIIFADEIYDKILYDGAVHCH
FT                   IAALAPDLLTVTFNGLSKAYRVAGFRQGWMVLNGPKHHAKGYIEGLDMLSSMRLCANTP
FT                   MQHAIQTALGGYQSINEFILPGGRLLEQRNRAWELVNQIPGVSCVKPMGAMYMFPKIDT
FT                   EMYRIRDDMKFVYDLLVREKVLLVQGTGFNWIKPDHFRIVTLPYVHQIEEAMGRLARFL
FT                   QTYHQ"
FT   gene            complement(603173..605752)
FT                   /locus_tag="NGK_0739"
FT   CDS_pept        complement(603173..605752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0739"
FT                   /product="putative ClpB protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0739"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29420"
FT                   /db_xref="GOA:B4RKS9"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR017730"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKS9"
FT                   /protein_id="ACF29420.1"
FT                   /translation="MRYDKLTAKFQQALAEAQSLALAADSSYLEAGFVLKALLDDQNSG
FT                   AAALLAHAGVNVPQVKQRLQQHLNSLPKVSGQGGEILPSRELQAVLNLMDKAATKRGDA
FT                   YIASELFLLALVQQNDAAGKILKEAGATEQNINAAIDAVRGGQNVNDANAEDQRDALKK
FT                   YTLDLTQRARDGKLDPVIGRDDEIRRAIQVLQRRTKNNPVLIGEPGVGKTAIVEGLAQR
FT                   IVNGEVPESLRNKRLLVLDLAALIAGAKYRGEFEERLKGVLNDLAKDDGNTLIFIDEIH
FT                   TLVGAGKTDGAMDAGNMLKPALARGELHCIGATTLDEYRQYIEKDAALERRFQKVLVGE
FT                   PSVEDTIAILRGLQERYEIHHGIDITDPAIVAAAELSDRYITDRFLPDKAIDLIDEAAS
FT                   RVKMEKETKPEAMDKIDRRLIQLRMEKAHVEKEKDDASKKRLELIDEEIDGLQKEYADL
FT                   DEIWKAEKAISDGAANIKKQIDEVKIKIEQAKRQGDLALASKLMYEDLEHLEKQRAAAE
FT                   RADTDSTKPANKLLRNNVGADEVAEIVSRMTGIPVSKMMEGERDKLLKMEEVLHRRVVG
FT                   QNEAVRAVSDAIRRSRSGLADPNKPYGSFLFLGPTGVGKTELCKALAGFLFDSEDHLIR
FT                   IDMSEYMEKHAVARLIGAPPGYVGYEEGGYLTEQVRRKPYSVILLDEVEKAHPDVFNIL
FT                   LQVLDDGRLTDGQGRTVDFKNTVIVMTSNIGSQHIQQMGTQDYEAVKEVVMEDVKEHFR
FT                   PEMINRIDEVVVFHGLDQANIRSIAKIQLKGLEKRLEKQNLRLTVSDAALDIIAKAGFD
FT                   PIYGARPLKRAIQSEIENPLAKALLAGNYAPESEIKVEADGDRLKFA"
FT   gene            605878..606015
FT                   /locus_tag="NGK_0740"
FT   CDS_pept        605878..606015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0740"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0740"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29421"
FT                   /db_xref="GOA:B4RKT0"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKT0"
FT                   /protein_id="ACF29421.1"
FT                   /translation="MYDNMYNYIFLIWKSLLSAGCMWQIGYNRRIFSLSDGIAAVRTFL
FT                   "
FT   gene            606012..607022
FT                   /locus_tag="NGK_0741"
FT   CDS_pept        606012..607022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0741"
FT                   /product="tryptophanyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0741"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29422"
FT                   /db_xref="GOA:B4RKT1"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024109"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKT1"
FT                   /protein_id="ACF29422.1"
FT                   /translation="MSKKRVLTGVTTTGTPHLGNYVGAIRPAVRAAQNPDTESFLFLAD
FT                   YHGIIKCHEQEMIHQSTQAVAATWLACGLDPERTTFYRQSDIPEVMELNWILTCITAKG
FT                   LMNRAHAYKAAVQANAENGQEDPDFGVEMGLFSYPILMTADILMFNANEVPVGRDQIQH
FT                   VEMARDIAGRFNHRFQELFTLPEVKIDENVELLVGLDGRKMSKSYGNTIPLWENDKKTQ
FT                   KSVNKIITNMKEPGEPKQPDESPLFEIYKAFSTPSETAEFTQMLADGLAWGEAKKLSAA
FT                   KINAELAELRERYNALTSNPSQIEEILQAGAQKARKEARELLDKVRDAVGIRPLK"
FT   gene            607103..607648
FT                   /locus_tag="NGK_0742"
FT   CDS_pept        607103..607648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0742"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0742"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29423"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKT2"
FT                   /protein_id="ACF29423.1"
FT                   /translation="MLKIPFAVLGGCLLLAACGKSENTAEQPQNAAQSAPKPVFKVKYI
FT                   DNTAIAGLALGQSSEGKTNDGKKQISYPIKGLPEQNAVRLTGKHPNDLEAVVGKCMETD
FT                   GKDAPSGWAENGVCHTLFAKLVGNIAEDGGKLTDYLISHSALQPYQAGKSGYAAVQNGR
FT                   YVLEIDSEGAFYFRRRHY"
FT   gene            complement(607661..607789)
FT                   /locus_tag="NGK_0743"
FT   CDS_pept        complement(607661..607789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0743"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0743"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29424"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKT3"
FT                   /protein_id="ACF29424.1"
FT                   /translation="MKHVRKLFYENSSENCNTHPLLLSFPAARTFSARFEKSKYIP"
FT   gene            607965..608309
FT                   /locus_tag="NGK_0744"
FT   CDS_pept        607965..608309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0744"
FT                   /product="Ag473"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0744"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29425"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKT4"
FT                   /protein_id="ACF29425.1"
FT                   /translation="MKKLLIAAMMAAALAACSQEAKQEVKEAAQAVESDVKDTAASAAE
FT                   SAASAVEEAKGQVKDAAADAKASAEEAVTEAKDAAAETKEAVSEAAKDTLNKAADAAQE
FT                   AADKMKDAAK"
FT   gene            complement(608519..610027)
FT                   /locus_tag="NGK_0745"
FT   CDS_pept        complement(608519..610027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0745"
FT                   /product="putative exopolyphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0745"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29426"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="InterPro:IPR030673"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKT5"
FT                   /protein_id="ACF29426.1"
FT                   /translation="MTTNPANVLASVDLGSNSFRLQICENNNGQLKVIDSFKQMVRFAA
FT                   GLDEQKNLSTSSQEQALDCLAKFGERLRGFRPEQVRAVATNTFRVAKNIADFLPKAEAA
FT                   LGFPIEIIAGREEARLIYTGVIHTLPPCGGKMLVIDIGGSSTEFVIGSTLNPDITESLP
FT                   LGCVTYSLRFFQNKITAKDFQAAISAARNEIQRISKNMRREGWDFAVGTSGSAKSIRDV
FT                   LAAEMPQEADITYKGMRALAERIIEAGSVKKAKFENLKPERIEVFAGGLAVMMAAFEEM
FT                   KLDRMTVTEAALRDGVFYDLIGRGLNEDMRGQTVAEFQHRYHVSLNQAKRTAETAQTFM
FT                   DSLCHAKNVTVQELALWQQYLGRAAALHEIGLDIAHTGYHKHSAYILENADMPGFSRKE
FT                   QTILAQLVIGHRGDMKKMGGIIGGNEMLWYAVLSLRLAALFCRSRQDLGFPKNMQLRTD
FT                   TESCGFILRIDRKWLERHPLIADALEYESVQWQKINMPFKVEAV"
FT   gene            610039..610197
FT                   /locus_tag="NGK_0746"
FT   CDS_pept        610039..610197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0746"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0746"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29427"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKT6"
FT                   /protein_id="ACF29427.1"
FT                   /translation="MGEKRNVTLTAQALTINDAAVFDSAHGCCRRYVSDSKKCRLKNVR
FT                   TAFFALI"
FT   gene            complement(610190..610936)
FT                   /locus_tag="NGK_0747"
FT   CDS_pept        complement(610190..610936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0747"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0747"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29428"
FT                   /db_xref="InterPro:IPR007655"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKT7"
FT                   /protein_id="ACF29428.1"
FT                   /translation="MRYGLGVSREINAGGHHFLYGGISRGVHYWDNKDFSEQSLRLSFG
FT                   HQNRSVTRSFGTVPFVGQNLLGGSRYNFAGGFNADFSRRLGERWRLTLNAGNMWKHYQE
FT                   DRTAARYGSHMPLAGATLMYPAPKDRLLYGGADWPHDMTKEAEQASVRKGLRVGAVKTF
FT                   DGGLGLRANLRYTRRTFDAPGTIVYRFPRKDHEYQANLSLRHDKISWKGFTPQLNFRYL
FT                   KIGSNMKSFYTRKNTQIFMSVEKDFK"
FT   gene            610940..611254
FT                   /locus_tag="NGK_0748"
FT   CDS_pept        610940..611254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0748"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0748"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29429"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKT8"
FT                   /protein_id="ACF29429.1"
FT                   /translation="MCLLRQAVGGFRPASARKFNRFFGRSVVYSGLTKIRTRRRAAGST
FT                   DGTEPIRPVLGHLREPFPLSRGGATPYRFLLIRHIVLKHRPKPDIIRLSTSVKIFFLTG
FT                   "
FT   gene            611443..612129
FT                   /locus_tag="NGK_0749"
FT   CDS_pept        611443..612129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0749"
FT                   /product="outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0749"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29430"
FT                   /db_xref="GOA:B4RKT9"
FT                   /db_xref="InterPro:IPR003394"
FT                   /db_xref="InterPro:IPR006315"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKT9"
FT                   /protein_id="ACF29430.1"
FT                   /translation="MQADLAYAAERITHDYPEPTAPGKNKISTVSDYFRNIRTHSIHPR
FT                   VSVGYDFGGWRIAADYARYRKWNNNKYSVDIENVQIREDNGNRIDRKTENQENGTFHAV
FT                   SSLGLSAVYDFKLNDKFKPYIGARVSYGHVRHSIDSTKKTTEFVTSAGAPGGAPTVYPP
FT                   HKNTQDDHREGNSIRRVGLGVIAGVGFDITPKLTLDAGYRYHNWGRLENTRFKTHEASL
FT                   GVRYRF"
FT   gene            612491..612871
FT                   /locus_tag="NGK_0750"
FT   CDS_pept        612491..612871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0750"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0750"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29431"
FT                   /db_xref="GOA:B4RKU0"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKU0"
FT                   /protein_id="ACF29431.1"
FT                   /translation="MKYRRFYRNGGTYFFTVVTNKRQKILTDDAVRLALRQAVMAVRER
FT                   NPFEILAWVLMPDHLHTIWRLPDNDSAYSERWRQIKRHSQYLIGGNLRLWKNAFGNILS
FT                   AVRPILPAILIICISIRSNMAM"
FT   gene            613048..613284
FT                   /locus_tag="NGK_0751"
FT   CDS_pept        613048..613284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0751"
FT                   /product="putative transposase for IS1106A3"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0751"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29432"
FT                   /db_xref="GOA:B4RKU1"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKU1"
FT                   /protein_id="ACF29432.1"
FT                   /translation="MRKARRNRPLPEAQTKRNRYLSKTRYVVEQSFGTLHRKFRYARAA
FT                   YFGLIKVSAQSHLKAMCLNLLKAANRLSAPAAA"
FT   gene            complement(613387..613731)
FT                   /locus_tag="NGK_0752"
FT   CDS_pept        complement(613387..613731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0752"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0752"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29433"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKU2"
FT                   /protein_id="ACF29433.1"
FT                   /translation="MIASNAKNLAQNPSAAYRPALFGQTLILPPSRTLVQTGTDDTARA
FT                   FPVFTGYPSSGLCSSTISALRFSGGSRRKYSGLNLNRYGVASPCRTGLNLIHYILRPLQ
FT                   NSLPSRQLKP"
FT   gene            613786..614409
FT                   /locus_tag="NGK_0753"
FT   CDS_pept        613786..614409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0753"
FT                   /product="putative transglycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0753"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29434"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKU3"
FT                   /protein_id="ACF29434.1"
FT                   /translation="MKKPTDTLPVNLQRRRLLCAAGALLISPLAHAGAQREETLADDVA
FT                   SVMRSSVGSVNPPRLVFDNPKEGERWLSAMSARLARFVPDEGERRRLLVNIQYESSRAG
FT                   LDTQIVLGLIEVESAFRQYAISGVGARGLMQVMPFWKNYIGKPAHNLFDIRTNLRYGCT
FT                   ILRHYRNLEKGDIVRALARFNGSLGSNKYPNAVLGAWRNRWQWR"
FT   gene            614488..615903
FT                   /locus_tag="NGK_0754"
FT   CDS_pept        614488..615903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0754"
FT                   /product="Drug resistance translocase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0754"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29435"
FT                   /db_xref="GOA:B4RKU4"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKU4"
FT                   /protein_id="ACF29435.1"
FT                   /translation="MQLLMPSEKLFMARDNRIQMFPHEWRASTTLSGVYALRMLGMFLV
FT                   LPVLAIYAASLPGAEDNKTLVGLAMGIYGLTQALLQLPLGIASDKFGRKKTIYVGLVVF
FT                   AAGSFLAAAADTLPMLVAARAIQGAGAVSAAVTALLADLTRDGVRTRAMAMIGLSIGLT
FT                   FSVSLVVAPMIADVAGVRGLFMLTGILTVISIGVVAWMTPDPEVSKLHEDTQAQPSRIG
FT                   EVLKNRRLLTLDFGIFALHAAQMALFTALPFAMTRLGLEKIQHWKVYLPSTITGLVVMV
FT                   PLIIVGETRNKLKQVFVLGIVCIAAAQLGLLSGMHSIWLITAYLVVYFIGFNVLEASLP
FT                   SMVSKIAPSDLKGTAMGVYNTMQSLGLFAGGAAGGLLFQKYGFAGVFAFCSILMLLWLV
FT                   IAVLSPAPKPVKNLSYPVGGVWQGNRDGLQRALLQLEGVEDIGFSFDGQTVYLKVLQKG
FT                   FDQAAAEKIITGV"
FT   gene            615907..616431
FT                   /locus_tag="NGK_0755"
FT   CDS_pept        615907..616431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0755"
FT                   /product="putative single-stranded DNA binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0755"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29436"
FT                   /db_xref="GOA:B4RKU5"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKU5"
FT                   /protein_id="ACF29436.1"
FT                   /translation="MSLNKVILIGRLGRDPEVRYMPNGEAVCNFSVATSETWNDRNGQR
FT                   VERTEWHNITMYRKLAEIAGQYLKKGGLVYLEGRIQSRKYQGKDGIERTAYDIVANEMK
FT                   MLGGRNENSGGAPYDEGYGQNQEAYQRPAQQSRQPAPDAPSHPQEAPAAPRRQPVPAAA
FT                   PVEDIDDDIPF"
FT   gene            616514..616828
FT                   /locus_tag="NGK_0756"
FT   CDS_pept        616514..616828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0756"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0756"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29437"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKU6"
FT                   /protein_id="ACF29437.1"
FT                   /translation="MHLGRLVAAPCVGRNVAIAPFGRFEASDACRTPPLFSDGILKLRR
FT                   CFQIVRSNSRASASLFEIKGLESNAKRLNHHCPMRQTGIVRQYGCLKIGKSGWKTKGRS
FT                   "
FT   gene            616837..617727
FT                   /locus_tag="NGK_0757"
FT   CDS_pept        616837..617727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0757"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0757"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29438"
FT                   /db_xref="GOA:B4RKU7"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKU7"
FT                   /protein_id="ACF29438.1"
FT                   /translation="MALLAAMTWGMLPIAVRQVLKFVDAPTLVWVRFTVAAAVLFVLLT
FT                   LGGRLPKRRDFSWHSFRLLLLGVTGISANFVLIAQGLHYISPTTTQVLWQISPFTMIVV
FT                   GVLVFKDRMTAAQKIGLVLLLVGLLMFFNDKFGELSGLGAYAKGVLLCAAGSMAWVCYA
FT                   VAQKLLSAQFGPQQILLLIYAASAAVFLPFAEPAHIGSLDGTLAWVCFVYCCLNTLIGY
FT                   GSFGEALKHWEASKVSAVTTLLPVFTVIFSLLGHYVMPDTFAAPDMNGLGYVGALVVVG
FT                   GAVTAAVGDRPFKRR"
FT   gene            complement(617792..619180)
FT                   /locus_tag="NGK_0758"
FT   CDS_pept        complement(617792..619180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0758"
FT                   /product="fumarate hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0758"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29439"
FT                   /db_xref="GOA:B4RKU8"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR005677"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR018951"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKU8"
FT                   /protein_id="ACF29439.1"
FT                   /translation="MNTRTEHDTMGNVEVPSEAYWGAQTQRSRNNFKIGGETLPQPLIY
FT                   ALALVKKAAAATNVSLGRIKPEQADLITQAADDVLNGRLDGQFPLVVWQTGSGTQSNMN
FT                   MNEVLANRANEIAGTGLAAYRPVHPNDHVNRAQSTNDAFPTAIHVAAAIEINRHLIPAV
FT                   KALRDTLDKKAQAFAPIVKIGRTHLQDATPLTLGQEFSGYVSQLDHSLGRLNDALKGLY
FT                   ELALGGTAVGTGLNSHPEYAEIAAAKLAELSGLPFVSAPNKFEALGGRDAAVAASGALK
FT                   TLAASLNKIANDIRWLASGPRCGLGEIKIPENEPGSSIMPGKVNPTQCEAMTMVCCQVF
FT                   GNDVTIGMAGASGNFELNVYMPVIAYNLLQSIRLLGDACNSFNENCAAGIEPVPEKIDY
FT                   FLHHSLMLVTALNRKIGYENAAKVAKTAYKNDKSLRETAVGLGLLTGEEFDELVVPADM
FT                   VHPR"
FT   gene            complement(619324..621303)
FT                   /locus_tag="NGK_0759"
FT   CDS_pept        complement(619324..621303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0759"
FT                   /product="transketolase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0759"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29440"
FT                   /db_xref="GOA:B4RKU9"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005478"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033247"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="PDB:5VRB"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKU9"
FT                   /protein_id="ACF29440.1"
FT                   /translation="MSQLANVIRFLSADAVQKANSGHPGAPMGMAEMAETLWTKFLNHN
FT                   PANPKFYNRDRFVLSNGHASMLLYSLLHLTGYNLSIEDLKNFRQLHSKTPGHPEYGYTD
FT                   GVETTTGPLGQGIANAVGMALAEKILAAEFNKDGLNIVDHYTYVFMGDGCLMEGVSHEA
FT                   CSLAGTLGLGKLIVLYDDNNISIDGKVDGWFTENIPQRFESYGWHVVPNVNGHDTAAIQ
FT                   TAIEAARAETGKPSIICCKTLIGKGSANKEGSHKTHGAPLGADEIEATRKHLGWAYPAF
FT                   EIPQEIYDAWNAKEKGAKLEAGWNELFAQYQAKYPAEAAEFVRRMDKKLPENFDEYVQT
FT                   ALKEVCAKAETVATRKASQNSIEILAKELPELVGGSADLTPSNLTDWSNSVSVTRDKGG
FT                   NYIHYGVREFGMGAIMNGLVLHGGVKPFGATFLMFSEYERNALRMAALMKINPVFVFTH
FT                   DSIGLGEDGPTHQPIEQTATLRLIPNMDVWRPCDTAESLVAWAEAAKAEDHPSCLIFSR
FT                   QNLKFQARSEQQLNDIKRGAYVISEAQGNAQAVIIATGSEVGLAVEAQKVLAGQGIAVR
FT                   VVSMPSTSVFDRQDAAYQAAVLPEGLPRIAVEAGHTNGWYKYVGLNGAVVGINRFGESA
FT                   PADLLFKAFGFTVDNVVDTVKSVL"
FT   gene            621335..621478
FT                   /locus_tag="NGK_0760"
FT   CDS_pept        621335..621478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0760"
FT                   /product="GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0760"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29441"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKV0"
FT                   /protein_id="ACF29441.1"
FT                   /translation="MDNRKALIIARFAYAFKKRADAGEGGGRGWAVGKDFRFAGEACHY
FT                   SF"
FT   gene            complement(621573..621695)
FT                   /locus_tag="NGK_0761"
FT   CDS_pept        complement(621573..621695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0761"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0761"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29442"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKV1"
FT                   /protein_id="ACF29442.1"
FT                   /translation="MYNFMCRPDVLGEYISHPHQNALILPHRPNKIKILLKNKD"
FT   gene            621688..623334
FT                   /locus_tag="NGK_0762"
FT   CDS_pept        621688..623334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0762"
FT                   /product="putative ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0762"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29443"
FT                   /db_xref="GOA:B4RKV2"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014116"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR032879"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKV2"
FT                   /protein_id="ACF29443.1"
FT                   /translation="MYNSGNIFWEKRIFSKLETQCLKKTRKMTSEKQNGGGNGQTINQK
FT                   SKECRMTTENQAGSPASGIGTSEQTKAAPKVKKTFDPRASVIQIHPEGERIHPKKAEGR
FT                   FAKLRIAAVLATQFVFYVIPWFNWSGRQAVVFNIPERHFFIFGLSLGVGDLIYLALLLM
FT                   ICAFGLFWWTTIAGRLWCGYSCPQTVYTEIMLWIDNLVEGDRNKRLKLEKSPWNFTKIR
FT                   IKATKYLLIFLVCAWTGITFAGWFVPIRQFVPDLFTGAAGGGAMFAAAFYGFMTFFFAH
FT                   IMREKVCLHMCPYARFQSAMFDKDTLIVSYDAERGEPRGARKKTVNKEEAGLGDCINCA
FT                   MCVQVCPVGIDIRNGLQYQCIGCAACIDACDEIMDKMGYPSGLIRYTTESALEHEYAEK
FT                   DIKKRLLRPRVAGYGAVLAVVVAAFLVGLSTRKMVEVDILKDRGVMVRENAKGWLENAY
FT                   SLRIINNSEKEQLITASVKGFDEIALTGLPEGGIKVAPRETITLPVQVSTIPEYADKGS
FT                   HPIEFIFQYRESGASDGKPVVLEEDATFIGE"
FT   gene            623337..623885
FT                   /locus_tag="NGK_0763"
FT   CDS_pept        623337..623885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0763"
FT                   /product="Inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0763"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29444"
FT                   /db_xref="GOA:B4RKV3"
FT                   /db_xref="InterPro:IPR008620"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKV3"
FT                   /protein_id="ACF29444.1"
FT                   /translation="MSQNNPIKPWYKHVWPWVLMAGPIFVVIASVAMFFVAQQHATDLV
FT                   TDDYYKDGKHIDIQLHRDEEAVRRHIGVQVLISPDMNAAKVFVGGEFDGKQPLNLLLMH
FT                   PTRKADDQTVALKPVGSAQNGRAEYEAVFKTLPPANHWYVRVEDAAGVWRVENKWITSQ
FT                   GNAVDLTPMDKLFNNAGSK"
FT   gene            complement(623946..624065)
FT                   /locus_tag="NGK_0764"
FT   CDS_pept        complement(623946..624065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0764"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0764"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29445"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKV4"
FT                   /protein_id="ACF29445.1"
FT                   /translation="MPSEAFQTAFFRLPFGMMLKNKRDEIHLFSSDKSDHHAE"
FT   gene            624066..624179
FT                   /locus_tag="NGK_0765"
FT   CDS_pept        624066..624179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0765"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0765"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29446"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKV5"
FT                   /protein_id="ACF29446.1"
FT                   /translation="MCCMSDIMRKAFCSHKNVFISLRFFDTVPEHNLKNAV"
FT   gene            complement(624227..625402)
FT                   /locus_tag="NGK_0766"
FT   CDS_pept        complement(624227..625402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0766"
FT                   /product="2-nitropropane dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0766"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29447"
FT                   /db_xref="GOA:B4RKV6"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKV6"
FT                   /protein_id="ACF29447.1"
FT                   /translation="MQNIFDPLIIRGKSLIPIVQGGMGVGVSASGLSSAVARENGIGTI
FT                   ASVDLRHLHEDLLAESQINPSEEKYTSLNCTALDREIQKAKSASEGKGLIAVNVMKAVK
FT                   DHAAYVRQACESGADAVVMGAGLPLDLPEMTEGYHKDVALLPILSESRGINIVLKRWMK
FT                   KGILPDAIVVEHPAHAAGHLGASTVEGVNDAKFDFKRVIEETFEVFKNLGLEGEKIPLI
FT                   LAGGMANFEKVKTALKNWGASAVQIGTAFAVTEEGDAHLNFKKTLASAETEKVVEFMSV
FT                   AGLPARGIRTKFLDSYIRREGKLQANAKADPRRCTQGLNCLTSCGLRDGLSKAGQFCID
FT                   IQLAAAFRGEVDKGLFFRGKDQLPFGNAIRTVRETIQYLLTGSEPVATLGR"
FT   gene            complement(625839..625913)
FT                   /locus_tag="NGK_trnaGlu2"
FT   tRNA            complement(625839..625913)
FT                   /locus_tag="NGK_trnaGlu2"
FT                   /product="tRNA-Glu"
FT   gene            complement(625931..626007)
FT                   /locus_tag="NGK_trnaArg2"
FT   tRNA            complement(625931..626007)
FT                   /locus_tag="NGK_trnaArg2"
FT                   /product="tRNA-Arg"
FT   gene            626098..626892
FT                   /locus_tag="NGK_0767"
FT   CDS_pept        626098..626892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0767"
FT                   /product="putative DNA polymerase III subunit"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0767"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29448"
FT                   /db_xref="GOA:B4RKV7"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKV7"
FT                   /protein_id="ACF29448.1"
FT                   /translation="MLFEFKENKMIVVSRWPLLEKAFLRFGMPVAVVDLESTGGNLYED
FT                   RVTEVALVKFGQGRAERYEWLVNPQKPIPKFVAELTGISDGMVADAPVFAEIAGGLFSV
FT                   LKGCVLVAHNSRFDYTFLKHEFHRAGIGFSSPALCSVQLSRRLYPQFYKHSLDGIIERL
FT                   GIVVEDRHRAMADVSALCDYLEYSLSAHGLEEWSRQCFRLTNPKLLPAALPERLRERLY
FT                   GLPDGTGVLACFDGGGKVNYIGTFERAYGEVAALLDSGKAPV"
FT   gene            626930..627538
FT                   /locus_tag="NGK_0768"
FT   CDS_pept        626930..627538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0768"
FT                   /product="putative DNA polymerase III subunit"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0768"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29449"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKV8"
FT                   /protein_id="ACF29449.1"
FT                   /translation="MGSLHAYKIKAELVGRYHSGCYVSAKNLLKTFTTVRFEKGSDGML
FT                   NAKTAALKNGVTDNPPTGLFANKKAARRALSSWAETYGLCPASAGILPDGYAEDEPCPV
FT                   YVSGRCDKACGRFDEQVLAFAHKLPVLDWGKMHEVEITETDPLTGEKSFCMEWAAHWKW
FT                   MTGFGISIKIYRMCLRRSLKRTGKILRKSVKSIPVGESW"
FT   gene            627608..627808
FT                   /locus_tag="NGK_0769"
FT   CDS_pept        627608..627808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0769"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0769"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29450"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKV9"
FT                   /protein_id="ACF29450.1"
FT                   /translation="MCLKMPSEFFQTAFLPTRFACRVGLPVRPEASDKQGGFYSGLNLN
FT                   RYGVASPCRTICTVCGFAALS"
FT   gene            complement(627849..630218)
FT                   /locus_tag="NGK_0770"
FT   CDS_pept        complement(627849..630218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGK_0770"
FT                   /product="putative phage associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGK_0770"
FT                   /db_xref="EnsemblGenomes-Tr:ACF29451"
FT                   /db_xref="GOA:B4RKW0"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B4RKW0"
FT                   /protein_id="ACF29451.1"
FT                   /translation="MNATLRFIDPKMKQAQPKLMTLGKSKLLELLVEDDDTLLELAEGG
FT                   EVNGNTFDDVDRMTIKELRVALRESRETAEAKDKVIADKNKKVDELAEKLSKKQTGVKE
FT                   PKPADVGIELTMQLGSLTAWKSVSARKSA