(data stored in ACNUC7421 zone)

EMBL: CP001053

ID   CP001053; SV 1; circular; genomic DNA; STD; PRO; 3625999 BP.
XX
AC   CP001053; AAUH01000000-AAUH01000084;
XX
PR   Project:PRJNA17463;
XX
DT   08-MAY-2008 (Rel. 95, Created)
DT   30-AUG-2017 (Rel. 134, Last updated, Version 7)
XX
DE   Paraburkholderia phytofirmans PsJN chromosome 2, complete sequence.
XX
KW   .
XX
OS   Paraburkholderia phytofirmans PsJN
OC   Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales;
OC   Burkholderiaceae; Paraburkholderia.
XX
RN   [1]
RP   1-3625999
RX   DOI; 10.1128/JB.05055-11.
RX   PUBMED; 21551308.
RA   Weilharter A., Mitter B., Shin M.V., Chain P.S., Nowak J., Sessitsch A.;
RT   "Complete genome sequence of the plant growth-promoting endophyte
RT   Burkholderia phytofirmans strain PsJN";
RL   J. Bacteriol. 193(13):3383-3384(2011).
XX
RN   [2]
RP   1-3625999
RX   DOI; 10.1016/j.plaphy.2011.09.013.
RX   PUBMED; 22099516.
RA   Da K., Nowak J., Flinn B.;
RT   "Potato cytosine methylation and gene expression changes induced by a
RT   beneficial bacterial endophyte, Burkholderia phytofirmans strain PsJN";
RL   Plant Physiol. Biochem. 50(1):24-34(2012).
XX
RN   [3]
RP   1-3625999
RG   US DOE Joint Genome Institute
RA   Nowak J., Sessitsch A., Lazarovits G., Compant S., Barka E., Tiedje J.;
RT   "Complete sequence of chromosome2 of Burkholderia phytofirmans PsJN";
RL   Unpublished.
XX
RN   [4]
RP   1-3625999
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Pitluck S., Chain P., Malfatti S., Shin M., Vergez L., Lang D., Schmutz J.,
RA   Larimer F., Land M., Hauser L., Kyrpides N., Mikhailova N., Nowak J.,
RA   Sessitsch A., Lazarovits G., Compant S., Barka E., Tiedje J.;
RT   ;
RL   Submitted (28-APR-2008) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 254ca6ddf17eb686a2e5fa7f479a3ce3.
DR   BioSample; SAMN02598395.
DR   EnsemblGenomes-Gn; Bphyt_R0066.
DR   EnsemblGenomes-Gn; Bphyt_R0067.
DR   EnsemblGenomes-Gn; Bphyt_R0068.
DR   EnsemblGenomes-Gn; Bphyt_R0069.
DR   EnsemblGenomes-Gn; Bphyt_R0070.
DR   EnsemblGenomes-Gn; Bphyt_R0071.
DR   EnsemblGenomes-Gn; Bphyt_R0072.
DR   EnsemblGenomes-Gn; Bphyt_R0073.
DR   EnsemblGenomes-Gn; Bphyt_R0074.
DR   EnsemblGenomes-Gn; Bphyt_R0075.
DR   EnsemblGenomes-Gn; Bphyt_R0076.
DR   EnsemblGenomes-Gn; Bphyt_R0077.
DR   EnsemblGenomes-Gn; Bphyt_R0078.
DR   EnsemblGenomes-Gn; Bphyt_R0079.
DR   EnsemblGenomes-Gn; Bphyt_R0080.
DR   EnsemblGenomes-Gn; Bphyt_R0081.
DR   EnsemblGenomes-Gn; Bphyt_R0082.
DR   EnsemblGenomes-Gn; EBG00001160747.
DR   EnsemblGenomes-Gn; EBG00001160748.
DR   EnsemblGenomes-Gn; EBG00001160749.
DR   EnsemblGenomes-Gn; EBG00001160750.
DR   EnsemblGenomes-Gn; EBG00001160751.
DR   EnsemblGenomes-Gn; EBG00001160752.
DR   EnsemblGenomes-Gn; EBG00001160753.
DR   EnsemblGenomes-Gn; EBG00001160754.
DR   EnsemblGenomes-Gn; EBG00001160755.
DR   EnsemblGenomes-Gn; EBG00001160756.
DR   EnsemblGenomes-Gn; EBG00001160757.
DR   EnsemblGenomes-Gn; EBG00001160758.
DR   EnsemblGenomes-Gn; EBG00001160759.
DR   EnsemblGenomes-Gn; EBG00001160760.
DR   EnsemblGenomes-Gn; EBG00001160761.
DR   EnsemblGenomes-Gn; EBG00001160762.
DR   EnsemblGenomes-Gn; EBG00001160763.
DR   EnsemblGenomes-Gn; EBG00001160764.
DR   EnsemblGenomes-Gn; EBG00001160765.
DR   EnsemblGenomes-Gn; EBG00001160766.
DR   EnsemblGenomes-Gn; EBG00001160767.
DR   EnsemblGenomes-Gn; EBG00001160768.
DR   EnsemblGenomes-Gn; EBG00001160769.
DR   EnsemblGenomes-Gn; EBG00001160770.
DR   EnsemblGenomes-Gn; EBG00001160771.
DR   EnsemblGenomes-Gn; EBG00001160772.
DR   EnsemblGenomes-Gn; EBG00001160773.
DR   EnsemblGenomes-Tr; Bphyt_R0066-1.
DR   EnsemblGenomes-Tr; Bphyt_R0067-1.
DR   EnsemblGenomes-Tr; Bphyt_R0068-1.
DR   EnsemblGenomes-Tr; Bphyt_R0069-1.
DR   EnsemblGenomes-Tr; Bphyt_R0070-1.
DR   EnsemblGenomes-Tr; Bphyt_R0071-1.
DR   EnsemblGenomes-Tr; Bphyt_R0072-1.
DR   EnsemblGenomes-Tr; Bphyt_R0073-1.
DR   EnsemblGenomes-Tr; Bphyt_R0074-1.
DR   EnsemblGenomes-Tr; Bphyt_R0075-1.
DR   EnsemblGenomes-Tr; Bphyt_R0076-1.
DR   EnsemblGenomes-Tr; Bphyt_R0077-1.
DR   EnsemblGenomes-Tr; Bphyt_R0078-1.
DR   EnsemblGenomes-Tr; Bphyt_R0079-1.
DR   EnsemblGenomes-Tr; Bphyt_R0080-1.
DR   EnsemblGenomes-Tr; Bphyt_R0081-1.
DR   EnsemblGenomes-Tr; Bphyt_R0082-1.
DR   EnsemblGenomes-Tr; EBT00001749531.
DR   EnsemblGenomes-Tr; EBT00001749532.
DR   EnsemblGenomes-Tr; EBT00001749533.
DR   EnsemblGenomes-Tr; EBT00001749534.
DR   EnsemblGenomes-Tr; EBT00001749535.
DR   EnsemblGenomes-Tr; EBT00001749536.
DR   EnsemblGenomes-Tr; EBT00001749537.
DR   EnsemblGenomes-Tr; EBT00001749538.
DR   EnsemblGenomes-Tr; EBT00001749539.
DR   EnsemblGenomes-Tr; EBT00001749540.
DR   EnsemblGenomes-Tr; EBT00001749541.
DR   EnsemblGenomes-Tr; EBT00001749542.
DR   EnsemblGenomes-Tr; EBT00001749543.
DR   EnsemblGenomes-Tr; EBT00001749544.
DR   EnsemblGenomes-Tr; EBT00001749545.
DR   EnsemblGenomes-Tr; EBT00001749546.
DR   EnsemblGenomes-Tr; EBT00001749547.
DR   EnsemblGenomes-Tr; EBT00001749548.
DR   EnsemblGenomes-Tr; EBT00001749549.
DR   EnsemblGenomes-Tr; EBT00001749550.
DR   EnsemblGenomes-Tr; EBT00001749551.
DR   EnsemblGenomes-Tr; EBT00001749552.
DR   EnsemblGenomes-Tr; EBT00001749553.
DR   EnsemblGenomes-Tr; EBT00001749554.
DR   EnsemblGenomes-Tr; EBT00001749555.
DR   EnsemblGenomes-Tr; EBT00001749556.
DR   EnsemblGenomes-Tr; EBT00001749557.
DR   EuropePMC; PMC3133278; 21551308.
DR   EuropePMC; PMC3639386; 23641251.
DR   EuropePMC; PMC4600099; 26350963.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00442; ykkC-yxkD.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01695; C4.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01989; SECIS_3.
DR   SILVA-LSU; CP001053.
DR   SILVA-SSU; CP001053.
DR   StrainInfo; 382964; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4002732
CC   Source DNA and bacteria available from James Tiedje
CC   (tiedjej@msu.edu)
CC   Contacts: James Tiedje (tiedjej@msu.edu)
CC             David Bruce (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LLNL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3625999
FT                   /organism="Paraburkholderia phytofirmans PsJN"
FT                   /chromosome="2"
FT                   /strain="PsJN"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:398527"
FT                   /type_material="type strain of Paraburkholderia
FT                   phytofirmans"
FT   gene            complement(270..479)
FT                   /locus_tag="Bphyt_3990"
FT   CDS_pept        complement(270..479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_3990"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0463 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_3990"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18376"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE55"
FT                   /protein_id="ACD18376.1"
FT                   /translation="MTRLIIRDLTDSVELDRQAMTAIVGGARIGARLNAAVPLVPASAR
FT                   VVEYPPGFPAAHQTIAKAAMQRKP"
FT   gene            complement(663..947)
FT                   /locus_tag="Bphyt_3991"
FT   CDS_pept        complement(663..947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_3991"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0448 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_3991"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18377"
FT                   /db_xref="UniProtKB/TrEMBL:B2TAL8"
FT                   /protein_id="ACD18377.1"
FT                   /translation="MSSLMIRDLSGTRELDRRAMSAVAGGTGSSVPGLPSVAGLGGIAN
FT                   VNVSINQNLNQMQYVNVAALNNVGVIGAGFVPLHLNVSPSLWGANNATV"
FT   gene            complement(1036..1314)
FT                   /locus_tag="Bphyt_3992"
FT   CDS_pept        complement(1036..1314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_3992"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0465 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_3992"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18378"
FT                   /db_xref="UniProtKB/TrEMBL:B2TAL9"
FT                   /protein_id="ACD18378.1"
FT                   /translation="MNALMIKDLSITEQLDSRAMSAVRGGTGYYPSSSYFNFSPVFAPN
FT                   DSKKVDATQLINNQLNLQNANGNNVAFATGISSTVNPYVTTSNNIHV"
FT   gene            1730..3865
FT                   /locus_tag="Bphyt_3993"
FT   CDS_pept        1730..3865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_3993"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: protein of unknown function RIO1;
FT                   Serine/threonine protein kinase-related; SMART: tyrosine
FT                   protein kinase; serine/threonine protein kinase; KEGG:
FT                   bxe:Bxe_B0466 serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_3993"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18379"
FT                   /db_xref="GOA:B2TE58"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE58"
FT                   /protein_id="ACD18379.1"
FT                   /translation="MASLARVIHDFQNGELSRDEFVAQLDSTLTTEGLGPTQLLDMLGA
FT                   AHRKAPLPDDLYVEVRRRIEQLRVSNVAAGGDETGIQTTVEIPSIRSASAGSAANAAGA
FT                   GSTTDHDQIKGTGDTLNNRFVLEECLGVGGMGTVYKALDLRKLEASDRKPYLAIKVLNV
FT                   QFRGNPNSLVALQREARKAQVLAHRNIITVYDFDRDGPIVYLTMEYLSGKPLSQLLRTP
FT                   GYQGMPVRAALPIVRGMCSALAYAHERGFVHCDFKPANVFLTTNAEVKVIDFGIARVFQ
FT                   RPEEESDATVFDPGSLGALTPAYASPEMIEHREPDPRDDIYALGCITYELLTGHHPFDR
FT                   LSATQARNSDFKPQRPANLDSKQWRALRAALSFDRNTRMPSVARFIAEFDNEARAEKSG
FT                   TLAKVGLASFAVVCAAAVGVFAFRSGANRHNGAQTQAGASQALTGQAASSISEGAVTAP
FT                   PAAPPASPVAAAPATPPAVSAAKPAPKPALTLAAVTPALTQVPCSALSASVQDHSLTVR
FT                   GYVSQRYGAAHLKDTLAALPGVDTLTLQVEPLADDKCDTIKAFAPYWIHNMQAGHVAAL
FT                   HVRPPGGQLSDGDPLVVDVTTPGYDSYVNLDYYQLDGSVVHMVPSPRAKDNQAPPHYAA
FT                   TVGSAGDWIISKPFGSEMVVLLITPAPLFDKPRPESESRADYLRALDARLAQIGGKYSR
FT                   DHIVADFAPITTKPRSP"
FT   gene            complement(3938..5911)
FT                   /locus_tag="Bphyt_3994"
FT   CDS_pept        complement(3938..5911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_3994"
FT                   /product="protein of unknown function DUF323"
FT                   /note="PFAM: protein of unknown function DUF323; peptidase
FT                   C14 caspase catalytic subunit p20; KEGG: bxe:Bxe_B0467
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_3994"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18380"
FT                   /db_xref="GOA:B2TE59"
FT                   /db_xref="InterPro:IPR001309"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR029030"
FT                   /db_xref="InterPro:IPR042095"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE59"
FT                   /protein_id="ACD18380.1"
FT                   /translation="MWRIFMLVCMAGAMQAHWGDAFAAPQSEGAERGASEASLPLTQVA
FT                   PFAPQRGNALAPRIALVIGNGAYGAEGVGGTGHDGPQVDALRENAPRDATAMRDKLQTL
FT                   GFDVILRTNATPQQMREAIGEFHQRLRAGGVGLFYFAGHGMRIGPQTLLIPAGLDARSP
FT                   AAVVRNGVDLHTVLQAMDGPRDARLNLVILDTCLNDPFSTTSTDDTSALPHNTVVAYAT
FT                   APGGFAADGTRHGVYTNAWLHALDSAPSLTLADLLQRVAAQVRDATGGEQTPWVAASLP
FT                   RPWLTADAAFTARDNPVVTLHSRGILPKDSSEQYEITFWNSIKDSNYPGDYEAYLKAYP
FT                   NGRFATLAHARIERLRAAATSNGPSATTPAAPSIAPTPQVARPTPPASTPPPKPAPSAA
FT                   PAAAPPAAAVAQKPVTHAPVAGESRDCATCPIMITVPAGSFSMGSSTDDPSEKPVHHVT
FT                   IGAPFAIGKYEVTVDQWNACVAANACQKLTPESNTNKAAPARDLSWDDAQQYVKWLSKT
FT                   TGKPYRLPTEAEWEYADRGGTTSAYWWGDQMRKGNANCKDCGDPWHKEGPEAAGSFAPN
FT                   PLGLYDMNGSVWEWTADCWHNTYQAAPADGHAWDTPGCDMRVIRGGSWREGGSYMLSAT
FT                   RFKYSAGVRQSQDGFRVVKDLK"
FT   sig_peptide     complement(5840..5911)
FT                   /locus_tag="Bphyt_3994"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.988) with cleavage site probability 0.981 at
FT                   residue 24"
FT   gene            6280..6783
FT                   /locus_tag="Bphyt_3995"
FT   CDS_pept        6280..6783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_3995"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0468 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_3995"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18381"
FT                   /db_xref="InterPro:IPR025512"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE60"
FT                   /protein_id="ACD18381.1"
FT                   /translation="MRRTVTPVVLDVPHGSHARREVLRRTLRATLLLMFGNMVPSVFAA
FT                   AEQTPSPPGAEEYIIWPSDGTVIHGGKLWVRMGLRNMGVCPKGVVFPNTGHHHLLIDTD
FT                   LPPLDQEIPSDRNHLHFGAGETDARIELPPGKHTLQLILGDHNHVPHVPPVYSKKITIT
FT                   VLKD"
FT   sig_peptide     6280..6414
FT                   /locus_tag="Bphyt_3995"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.660) with cleavage site probability 0.505 at
FT                   residue 45"
FT   gene            6831..7265
FT                   /locus_tag="Bphyt_3996"
FT   CDS_pept        6831..7265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_3996"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0469 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_3996"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18382"
FT                   /db_xref="InterPro:IPR025512"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE61"
FT                   /protein_id="ACD18382.1"
FT                   /translation="MYKIIAVAALVMSAALASPNAAIAGTTPAPAGAHEYIGYPNDGQV
FT                   VPANKPFKVWFGLRYMGVAPKGVKYPNTGHHHLLIDTDLPPMDQEIPSDRNHLHFGAGE
FT                   TETMIQLPPGKHTLQLLMGDDMHVPHNPPVYSKKITVIAR"
FT   sig_peptide     6831..6905
FT                   /locus_tag="Bphyt_3996"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.956 at
FT                   residue 25"
FT   gene            7569..7850
FT                   /locus_tag="Bphyt_3997"
FT   CDS_pept        7569..7850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_3997"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0470 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_3997"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18383"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE62"
FT                   /protein_id="ACD18383.1"
FT                   /translation="MNTLMIKDLSITEQLDSRAMSAVRGGTGYYPSSSYFNFMPVYAPN
FT                   NSKTVDATQLINTTMNIQNANGNNAAFVAGISSTIDPHVTASNNINVH"
FT   gene            8076..9530
FT                   /locus_tag="Bphyt_3998"
FT   CDS_pept        8076..9530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_3998"
FT                   /product="RND efflux system, outer membrane lipoprotein,
FT                   NodT family"
FT                   /note="TIGRFAM: RND efflux system, outer membrane
FT                   lipoprotein, NodT family; PFAM: outer membrane efflux
FT                   protein; KEGG: bxe:Bxe_B0471 ABC efflux system, outer
FT                   membrane lipoprotein, NodT family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_3998"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18384"
FT                   /db_xref="GOA:B2TE63"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE63"
FT                   /protein_id="ACD18384.1"
FT                   /translation="MSALLSSARQRFFRGTSALRCVCAATVCALSLSACIDVSMPDYKR
FT                   PDTPAKASWSDQKGSPVSAAATIEPDWWKGFQDPYLDTLIAKAIAGNFDIKVLAARIDV
FT                   AGTQIGEAKAGALPTMDLGAGADFEKTTHQTFSRQYNLATQVNWDIDIWGKVEKGVQAQ
FT                   KAEFHASEADWRAGYLELVSNVSSTYFQILQFDDQIEQQQKTLETNRQILAIYDGQRRN
FT                   GLIPQTQVLRQQAEINRLTNQLLDLRRSRALANNALCTLIGVPAGEFQMPKGHLQQRVQ
FT                   LPPVPDGLPAQLLARRPDVVAAEFRVLEAYDLVGQAKLAQLPTISLTGHGGTASFALTD
FT                   LLKSFTYGFMPSINIPLLDPGVRAHVKVTQAQSTVAEQQYRVAVMGAFEEVENALVNVN
FT                   SHKEQRVELQQEVSRLQIVADQIQSQLRLGVVSQLEVFETERTLLEAQQGLLANHQQIL
FT                   SDTVLLYKALGGGWPSGDVQAQVKEH"
FT   sig_peptide     8076..8180
FT                   /locus_tag="Bphyt_3998"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.947) with cleavage site probability 0.841 at
FT                   residue 35"
FT   gene            9760..12342
FT                   /locus_tag="Bphyt_3999"
FT   CDS_pept        9760..12342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_3999"
FT                   /product="FHA domain containing protein"
FT                   /note="PFAM: Forkhead-associated protein; KEGG:
FT                   bxe:Bxe_B0472 putative forkhead-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_3999"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18385"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE64"
FT                   /protein_id="ACD18385.1"
FT                   /translation="MAAGEAPIAEMRATEDAAFDVVLSPIASAQRPALDAIRIVDNLFA
FT                   IGRSEAPFTDYPAERIARLSRRHARVFTEHGAVYVADLGSKNGTTVNGVAVRQTPARVR
FT                   AGDELCFGGELCYRVSIEPRARIVAAASPSAAPGLLLVPQRDDLGLQPIEVQAFPFLVS
FT                   KADEVFSRYKDRYPHQVNYISRRHAHIFLKGGELYVEDLGSTNGTFVGGKRLDESALPL
FT                   VEGDLVAFGGDHFVYRVSLQKPPEVEPTVTQLFVNPAANEAVDPDKTTFVGAAHSFLDI
FT                   FCVDPGLQREDEVNEAAQAASAHAKRDAPTGTAKAASGTNGANGANGAANAAAAKSRPR
FT                   RWRLVAGELGKAFAIDDRASVRRMATWGGVGVVVLAAIATTLYMRGSSERELKNLLANG
FT                   DYTSAVTAASGYLASHPADTKVKALASEALLKAKLPSWLNALQKAQFDQADALLKEMRS
FT                   LSANNADAASLVNELQWVGDLERFVAARGGMDAPIRMYADEGTINNLLQRWEDDARSHQ
FT                   RALDRIASYVPVFADPYAQALSHLRKLESDDSVYLAAIDRLNGTIRTELARDKPDALPP
FT                   VLDDYTQRYPRLAGIDRVRQDLRQYTDLLNAALSRQLVPLLAMLKTARFSTPPFQAQFQ
FT                   QLAASRLPSPDVIARHDAVTAAWQHGDAQQALAGLQAMPAGPWSDVLAAELAHKKTLLD
FT                   QYAQLQKTRGDKDYDQRLLSFYASLDPATDVWFLQSIQKDVAALHDKALARAQDLLLRA
FT                   QSLWKQYRAGGSIGGTQRLEAGISPGFRSEARLLSDAKTSAQQGMRIYTQLKADHPADF
FT                   DRLLADIEAEANLQRRSLTELRMVLDPGLLKAKLALIGGEQSETRQSP"
FT   gene            12320..13693
FT                   /locus_tag="Bphyt_4000"
FT   CDS_pept        12320..13693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4000"
FT                   /product="secretion protein HlyD family protein"
FT                   /note="PFAM: secretion protein HlyD family protein; KEGG:
FT                   bxe:Bxe_B0473 ABC efflux pump, membrane fusion protein,
FT                   HlyD subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4000"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18386"
FT                   /db_xref="GOA:B2TE65"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE65"
FT                   /protein_id="ACD18386.1"
FT                   /translation="MKRDSHPRPLSEALEDHSVEGIAILMAEPVRLARALIWAMVALVV
FT                   VGLLWSFVGRADVIVSAQGTLSPESEVRRIYAPIDGELADLYIAEGQPVQKGDVLARLN
FT                   ARGAIEAASNALQAQLKLEDAERDWKQFPEKKALMERKAAALKTQMEVEARQHENRVSE
FT                   GTTKLAEGQKAELDEARSILDNARRTREAARQELDRYSRLFAQPGGGGIAELQVEQKRT
FT                   AAMEADNAYRVAQSKLAELDFRLSHEYTQANAQLETSGQQTTDLQLQYDSAVRDITDAE
FT                   DKLRLQLQSARLVSEAAARIRFENIDKDNFLLILAPVSGVITDVTSTQRGDKIQANAPL
FT                   GGIAPKDARPVLKIEIAEHDRAFLHEGLPVKLKFNAFPYQRYGLISGTLAYISPATKPS
FT                   LTDKQPVYEGRVTLDKNYYQIADTRYPLRYGMTASAEIVVRERRLIDLGLDPFRQVAG"
FT   gene            13731..14483
FT                   /locus_tag="Bphyt_4001"
FT   CDS_pept        13731..14483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4001"
FT                   /product="PpiC-type peptidyl-prolyl cis-trans isomerase"
FT                   /note="PFAM: PpiC-type peptidyl-prolyl cis-trans isomerase;
FT                   KEGG: bxe:Bxe_B0474 putative peptidyl-prolyl isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4001"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18387"
FT                   /db_xref="GOA:B2TE66"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE66"
FT                   /protein_id="ACD18387.1"
FT                   /translation="MTAIVRIDDEVVDVAEFIRLLKLTGQFESLIEQIVRDKLTVHAAK
FT                   KQGITVTADEIQQRADQFRRVRGLHRATDMNQYLDALNVSLDEFEAFITDGLYQEKMLD
FT                   EIGNEAAIKDYFALNSPKFDAIEVSHIVLDSEGKAKEMISYLHDDPDSFADMAREHSIA
FT                   DTREAGGVIGKVLRGSLKPDIEAKIFNAAVGDLLGPFPSADRSCFEIFAVTAKYPATLD
FT                   ADVASEVRRLLREGWLISRAQEHVIEAR"
FT   gene            14550..17606
FT                   /locus_tag="Bphyt_4002"
FT   CDS_pept        14550..17606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4002"
FT                   /product="cyclic nucleotide-regulated ABC
FT                   bacteriocin/lantibiotic exporter"
FT                   /note="PFAM: cyclic nucleotide-binding; ABC transporter
FT                   transmembrane region; ABC transporter related; peptidase
FT                   C39 bacteriocin processing; SMART: AAA ATPase; KEGG:
FT                   bxe:Bxe_B0475 cyclic nucleotide-regulated ABC
FT                   bacteriocin/lantibiotic exporter, fused ATPase and inner
FT                   membrane subunits"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4002"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18388"
FT                   /db_xref="GOA:B2TE67"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005074"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR018488"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE67"
FT                   /protein_id="ACD18388.1"
FT                   /translation="MDAPQTAPSAAEFLTSVEIFSPFSRDEIERLAEYAQARFYSFGET
FT                   VCSAGETADGLYVIRSGSVRIFSEEHGKETSLGVRKSGEIFADIAMLRTYVHEASVRSS
FT                   AKTELLFIPRAAIEPVIAGNQAALAFVASYVAINSAGGFVAQLFDLRGKLNKAELEEYV
FT                   RSVGVKRVAAGKEILKQDGREDRRLYVVRHGEVRIVRHEEGHDYTLATLGEGEIFGEKA
FT                   CLMRQEQMASVVATTDTRLLVIPERTVHFILERNPKLREVLDERIRYGDRELQRQKRVE
FT                   QRRKLPLMLDLQSKPEFGEKVIKRFALVEQAEEMDCGAACLAMVCRHYSIPMTLGKLRE
FT                   LANVTTQGATLDSLARAGESLGFTARGVQCTFDSLRGFDLPFIVHWEGYHYVVVYGLSK
FT                   EYVWVADPAVGFKKMTVEDFERGWSGTCLLFTGGPHLLQMSAARSPWIRFVGYLKPYKK
FT                   ILGHLFLATFVIQVLGVIPPLIIQNILDGVIVHQNVSLLHLLIGGLIISNVFSQLMSSI
FT                   RAYLANFMVRNMDFAMMSQFFKHTMSLPFSFFAKRKTGDIFARFQENQTIRAFLTESTV
FT                   TTALNLLMVFIYFTIMFVYNVKMTLVLIAFVIPIMALTAIATPKIKGYAREVFTASTES
FT                   KSFLMEALAGVETIKGMGIERPVRLRWEKKYAKALEVQYRAHAFNILVGLGSQLLNSAT
FT                   TIAILWVGANLVLAREMTIGQLIAFNAFMGSVLGPLMGLVGLWSMLNDAGVAMERLGDV
FT                   LDIEPEQKPQDLPSRVMLPELQGEISLSGVYFRYGENDSAYVLENISFDIKPGELVAIV
FT                   GRSGSGKTTLAKLLVGFYTPTEGKMTIDGYDLGVVDKAYYRAQIGYVMQSNLLFSGTIS
FT                   ENIASGDDAPDRRRIEEVAKMADAHGFISKMPLGYEQIVGERGIGLSGGQIQRLCIARA
FT                   LYHDPRLLVFDEATSALDSQSESNILGNMHDILKGRTAVIIAHRLSTIMRADKILVLYE
FT                   GAIVEQGRHDELIQRGGMYYQLVQKQLSA"
FT   gene            17606..18961
FT                   /locus_tag="Bphyt_4003"
FT   CDS_pept        17606..18961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4003"
FT                   /product="putative sigma54 specific transcriptional
FT                   regulator"
FT                   /note="PFAM: sigma-54 factor interaction domain-containing
FT                   protein; ATPase associated with various cellular activities
FT                   AAA_5; SMART: AAA ATPase; KEGG: bxe:Bxe_B0476 sigma54
FT                   specific transcriptional regulator with PAS sensor, fis
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4003"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18389"
FT                   /db_xref="GOA:B2TE68"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE68"
FT                   /protein_id="ACD18389.1"
FT                   /translation="MMKILDQIEEASPAISYAGLIERIEILRSTLRWSSRLERADIDKL
FT                   LRQATSLRDEVMQLSHKERFVQAAVAAEPQERADLSRGARRKALLERSFIFEGTFGDNP
FT                   RLLESLEIAEKAAPTDLPVLIDGESGTGKELMAKVIHANGSRADKPFISVNCGAIPDNL
FT                   LESELFGHRKGAFTGASNDRKGKFESAHTGTIFLDEIGELPLAGQVKLLRVLEAHEIQR
FT                   VGSDETIAVDTRIVAATNRNLRRLSEEGKFREDLFYRLSVIHVTLPPLRERRDEIPLLI
FT                   SWFGDEAAGTLKRRPVRLTPRLRDFLLNYAYPGNIRELRNVMYRVSCLAGDMADVDHLP
FT                   VDMRPAAPGTAAASNAATATGQEPISVANLMSLSDAKRAASDDAEKAFLERGLREVSGT
FT                   VAELARRIDMNRSHLQMLLKKHGLHSKDFRNRNQPAANKNGAEDRDDEDNDT"
FT   gene            complement(18986..19756)
FT                   /locus_tag="Bphyt_4004"
FT   CDS_pept        complement(18986..19756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4004"
FT                   /product="protein serine/threonine phosphatase"
FT                   /note="PFAM: Protein phosphatase 2C-like; SMART: protein
FT                   phosphatase 2C domain protein; KEGG: bxe:Bxe_B0477 protein
FT                   serine/threonine phosphatases"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4004"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18390"
FT                   /db_xref="GOA:B2TE69"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE69"
FT                   /protein_id="ACD18390.1"
FT                   /translation="MTCASQFRWTSSARSDAGRVREINEDSCLDQSALGRWAVADGMGG
FT                   HAVGDLASRLVIDALSRLTPPVSMKSFVADARARLQTANRQLREEAARRQVQRIGSTVV
FT                   ALLACDRFCGYIWAGDSRLYLLREGSLRQLTRDHSQVEALKSLGVLTEEEARHHPAQHM
FT                   ITRAVGATDLLELDDDVIEVADGDVFLLCSDGLSNEVSEDDMLAVMSNAACANACEELV
FT                   DMALARGGRDNITAVVVRAEDPNAADKTLLNPSP"
FT   gene            complement(19762..20049)
FT                   /locus_tag="Bphyt_4005"
FT   CDS_pept        complement(19762..20049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4005"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0478 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4005"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18391"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE70"
FT                   /protein_id="ACD18391.1"
FT                   /translation="MASITVSDLSLNLALDRKAMTAIRGGGGAPWVYGWIQPYVRDTPS
FT                   IGPVVNLYDVTNNFYANQMINTFQSVDVRNTGANSNISVSPDARSRNDMV"
FT   gene            20520..21017
FT                   /locus_tag="Bphyt_4006"
FT   CDS_pept        20520..21017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4006"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0479 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4006"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18392"
FT                   /db_xref="InterPro:IPR007053"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE71"
FT                   /protein_id="ACD18392.1"
FT                   /translation="MNTNQTSSEHSADRCDAASTIDLPIGAHLVTQRRGYEHHGIYVGN
FT                   GRVVHYSGFAGSTHRGPVEEVELERFAAGHPLSIRPTPAARYVGDEAVRRARSRLGENH
FT                   YRLLTNNCEHFCAWCLLGESRSEQVHCCLRHPRTGMHALVCLVKAFVESSAKGAHGSAQ
FT                   FA"
FT   gene            21085..21342
FT                   /locus_tag="Bphyt_4007"
FT   CDS_pept        21085..21342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4007"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0480 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4007"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18393"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE72"
FT                   /protein_id="ACD18393.1"
FT                   /translation="MAAAEKTLHWAVDKWLAPTPSMPARVVQFCHRASQHQRYVCVEAL
FT                   RPGGMLSIFFFRHDDGSWNVFPPQAERPAMNGHRRALLAA"
FT   gene            complement(21339..22217)
FT                   /locus_tag="Bphyt_4008"
FT   CDS_pept        complement(21339..22217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4008"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bxe:Bxe_B0481 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4008"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18394"
FT                   /db_xref="GOA:B2TE73"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037422"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE73"
FT                   /protein_id="ACD18394.1"
FT                   /translation="MRPYLPLNALRAFESSARHLSFTRAAFELNVTQAAVSQQVRTLEE
FT                   RLGTALFKRLPRGLAMTDEGLALRPVLTDAFDRIEAVLKQFEGGHFHEVLTVGVVGTFA
FT                   VGWLMPRLKSFRDAHPFVELRLLTNNNLVDLATEGLDFAIRFGDGTWPGSLATRLLDAP
FT                   LALLCTPEIAERLTKPEDLAGETLLRSYRTDDWMSWFSAAGIPPRPIRGPVFDSSRLMV
FT                   EAAMQGAGIALAPALMFDHEINTGRLVRPFDVEVHAGSYWLTWLKGKPMTPAMLLFNQW
FT                   IIKEASAQTQN"
FT   gene            22318..23265
FT                   /locus_tag="Bphyt_4009"
FT   CDS_pept        22318..23265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4009"
FT                   /product="Beta-lactamase"
FT                   /EC_number="3.5.2.6"
FT                   /note="PFAM: beta-lactamase; KEGG: rpa:RPA0362 putative
FT                   class A beta-lactamase precursor (penicillinase)"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4009"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18395"
FT                   /db_xref="GOA:B2TE74"
FT                   /db_xref="InterPro:IPR000871"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023650"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE74"
FT                   /protein_id="ACD18395.1"
FT                   /translation="MITRRKFAGAMLGVSIAGVAVGSVGAFGKASGKTVKTGAAAQGRE
FT                   LAKADAIRRRLAEIEAASGGRLGVSIVDTMSGVHAGLRTDERFPMCSTFKILVAGAVLA
FT                   RTDRGEESLQRRVVFSLSDVVSNSPATSKHTRELIGNAGMSVAELCKAAITLSDNTAAN
FT                   LLLSTFGGPAGLTAFARSLGDRVTRLDRIEPALNEGTPGDLRDTTTPNAMLGNLRELLL
FT                   GERLSSSSRAQLLAWLAANETGGARIRAKLPKDWGVGDKTGTGDHGTANDVAILWPPGR
FT                   GPVLVTVYLTETDGDAARSNTAIADVGALVVASI"
FT   sig_peptide     22318..22404
FT                   /locus_tag="Bphyt_4009"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.559 at
FT                   residue 29"
FT   gene            23311..23556
FT                   /locus_tag="Bphyt_4010"
FT   CDS_pept        23311..23556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4010"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sus:Acid_4229 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4010"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18396"
FT                   /db_xref="GOA:B2TE75"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE75"
FT                   /protein_id="ACD18396.1"
FT                   /translation="MTDAPIEVRDDTPLAFLGFTATPHIFTVLAIVELIADQLPKPLAI
FT                   PCRCNSARVSCLAASGVTRRRGADRHGVALMYFRKM"
FT   gene            complement(23615..24631)
FT                   /locus_tag="Bphyt_4011"
FT   CDS_pept        complement(23615..24631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4011"
FT                   /product="C4-dicarboxylate transporter/malic acid transport
FT                   protein"
FT                   /note="PFAM: C4-dicarboxylate transporter/malic acid
FT                   transport protein; KEGG: bxe:Bxe_B0482 potassium-tellurite
FT                   ethidium and proflavin transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4011"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18397"
FT                   /db_xref="GOA:B2TE76"
FT                   /db_xref="InterPro:IPR004695"
FT                   /db_xref="InterPro:IPR038665"
FT                   /db_xref="InterPro:IPR039264"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE76"
FT                   /protein_id="ACD18397.1"
FT                   /translation="MNSNRGTIPVAFFGIAVGALAFANLWRVAIRLWHLPALAGDAITV
FT                   AALAVWLVILVAYGQKWLTRADEARAEIQHPVQSSFAALAPISSLLAAQLLQPYAHTLA
FT                   LALYGVAVVAQLALGMYLHGRLWQGGRKPELVTPAIYLPTVGASFVAGTASAAFGFHQL
FT                   GELFFGVGLLSWLAIESLVLHRAAVHEPLPDALRPVLGIQLAPPVVGGVTYLSLSSGTP
FT                   DLFAMILLGYGLYQALLLLRLLPWIRQQAFTPAYWAFSFGVAALPTMALRMVERGATGP
FT                   VEYAAPVLFIAANVIIAILAVKTLSLLMRGKLIPATPVTGALSAPQTPAGSRIARAS"
FT   sig_peptide     complement(24566..24631)
FT                   /locus_tag="Bphyt_4011"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.974) with cleavage site probability 0.527 at
FT                   residue 22"
FT   gene            24912..25676
FT                   /locus_tag="Bphyt_4012"
FT   CDS_pept        24912..25676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4012"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="PFAM: regulatory protein IclR; Transcriptional
FT                   regulator IclR; KEGG: bch:Bcen2424_5466 transcriptional
FT                   regulator, IclR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4012"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18398"
FT                   /db_xref="GOA:B2TE77"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE77"
FT                   /protein_id="ACD18398.1"
FT                   /translation="MPTPADKSNTKESEGVAVIDRACAILFAFRPDDYALTLAELAART
FT                   GLYKSTLLRLAGSLIQHRLLLRLDDGRYQLGSATFMLGALYQRSLNLGDIVVPLMRELA
FT                   ETSGESVSFYVRDEAVRVCLHRVDSRHAVRFHVREGDVLPLESGSGGLALLAFGGMPGA
FT                   PYEKIREDFYCVSIGERDRETAGISMPVFGVRQSLRGVLTLAGPSSRIDQAFLERNLGA
FT                   LFDCAARATDALGGDSRAMRNAQRRAAEVQDK"
FT   gene            complement(25706..26530)
FT                   /locus_tag="Bphyt_4013"
FT   CDS_pept        complement(25706..26530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4013"
FT                   /product="citrate synthase"
FT                   /note="KEGG: reu:Reut_B4959 citrate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4013"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18399"
FT                   /db_xref="GOA:B2TE78"
FT                   /db_xref="InterPro:IPR002020"
FT                   /db_xref="InterPro:IPR016142"
FT                   /db_xref="InterPro:IPR016143"
FT                   /db_xref="InterPro:IPR036969"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE78"
FT                   /protein_id="ACD18399.1"
FT                   /translation="MTQAFDAAKLAADYWSTSIIDIHPGSINVRGFPIQELIGNISFPQ
FT                   MIWLMLRGELPDTEQARLFEAALVSSVDHGPHAPSIAISRMATSCGLPLNGAMASAINA
FT                   LDDVHGGAGQQAVELYDAIDVRMQAGATLEHAVEQGVDAFIAAHGKYLPGFGHRFHPVD
FT                   PRAPRLLALVDENVRAERISGRYAVIARGIEALLMSRKSKPVPMNIDGATAVIYAELGF
FT                   APELARGVFCLSRAVGILSHAWEQRGRKERNKGPMPRQMAYTYTGKPERHLP"
FT   gene            complement(26533..27732)
FT                   /locus_tag="Bphyt_4014"
FT   CDS_pept        complement(26533..27732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4014"
FT                   /product="L-carnitine dehydratase/bile acid-inducible
FT                   protein F"
FT                   /note="PFAM: L-carnitine dehydratase/bile acid-inducible
FT                   protein F; KEGG: reh:H16_B2210 predicted acyl-CoA
FT                   transferase/carnitine dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4014"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18400"
FT                   /db_xref="GOA:B2TE79"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE79"
FT                   /protein_id="ACD18400.1"
FT                   /translation="MTLPLAGVRVLDLSNVLAGPFCAYQLALLGAEVIKVEHPEGGDLA
FT                   RRLGADKDASARNMGASFVAVNAGKQSVTLNLKDPRGKAILRELVKTADVLVENFRPGV
FT                   MTRLGLDFEALREVNPKLVYCAISGFGMDGEFSKRPAYDQIIQGISGVMSVTGDADSAP
FT                   LRVGYPVSDTVGGLTAAFGICAALLDARATGHGRMLDVSMLEATLATMGWVVSNFLNAG
FT                   VTPTPMGNENFTAAPSGTFKTGDGPLNIAANENKQFVSLCQLIGRADLLDDPRFSERNA
FT                   RKMNRAALKAEIEAALARDSAANWEARFFEAGVPAGRVMSVPEILAHPHLESRGFIREF
FT                   AADATTERQRVTRAGFRLHDADTAPGTPAPVLSAHTREQLAALGYDDAHIDQLRAEGVV
FT                   "
FT   gene            complement(27774..29207)
FT                   /locus_tag="Bphyt_4015"
FT   CDS_pept        complement(27774..29207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4015"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1; KEGG: bcm:Bcenmc03_5007
FT                   major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4015"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18401"
FT                   /db_xref="GOA:B2TE80"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE80"
FT                   /protein_id="ACD18401.1"
FT                   /translation="MASLPIDASGASPHSSAGAPALTPGVNARIDRLPATRAVWMLVLL
FT                   LSIGGWFEFYDLFFTAYVGPGLVKSGVYSTTTASFFGVSGLGAFVAASFAGLFIGTFFL
FT                   AGMADRYGRKTVFTVSLLWYSAATLIMALQSTAPAINLWRLIAGIGVGVELVTIDTYVS
FT                   ELVPKHLRGRAFAFVHLVQYTAVPSVAFLAWWLVPRTPFGLDGWRWVVIIGALGAVVVW
FT                   AIRRRLPESPRWLAQQGRAAEAEQVLQALEAKVAAQYGKPLPPAVPTVEPATTKAAFRE
FT                   IWQPPYRKRAITMLVFNLFQAIGFYGFASWVPTLLVSKGVTITHSLLYSFVIAASNPFG
FT                   PLIGMAIADRIERKTLIVLSALGIAVFGSLFAMQTSPAMLMTLGVLITLSGTLLSVGYH
FT                   AYQTELFPTRLRARAVGFVYSMSRLSAMFSGFMIAFALRHFGVSGVFALISASMVMVMG
FT                   AIGIFGPRTNHRNLDEISH"
FT   gene            complement(29413..29763)
FT                   /locus_tag="Bphyt_4016"
FT   CDS_pept        complement(29413..29763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4016"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   bxe:Bxe_B0483 response regulator receiver domain
FT                   protein(CheY)"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4016"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18402"
FT                   /db_xref="GOA:B2TE81"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE81"
FT                   /protein_id="ACD18402.1"
FT                   /translation="MKTILVVDDEFDILTVWRLLLERHGYTVLTASNGAAALEQIRNTR
FT                   PDIIVSDCMMPVMSGLQLCAELNADSDLRAIPIILCSAAADIPVQPNPRIEYARKPLSF
FT                   DALLTMLQRMGA"
FT   gene            complement(29770..31245)
FT                   /locus_tag="Bphyt_4017"
FT   CDS_pept        complement(29770..31245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4017"
FT                   /product="Non-specific serine/threonine protein kinase"
FT                   /EC_number="2.7.11.1"
FT                   /note="PFAM: KaiA binding; KEGG: bxe:Bxe_B0484 RAD55"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4017"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18403"
FT                   /db_xref="GOA:B2TE82"
FT                   /db_xref="InterPro:IPR010624"
FT                   /db_xref="InterPro:IPR014774"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030665"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE82"
FT                   /protein_id="ACD18403.1"
FT                   /translation="MTNHESQTSSRSNVETGVPGLDEILGGGLVRGGVYLLEGMAGAGK
FT                   TILSSQIGFHRVSQGEKVLYMTLIAESHDKLLGHLKGLSFFDEKAVAQQMLFVSGYHEL
FT                   MKDGLDGFLKLIASSIYDYRPSLMIIDGFRSAREFSETELSLSKFIHELNALVAAMDCT
FT                   TLLLAPLSGNEPHPEHTLVDGLIELNRYSDGMRRAREIEVHKMRARNHLMGKHFFRIAE
FT                   SGLLMFPRLEAQCAAQAGPVDLKTRLGFALPHLDGLLGGGFAQGSTTTLVGPSGVGKTL
FT                   LCLQFLAAGVARGERCLYLGFYEGPQRLIGKAEAVSIGLANAYQDGRLVIQWQPAIELA
FT                   VDELAATALATVKKIGASRIVIDGVEGFRDSALRTERFGLFLNALLHQLREACITTLLT
FT                   EELPLYADPGHARSVRVSALTENLVLLRYAETDTGLRRMISVVKQRESAHDTSLRELVI
FT                   SSQGLDVIENPASAASLHAPAGLSATLQPRRNT"
FT   gene            complement(31599..33332)
FT                   /locus_tag="Bphyt_4018"
FT   CDS_pept        complement(31599..33332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4018"
FT                   /product="Feruloyl esterase"
FT                   /EC_number="3.1.1.73"
FT                   /note="PFAM: Tannase and feruloyl esterase; KEGG:
FT                   bvi:Bcep1808_3848 feruloyl esterase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4018"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18404"
FT                   /db_xref="GOA:B2TE83"
FT                   /db_xref="InterPro:IPR011118"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE83"
FT                   /protein_id="ACD18404.1"
FT                   /translation="MKCTSIALAAAATLTLAACGGNDLGSAANTGANSSALPQLSAATP
FT                   GTLAGNCAALAAKLSFANTVFTTVTDVAAGTLKVAGKSIAEHCLIQGSMNQRVSSVDGK
FT                   TYAIGFEMRLPIAWNGRFFYQPNGGLDGNVVTATGEIGGGGPTSDALNMGFAVISSDAG
FT                   HSSAQNPLFGLDPQARIDYGYNAVATLTPMAKQVIKLAYGKAPDRSYFDGCSNGGRHAL
FT                   VAAARSSAEYDGIIAGDPGFHLPKAAVGEMWSAQQLAKVATATTSNGLPDITTGFTATE
FT                   RQMVASKILSKCDALDGATDGLIQDIKACQANFSLATDVPTCTNNVRDGTCLTSAQKDA
FT                   VGNVFSGARNSAGTALYASFPYDAGLGPGWSAWKQANSITLDPAAAAFTFTTPPQTAAV
FT                   LSQLSAYALNFSMDTDAPKIFATSGAYSESAWSFMTPPDETNLSALKQRGAKLMVYHGT
FT                   SDPVFSSNDTTDWYQRLTAANSGDASNFARLYTIAGMNHCSGGPSTDQFDMLTPLVAWV
FT                   EQGKAPDSVVATARDASNVTPNSDVPTGWGAGRTRPLCPYPKVARYQGGDVSAASSFAC
FT                   S"
FT   sig_peptide     complement(33270..33332)
FT                   /locus_tag="Bphyt_4018"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.595 at
FT                   residue 21"
FT   gene            complement(33343..34482)
FT                   /locus_tag="Bphyt_4019"
FT   CDS_pept        complement(33343..34482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4019"
FT                   /product="porin Gram-negative type"
FT                   /note="PFAM: porin Gram-negative type; KEGG:
FT                   bvi:Bcep1808_3847 porin, gram-negative type"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4019"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18405"
FT                   /db_xref="GOA:B2TE84"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE84"
FT                   /protein_id="ACD18405.1"
FT                   /translation="MQASARLLLCGALCAVSGAAAAQSSVTLYGIIDTGIEYVSHANAA
FT                   GKSVFRMPSVTGELPSRWGLRGNEDLGGGYSAVFTLESGFNVRAGDLGQGGRLFGRQAF
FT                   VGIKSPYGTVSFGRQYTMTYLALMGADLIGPDIYGLGSLDAYVPNARADNSVVYLGSYA
FT                   GVTLGANYSFGRDSAGTGNSPGQGTCTGSVAGQATQCREWSVMLKYDAPLFGVAASYEE
FT                   QRGGSTAAANFFDGIAPTPLTRAADKDIRTHVSAYANLGKAKLGLGWLNRRVEPGADTI
FT                   ASVRSNLFFVAASYNVTPAFIVDGEVYHITNSEHDTRATMGTLRTTYLLSKRTAVYAQG
FT                   SYLANSAKAHYSVSGGGGGTTPTAGTGQTGAMVGIRHSF"
FT   sig_peptide     complement(34414..34482)
FT                   /locus_tag="Bphyt_4019"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.892 at
FT                   residue 23"
FT   gene            complement(34544..35791)
FT                   /locus_tag="Bphyt_4020"
FT   CDS_pept        complement(34544..35791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4020"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1; KEGG: bch:Bcen2424_5633
FT                   putative 3-hydroxyphenylpropionic transporter MhpT"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4020"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18406"
FT                   /db_xref="GOA:B2TE85"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE85"
FT                   /protein_id="ACD18406.1"
FT                   /translation="MKRAGTLNSTEATTVPAASSRTGAFVTLGLCFAIALLEGLDLQSV
FT                   GVAAPRMAREFGLSVAQMGLAFSAGTFGLLPGAMFGGRLADRIGRKRVLVISACLFGLL
FT                   SIMTALVSDFHTLVIVRVLTGIGLGGALPNLIALSSEAVEPRSRGTAVSVMYCGIPFGG
FT                   VIASVIGVLSAGDTEWRHIFYVGGAGPLVLVPLLLVFLADSKAFTKASRDGQVKPAPVG
FT                   EILFGGTRGLSTVQIWVSYFCTLIVLYFLLNWLPSLMAASGLTRAQVGYVQIFFNIGGG
FT                   IGALCIGMLMDRMRSGVVVAGMYVGIIASLATLSTAHGFGALAASAFFAGMFVIGGQSV
FT                   LYALSAAFYPTAMRGTGVGAAVAVGRIGSVVGPLAAGQLLAMGRSSSTVIGASIPVTLI
FT                   AAAAALLLLRRPRADD"
FT   gene            complement(36123..36623)
FT                   /locus_tag="Bphyt_4021"
FT   CDS_pept        complement(36123..36623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4021"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; KEGG:
FT                   bpd:BURPS668_A1140 transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4021"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18407"
FT                   /db_xref="GOA:B2TE86"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE86"
FT                   /protein_id="ACD18407.1"
FT                   /translation="MRDRPNLLSMMSKNQNTPAEPAATRTRRSSLRLTYVIGSLDRILR
FT                   RRMTEALAPLGLTLAQFTALSVLEAKGQASNAQVAERSFITPQSANEVMNAMAARNWVS
FT                   REPDPRHGRIVLLQLTDEGRAVLRDCEQAVKTIEKQMMEGIELDAAGAVQTHLETFVRN
FT                   LRG"
FT   gene            36761..37588
FT                   /locus_tag="Bphyt_4022"
FT   CDS_pept        36761..37588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4022"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   bvi:Bcep1808_3841 p-hydroxycinnamoyl CoA hydratase/lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4022"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18408"
FT                   /db_xref="GOA:B2TE87"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE87"
FT                   /protein_id="ACD18408.1"
FT                   /translation="MSYEGRWKTVKVDVAEGIAWVSFNRPEKRNAMSPTLNKEMIEVLE
FT                   AVELDAEAQVLVLTGEGDAWTAGMDLKEYFREVDAGPEILQEKIRRDACRWQWQLLRMY
FT                   SKPTIAMVNGWCFGGGFSPLVACDLAIAADEATFGLSEINWGIPPGNLVSKAMADTVGH
FT                   RQALYYIMTGETFTGQEAAQMGLVNKSVPRAELREATRALAGKLLEKNPVVLRAAKHGF
FT                   KRCRELTWDQNEDYLYAKLDQAQLRDPEGGREQGLKQFLDDKAIKPGLQTYKR"
FT   gene            37670..39121
FT                   /locus_tag="Bphyt_4023"
FT   CDS_pept        37670..39121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4023"
FT                   /product="Aldehyde Dehydrogenase"
FT                   /note="PFAM: Aldehyde Dehydrogenase_; KEGG:
FT                   bvi:Bcep1808_3842 aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4023"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18409"
FT                   /db_xref="GOA:B2TE88"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE88"
FT                   /protein_id="ACD18409.1"
FT                   /translation="MHEVTLLIGGESRGAADGKTFERINPASGQAASRAAAATLADADA
FT                   AVEAASRAFPAWSALAPTRRRKRLLAAADLMDARTAQFIETGVAETGAMPNWYGFNVML
FT                   AANMLREAAAMTTQIDGDVIPSDVPGSLAMAVRQPCGVVLGMAPWNAPVILGTRAIAMP
FT                   LACGNTVVLKASEGCPGVHRLIGSVLQEAGLGDGVVNVITHSAEDAPAIVERLIAHPAV
FT                   RRVNFTGSTRVGRIVAQHAASHLKPALLELGGKAPVVVLDDADLEAAVAGIAFGAFFNQ
FT                   GQICMSTERVIVDRKIADALVEKLAAKARTLKAGDPAAADSVLGVLESAAAAQRIKALI
FT                   EDAYEKGAKLPVGCTAEGAAMQPVIVDGITPAMKLYAEESFGPVVTVQRVDGDEEAIRI
FT                   ANDSEYGLSAAVFSRDVSRALNVAKRIESGICHINGPTVHDEAQMPFGGVKKSGYGRFG
FT                   SKASIAEFTDLRWITIQTGPRHYPI"
FT   gene            39158..41059
FT                   /locus_tag="Bphyt_4024"
FT   CDS_pept        39158..41059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4024"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   bmu:Bmul_3212 AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4024"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18410"
FT                   /db_xref="GOA:B2TE89"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE89"
FT                   /protein_id="ACD18410.1"
FT                   /translation="MHSEPIQPNTPDAPMRYRATTIGASSLRTQRQGDTWYLRAAEPLG
FT                   AHPQRMTDRLVSGARAHPERWLAARRGSDGQWIGLSYAKALQSARAIGQALLARGLSAE
FT                   RPLAILSGNDLEHLQLALGAMWAGVPYAAISPAYALASGDFGKLRHTIDLLTPGLVFAS
FT                   VYDSFAKAIDATVSFDVEVVAAKLPREQPAARNVTAFDELLNTTPTTVDTVHATVSPDA
FT                   IAKFLFTSGSTKLPKAVPTTHRMLCSNQQMLLETFPEFAKEPPVLVDWLPWNHTFGGSH
FT                   NVGIALYNGGTLYIDDGKPVNGKFEETLRNLREIAPTIYFNVPKGWEELAIALERDEQL
FT                   RETFFSRVKVYFFAGAGLSQAAWDRLERVTETYCGERIRIMAGLGMTETSPSCLFTTGP
FT                   IMRAGYVGLPAPGCEVKLAPVGDKLEARYRGPHVMAGYWRADTAELHNAFDEEGYFRSG
FT                   DALRFVDATRPELGLLFDGRIAEDFKLSSGTFVSVGPMRARVISEGAPYVQDVVVAGMN
FT                   RDDVGLLVFPRIDDCRRLARLPASASAREVVAAPAVRAHFTALLDTLNRSATGGATTIA
FT                   RLRLMDVAPSLDLGEITDKGSINQRAVLMHRAALVEAMYDVAQRDPAVIVASACGAT"
FT   gene            41099..41983
FT                   /locus_tag="Bphyt_4025"
FT   CDS_pept        41099..41983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4025"
FT                   /product="amidohydrolase 2"
FT                   /note="PFAM: amidohydrolase 2; KEGG: bvi:Bcep1808_3840
FT                   amidohydrolase 2"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4025"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18411"
FT                   /db_xref="GOA:B2TE90"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032465"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE90"
FT                   /protein_id="ACD18411.1"
FT                   /translation="MNLDQLVAIDTHVHAEVSCCQPPDLFGKEFDDAADKYFGTVLKLG
FT                   RRPTIPETIEHYRVRKIGFVMFTVDCEANLGRRRIPNEEIAEFAQKNSDIMIAFASIDP
FT                   HKGKMGVREARKLIEEYGVRGFKFHPTMQAFFANDRLAYPLYELIAEHRLTAVFHSGHS
FT                   GMGSGMRGGGGLRLKYSEPIHLDDVAADFPDMNIVIAHPSWPWQEQALSIALHKPNVYI
FT                   DLSGWSPKYFSPELIRYANTVLKRKMLFGSDFPLIQPDRWLEDFAQVGFREEVQPLILK
FT                   QNAIGLLGLQQAA"
FT   gene            42010..43176
FT                   /locus_tag="Bphyt_4026"
FT   CDS_pept        42010..43176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4026"
FT                   /product="Squalene/phytoene synthase"
FT                   /note="PFAM: Squalene/phytoene synthase; KEGG:
FT                   bxe:Bxe_B0485 squalene/phytoene synthase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4026"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18412"
FT                   /db_xref="GOA:B2TE91"
FT                   /db_xref="InterPro:IPR002060"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033904"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE91"
FT                   /protein_id="ACD18412.1"
FT                   /translation="MGRDRSAAHGRGASPYTIRQRLIFCPFFARFLHNSDLIPSMPNPT
FT                   RAFLLGPLLKGVSRSFYLTLRVLPVGMRDPIGLAYLLARAADTIADTSLISPEQRLALL
FT                   LSLRAQVNGATDDVALFQRMAAEVAGQQDQSDEKVLLESLGPALDVLSQLSESDRKAVR
FT                   EIVSTLTEGMEFDLRTFPDERSGQIAALREYDELDRYTYLVAGCVGEFWTTMTYAHMPG
FT                   TLKERPETMARRGVRFGKALQMTNVLRDCGKDLRIGRCYLPQTLLDRYGLSVQDLLVPA
FT                   NSVRARPLMLELLRTTLDHFRDALDYTLAIPAFSVRLRLACLWPILIGLETLLLLVDNA
FT                   AWLDPQKVSKVRRNRVYQIIASSLLLVPSNGLVRNAIEQRIRQIEARL"
FT   gene            43294..43542
FT                   /locus_tag="Bphyt_4027"
FT   CDS_pept        43294..43542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4027"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0487 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4027"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18413"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE92"
FT                   /protein_id="ACD18413.1"
FT                   /translation="MRQAFNIAVVLLLGYLMADRALMRAQAGEMGTITCHQGAEMVKSN
FT                   ALKKGFGDIGASSQGENFLSSCLVTGRGQVGDLIARD"
FT   gene            complement(43885..44202)
FT                   /locus_tag="Bphyt_4028"
FT   CDS_pept        complement(43885..44202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4028"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0489 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4028"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18414"
FT                   /db_xref="InterPro:IPR025421"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE93"
FT                   /protein_id="ACD18414.1"
FT                   /translation="MKSLIQAVVIAAVLAAPVASFAQSNQPVTRAQVRAELIQLEKAGY
FT                   QPGLADPYYPADIQAAQARVARENGTAQAAESGYGGTVSGASQAGRPVPANGPQSVYFG
FT                   H"
FT   sig_peptide     complement(44134..44202)
FT                   /locus_tag="Bphyt_4028"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.947 at
FT                   residue 23"
FT   gene            complement(44430..45122)
FT                   /locus_tag="Bphyt_4029"
FT   CDS_pept        complement(44430..45122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4029"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0490 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4029"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18415"
FT                   /db_xref="GOA:B2TE94"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE94"
FT                   /protein_id="ACD18415.1"
FT                   /translation="MDWSKVASNIGSSAPLLAGLVGGPIGVGVTAAAAIISHALGTPSD
FT                   PGVVELALNDPSALEKVRQAESANSLQLQQLMVTAAQASLAHESDMARIQAADRADARA
FT                   MGISNKDWVPKVLAMAVTAGFFGILLLMAFQPLPGTNKDLVNVIVGALGTAWISIIGYY
FT                   FGTSVGSMRKTELLAKPSVPITPDSALTLREPATASAARPQAAQAPSHSEAFQQFTPGG
FT                   QGPIFSGS"
FT   sig_peptide     complement(45027..45122)
FT                   /locus_tag="Bphyt_4029"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.788) with cleavage site probability 0.305 at
FT                   residue 32"
FT   gene            complement(45122..45604)
FT                   /locus_tag="Bphyt_4030"
FT   CDS_pept        complement(45122..45604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4030"
FT                   /product="protein of unknown function DUF847"
FT                   /note="PFAM: protein of unknown function DUF847; KEGG:
FT                   bxe:Bxe_B0491 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4030"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18416"
FT                   /db_xref="InterPro:IPR008565"
FT                   /db_xref="InterPro:IPR018537"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE95"
FT                   /protein_id="ACD18416.1"
FT                   /translation="MDNFEDAFRALIGSEGGYSFNPHDPGGETMWGVTARVARSAGYAG
FT                   AMKDLPLDTARQIAKQKYWDPLHLDELDPRVAFQIFDANYNGGLVVLWMQKASGAKEDG
FT                   KFGPDTLDAVKNADALKFVMRFAAYRLRYLRNLHAWPNFSRGWTERMAANLLLGAA"
FT   gene            complement(45686..47119)
FT                   /locus_tag="Bphyt_4031"
FT   CDS_pept        complement(45686..47119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4031"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: bxe:Bxe_B0492
FT                   putative TPR repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4031"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18417"
FT                   /db_xref="GOA:B2TE96"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE96"
FT                   /protein_id="ACD18417.1"
FT                   /translation="MSSVQSQRRPVNWQSRPFCADARSKRRMAKRDFPAGFVPFGLQTA
FT                   GFIVRGPKQLWPYVLPWVFAVLTIGFFCLVVRGVLTRQLLVPPVETPQSLVERGYTSNF
FT                   LAERIMSSMRAIGQDAESIPHDTLTDNDAQPDIQIPGQEMSYATTVRFIKGVIKRTDVA
FT                   VHVGITKVNDSADSYVAHVQIEGGPFNSRESTVSFEGRDLEKFVHDIAVKAMRLAEPNI
FT                   LASHLYSQVQKTKCSLAHCDYGEIVAIYDEVLALPASEQGEWALAGKAWLLANQGLSKE
FT                   AEQQTREALTVYQHSAVLHASLGIALEQQHRIDDALDALRAGAREKSKTAENLRLLGDV
FT                   LLHANRYSEALDAFKQADKMKPDSVDNLHDWGEALVTVGRYDEAIEKLSRAVALRPDLA
FT                   PSYAEWGRALDRKGDRSGASRKFAQALQLDAGTLSVRESHLARLARAAQGGNRPDASKP
FT                   DDGVRPVSNPPAPLALQTA"
FT   gene            complement(47455..47721)
FT                   /locus_tag="Bphyt_4032"
FT   CDS_pept        complement(47455..47721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4032"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B0663 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4032"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18418"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE97"
FT                   /protein_id="ACD18418.1"
FT                   /translation="MKKALIIAGGLLCAFTWQAHAQDAATESTAQAQPAAADAVGGQPS
FT                   TTSMSGGPLKAQGLTRADVYQQLVQSQKSGESARLQELFKGGN"
FT   sig_peptide     complement(47656..47721)
FT                   /locus_tag="Bphyt_4032"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 22"
FT   gene            complement(48178..49041)
FT                   /locus_tag="Bphyt_4033"
FT   CDS_pept        complement(48178..49041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4033"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bxe:Bxe_B0493 ABC
FT                   nitrate/sulfonate/bicarbonate family transporter, inner
FT                   membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4033"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18419"
FT                   /db_xref="GOA:B2TE98"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE98"
FT                   /protein_id="ACD18419.1"
FT                   /translation="MSTTPQQMMPSGIDAASLAHVERVAQKRIRQRHALVISLRIVVLV
FT                   VVLGGWELSARLKWIDPFFFSMPSAIFDQIIDWFVNGTSQGPLLTQVWVTLEETGLGFI
FT                   IGSVAGVFCGIVLGRNKLLSDVFSLYIKIANSIPRVVLGSVFVIALGLGMASKVALAVV
FT                   MVFFVVFANAFQGVREADRFMIANAQILGASRRQVTTSVVIPSALSWILASLHVSFGFA
FT                   LVGAVVGEFLGSKQGIGLLISTAQGAFNASGVFAAMIVLAVVALAADYLLTAVEQRLLK
FT                   WRPTAV"
FT   gene            complement(49058..49852)
FT                   /locus_tag="Bphyt_4034"
FT   CDS_pept        complement(49058..49852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4034"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bxe:Bxe_B0494 ABC nitrate/sulfonate/bicarbonate
FT                   family transporter, ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4034"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18420"
FT                   /db_xref="GOA:B2TE99"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE99"
FT                   /protein_id="ACD18420.1"
FT                   /translation="MNQPLSRDTPAIEMRNVSCRFISPDGKATIALRDFSMSVARGEFV
FT                   AVVGPTGCGKSTTLSMITGLLKPTTGEVRVMGAPVDGIDPRIGFVFQADAVFPWRSVLD
FT                   NVAAGPLYRGRSKSAAYDEANEWLRRVGLDKFGKHYPHQLSGGMRKRVALAQTFINKPE
FT                   ILLMDEPFSALDMQTRTLMQDELLQLWGGAGSVVFVTHDLEEAIALADRVFVLTARPAT
FT                   LKKVYEIDLPRPRVTSEIRYEPRFIEISRDIWHDLREEVQIG"
FT   gene            complement(49893..50912)
FT                   /locus_tag="Bphyt_4035"
FT   CDS_pept        complement(49893..50912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4035"
FT                   /product="ABC nitrate/sulfonate/bicarbonate family
FT                   transporter, periplasmic ligand binding protein"
FT                   /note="KEGG: bxe:Bxe_B0495 ABC
FT                   nitrate/sulfonate/bicarbonate family transporter,
FT                   periplasmic ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4035"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18421"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEA0"
FT                   /protein_id="ACD18421.1"
FT                   /translation="MRTLRQIAAVSGVAFTLAAASAAAHAEKLTIMVGGATKIIYLPAK
FT                   LTEQLGYFKDEGLDVEILSQPAGVDAENELLAGAVQGVVGFYDHTIDLQSKGKEVQALV
FT                   IFGQVPGEVEMVSTKAADSFKSMADSKGKTLGVTGLGSSTSFLTQYLAQRAGVPSTQYT
FT                   LLPVGADNSFIAAIKQSRIDAGMTTEPTVSQLLKTGDAKVLVDMRTLEGTRAALGGTYP
FT                   ASSFYVQRAWAESHKDDAAKLSHAFAKTLNFIATHSAEEIAAKMPKDYYGNNKDLYVGA
FT                   LKASLPMFTKDGKMPADGPDTVLKVLSAFNPSVKGKHIDLAKTYTNDYVSAPVKTAAK"
FT   sig_peptide     complement(50832..50912)
FT                   /locus_tag="Bphyt_4035"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.943 at
FT                   residue 27"
FT   gene            51162..51839
FT                   /locus_tag="Bphyt_4036"
FT   CDS_pept        51162..51839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4036"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: bxe:Bxe_B0496 two component
FT                   transcriptional regulator, winged helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4036"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18422"
FT                   /db_xref="GOA:B2TEA1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEA1"
FT                   /protein_id="ACD18422.1"
FT                   /translation="MKLLLIEDNPTLAHWLAKMLEQEAFALDTVQDGDAADQLLRTNHY
FT                   DVILLDLNLPKLSGKNVLRRLRQRGDATPVLILTASGSIDEKVELLGAGADDYLVKPFE
FT                   VRELIARIKVAIRRQSPSKASEVVCGDLTFDIDTRQFTLKGAPLNVTPRERSVLETLIL
FT                   RLGKTVTKPALVDAIFTLADEPSEDAVEIYISRLRKKLDGSSAAIVTLRGLGYLLRKKE
FT                   DDQ"
FT   gene            51829..53223
FT                   /locus_tag="Bphyt_4037"
FT   CDS_pept        51829..53223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4037"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; Two-component sensor
FT                   kinase domain protein; KEGG: bxe:Bxe_B0497 histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4037"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18423"
FT                   /db_xref="GOA:B2TEA2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013727"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEA2"
FT                   /protein_id="ACD18423.1"
FT                   /translation="MTNSLRMRLLWWLLVPLALYVFVTGKAEYDNARRTADLVQDNQLI
FT                   SSARMIAGEVEWVDGFLRVDVPPAALEVFVSPYRDQVFYSVQVDDGRLLAGIPDFPARP
FT                   VQTPDTPDHYDTRLQGHDVRAVGLVRLMYDNGATRRVRVTVGKTVRSRDAMAQQLWQPQ
FT                   LVRQIEMIVLAVALVCIGLTFELRPLMKVKEEVADRDPMQLEPIRVERLHTELRPIVEA
FT                   INQCIARLGVQVAAQRRFIADAAHQLRTPLTLLGTQLQFARQQDGLNPALDEALAAMHR
FT                   SNRSMVGLTNKLLLLAQAEAADNKQLAVETVDLVPLALEVVEDLALLAQARDIDLGAEL
FT                   NGAAPVAGHRGLLQALIANLAENAIRYTGSGGHVTVGVSADADTVTVSVLDDGPGIPAE
FT                   SRGRVFEPFFRASADTEGTGLGLAIVREIADAHHGEIALKPGDGGKGVHISVVFPRAAA
FT                   ERFKAG"
FT   sig_peptide     51829..51900
FT                   /locus_tag="Bphyt_4037"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.650) with cleavage site probability 0.305 at
FT                   residue 24"
FT   gene            53349..54419
FT                   /locus_tag="Bphyt_4038"
FT   CDS_pept        53349..54419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4038"
FT                   /product="NMT1/THI5 like domain protein"
FT                   /note="PFAM: NMT1/THI5 like domain protein; KEGG:
FT                   bpd:BURPS668_0038 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4038"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18424"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEA3"
FT                   /protein_id="ACD18424.1"
FT                   /translation="MRKNNGDIVTMPHAVTRVARALHAAVAASLTIFLLAQPAAPARAD
FT                   SPEKIVIMVGGITKLIYLPARLTEQLGYFKAEGLDVELQSQPAGVDAENELLAGGVQAV
FT                   VGFYDHAIDLQAKGKEIKAIVVFGQVPGEVEMVAARAAGSIRSMADVKGKTLGVTGLGS
FT                   STNFLTQYLASLKGVPRSQYTVLPVGADNSFIAAIRQGRIDAGMTTEPTVSQLLKSGDA
FT                   RVLVDMRNVEGTRAALGGTYPASSLYVQSAWLDTHPQEAAKLARALVKTLRYLNTHSAE
FT                   EIAAQMPKDYIGNDEALYVSALKASLPMFTADGKMPADGPETVLKVLAGFNPSVKGRHI
FT                   DLSRTFTNQFVNEVKP"
FT   sig_peptide     53349..53483
FT                   /locus_tag="Bphyt_4038"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.880) with cleavage site probability 0.860 at
FT                   residue 45"
FT   gene            54486..55868
FT                   /locus_tag="Bphyt_4039"
FT   CDS_pept        54486..55868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4039"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; Two-component sensor
FT                   kinase domain protein; KEGG: bpd:BURPS668_0041 sensor
FT                   histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4039"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18425"
FT                   /db_xref="GOA:B2TEA4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013727"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEA4"
FT                   /protein_id="ACD18425.1"
FT                   /translation="MFSGSLRGRLLWWLLLPLAAFVSISGVISYRNAQTTADLVQDNAL
FT                   LSSMRIIGEDIDWDNGNVSIQIPPAALELFESPEQDSVFYRVEASGHRLVEGSLELPLP
FT                   PQTGDKPTLYMTRLEDGRAVRAVAYVRQLYDTGRTEEVIVAVAKTEGSRDAMVWRLLRP
FT                   QLFGEVLTLVLAMVFVYLGLTFELRPLMKVKDDVADRNPSQLQPIRVARLHVELRPIVD
FT                   AINQCIARMGQQAATQRQFISDAAHQMRTPLTLLVAQIQFARQRENRDAPLAEALAGMH
FT                   KSSRKLTTLTDKLLLLAQAESAAPVSACERVDLSALIAGVLEELIAFAQSREIDLGAEL
FT                   EDGMVVTGDEALTAALVTNLVDNALRYTQAGGRVTVQTTRLNDIAIVRVIDNGPGIKPD
FT                   ARARVFERFYRASSHADGTGLGLPIVREIAHRQGGTVTLESGEDGIGFVATVGMRIWTA
FT                   AT"
FT   sig_peptide     54486..54587
FT                   /locus_tag="Bphyt_4039"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.980) with cleavage site probability 0.954 at
FT                   residue 34"
FT   gene            55894..56592
FT                   /locus_tag="Bphyt_4040"
FT   CDS_pept        55894..56592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4040"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: bmu:Bmul_0032 two component
FT                   transcriptional regulator, winged helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4040"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18426"
FT                   /db_xref="GOA:B2TEA5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEA5"
FT                   /protein_id="ACD18426.1"
FT                   /translation="MKLLLVEDDADLARWVMNLMQVEHFVIDWAQNGEQAETLLGLQCY
FT                   DAVLLDLRLPGIGGKDVLARLRRKRDNVPVLMLTANGSTDDKVACFSAGADDYVVKPFD
FT                   ARELVARIKALIRRQAAGDKGQSIECGDLRYLFDSREFMLQSEPLPLRRREHAILETLM
FT                   LKQGKTVSKSTLMDKVFTLDDEPSADAIDIYIHRLRKHLAASSAKIMTLRGLGYILREA
FT                   EPREAFAAAL"
FT   gene            56775..57899
FT                   /locus_tag="Bphyt_4041"
FT   CDS_pept        56775..57899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4041"
FT                   /product="porin Gram-negative type"
FT                   /note="PFAM: porin Gram-negative type; KEGG: bps:BPSL0041
FT                   outer membrane porin lipoprotein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4041"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18427"
FT                   /db_xref="GOA:B2TEA6"
FT                   /db_xref="InterPro:IPR002299"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEA6"
FT                   /protein_id="ACD18427.1"
FT                   /translation="MKKSRLLLVASAGALAMGSAHAQSNVQLYGLMDLSAVSYQTNANA
FT                   DGKHVVSMGINGEPWFSGSRFGMKGAEDLGGGLRAIFKLEAEYRVSDGAMEDPGQLFDR
FT                   DAWVGVESDTFGKFTAGFQNTVARDAAAIYGDPYTSASLNTEEGGWTNTNNFKQMIFYA
FT                   GSATGTRYENGLVWKKLFYNGLFAAAGYAFGNKTSFGNNATYTGALGYNGGPFNVSAFY
FT                   NHVNNNGFTNKAYSIGGNYTYSIFRVNAGYFHYSGDQGALGERRDNAWTVSFRLAPKGP
FT                   LDYEIGYQQMHASNAAFDDNGSIANANLGFNPDTGTGSGYKETLYGSVFYHFSKRTEVY
FT                   VAGDYMKLHRGYVIASTFGAKNQLELTTGIRTRF"
FT   sig_peptide     56775..56843
FT                   /locus_tag="Bphyt_4041"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 23"
FT   gene            57987..58271
FT                   /pseudo
FT                   /locus_tag="Bphyt_4042"
FT   gene            58278..58511
FT                   /locus_tag="Bphyt_4043"
FT   CDS_pept        58278..58511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4043"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bps:BPSL1298 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4043"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18428"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEA7"
FT                   /protein_id="ACD18428.1"
FT                   /translation="MSSIYYAGCKARIKNLELAWDDAEPSLKPRAGADWHKVDKAIDRA
FT                   LSALRASAPSAVECKQSLADLMAVMDRMSGKV"
FT   gene            complement(58634..58882)
FT                   /pseudo
FT                   /locus_tag="Bphyt_4044"
FT   gene            59188..60105
FT                   /locus_tag="Bphyt_4045"
FT   CDS_pept        59188..60105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4045"
FT                   /product="diguanylate phosphodiesterase"
FT                   /note="PFAM: EAL domain protein; KEGG: bxe:Bxe_B0499
FT                   putative diguanylate phosphodiesterase (EAL domain)"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4045"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18429"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEA8"
FT                   /protein_id="ACD18429.1"
FT                   /translation="MCIRWRGLNIMSAMYTLDYAQPKSLANALDSRVDFVAQNDAETSG
FT                   DASLRLSELERRVCDGLHAGEFHLVFQGAYRAASGVLARLEAQVRWMHPDYGLLLPGIF
FT                   MMPLDHPIVAREMVSFVVDSVCRELRDALRAKLPLQPIAITVPAQVALLDSFAEELVRV
FT                   AGSYGVPASLLEIEVTDSVEAAKLLSLRTLTEGLRAAGIGLSIGKWGNGASSLASLGSL
FT                   DVDTVVVARELMPAVPGDKRGAAVMTAIMDLLHALDLRVVVSGVDTQEQFRWLCRWPEA
FT                   LVQGVLFGRPKVGLARVLELRWEA"
FT   gene            complement(60302..61030)
FT                   /locus_tag="Bphyt_4046"
FT   CDS_pept        complement(60302..61030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4046"
FT                   /product="glycosyl transferase, WecB/TagA/CpsF family"
FT                   /EC_number="2.4.1.187"
FT                   /note="KEGG: bxe:Bxe_B0500 glycosyl transferase
FT                   WecB/TagA/CpsF; TIGRFAM: glycosyl transferase,
FT                   WecB/TagA/CpsF family; PFAM: glycosyl transferase
FT                   WecB/TagA/CpsF"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4046"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18430"
FT                   /db_xref="GOA:B2TEA9"
FT                   /db_xref="InterPro:IPR004629"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEA9"
FT                   /protein_id="ACD18430.1"
FT                   /translation="MDIATMQETVNIIGDRIEARQFTQHVVVNVAKLVNMQTDSVLYSS
FT                   VRACDIVNIDGMGVVWGARLLGHAVPERVAGVDLFDRLLQMAAARELPVFLLGATDEVV
FT                   ARTAAVVTLRHPELRIAGYHHGYFWDDEEGMVETIRKSGAKLLFVAITSPKKESFINRW
FT                   QDRLGVDFVMGVGGTFDVVAGKVRRAPQWMQRHGLEWAYRVIQEPRRMWKRYFVTNNRF
FT                   AVMLLRARLASAFKRMAGEH"
FT   gene            complement(61098..62264)
FT                   /locus_tag="Bphyt_4047"
FT   CDS_pept        complement(61098..62264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4047"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0501 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4047"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18431"
FT                   /db_xref="InterPro:IPR008930"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEB0"
FT                   /protein_id="ACD18431.1"
FT                   /translation="MTIHLDAGPLADALVMQCRSTGYAGYDPFDGLNSVLFEKLGLGCL
FT                   PFAKIAWLQLHKRSLANLRPLVGVARRRNPKGIALIILGLLERERRVGDGWSIEEAVGL
FT                   ADWLLDQRCDRKKWTHSAWGYHFDWAARAFFVPRGTPNAITTCYIARALTALGDETGER
FT                   RFTDAATDAGFFIDSLYREGDGYYAYIPGESAFVHNANLWAAAVVGETASRVGNGALMQ
FT                   RALGAARRSVAMQREDGAWRYGTRDHHSFVDGFHTGYNLEALSALQRSAGTDEFSDAIG
FT                   RGMAYYRQNFFLPDGTVKYYDNAIWPLDTHSVAQALLTLLNVGASDEDHRLADRVFKRA
FT                   LNTLYMPRERRFMYQRGRLTKNRINYLRWTQAWAFYAIGAYANSARFK"
FT   gene            complement(62261..63058)
FT                   /locus_tag="Bphyt_4048"
FT   CDS_pept        complement(62261..63058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4048"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B2249 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4048"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18432"
FT                   /db_xref="InterPro:IPR025975"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEB1"
FT                   /protein_id="ACD18432.1"
FT                   /translation="MNPRRYVTAVTLTFFATCSIAQTVDDPVRQLAGFQTLFATNWTHG
FT                   FDPTVDIQSPDTRDLMVVKDPLSPDRHAVKVNIRRSEDFSHVANGTPRGELVFARAAKI
FT                   ASGHEYRIEWSTLLPADFVFDDEQMQIIMQVHQTDTWVGSPPLMLQLQGGDYLFSERGG
FT                   TDTKHGHDILLPDASADRGKWVHWILRYQPDATGKRAVTDLWKNGVPVFASRGFPNAYP
FT                   HERHAYLKLGVYKPSWQNFQSRTSETGLFYGPVSISERAEGGE"
FT   sig_peptide     complement(62993..63058)
FT                   /locus_tag="Bphyt_4048"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.621 at
FT                   residue 22"
FT   gene            complement(63055..64146)
FT                   /locus_tag="Bphyt_4049"
FT   CDS_pept        complement(63055..64146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4049"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   bxe:Bxe_B0503 putative glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4049"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18433"
FT                   /db_xref="GOA:B2TEB2"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEB2"
FT                   /protein_id="ACD18433.1"
FT                   /translation="MSIRVLQVGPGHGQQGGIASVLSQLARSREQFGRAGVAVSFFETR
FT                   GFRNLGDLLAFALIDMPSFVRATIRADVVHFHVSERGSFYRKFALFVVARLLGKRTVFQ
FT                   LHSGNFERFIQDADRVTRLLAGLFIDKTDCVIAVSTPIAKCLQHWRRTDAVQVVGNMAL
FT                   DAEHGAPTATPLACSRPYIAFAGRLSEAKGLDELIRAVADLVRRGRDIEVRVAGTGDML
FT                   RWQRIAAAHGLDERVVFEGWLDGNAKLAFYRGARLFCMPSHFESFGIATLEAMFCGLPV
FT                   VGTRLGGFLDLVEDGVSGYLVDGHDSRGLAEAICKLVDDPEHAMRMGCVGLVRAQTCFR
FT                   AASIVDRYVDCYRRVDTRGRSER"
FT   gene            complement(64143..65402)
FT                   /locus_tag="Bphyt_4050"
FT   CDS_pept        complement(64143..65402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4050"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0504 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4050"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18434"
FT                   /db_xref="GOA:B2TEB3"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEB3"
FT                   /protein_id="ACD18434.1"
FT                   /translation="MNASIAFVPSYRESQLTGWHSVGAWAISFSYLLFCISDTLLSLEM
FT                   DGSQLVKLGAFVLLAVAILLRPRFHKLIALIVPFMLALYIAMWRAFNVNAGGEEFLRFL
FT                   APMAITVAIFAYRSKLAPVLFMFFAVVLSNDLFQCYFYLAYGLKLPLFLPVKFDSGLYL
FT                   RAQGWIGFFSEFSFINFCAFLVCRHYRPTRRSQRAAWIFLTFALLGVSFKIFATIAMYF
FT                   IVARKLTVRSFIAALSAIGLVLFALMAGLLDSLIKIAMTKISFYVVAGNSARAESYRVM
FT                   FQSLMKGNIFGEGLGSFGGPASVKYHSPLYSIYHFNWYGLGNTLTTTDTFYPHLFVELG
FT                   VLGAILWLAFMLLYGQVSKRRRVWLFLVGAFCFDNIFSMSFVSASYVFSALMLMYLFSD
FT                   NGSLISRPPSAAGKRAGAMR"
FT   gene            complement(65399..66730)
FT                   /locus_tag="Bphyt_4051"
FT   CDS_pept        complement(65399..66730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4051"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0505 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4051"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18435"
FT                   /db_xref="GOA:B2TEB4"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEB4"
FT                   /protein_id="ACD18435.1"
FT                   /translation="MKQGNANAVRRRLRFDALAGAVSVERIEALICTGSPGLYRVVVFF
FT                   AVQHVYSLAELGRTASSMSIAQMVAFFTAIGWATLILVRVPAATTEQGAIAVFYRVATM
FT                   SLATTVLCTLLALTIAFFKTVQFDLPAFVALLWGWTAYQIARHYFVALKRFRIAIAFDI
FT                   ALIASSGGMLALCHRGGLSADNAVAMALGAIAIAMFVRIGRPALDVLPKRLDTEGLQFG
FT                   LTNFLSGGIQLVFVPAATIMCGAAFAGMLSLLSSVTAIGMLLPRAISMTQLADLAKRKA
FT                   ASLSLDDSLHTMSRNIGWCNGAMLVFNVILVLLLAARPVHGAAHQSGIIVAGLLLAIQC
FT                   AVGMMGIANSSIMMVFERGGSAAKINIFTTSAFALLAVPCYAYGGQSGLMMILCAAIAV
FT                   TVWRNWLIRCCARQIHSRYVDLCGSAAVSDVKCQVQPLACGASR"
FT   gene            complement(66730..67968)
FT                   /locus_tag="Bphyt_4052"
FT   CDS_pept        complement(66730..67968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4052"
FT                   /product="nucleotide sugar dehydrogenase"
FT                   /note="TIGRFAM: nucleotide sugar dehydrogenase; PFAM:
FT                   UDP-glucose/GDP-mannose dehydrogenase;
FT                   UDP-glucose/GDP-mannose dehydrogenase dimerisation;
FT                   UDP-glucose/GDP-mannose dehydrogenase; KEGG: bxe:Bxe_B0506
FT                   UDP-N-acetyl-D-mannosamine dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4052"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18436"
FT                   /db_xref="GOA:B2TEB5"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028359"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEB5"
FT                   /protein_id="ACD18436.1"
FT                   /translation="MSFDVVSIIGLGYIGLPTAAAFAARRKKVIGVDVSQRTVDTINKG
FT                   EIHIVEPELDMLVHAAVTQGYLRATQTPEPADAFLIAVPTPFCDGNKPDLSYIEAASRS
FT                   IAPALKKGDIVVLESTSPVGTTEKMSAWLAECRPDLTFPQHSGEQSDIRVAHCPERVLP
FT                   GHVIRELVQNDRVIGGMTRRCGELARELYQIFVQGDCILTDARTAEMCKLSENAFRDVN
FT                   IAYANELSMICDRLDINVWELIRLANRHPRVSILQPGPGVGGHCIAVDPWFIVDSAPEE
FT                   AKLIRAARGVNDGKPHYVIDQTKRLAARFKTPVIACLGLAFKANIDDLRESPAIDIVSQ
FT                   LADEHVADIVVVEPNVSVLPDALRGKVELTSLASAIEAADIVLLLVDHREFKDINRRRL
FT                   QSKLLVDTRGIFA"
FT   sig_peptide     complement(67897..67968)
FT                   /locus_tag="Bphyt_4052"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.692) with cleavage site probability 0.652 at
FT                   residue 24"
FT   gene            complement(68137..70359)
FT                   /locus_tag="Bphyt_4053"
FT   CDS_pept        complement(68137..70359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4053"
FT                   /product="exopolysaccharide transport protein family"
FT                   /EC_number="2.7.10.2"
FT                   /note="KEGG: bxe:Bxe_B0507 exopolysaccharide transport
FT                   protein/putative tyrosine protein kinase; TIGRFAM:
FT                   exopolysaccharide transport protein family; capsular
FT                   exopolysaccharide family; PFAM: lipopolysaccharide
FT                   biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4053"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18437"
FT                   /db_xref="GOA:B2TEB6"
FT                   /db_xref="InterPro:IPR003856"
FT                   /db_xref="InterPro:IPR005700"
FT                   /db_xref="InterPro:IPR005702"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032807"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEB6"
FT                   /protein_id="ACD18437.1"
FT                   /translation="MKNQFSRDEDEIDIRALIDVIFKNKKLIIAVTIVCTLIGVMYAFL
FT                   ATPIYRGDITVQVEDNSDLAGAAAGNLMSGLTSLFDIKSTDDGEMQILDSRLVTANMVD
FT                   ELRLYIDARPKYFPLLGAFIAKHRTSLSQPGILGVGGYAWGSESIVVDQFDVPGEFEED
FT                   KFSVTTLGNNRYRLSGSDLNADVVGVVGVPLLANTSSGPIKLLVSRLSSRENAQFELRR
FT                   FSRIQVLEQLRKDLVITEMGKDQSGVIGVTYDDQDPARAAAVLNKIAENYVAQNADRKA
FT                   AAAEKSLVFLKSQLPDVERSLRLAEDRLNAYQNRHKVVDLSEQAKAVLGQAVEAQSSLF
FT                   QLEQKRKELATIYSAQYPAVLALDQQIAAARAHIDNFNESIQRLPDDQQNIVRLNRDVT
FT                   VQTSLYVGLLNSVQQLQLATASKIGNVRVIDHALVADKPTKPKKALVIALAAVIGLFGG
FT                   IGFALARSTLFGGLTDPMDIERDLSLDVIATIPLSDTQRQLTRVRERGGRRGPSILALA
FT                   RPQEPAVEAIRSLCTALQFALLENPKNNVILMTGPSVGIGKSFTSANLAALLGMSKKRV
FT                   LLMDVDLRRGHLAAEFDVSGKVGLSNVLRDDMPLEAAIIKDVSPNVDFLATGPLMAQPV
FT                   ELLSSGGIAKILADVSGRYDIVLLDAPPVLPVTDATVFAPFAGIVLLAARSGMTSSGEL
FT                   LESAKRIERVGAKITGIVFNGFKPSLRSAQYGDYGGYAYLSNASDT"
FT   gene            complement(70416..70868)
FT                   /locus_tag="Bphyt_4054"
FT   CDS_pept        complement(70416..70868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4054"
FT                   /product="protein tyrosine phosphatase"
FT                   /note="PFAM: low molecular weight phosphotyrosine protein
FT                   phosphatase; KEGG: bxe:Bxe_B0508 protein tyrosine
FT                   phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4054"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18438"
FT                   /db_xref="GOA:B2TEB7"
FT                   /db_xref="InterPro:IPR017867"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEB7"
FT                   /protein_id="ACD18438.1"
FT                   /translation="MINTVLIVCEGNLCRSPMAQGLLQRELSDIEVTSAGLSAAKGAPM
FT                   DRFAREMLADRGIDMSSHVARRLNERVCGAADLILVMELAQKQAIEKFYPTARGRVYRL
FT                   ADADHVDVPDPFGRSARIYDQAMTLIERGVLDWTRRIVDLSRGLRA"
FT   gene            complement(70865..72037)
FT                   /locus_tag="Bphyt_4055"
FT   CDS_pept        complement(70865..72037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4055"
FT                   /product="polysaccharide export protein"
FT                   /note="PFAM: polysaccharide export protein; KEGG:
FT                   bxe:Bxe_B0509 putative polysaccharide export, outer
FT                   membrane protein, EpsA"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4055"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18439"
FT                   /db_xref="GOA:B2TEB8"
FT                   /db_xref="InterPro:IPR003715"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEB8"
FT                   /protein_id="ACD18439.1"
FT                   /translation="MGHSKRTFEYGVWRQYRRRLRRALCVAFCYGLVACAAAPGMRMPT
FT                   SASLPTGNSNAQGQQADLQIPIVDINTALIKKLRDASDQTSTDQTRELSGQTGPYTLGV
FT                   GDVLQITVWDHPELAAALGNQNQNNSRPFDPAQGFVIDNGGNIQFPYAGSIHVAGLRVE
FT                   QAQQAVYAELSKIFIKPQLTVRVTSFRAKQIYVDGEVRTPGAVPVNDIPLTLYEAINRA
FT                   GGFSPAADQSRMILVRNGVSYRLNLSKMLESDQNPSGIMLKNGDLLRVVSRDDNGVFVM
FT                   GEVNKPVTALPMKSGKLTLSDALSQAGSLNTASADAAQLYVIRGSTDSQAEVFHLDAHS
FT                   PVSMILANQFELQPKDVVYVDGNGLVRFSRVLSLLLPAINAGLTTAIVTK"
FT   sig_peptide     complement(71927..72037)
FT                   /locus_tag="Bphyt_4055"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.961) with cleavage site probability 0.402 at
FT                   residue 37"
FT   gene            complement(72169..73584)
FT                   /locus_tag="Bphyt_4056"
FT   CDS_pept        complement(72169..73584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4056"
FT                   /product="Undecaprenyl-phosphate glucose
FT                   phosphotransferase"
FT                   /EC_number="2.7.8.6"
FT                   /note="TIGRFAM: Undecaprenyl-phosphate glucose
FT                   phosphotransferase; exopolysaccharide biosynthesis
FT                   polyprenyl glycosylphosphotransferase; PFAM: sugar
FT                   transferase; KEGG: bxe:Bxe_B0510 undecaprenyl-phosphate
FT                   galactosephosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4056"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18440"
FT                   /db_xref="GOA:B2TEB9"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="InterPro:IPR017473"
FT                   /db_xref="InterPro:IPR017475"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEB9"
FT                   /protein_id="ACD18440.1"
FT                   /translation="MNAISTAHESRKSTGFQGLLARILDISLIVGGAVAASQIRFEDLT
FT                   GNHVDTGFIAFAAAFALALFPVFGVYQSWRGRSMLRLISQISLAWLVAQSCGLILMFSL
FT                   HRTDLISRLWFAYWTGMTGAALIVSRSLTYALLRRVRDAGLNLRSVAVVGRGSHCQQVV
FT                   RSIQAARASGFRVSAAFDLFTCVERSISNTPLFDEFTEFSDFVRTESIQEIWLALPLSE
FT                   ESMISRCLQEFRDDLVNIRFLPDVSSLALFDSSVIDLIGVPAINLVASPLSSHALLKKE
FT                   IFDRLFAIAALFCVAPLMVSVAVAVKLSSPGPVFFAQKRKGADGQVFRIYKFRTMRMHA
FT                   SEPGVVKQASRNDPRITPVGAFLRRTSLDELPQFLNVLRGDMSIVGPRPHAIEHDELYR
FT                   TIVDGYIHRYRIKPGITGWAQVNGYRGETDRVEKMQKRVEHDLYYLRNWSFGLDMKIVL
FT                   ATVVRGFTHRNAY"
FT   gene            complement(74659..74976)
FT                   /locus_tag="Bphyt_4057"
FT   CDS_pept        complement(74659..74976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4057"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A3353 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4057"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18441"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEC0"
FT                   /protein_id="ACD18441.1"
FT                   /translation="MTMDEDIAHVARVMVPSLSAFRGEPVLQPAYWRRRLQRIQSEFRL
FT                   TETQASQIQHLLGDLDRFEAESSTRRTPLGTKIRAPWIPRQCGDDAQGLMRYGKQFPHV
FT                   E"
FT   gene            complement(75390..76658)
FT                   /locus_tag="Bphyt_4058"
FT   CDS_pept        complement(75390..76658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4058"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0515 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4058"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18442"
FT                   /db_xref="GOA:B2TEC1"
FT                   /db_xref="InterPro:IPR007269"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEC1"
FT                   /protein_id="ACD18442.1"
FT                   /translation="MNSTFDTVARVHDPRPRSATPFSIGLLGIAVGLLTLWLLRDSSSF
FT                   DGATRSTVACLAIIATIAAYELFVARVYLRPSAGLASRAVRPLSIVRVELRLAALASVY
FT                   AGIGALYWLLPEYHGAFYNPFWSLLGTLAPYVLIAAPFYFAWMDRHQRETDDAYLLWAR
FT                   FLFRGERPANWRPVREMLAGWMVKAFFLPLMIVYLSTNADHLDASLTTALNAPFSLATF
FT                   RFMYDLSFAMDLMFGTVGYLCTLRILDSHVRSAEPTVLGWLVALICYQPFWSLISNQYI
FT                   HYEGSVFWDNWLISMPVVRVVWGAVIVALLLCYALTTISFGLRFSNLTNRGIITSGPYR
FT                   FTKHPAYIAKNLSYWMVTVPFIEPLGWRAAVTHCAALLAVNMLYFLRAKTEEKHLMNDS
FT                   EYREYAAWIARNGVFARLSRVFD"
FT   gene            complement(76739..77755)
FT                   /locus_tag="Bphyt_4059"
FT   CDS_pept        complement(76739..77755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4059"
FT                   /product="putative lipoprotein"
FT                   /note="KEGG: bxe:Bxe_B0516 putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4059"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18443"
FT                   /db_xref="InterPro:IPR031929"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEC2"
FT                   /protein_id="ACD18443.1"
FT                   /translation="MLGNGTAAGLGTVGSAANPLGPTLTSTSGVVANTGAAVTALGGVV
FT                   NSLGSGPLKPLSPVTSTLGSVVGGVGSGVTAVGSGLNTALTSAPVQQIETQLSSAINPI
FT                   TTTVSNTTQTLGNATGLGAPLNTLLGTLGNGLNAAGLKVSGATGDQVGKDVGGVVSQLG
FT                   KTVTTTGGLFTGATTNPLAPITGLLGPLGGLGGAGGSGGSGGVSIPPLTGLIGNLGSLG
FT                   GAAGGTGGAGGAAGLLAPLTGLLGKVGSPGGTSGAGGPLAPVASVIGSLTVNVTGGVSA
FT                   GGSSGGAAGNPVTGLISGLTGGSAGAAGSSGSGNKNPLAPVTNLVGGLLGGVAAAGK"
FT   gene            77907..78833
FT                   /locus_tag="Bphyt_4060"
FT   CDS_pept        77907..78833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4060"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bpl:BURPS1106A_A2683 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4060"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18444"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEC3"
FT                   /protein_id="ACD18444.1"
FT                   /translation="MLPMGVEEVPEVPEVPEVPEVPEVPEVPEVPEVPEVPEVPEVPEV
FT                   PEVPEVPEVPEVPEVPEVPEVPEVPEVPEVPEVPEVPEVPEVPEVPEVPEVPEVPEVPE
FT                   VPEVPEVPEVPEVPEVPEVPEVPEVPEVPEVPEVPEVPEVPEVPEVPEVPEVPEVPEVP
FT                   EVPEVPEVPEVPEVPEVPDPDVPPKPPPPSPGLGVLSVDPHPYSASNVDVATAMAVRPA
FT                   NFFMMSPLNDYWRGHCCKLHAKCHLWRDLAFKAQVYRKNKTQEEFTPTESQFPSQRQTR
FT                   VPRACYVTRAQTVTVRNTPQSSRSTFA"
FT   gene            complement(78863..80026)
FT                   /locus_tag="Bphyt_4061"
FT   CDS_pept        complement(78863..80026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4061"
FT                   /product="iron-containing alcohol dehydrogenase"
FT                   /note="PFAM: iron-containing alcohol dehydrogenase; KEGG:
FT                   bcm:Bcenmc03_3517 alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4061"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18445"
FT                   /db_xref="GOA:B2TEC4"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEC4"
FT                   /protein_id="ACD18445.1"
FT                   /translation="MMNAFRFQTVPTLVVEFGAARRLGALLRAQFPALSRVCVVTDGFL
FT                   HRSGLLNPALADLATHGWDATVIDDVIADPPEHIVLEATSRARTAGAEIVLGLGGGSSM
FT                   DVAKLIAVLAPQQQQALSEMYGVNKITVARLPLVQMPTTAGTGSEVTAVSIVTVGEAKK
FT                   MGVVAPQLIADLAILDAELTLGLPVAATAATGVDAMVHAIEAYTSAHLKNPVSDLLAVK
FT                   ALDLLSRNLLPACENGDDRAAREAMLLGATFAGQAFANSPVAAVHALAYPIGGIYHVPH
FT                   GLSNALVLPHVLRFNADAAAPLYAELAEVVVPGVTGSDESKTQALIERLEQMIAATAIP
FT                   ARLRDVGIEQSGLERMASDAMLQTRLLVNNPRPVTEADALAIYTAAF"
FT   gene            complement(80023..80331)
FT                   /locus_tag="Bphyt_4062"
FT   CDS_pept        complement(80023..80331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4062"
FT                   /product="Antibiotic biosynthesis monooxygenase"
FT                   /note="PFAM: Antibiotic biosynthesis monooxygenase; KEGG:
FT                   rme:Rmet_5441 antibiotic biosynthesis monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4062"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18446"
FT                   /db_xref="GOA:B2TEC5"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEC5"
FT                   /protein_id="ACD18446.1"
FT                   /translation="MAHAYLQVIAHYFAKPGNGDAIVKPLTELAAATRKEPKNIYYEFF
FT                   RSPLEPDHFVILENYSDADGLAEHRETEHFQRLGFGTIIPLLERREVESHMVSGDAP"
FT   gene            80806..81477
FT                   /locus_tag="Bphyt_4063"
FT   CDS_pept        80806..81477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4063"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: sigma-70 region 2 domain protein; Sigma-70
FT                   region 4 type 2; KEGG: bxe:Bxe_B0517
FT                   extracytoplasmic-function sigma-70 factor PvdS"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4063"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18447"
FT                   /db_xref="GOA:B2TEC6"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEC6"
FT                   /protein_id="ACD18447.1"
FT                   /translation="MAEVLVRREPSTAMPISVLNAAGACPPVSRRTRNHARAVDWEKGT
FT                   LLDVLIDNRPMLVNLARGFVGCASLAEDVVHDVFIKLVDFPDQDAVRQPVAYVTRMVRN
FT                   ASIDAFRRQSLENTYHADEDDGLHVPSPEPSPEAALLVRDTLRHVYNALEQLPARSRAA
FT                   FEMVRLREETLQNTARALDVSQTLVHFMVRDAEKHCADCLDACNRGVAGPAFCSGRARR
FT                   R"
FT   gene            81606..81845
FT                   /locus_tag="Bphyt_4064"
FT   CDS_pept        81606..81845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4064"
FT                   /product="MbtH domain protein"
FT                   /note="PFAM: MbtH domain protein; KEGG: bxe:Bxe_B0518
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4064"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18448"
FT                   /db_xref="InterPro:IPR005153"
FT                   /db_xref="InterPro:IPR037407"
FT                   /db_xref="InterPro:IPR038020"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEC7"
FT                   /protein_id="ACD18448.1"
FT                   /translation="MTQAQQTSSAAAGEADDLVYTVVINDEEQYSIWPTFRDVPAGWRE
FT                   VGVRGQKAECLAHIETVWTDMRPASLRRHMDAAA"
FT   gene            81933..82967
FT                   /locus_tag="Bphyt_4065"
FT   CDS_pept        81933..82967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4065"
FT                   /product="Taurine catabolism dioxygenase TauD/TfdA"
FT                   /note="PFAM: Taurine catabolism dioxygenase TauD/TfdA;
FT                   KEGG: bxe:Bxe_B0519 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4065"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18449"
FT                   /db_xref="GOA:B2TEC8"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="InterPro:IPR042098"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEC8"
FT                   /protein_id="ACD18449.1"
FT                   /translation="MTTLSKPLPTLADLSIEPGLPTVVSPRAGAEISLEEAAPLLRSIV
FT                   DDTLERAGGVLFTGFRVASIDAFQSFAGSFGHPLIGYEFASTPRSQVEGAVYTSTEYPQ
FT                   HRSIPLHNEQSYTREWPLRIWFHCALAARTGGATPIADSRAIYRALDPALVERFTKREL
FT                   LYVRNFGQGLDLPWEQAFGSDDPRTVERICRARGIECEWRDSEDGELLLRTRERCQAVA
FT                   RHPRTGERVWFNQANLFHLSSLDEDMQEALIDSVGVENVPRNVYYGDGEPLEAEALAEI
FT                   RGVLDQQRIVFPWLTGDVLMLDNMLTAHARDPFEGPRKVVVAMARSYSEAEGESEGKKR
FT                   TTAE"
FT   gene            82964..83830
FT                   /locus_tag="Bphyt_4066"
FT   CDS_pept        82964..83830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4066"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bxe:Bxe_B0520 ABC cobalamin/Fe3+-siderophores
FT                   transporter, ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4066"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18450"
FT                   /db_xref="GOA:B2TEC9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEC9"
FT                   /protein_id="ACD18450.1"
FT                   /translation="MTKSHGAALAAHSLTVGYRDHVVLHGLNLNIAAGRVTALCGPNGC
FT                   GKSTLLRTLAGLQPALSGSVDVNGVPLASHRRRVLARTLTMLAQFNQIPSGLTVRELVA
FT                   YGRYAHGGWLRGLSRADHAAIDEALVTSGLADDAARDVAALSGGERQRAWIAMALAQQA
FT                   PIVLLDEPTTYLDIHHQLDILRELRRLNRERGLTIVWVLHDLNQAAAYSDEIVLMRAGR
FT                   IVAQGSPDAMLDPRHLNETFSVPMLKIAHPQTGAPMCVPAYEGDFTDSNADAASLREEA
FT                   ISKDVAA"
FT   gene            83827..85935
FT                   /locus_tag="Bphyt_4067"
FT   CDS_pept        83827..85935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4067"
FT                   /product="transport system permease protein"
FT                   /note="PFAM: transport system permease protein; KEGG:
FT                   bxe:Bxe_B0521 iron-hydroxamate transporter permease
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4067"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18451"
FT                   /db_xref="GOA:B2TED0"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:B2TED0"
FT                   /protein_id="ACD18451.1"
FT                   /translation="MTTLAARKRLSRSTQAMDSYRAPVKSRVTTIGAALVALIVIVAVM
FT                   RLAPGFRTWLAAPTGSDAAQLAGILLFDLSVPRILAALVAGGCLAVAGTLFQSLTRNPL
FT                   ASPDLLGITGGAQLGLLAAMLVPSLAGVASVPLLFACGLGAAACVAAAAGGWRATPLRL
FT                   VLAGSVCMLLFSALTTLILAFFEQSIVGVSLWASGSLYQPGAAGLKIAASWLVLPLIAL
FT                   PFVIRPLDPLALGDDAAAAAGVRVDATRLAAMVVAVGFASVAVSVAGPLSYVGLIAPNL
FT                   LRQMRGAKASRLAALVPLSALVGGALVLVTDSAVQALDLDATLSTGVAIAFVGTPLMLA
FT                   MIRSGAAWSGALHAGQERAVARAGTRFVRAIDARPWPLTASALVLLGVVLVCAGASFGP
FT                   TTIGAQRWLAAFDHRDELARMLLDLRLPRLICALLAGALLAASGVLMQSIVRNPLAGPE
FT                   VLGVTQGAGLATLAALVMWPLANHSTLAAASLAGGGITLALTLLLNRRHRYAPLAVALT
FT                   GIVIGTLWTTLSQWLITQQSVQPARFVVWLVGGTYGRSWGEVTTLLPWCVLALPVFALL
FT                   ARPLDLLALGDDQAASLGLPIGVLRPLVLTVATLAACAAVAAVGPVGFIGLMAPHLASM
FT                   LGARAHRTRLWLAAACGALVLVVADIAARTLLAPREIPAGVLTALIGAPYLLALLIVEA
FT                   RREKRGKR"
FT   gene            85932..86750
FT                   /locus_tag="Bphyt_4068"
FT   CDS_pept        85932..86750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4068"
FT                   /product="putative iron reductase"
FT                   /note="KEGG: bxe:Bxe_B0522 putative iron reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4068"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18452"
FT                   /db_xref="GOA:B2TED1"
FT                   /db_xref="InterPro:IPR008090"
FT                   /db_xref="InterPro:IPR022770"
FT                   /db_xref="InterPro:IPR024726"
FT                   /db_xref="UniProtKB/TrEMBL:B2TED1"
FT                   /protein_id="ACD18452.1"
FT                   /translation="MTRQLDNDQRAQCFAQFAPESIAHYLEHVWLGTPNAIEEPAFAGD
FT                   ATTSLSVICVSELTCYRTELLDAMVTLYGGEREMHARALLSQWTKYYFGFAATAGFVAA
FT                   ALLRRPLAMSPDTTHVVLRDGLPIAAYFAPDALQPVECAPARRYAPLVDHLNTVIETLC
FT                   AMTKIAPRVLWSNAGNLLDYLFEQCAPQFDLTDDIAWLFGPIAADGETNPLRLPVRLAK
FT                   PRAASLPNPFSARRVCCVRYEIPGETQLCGRCPLLLTMSDAEIALQAASH"
FT   gene            86828..87856
FT                   /locus_tag="Bphyt_4069"
FT   CDS_pept        86828..87856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4069"
FT                   /product="periplasmic binding protein"
FT                   /note="PFAM: periplasmic binding protein; KEGG:
FT                   bxe:Bxe_B0523 ABC Fe3+-hydroxamate transporter, periplasmic
FT                   ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4069"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18453"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:B2TED2"
FT                   /protein_id="ACD18453.1"
FT                   /translation="MNAVMAATLFSNAYAFAQGNGTAASPTQSNTAQAQPQTCKPLADN
FT                   PIVSQASPSLPAQPKRIVVLEFMFAEDLAAVGITPVGMADPEYYPVWIGYDNARLASVP
FT                   DIGTRQEPSLEAIAAAKPDLILGVGLRHAPIFAALERIAPTVLFKYGPNFTEDGARVTQ
FT                   LDWGRKILRTIGCLTGREEAARAVEAKVDAGFARDAQRLAEAGRRGEQVAWLQELGLPD
FT                   RYWAFTGNSTAAGVAHALGLNLWPAEATREGTAYVSSEDLLKKPKLTVLFVSATEKDVP
FT                   LATKLDSPIWRFVPARSAGRVGLVERNIWGFGGPMSALRLANTMTDTLLSLPAPGVNKQ
FT                   ER"
FT   sig_peptide     86828..86881
FT                   /locus_tag="Bphyt_4069"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.979) with cleavage site probability 0.907 at
FT                   residue 18"
FT   gene            complement(87949..88236)
FT                   /locus_tag="Bphyt_4070"
FT   CDS_pept        complement(87949..88236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4070"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bvi:Bcep1808_3442 DGPFAETKE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4070"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18454"
FT                   /db_xref="UniProtKB/TrEMBL:B2TED3"
FT                   /protein_id="ACD18454.1"
FT                   /translation="MKWRMARWALVVRRSAGPSGVVRNEEGRVARLRVSLDKFFGPSSR
FT                   RPNPMPSDSEIEIRPFCEPADFGEAFTPELQESEARLQRQIEANQGKERR"
FT   gene            complement(88236..90002)
FT                   /locus_tag="Bphyt_4071"
FT   CDS_pept        complement(88236..90002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4071"
FT                   /product="cyclic peptide transporter"
FT                   /note="KEGG: bxe:Bxe_B0524 ABC cyclic peptide efflux pump,
FT                   fused ATPase and inner membrane subunits; TIGRFAM: cyclic
FT                   peptide transporter; PFAM: ABC transporter related; SMART:
FT                   AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4071"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18455"
FT                   /db_xref="GOA:B2TED4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005898"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:B2TED4"
FT                   /protein_id="ACD18455.1"
FT                   /translation="MTAANERYDAPPSSASPPSNSAGKPAMRLIVALLKRSRGSFAIAL
FT                   TACVLNGIASVLLVATLSRALSQTGVADLSLALRFAVCAIVALVTRVITGVLFARLSQD
FT                   TMAQLREHVARRVAEAELRDVERIGAAPVQSVLTDDATNVSMLFFALPNLVMHGSIVFG
FT                   CLGYLAWLSWPVCLLAVAAILVGSFGYHAGDKRAIASLEAAGRSQDKLFGYLGALFTGA
FT                   KELKLHQARSRQFVDGQLGSAIDEVRDHRRRAFSAYAVGVGWIVFLFYVFLGVAAFWPA
FT                   LGVHADAPSASGYVVVFLFMLLPLDGLLNNVPTLNAARVSLDRIEKVMGEFGALRTSPP
FT                   PDENASHAPYRTLTLSNVTHSYFHERDERMFRVGPVNLTFRPGELVFIVGGNGSGKTTL
FT                   AKVLTGLYEPEDGTIELDGKRVGFAERAAYRQRFTAVFNDFHLFDALLGIVDPNDASRA
FT                   QADARANALVAKLALDHKVQVVNGAFSTRALSTGQRKRLALVVAYLEDRPFYLFDEWAA
FT                   DQDPQFKAVFYEQLLPELRSRGKTVLVISHDDRYFHLADRVLKLENGSIVSETHGSAQA
FT                   VQSPAVANGTMG"
FT   gene            90294..99986
FT                   /locus_tag="Bphyt_4072"
FT   CDS_pept        90294..99986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4072"
FT                   /product="amino acid adenylation domain protein"
FT                   /note="TIGRFAM: non-ribosomal peptide synthase; amino acid
FT                   adenylation domain protein; PFAM: AMP-dependent synthetase
FT                   and ligase; condensation domain protein;
FT                   phosphopantetheine-binding; KEGG: bxe:Bxe_B0525
FT                   non-ribosomal peptide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4072"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18456"
FT                   /db_xref="GOA:B2TED5"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010060"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B2TED5"
FT                   /protein_id="ACD18456.1"
FT                   /translation="MTSFPIALHHQIHAMARIDPDAPALASFTPHTVRLTRGELDSRAA
FT                   RLAAQLRAAGVTTEVRVGVCVARSCDLFVALLAVLKAGGVFVALDPRHPAARLDWVARD
FT                   AGLMHGIVDGSADAAMRARFTQCFDVASAAATDAAAPRFDGDEANTPVHPRAAAYMIYT
FT                   SGSTGTPKAVAVEHGPLAAHGEALADSLPIGANDRVLHFASVNFDVSIEAWLVPLAVGG
FT                   SVVISDPPPFAPETTHAFMLREGITNTTLPPAYVREFANVCERLGVPPSLRTLLFGGEA
FT                   MSQDSFDEIRRVFPAVRLVNGYGPTEAVISPMLWPVDPGMTPLLDDGNGFASLPIGWPI
FT                   GRRVARIDGAARQGESGELLLGGVCLARGYHGRAALTAERFLPDASGEPGERIYRTGDL
FT                   ARERVDGSFDYLGRIDDQVQVRGVRVEPGEIAACLLTHPAVADAGVLAETAGGRTQLIA
FT                   CFVLHEELDDAALQTHLAAHLPQAWMPHRLVRFERLPYTLNGKLDRAALRDFIAKMPAV
FT                   VHVNHVAPRTATETRLAALWQTLLSDPAPIGCADRFFARGGDSLAAMQLQAAIRIEWRV
FT                   NLRLDALFDDQPLEALARLIDDSETETSMGSHAITVVQTTDAPFVDRAASFAQQRFWVL
FT                   AQTQDAGAAYHVAVQWDVQGALEIGTLQRALDCLIARHQAWRTTLVESDDGIVIQRIHA
FT                   RLPVPVVQFDLRACDEAERTSRLVELTEQQVGTAFDLSKGPLVRAALVTLTNDTQRFLL
FT                   TTHHSISDGWSSRCAFDELRAAYAAFAVGSEPQLPTLAIQYADYAQWQRDWLAAGEADR
FT                   QLAYWRDALRDAPEALALPLDRPRSPEHDYRGGRVALRLPIALSEAVRETARRVQASPF
FT                   TVLLAAFDAWLYRLTGTSDIVVAAPIAHRQRAETAPLVGLFLNTLALRARVAPDQSFAA
FT                   LLDGVRRSAFDAFAHQDVPFDQVLDAVKPPVRRGDAWLKVKFAQQFDLELSAELPGASV
FT                   RMSPGLDLAARFDYALDFTDDSRGIELVVAYALDGIDEATAHAWLHSYAALVADAVRDP
FT                   QRAIAELDCADSADYRAARRGREFQPAADNVLALFARHARKTPDRVALADAETQLTYAE
FT                   VDAASDRIAFALRQRGVGAEQPVAVCIERSVRFAVALIGVMKSGAYVVPLDPAAPRERL
FT                   TASVEACGARWILTANQTQAMAAVGAASTLDFDALTQASSPASVEEATASPATPLANQA
FT                   AYLIFTSGSTGTPKGVVISHGALADYVEGMLDELAFAADASMAMVSTVAADLGHTTLFG
FT                   ALCSGRTLHLLPAQCAFDPDRFAHEMRTRNVGILKIVPSHLHALLDAQHPADVLPAHAL
FT                   VMGGETLPWSLVERIAALNPTCRVINHYGPTEATVGALTCDTSASAQAALRTLSTRSAQ
FT                   AVPLGLPLPNAYACVLDSHGASVPPGAIGELYLGGPGLARGYLNRAAATAERFVPNPFA
FT                   PGERLYRTGDRVRLRADRRLDSLGRLDDQVKIRGYRVEPGEVSAALRALDGIVQAETLA
FT                   VEHDGRLRLASFVALASDARFDEAALRATLSARLPDYMVPAVLQHVAALPVTANGKVDR
FT                   AALRALATAPAPAVAAGDAPQNATEEALAAVWKDVLKAERVGRDDNFFELGGDSILVLQ
FT                   VIARSRKRGVRFTPKQLFDAPTLAQLARVATTVDVTAQAAPAASKSQPVPAKAEHSATL
FT                   TPAQLRFFALDIPRRGHWNQSIELDTQVPFDFDAFARAFETLLTYHEIFRQRFTPVGAQ
FT                   GEWRLELAERAFETLPLAASSARDEADALAQFDALQSTLDLTHGPLVCALAALLPDGTT
FT                   KLYLAIHHIIVDGVTWRVLLDDLDAAYRAACERRSVRLASTGTSAQEWAARLARAALDI
FT                   KNSPFAAELPYWAALAAPYDDLPLDRPQAKATNADAQSVIQTIDADLTRAALTEANAAY
FT                   RTQMIELLIAALAQSLDMPVCRIELEGHGREAVFDDVDVSRTPGWLTSHYPVQFTLEST
FT                   PAATLGAVKDTLRAVPNKGLGFGVLCHYGDPATRATLAAVPRPHVTFNYLGQFDAPREA
FT                   ALVPRFGGAGRERDPAGPIGNALAIHAYIDGDATRTLKIHWVYGATQFERATVEAIAQR
FT                   FESALAALTAACAARLAQRGGGATPGDYPLARMGGLTQAALERLPLDLRSIDDIYPLSP
FT                   MQHGILFHSLFAPEQSTYVNQLVATLIDPDVERLRAAFEAAVPRHDILRTSFTPDEATP
FT                   MQIVHRQARMPVDILDWRERGAHAHDAFEAWLRADRARGFDLTSPPLMRVALIRITDDA
FT                   WRLVWTRHHLLLDGWSTARFFADVLRDYIEPPRPQPFASPAKTRYRDFIAWLAARDTDS
FT                   ERAFWLQRLASLDEPTLVAERESASGRESQHLTRRETIDAATTARLTETARRLKVTVNT
FT                   MVQGAWALALQRMTHHTAVAFGATVAGRPDALPDVDTVLGLFINTLPVITAPLPQRRAS
FT                   EWLHDLQRDNAAAAEHAHTPLYEIQQWAGQGGGALFDTLVVFENYPVDEAWQGRDERAL
FT                   KLRELRNIEATDFALTLVIEAGATLTIDYGYDAAQLDEARVAALHRAFAACLAGLIADA
FT                   DAPLGTISISTADDLAALARFNSTEQVWPGTQQQALHRQFEQKALASPEAIALEFVDAL
FT                   GHTQQMSYGELDANADRVAASLIQAGVRADTAVALCVERSFDMVVALIGVLKAGAAYLP
FT                   IDPDYPADRIAYLLDDAKPAVVLTQPHLLERVMAAVDRTRVSILAVDALRGADFTLSAP
FT                   VPVAPDQLAYLIYTSGSTGKPKGAGNTHRALANRIAWMQDVYRLDANDVVLHKTPFGFD
FT                   VSVWEFVWPLAIGAKLAIAAPGDHRDPARLVAAIETHRVTTLHFVPSMLAAFAAHLEDF
FT                   RAAARCASVERIVASGEALAPELVARVAGQLPHARLYNLYGPTEAAIDVSHWTCDARDA
FT                   DAASVPIGHPIANLQLQVLDAALQPLPQGAIGELYLGGVGLARGYLGRAALTAERFVPD
FT                   PFSRGARLYRTGDLARRRADGALDYLGRMDTQVKLRGQRIEPGEIEALLRATPGVHDAV
FT                   VIVRDEQLIGYVACGADNALDTQALLDDLRAQLPSYMVPSYLIAMDALPVTPNGKCDRH
FT                   ALPVPVRGTASESATCVAATETERELAEIWKRVLRVDTIGRDDDFFALGGHSLLATQAN
FT                   AQANLHWTLILPLRTLFDERTLQRCAAAIDRALAERDAHGAGDTASAIDALLDEFELQ"
FT   gene            100021..105045
FT                   /locus_tag="Bphyt_4073"
FT   CDS_pept        100021..105045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4073"
FT                   /product="amino acid adenylation domain protein"
FT                   /note="TIGRFAM: amino acid adenylation domain protein;
FT                   PFAM: AMP-dependent synthetase and ligase; condensation
FT                   domain protein; phosphopantetheine-binding; KEGG:
FT                   bxe:Bxe_B0526 non-ribosomal peptide synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4073"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18457"
FT                   /db_xref="GOA:B2TED6"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B2TED6"
FT                   /protein_id="ACD18457.1"
FT                   /translation="MTTAKPDLLSLASRFALLPDAQRKAFLTKLDAAGIDFRVLPIPPR
FT                   AERTASVPASFAQTRLWLHARMIDEPAAYHITERLHLDGALDANALRLSCDALIARHEA
FT                   LRTTFAESGDGVLQTVHAPSRCPWHASDVSTWPADQREARAAGIARADEAKSFDLSLGP
FT                   LMRAHLIRLDTNTHWLALTTHHIVSDGWSADVILAELASFYRAYAKSEAVSLAPLPIQY
FT                   ADFALWQRRWLDAGERERQLAFWRERLDANRDVLTLPGAAPRPAQRSARGARHRFALDA
FT                   ALVQQVKALANAQRATPFAVLLAALSALLARSSGETQIQIGVPAANRERGEVAGLVGFF
FT                   VNTLTLATPVPATQPFAGLVGATQQTLIDAQSHQDVPFEQVVEALGVVRSASHHPLFQV
FT                   MAAYGARRRLPSLAEVRMTELPSGAPFAKFDLTLSFEERDDDSIDAYFIYALDVFDADA
FT                   IERLAARFIELLSNATAAPATAVGDLQWLPEAERAQLDAWNSTAFPAEAAFRPVHQRVA
FT                   DHAIARPDARGVADINRSLTRGEVDARATRLAQRLVAAGVSAEMRVGVALSRSVDLLVG
FT                   LIAALKSGGAFVPLDPSHPRERLAQILDDAQMTHVITERGSLAALPASDRLRLWLIDEE
FT                   PQADEPPAAHVELPRVSPHQAAYVIYTSGSTGKPKGVVVDHGSFALHCAAIAERYGAGE
FT                   RDVFLLFQSVNFDGAHEGWFSQYMSGAAVAITADTLWPPAQTCRMMVREGVTMTYVPPG
FT                   CATQLAEWALSHGAPPSLRSLTVGGEATSREAFALMRRAFPNARIVNGYGPTETVITPM
FT                   LWMFYPTDDTAKLADSAYLPIGTLVGARSAHVLDARLNPLPVGVIGELYLGGEGVGVAR
FT                   GYLDRPALTAERFVPDPFGALGARLYRTGDLVKRRADGVFDFIGRVDHQVKLRGLRIEL
FT                   GEIEAQLAAHDDVREAVAIVHGKGAQAALVAYVELSAEARERSTRADAAELDAHLRHTL
FT                   PDYMVPAHIVVLDALPRNANSKVDRAALPEPQRVARAYQAPAAGLETALAQIFREVLGV
FT                   ERVGRADHFFELGGHSLAAVRVATRVAERLARDVPVRTLFEAPTLAQYAQRVLASARSE
FT                   ALANVGNDASGGASNSQPTADANGVLPLSSAQLSLWFLWRSQPDSAAYNIPVALRLRGA
FT                   LDADALREAFAQAAARHPALRVRLVERAGQLPGQRVAEPAPFDLPVVDLSDDPSATARE
FT                   SAAVALTDEDALTPFHLLDNSPLWRARLLRLAERDHVLSLVVHHIVSDGQSIDLWLDDV
FT                   RTTYVAIVRGASPSAAGLGTAANKELVLPVAAPRARLSFWRDALTDAPSHVLPSPSSGR
FT                   AASPSWSCGRLAFEFSPALVRRARSMALEVHATLPMLLHAALNVAFYRATGATDQPVGV
FT                   LASTRELTGEAARRALGLFINAVVVRTRLAKTDTPATLLAEVRDAALAAYAHADTPFAD
FT                   VVAALRARRAEAGNPLFSVMFNYLRPAGTAERDWAGLTLDEFNDVRHRVVFELELDVVE
FT                   HADGRVTGAFSYANELVDGRFVEVLTADYLGVVQQFVDAPHEQLGASAARFALQSASVA
FT                   AGAQASASSHNEASQRAEVLERVWSELFEGNTPAHHDDLFEAGASSFDVVRFVDAARSA
FT                   GHALEIADVFAAPTFAQLAARLVARGSRVVELRDGA"
FT   gene            105179..106549
FT                   /locus_tag="Bphyt_4074"
FT   CDS_pept        105179..106549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4074"
FT                   /product="L-ornithine 5-monooxygenase"
FT                   /note="KEGG: bxe:Bxe_B0527 L-ornithine 5-monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4074"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18458"
FT                   /db_xref="GOA:B2TED7"
FT                   /db_xref="InterPro:IPR025700"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B2TED7"
FT                   /protein_id="ACD18458.1"
FT                   /translation="MHRDTVFDLIGIGFGPSNLALAVRLAEEAGVSDLAHCFIERQPEF
FT                   GWHRGMLLDDCRMQISFLKDLVTMRDPKSRFTFINYLFEHGRLADFVNLKNFYPTRVEF
FT                   HDYLSWVAASFDDRVNYGQTVTGIEAVRSTANTNDVEALRVFSRDSEGREWQRVTRALS
FT                   VGIGGGPQVPEAFAALGTHNIVHSSQYLTSIDRAVGPADGARKRVAVIGAGQSAAEVFV
FT                   DLTRRFPHVDASLIIRSSALKPADDSPFVNEIFSPAFTDIVYAQPRDGRRSLIERFRDT
FT                   NYAVVDRPLIEQIYEMLYLQNVSADPRHRLLANTGIETAVRTAGGQIELTLRDRLSGHA
FT                   RAEQFDALVLATGYRRDTHFDLLDGLAPHLGDALAQGNVERDYRLATPASFKPRVYLQG
FT                   CCEDSHGLSDTLLSVLALRSDEIATSLARHASQDRSGGRTPQAQENATGVGRMAFAL"
FT   gene            106597..108834
FT                   /locus_tag="Bphyt_4075"
FT   CDS_pept        106597..108834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4075"
FT                   /product="TonB-dependent siderophore receptor"
FT                   /note="TIGRFAM: TonB-dependent siderophore receptor; PFAM:
FT                   TonB-dependent receptor; TonB-dependent receptor plug;
FT                   KEGG: bpm:BURPS1710b_2091 TonB-dependent siderophore
FT                   receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4075"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18459"
FT                   /db_xref="GOA:B2TED8"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:B2TED8"
FT                   /protein_id="ACD18459.1"
FT                   /translation="MEWATGTRRSATAVTASVAFYAAAAASAQAQQSAQQPAQSEGNAQ
FT                   QGARSGQPAATQPATLPSISVNGLAGNDGTVGLVARRSNTGTKTDTPLKEIPQTINVVT
FT                   AQQIEETGATSINEALRYIPGFSTYGADVRSDWYSVLRGFTPTVFVDGLQVPNTLNLAS
FT                   WRVDPFMIDSITVLRGPTSVLYGQGDPGAIIDVQSKLANGERIREVEMQLGDYARKQIA
FT                   FDVGDKVDQAGTLSYRFLGVGRDGNSQTGPNPEQRVALAPSVKWQPNAKTSLTVEASYL
FT                   QDWGDASNNFLPAQGTVLPNPNGKISPDLYTGDPEFSHYRKKQWSVGYQFEYKFDPVWT
FT                   FRQNTRLMHLSLDQGQVFGGGLDPADPTEASLLRYVGLYQLNYSRFDVDNQALARFGTG
FT                   PLDHTVLLGFEYNRQATTDSESMATGPSLNMYNPVYTPITNAIFSGPDAFPRTDTKSTM
FT                   NAFGVYAQDQIKWQRWVLTLGARQDWSNTTQNDIAGGSRLEQNDHAFSGRVGVVYLGDY
FT                   GLSPYISYSTSFNPLVGVKIVGGGIAEPTKGKQIEAGLRWQPAGKNLMLNAAVYQINQT
FT                   NVVTPDFGIDPTGGTSVQTGEVRSRGIELSGVGNVTRNFSVIAAYVYQDVKNIKAGDDT
FT                   LGKWPVDIPRPRQMASLWGDWTWHAGPLAGLGFGGGIRYQSGAAGAADNSLYVPSYTVY
FT                   DAAVHYETRNWRFAVNGQNIFNRRFVSGCQSVNTCFYGNPRTVIATARYDW"
FT   sig_peptide     106597..106689
FT                   /locus_tag="Bphyt_4075"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.759 at
FT                   residue 31"
FT   gene            108869..109711
FT                   /locus_tag="Bphyt_4076"
FT   CDS_pept        108869..109711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4076"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0528 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4076"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18460"
FT                   /db_xref="GOA:B2TED9"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="UniProtKB/TrEMBL:B2TED9"
FT                   /protein_id="ACD18460.1"
FT                   /translation="MSKKKLVYIWSLRNAAADKAGQEIAYKSGTRYMKSVLESLVEALN
FT                   DTELGDQYSLEKVIYDDDAGSSVDREKLKEYGFAYEPGKRWLYPPNLRVQGKPVNDLLL
FT                   AIPSTYRREPLDAPGRPAGKSAFEKHLLDTLVALKADIVVLDGLLIILDELVRPGAPFY
FT                   RKIVNIHPGVTRAESPYERRGAYATLDALYGARGKKVVNWKTMETVAVEPLYLTGASFH
FT                   YVDNGIDSGEVIHDVLNTEIDKDDTILELRWNNFNRSLFPALNEGLAIMAGQTVQVEA"
FT   gene            complement(109779..111503)
FT                   /locus_tag="Bphyt_4077"
FT   CDS_pept        complement(109779..111503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4077"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bxe:Bxe_B0529 major facilitator superfamily (MFS) efflux
FT                   pump"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4077"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18461"
FT                   /db_xref="GOA:B2TEE0"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEE0"
FT                   /protein_id="ACD18461.1"
FT                   /translation="MSHDPIAPPRREEWRSTNAAVGHQPTSHEAHRAGAVASDKTPQSA
FT                   TFLSLRKNTLALGAVCLASLMFGLEISSVPVILPTLERVLHGDFKGMQWIMNAYTLAVT
FT                   TVLMATGTLADRFGRRRIFVVGIALFGITSLICGLAQSVPTLIVARLLQGASGGAMLIC
FT                   QVAVLSHQFNEGPERARAFSAWGIIFGIGLGFGPIIGGAIVALSSWQWVFWVHALLAVV
FT                   TLMLVFSGVQESRDPHAHTLDVAGIVTLSLAVFGLVYFITQVPALGFSNPRALFIIAAT
FT                   LVAFVAFLFAERLNTRPMFDFSVFRIPQFSGALMGSAGMNFSFWPFMIYLPIYFQIGLG
FT                   YDSVSAGLALLAYTLPTLLFPPLGERLALRYGSGIAIPAGLFTIGLGFMLMRYGSGAAH
FT                   ADLWTLLPGCMIAGAGLGLTNTPVTNTTTAAVPAERAGMASGIDMSARMITLAINIALM
FT                   GAILVGGILASLKTRLPKTLDTAPLGRLAEKIAAGDVEAVRTGMPALAQIDPSGSAVHA
FT                   ALMHGFGWVMVYGGVGVWVLAALSFVISGSASRRLSGEKCAPAQKQQHQPAQCDACS"
FT   gene            111631..112569
FT                   /locus_tag="Bphyt_4078"
FT   CDS_pept        111631..112569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4078"
FT                   /product="transcriptional regulator, LysR family"
FT                   /EC_number="4.2.1.1"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bxe:Bxe_B0530 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4078"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18462"
FT                   /db_xref="GOA:B2TEE1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEE1"
FT                   /protein_id="ACD18462.1"
FT                   /translation="MSDILDGVTTFVRVVETGSFALAAERMNLTRSAVGKVIVRLEKRL
FT                   GVRLLNRTTRSQSLTEDGQAYYDRCVRALAELEAAEADLDSGRREPQGRLRVSVPQAFG
FT                   HYCVAPVLLGLARKHPQLKIDISITDRFVDVIEEGFDLVVRVGPLADSVSLAARKLGMQ
FT                   HASIGAAPAYLARHGTPRNVEELRGHAVIGYLRAGSAQPWDVVDVDGQIRRAQVQPQLG
FT                   FDDMKGIVDAALAGFGLAWLPSWLLTRYEKTGELVTVMENCFRPAQEIHLVWPKSRYLA
FT                   LKTRCAIDALVAEIPAMIGAPAPGAPRSRDA"
FT   gene            complement(112566..114749)
FT                   /locus_tag="Bphyt_4079"
FT   CDS_pept        complement(112566..114749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4079"
FT                   /product="TonB-dependent siderophore receptor"
FT                   /note="TIGRFAM: TonB-dependent siderophore receptor; PFAM:
FT                   TonB-dependent receptor; TonB-dependent receptor plug;
FT                   KEGG: bxe:Bxe_B0531 TonB-dependent siderophore receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4079"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18463"
FT                   /db_xref="GOA:B2TEE2"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR030149"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEE2"
FT                   /protein_id="ACD18463.1"
FT                   /translation="MQKFFVAGRPAFVRGPRRTPSLLSAGLLASVGLTLSTLSTSGWAQ
FT                   VAASDAGTTLPAVSVSAAKDTTVAQADTISAGALGSRKQVDTPFSTHVVTSDEAQDLFA
FT                   TTANDLYKYDPAVSVISDNGVSENSMFTVRGMPIDTLNSVKVDGQTFPSWDTDLSLEPF
FT                   EQVELLKGLSGFMYGFGSPGGIVNYVLKRPTDTPYRSISVGYKSAGVFSEAVDLGGRFG
FT                   NDDRFGYRLNLANENGNTAEDHGHVRRQVASLAFDFRITPDLTWSADAFYQKRRTNGTL
FT                   FGLMFGGDAGGIPDASKVTHALTQPQNYYETEMASFGTGLDYRISENWHASIKYRFAKE
FT                   NRTNSDSFLFVTDPAGNYSNTLYAALTRYFYQNVDGMVQGHFNTGTIKHDVVVGAGFLT
FT                   QTSEYSNSTGWNEGYFLGNGNLYASTLLTNDEVSISSNLYRQQRTTQAAVYASDTVQLT
FT                   SRLAALVGVRYTQYQQHVYDPSGAVSSQYQADPVTPTFALMFKTDPYSTLYVSYVESLE
FT                   QGGAASNTNLNYPDTFGPLRSKQYEVGFKTDHAKWGANLALFRVDQGYNYTNVDNIFVQ
FT                   DGTKRYQGLDASGWLAVTSEWRVLGGVMWLDTKAMDVNDPTVEGKRIYGAPRFTVTGRI
FT                   EYNPSYLRPLTLAFGGKYVGNQAVDAQNTQFVPAYTTFDLSGRYETKIAGKDVTFRAGI
FT                   NNLFNRRYWTTAWGYYVAPSATRTAVASATLQF"
FT   sig_peptide     complement(114615..114749)
FT                   /locus_tag="Bphyt_4079"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.872 at
FT                   residue 45"
FT   gene            115165..117393
FT                   /locus_tag="Bphyt_4080"
FT   CDS_pept        115165..117393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4080"
FT                   /product="isocitrate dehydrogenase, NADP-dependent"
FT                   /EC_number="1.1.1.42"
FT                   /note="KEGG: bxe:Bxe_B0532 isocitrate dehydrogenase
FT                   NADP-dependent, monomeric type; TIGRFAM: isocitrate
FT                   dehydrogenase, NADP-dependent; PFAM: Isocitrate
FT                   dehydrogenase NADP-dependent monomeric type"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4080"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18464"
FT                   /db_xref="GOA:B2TEE3"
FT                   /db_xref="InterPro:IPR004436"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEE3"
FT                   /protein_id="ACD18464.1"
FT                   /translation="MSTPPKIIYTLTDEAPALATYSLLPIVKAFTRSSDVIVETRDISL
FT                   AGRIIAAFPDYLSAEQKGPDDLAELGGLSTRPEANVIKLPNISASVPQLKAAITELRDQ
FT                   GYKLPAYPDVANTDAEKDVKARYDKIKGSAVNPVLREGNSDRRAPLSVKNYARKHPHKM
FT                   GAWSADSKSHVAHMSGGDFYGSEKSALIGAAGSVKIELTATDGSKTVLKEKTAVQAGEI
FT                   IDASVLSKNALRSFIEAEIADAKAKGVLFSVHLKATMMKVSDPIIFGHVVSVFYKDVLT
FT                   KHADALAQAGFNPNNGIGDLYARLKDLPAETVAAIEADIKAQYEQRPQLAMVNSDKGIT
FT                   SLHVPSDVIVDASMPAMIRESGKMWGADGALHDAKAVIPDRCYAGVYQAVIEDCKKHGA
FT                   FDPVTMGTVPNVGLMAQAAEEYGSHDKTFQIPANGVVRVTDAAGTVLIEQQVEAGDIWR
FT                   MCQTKDAPVQDWVKLAVNRARATNTPAVFWLDAARAHDAQIIKKVEQYLKNHDTTGLDI
FT                   RVMTPVEATKFSIERIRAGKDTISVTGNVLRDYLTDLFPIMELGTSAKMLSIVPLMAGG
FT                   GMFETGAGGSAPKHVQQLVEEGFLRWDSLGEFLALAASLEHLSSAYHNPKAQVLAKTLD
FT                   QATGKFLDNDKSPARKVGGIDNRGSHFYLALYWAEALAAQTEDAALQAQFAGVAKALAE
FT                   NEAKIVEELAAAQGKPVDIGGYYRPNVELTSKAMRPSATLNKIVDAIA"
FT   gene            complement(117501..117731)
FT                   /locus_tag="Bphyt_4081"
FT   CDS_pept        complement(117501..117731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4081"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0533 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4081"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18465"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEE4"
FT                   /protein_id="ACD18465.1"
FT                   /translation="MKGFRFGSNQGAFYILPGQDGWEATYGNETLGEFASPQQAADDLA
FT                   RGLICPHLSEGDDTSTLEIPEKLSEWEIVHV"
FT   gene            complement(118124..118942)
FT                   /locus_tag="Bphyt_4082"
FT   CDS_pept        complement(118124..118942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4082"
FT                   /product="alpha/beta hydrolase fold"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: bxe:Bxe_B0534
FT                   putative peroxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4082"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18466"
FT                   /db_xref="GOA:B2TEE5"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEE5"
FT                   /protein_id="ACD18466.1"
FT                   /translation="MEPSTHPHDDDLERFEAHGAAPLPVPSDEGYVEHEGARIWYASYG
FT                   AGAPVILLHGGLGHSGNWGYQVPALLDAGRRVVVVDSRGHGRSTRDARPYRYELMASDV
FT                   LAVMDTLQLERAALVGWSDGACVAMVLGATAAERVAGVFFFGCNMDPSGTRPFVPTPAI
FT                   ERCFSRHAKDYAQLSATPDDFEAFVGAVSTMMKTEPNYSAGDLAQIRVPVAIVQSEHDE
FT                   FIKPEHADYLARSIPGAELILLPGVSHFAPLQRPAQFNRVVLDFLRRIAD"
FT   gene            complement(119127..120515)
FT                   /locus_tag="Bphyt_4083"
FT   CDS_pept        complement(119127..120515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4083"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   rpc:RPC_1075 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4083"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18467"
FT                   /db_xref="GOA:B2TEE6"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEE6"
FT                   /protein_id="ACD18467.1"
FT                   /translation="MHGYSHSDATTSGGNTSVGVERTYRKIFFRLIPLLFLCYVISYID
FT                   RVNISFAKLQFMHDLGFSESTYGLGAGLFFIGYVLFEVPSNLWMQRIGARRTLLRIMFA
FT                   WGLVSSLMMFVRTPMQFYAMRFLLGVTEAGFFPGIIFYLSCWFPGARRARVTAFLMMAT
FT                   AVAGIVGGPMSGFIMTRLAGVGGLPGWQWLFLLEGVPAVTLGIVAFLLLGDKPDDVSWL
FT                   DEHEKALVSRELAADEKAKQTGHLDGLRGALANPRVYLAALVYFAVMMPFNAIGFWAPT
FT                   IIRDLGVANVLDVGLLSALVFIAAALGTYVVGASSDRTMERRWHVAVSACVTALAFALL
FT                   PAAGHNVTLGVGLLALAAAASYGSFVVFWTIPQTFLPRSSAAGGIAMITSLGGTGGFVS
FT                   PAFVGWVKTQTGSAQYGLIGLAVVLLAGVVLMLVVFPAPGRKLAVGATGGNPAAQTGLG
FT                   QTRH"
FT   gene            complement(120657..122909)
FT                   /locus_tag="Bphyt_4084"
FT   CDS_pept        complement(120657..122909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4084"
FT                   /product="CoA-binding domain protein"
FT                   /note="PFAM: CoA-binding domain protein; ATP-grasp domain
FT                   protein; KEGG: bpt:Bpet2987 acetyl-CoA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4084"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18468"
FT                   /db_xref="GOA:B2TEE7"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR032875"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEE7"
FT                   /protein_id="ACD18468.1"
FT                   /translation="MNPATHDAGALDIGRLVEPRSIAIIGASNDPKSISGQPMRFLMQH
FT                   GYQGTLYPVNPKYAQIDGVACHDSIAALPSTPDLALILVAARRVPDMLRQCGEKGVGFA
FT                   IVYSSGFAEAGEAGAALQRECADIAKAHGIRVIGPNCQGFVSTGANVYAGFGAPFGVAY
FT                   RRGGLSLISQSGGFGCALLLMADELGIGLRHFITTGNEADVSLLDLVNACIADPHTSLI
FT                   ATYIEGLKDAGRLVDMANRALDAGKPLLAWKVGNTADGAKAAASHTANLGGASALYRTA
FT                   FRQTGVIEVSDVADLGDYARAFEAGRLPRGKRIAVVTLSGGAGILITDACAERGMSVPA
FT                   LSAATLERLKPIVPAFASLNNPIDLTAGILAEPKIFADALQIIADDPNIDAIAIMAAAA
FT                   SGEVAQAMATAIVRVYGSIDKPLMLAWNARRDMAGEAYETIEAHGVPLYATPVRCGRAF
FT                   AALADYAQARRARAEARDPMPRALRRYDVEHARALLVDIQGKHGDLDLTEHASQALLRD
FT                   YGIDVPKSGLAQNRDQACALARAIGFPLVIKVQSPDIAHKTEAGAVRVGIRDEATLAAA
FT                   FDEIVGNAHRHVPHARIEGVLVQEEIRDALEMIVGIENDASFGPAVMCGLGGIYAEVLK
FT                   DVSFRLAPVTHADAHAMIRELRSFAMLDGARGKPPGDIEALVETIVALSTMALDQRASL
FT                   RELDINPLFVLPAGKGVRAGDALARLLPRAADSNDAADRTGAMHESEHCAPAVVDG"
FT   gene            complement(122918..124114)
FT                   /locus_tag="Bphyt_4085"
FT   CDS_pept        complement(122918..124114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4085"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase type 2 domain; KEGG: rme:Rmet_1816
FT                   acyl-CoA dehydrogenase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4085"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18469"
FT                   /db_xref="GOA:B2TEE8"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEE8"
FT                   /protein_id="ACD18469.1"
FT                   /translation="MTSHSSHFDAMLAGVAKFVRDEAIPRENEIEQADAVPADLVQRMR
FT                   ELGYFGWSIPRDFGGAGLSTEQLVRGAFELSQASVAFRARVGTNTGIGSEALVADGTDT
FT                   QKQRYLPRLASGEFTGAFALTEPDAGSDATALRTTARRDGDHYILDGSKCFITNAPIAD
FT                   LFTVMARTELAKPGAGGISAFLVERGTPGLSTSAPYDKMGQAGSPVGDVVFEGCRVPAA
FT                   NLIGGKEGMGFRTAMKVLNKQRIHLAALCTGPAMRMLEEAVAYTSRREQFGKPVAEFQL
FT                   VQALIAECQTEIYAARSMILETARKRDAGEDVALEASMCKMFASEMCGRVADRAVQMLG
FT                   GRGYLAGNAVERFYRDVRAFRIYEGTTQIHQLNIAKITLRRAAERDQAKVRADAACAA"
FT   gene            124279..125130
FT                   /locus_tag="Bphyt_4086"
FT   CDS_pept        124279..125130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4086"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="PFAM: regulatory protein IclR; Transcriptional
FT                   regulator IclR; KEGG: bbr:BB4480 probable transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4086"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18470"
FT                   /db_xref="GOA:B2TEE9"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEE9"
FT                   /protein_id="ACD18470.1"
FT                   /translation="MAANSKQSDAAALTGDYLDSKARYVPDEFDGDRQFATTLARGLDI
FT                   LHCFTPRESQLGNAELAARTGMTKATISRFTYTLTRLGYLRVNRMNNKFQLGSAVLSLS
FT                   YPLLASMSVRQIARPSMKELADQIRGSVSLGMRDRLNVVYLESSRSSTPLGMPADIGLS
FT                   YPIVRTAMGRALLAALPAERREALCNEIAVKSPHEWSTFRERVLSAIDYFYERGFCVSY
FT                   GDLRREIHAVAVPMKPSADGEILVFNCGVPSYLLKEKQLEGDIGPRLVSMVRSVEGAMG
FT                   IY"
FT   gene            complement(125233..126573)
FT                   /locus_tag="Bphyt_4087"
FT   CDS_pept        complement(125233..126573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4087"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0535 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4087"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18471"
FT                   /db_xref="InterPro:IPR021847"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEF0"
FT                   /protein_id="ACD18471.1"
FT                   /translation="MRKIARIIAAALGLGLALGLAGCGGGGGGSSSNSTANAPANAPVA
FT                   ASAPAGPGGTMSNPSTGDSSSNTLAVDASAVPTPVGPGNTMSVTVSGTGIHNQPMVSVK
FT                   LCAPGSNASTSCTTIPNVIVDTASFGLRLVRSAIPTSTFNALTAETDQSSGLPLAECAL
FT                   FGSGYAWGSVHLADIGLSSEVAASVPIQVIGDSALTIAAPSECQVGRPLAAASDLGANG
FT                   ILGIGVSPVDCGSQCALTVLSQFYYTNAGNAVSVPVSKQISNPVARFAQDNNGVILEMA
FT                   QVSDSGSATAQGTLVFGIDTQANNVLNGTGAPIFRTDLNGDFTSSYGGTTFTQTFFDSG
FT                   STVMFFPDTTIPRDTSSGYYIPTATVGRTSTLIGTNPASVSLGFNIANGATLTSSGNNA
FT                   FNNLGIYMTRQFDFGLPFFYGRHVYYGISGRASSGGGTGPYVAYVSS"
FT   sig_peptide     complement(126463..126573)
FT                   /locus_tag="Bphyt_4087"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.916 at
FT                   residue 37"
FT   gene            complement(126604..127098)
FT                   /locus_tag="Bphyt_4088"
FT   CDS_pept        complement(126604..127098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4088"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0536 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4088"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18472"
FT                   /db_xref="InterPro:IPR021267"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEF1"
FT                   /protein_id="ACD18472.1"
FT                   /translation="MLAVAAASLALVALAAPAYAALGAAPTYPVTASSTSAGAASQNSA
FT                   AVARFAASGSAASAAYTVSQTTLPSGTVVSEYIGAGNTVFALSWQGPTMPPLKTLLAAY
FT                   FPSYVQALTDAHATQGGGYGPAAVHQSALVVETGGHMGAFVGRAYLPQALPQGVSADDI
FT                   K"
FT   sig_peptide     complement(127036..127098)
FT                   /locus_tag="Bphyt_4088"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.980 at
FT                   residue 21"
FT   gene            complement(127277..128170)
FT                   /locus_tag="Bphyt_4089"
FT   CDS_pept        complement(127277..128170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4089"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bur:Bcep18194_A4509
FT                   transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4089"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18473"
FT                   /db_xref="GOA:B2TEF2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEF2"
FT                   /protein_id="ACD18473.1"
FT                   /translation="MDLNLRDIRAFIAVAQTGSFTRAATRLHLSQPALTVQIRRLEETV
FT                   GMRLFDRNSRNVALTPTGRELLPLLQKSLHDMEHVLIDARALGVGASGTVRIACLPTFA
FT                   ASVLPELVQDIKKAVPRVSFHVRDVVASMVNTLVRNEEVDIGLTGGQLDDAAFEVLHAG
FT                   IDRLVAVFPKRHALARRRRITLADLAVAPLVLTAQGTSVRAVVDSAFTNARCTPEIACE
FT                   PTYMMTAVAMVRAGLGVTILPASAREVRAEPELIVRAVDDPAFTRPIALIKKRGRTLPP
FT                   VTETFVTMLIEKLGAD"
FT   gene            128270..129574
FT                   /locus_tag="Bphyt_4090"
FT   CDS_pept        128270..129574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4090"
FT                   /product="citrate/H+ symporter, CitMHS family"
FT                   /note="TIGRFAM: citrate/H+ symporter, CitMHS family; PFAM:
FT                   Citrate transporter; KEGG: bam:Bamb_1244 citrate/H+
FT                   symporter, CitMHS family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4090"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18474"
FT                   /db_xref="GOA:B2TEF3"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="InterPro:IPR014738"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEF3"
FT                   /protein_id="ACD18474.1"
FT                   /translation="MLPLLGLATIVVLLGAILSKRMSPLVALIIVPIAASLIGGFGFQT
FT                   SKFVIDGLKNLAPVVGMFVFAILYFGTITDAGTLDPIIDRILRAVGTRPTRIVMGTTLL
FT                   ALLIHLDGSGAVCFLVTIPAMLPLYDRLKMDRRVLAAAVSMAAGINFLPWTGPMIRASA
FT                   SLHLPISALFNPLIPVQAIGLVFVFGMAFWLGRREEKRLGLTAASGSVPMPKRELSPEE
FT                   QALRRPKNFWFNIVLTLVVLGTMVVMGEKVPPAIMFMVGLCIALMVNYPNVDMQRKRID
FT                   AHARAALMMAGILLAAGVFTGVMQGSGMLKAMAQAAVGFVPPAMAGHIPVALGLLSMPL
FT                   SMLFDPDSFYFGVLPVIAEVAGQLGVPAVHVGQAALLGQMTTGFPVSPLTPATFLVVGL
FT                   CGIDLADHQKFTFPLLFGASVVMTIACVVLGIFSL"
FT   gene            129604..130962
FT                   /locus_tag="Bphyt_4091"
FT   CDS_pept        129604..130962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4091"
FT                   /product="protein of unknown function DUF1446"
FT                   /note="PFAM: protein of unknown function DUF1446; KEGG:
FT                   bcm:Bcenmc03_1346 protein of unknown function DUF1446"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4091"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18475"
FT                   /db_xref="InterPro:IPR010839"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEF4"
FT                   /protein_id="ACD18475.1"
FT                   /translation="MTATQPQRRVRIGAGAGYSGDRIEPAVELAQYGALDYLVFECLAE
FT                   RTIAIAQQARSKDPELGYDPLLETRMKAVLPAALRNGVRIISNMGAANPLAAARKTAEI
FT                   ARSLGLGDVKIAAVTGDDVLDVVRQGDFCFVESGERVADYKDRLVSANAYLGASAIVDA
FT                   LAAGAQIVLTGRVADPSLFVAPLIHEFGWRMDDWQTLGQATVIGHLLECAGQITGGYFA
FT                   DPGFKDVPELARLGFPIAEVGQDGGVVITKLAQAGGRVTEATCKEQLLYEIHDPQRYLQ
FT                   PDVVADFSQVRVAQEAPDRVRVSGGRGTPRTDTLKVSVAYFDGYIGEGQISYGGPGAFA
FT                   RARLALDIVRERLVLTGVQTRELRFDLIGVNALHGETAAVGYAEPYEVRARVAGRTTSL
FT                   AQAVQIGNEVETLYTNGPAGGGGVTKSAREVVAVQSVLLPREHVTPAFSMVEA"
FT   gene            130964..131278
FT                   /locus_tag="Bphyt_4092"
FT   CDS_pept        130964..131278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4092"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bmu:Bmul_1927 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4092"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18476"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEF5"
FT                   /protein_id="ACD18476.1"
FT                   /translation="MKLRELAHSRTGDKGNTLNISVICYDAQHYDHLRTVLTPERVKAH
FT                   LRDVVRGDVVRHELPAIAAFNFVLGNALGGGVTRSLALDAHGKSLSSALMDLDVEAPAS
FT                   "
FT   gene            complement(131304..132338)
FT                   /locus_tag="Bphyt_4093"
FT   CDS_pept        complement(131304..132338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4093"
FT                   /product="transcriptional regulator, LysR family"
FT                   /EC_number="4.2.1.1"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: ppw:PputW619_1688 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4093"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18477"
FT                   /db_xref="GOA:B2TEF6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEF6"
FT                   /protein_id="ACD18477.1"
FT                   /translation="MGNVAPLHRDRRATRYHRSATAGARPLIHIAHTCWGNLDLALGNI
FT                   NDIATFVTVVKAGSFTSAGQQLGITRSAVGKIIARLEARLQVRLLHRTPHSLGLTDDGS
FT                   VFYGRCTQILEDLEETETAMAVRSATPAGSLRISLPIALGHRQVLPIIALFLERWPAVS
FT                   AEVSFTDRFVDLVDEGIDVAIRVGEPKPDSRLIARTVATQKLITCASPVYLAKRGAPVS
FT                   PLDLAHHECLQFVSAGRPQPWLFAGVGQQAVEAGGRLKMDSAEALIGAAVNGVGIINLP
FT                   NYLVANEIRQGHLQPLLQSFAAQALPIRAIYPTRRHLTPKVRLFIDELIEAWQPVPPWE
FT                   EADA"
FT   gene            132404..133672
FT                   /locus_tag="Bphyt_4094"
FT   CDS_pept        132404..133672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4094"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bxe:Bxe_B1021 major facilitator superfamily (MFS)
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4094"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18478"
FT                   /db_xref="GOA:B2TEF7"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEF7"
FT                   /protein_id="ACD18478.1"
FT                   /translation="MDANQLAGSSARPALASDSALDAPLVSTGAAASRGASWAAVLSVA
FT                   VGSFAFVATEYMPVGLLPQIAHDLGVTPGTAGLMVTTPGIIAAISAPALLLAAGRINRR
FT                   LILLLLAALLVASNAISAIAPSFAVMLVGRALLGASLGGFWTVALGASGQLVREDQAAR
FT                   AGATIFMGITLATVIGVPLGTLIADLSSWRVSFFATAVLAGVALAAQVVFLPSLPPKAA
FT                   MRTDDFRAMLARSNVRRSLWMVGLLFGAHFAAYTYIAPFLERNAAFGPSWITAVLLGFG
FT                   VVGFAANFAISALVTRHLKVSLLMLGALMAAALFALPMLQVSRVGVIAAVMAWGIAYGA
FT                   IPLSLSIWMQWTSPERPEAGSSMFVSTVQTSIALGSLAGGAVVDHLSIASTMHFGGLLA
FT                   VLSLLVIMTFSTRHASLKDVLDK"
FT   gene            133904..135013
FT                   /locus_tag="Bphyt_4095"
FT   CDS_pept        133904..135013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4095"
FT                   /product="NADH:flavin oxidoreductase/NADH oxidase"
FT                   /note="PFAM: NADH:flavin oxidoreductase/NADH oxidase; KEGG:
FT                   gdi:GDI2773 putative N-ethylmaleimide reductase,
FT                   FMN-linked"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4095"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18479"
FT                   /db_xref="GOA:B2TEF8"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEF8"
FT                   /protein_id="ACD18479.1"
FT                   /translation="MSKLFTSVKVGPYEFAHRVVLAPLTRMRAEDGARPGRLMAEYYAQ
FT                   RTSAGALLIGEATIAAVEGNGYLGAPGLYDDSQIAGWREVTDAVHAKGGKIFLQLYHAG
FT                   RQSNAELQPEGRRPVGPSEVLHGGVAYTKAGWIPNTPNRALEIDEIAAIVESFRTAAER
FT                   GVKAGFDGVELHAANGYLFDQFLQDGSNKRTDIYGGSFENRARLLMEATRAVISVWGSN
FT                   KVAVRLGPSGSWGDMSDSDPVGLFSYVADELAKLDLAYLHLIEPRIAGNVEDESRNPDP
FT                   VAAQTIRKHYAGTIIAAGGFKGDSAEAILVDGDADLVAFGRDFIANPDLPERLRRNLPL
FT                   NAYDRPTFFGGTEVGYTDYPLYDEEAVSA"
FT   gene            complement(135141..136067)
FT                   /locus_tag="Bphyt_4096"
FT   CDS_pept        complement(135141..136067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4096"
FT                   /product="transcriptional regulator, LysR family"
FT                   /EC_number="4.2.1.1"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: spe:Spro_3137 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4096"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18480"
FT                   /db_xref="GOA:B2TEF9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEF9"
FT                   /protein_id="ACD18480.1"
FT                   /translation="MDRFGSLNVFVRAAETRSFTEAGRQLGISSSAVGKAISRLEGRLG
FT                   VRLFHRSTRSIALTPEGATFLTRCQRIIGEIEAAENELALANAAPRGLLRVSMPMVSTL
FT                   MMPVIAAFMKTYPDIVLDIDFSDRMVDVIEEGFDVVTRTGDAIDSTLVTRTMGTYRHVI
FT                   VGSPAYFAQRGVPSEPEQLREHACLQHRFPTTNKLRRWPLMRDGELLNIDLPTTAIATA
FT                   VEPLTMLAEQDLGLACVPDFTIRAQLARGSLVAVLQTYTDTPTVFRALWPSGRQISPKA
FT                   RVFVDYLSEHLFPVSAAAAGARGAGRA"
FT   gene            complement(136177..136761)
FT                   /locus_tag="Bphyt_4097"
FT   CDS_pept        complement(136177..136761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4097"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: bja:blr1086
FT                   transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4097"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18481"
FT                   /db_xref="GOA:B2TEG0"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011075"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEG0"
FT                   /protein_id="ACD18481.1"
FT                   /translation="MPKPSHKDTLIAEGMRVIHEFGFNGASVRDIVKAAGVPHGSFTNH
FT                   FASKEAFGLEVIELYFERARLEMRETLLNDELKPLYRLGKYIDVHIRLISLNDSRNGCL
FT                   LGNFAADSSDSEAIRARINAIFAETEKSVLYCLRAAVAAREVRADTNCEQLATFIVSSM
FT                   QGAFLLAKAQRDPAPVVNLKEVLFSSVLQRA"
FT   gene            complement(136840..137961)
FT                   /locus_tag="Bphyt_4098"
FT   CDS_pept        complement(136840..137961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4098"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; KEGG:
FT                   sco:SCP1.239c putative oxidoreductase, mmyg"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4098"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18482"
FT                   /db_xref="GOA:B2TEG1"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEG1"
FT                   /protein_id="ACD18482.1"
FT                   /translation="MTEKSAVSKVTPIRVGIVGVGNWAQHGHVRVLSLLPQYELTAVFS
FT                   QRREAAQGVAERYGFKYVVDSLDELVTHPEVDLVIVLTTAPQHAEGVRAAIAAGKDVYC
FT                   EWPLTPSVATSQELIDLAREANVRHVVGLQRRLAPHNRYVRDLLAQGYVGKLRSVRIHV
FT                   SMNYFQALRSQSLRWTVPSENFSSVIAIYAGHFLDMLFEATGWPHAIAALSVNQFEQVT
FT                   IAETGEAMPTTTPDQLVLAGRLQDGAVLSVHIEGGKRNGSGVQIDITGTEGDLRITNRS
FT                   AFGNVGDDYVIEGAHGNNLPLATLPVPASYDQLPPSDLPSAVLELAQLYAAFADDVRTG
FT                   GHTAPTFEHAVRLHKLLDAAVESSDSGRHIELD"
FT   gene            complement(138042..138788)
FT                   /locus_tag="Bphyt_4099"
FT   CDS_pept        complement(138042..138788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4099"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; KR domain protein;
FT                   KEGG: bvi:Bcep1808_3959 short-chain dehydrogenase/reductase
FT                   SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4099"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18483"
FT                   /db_xref="GOA:B2TEG2"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEG2"
FT                   /protein_id="ACD18483.1"
FT                   /translation="MKLTGNTIFITGGGSGIGRGLAEAFHKLGNQVIIAGRRKANLEET
FT                   IAANPGIQSVELDITDPQSITAVSQQLIAQYPSLNVLINNAGVMQIDDLSKPVNDALIV
FT                   STLTTNLMGPIRLTGALVEHLKQQGDATIINVSSVLGFVPMAISGVYSSAKAAIHSYTQ
FT                   SLRYKLKDTSVRVVEIAPPWVQTDLLDSRNEPRAMPLAPFIEQTMHELGTDADEAIVEI
FT                   ARPLRNNPGPNEAAFVTQFNDMFAGA"
FT   gene            complement(139047..139757)
FT                   /locus_tag="Bphyt_4100"
FT   CDS_pept        complement(139047..139757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4100"
FT                   /product="GntR domain protein"
FT                   /note="PFAM: regulatory protein GntR HTH; GntR domain
FT                   protein; KEGG: psb:Psyr_4228 regulatory protein,
FT                   GntR:bacterial regulatory protein, GntR"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4100"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18484"
FT                   /db_xref="GOA:B2TEG3"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEG3"
FT                   /protein_id="ACD18484.1"
FT                   /translation="MSSLTEKVVATLSDEIRRGTLRPGDRIPTEVAMMKQLSVSRSVVR
FT                   EAISRLQAAKVVETRHGIGTFVLEPATEKSMQLPAADLSSMLDVMAIIEFRIDVEAASA
FT                   ALAAARRTDQNLKQIRGALERFESELERGSTDTLAHDIEFHLQIARASGNRYFFDVLSQ
FT                   LGRAVSPRTRLGSAEIAELDHIEHLRNVLSEHQMIYRAIERQDPDDARAAMRMHLSNSR
FT                   ERLRRAHELSKAGD"
FT   gene            140181..141512
FT                   /locus_tag="Bphyt_4101"
FT   CDS_pept        140181..141512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4101"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bmu:Bmul_1091 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4101"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18485"
FT                   /db_xref="GOA:B2TEG4"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEG4"
FT                   /protein_id="ACD18485.1"
FT                   /translation="MTSALTTAADPLESAVSKVKRHVLPLFLIMFIANYIDRVNIGFVN
FT                   SHMQTDLGIGAAAYGLGSGLFFIGYALFEVPSNVLMQKYGARAWLTRIMGTWGLVAAAM
FT                   AFVWNDTSFYVLRFLLGIAEAGFFPGVVFYFTQWLPQKERGKAVAVFLGGSALASVLSG
FT                   PITGSLLSIRGFGLHGWQWMFLVEGGFSIVLCAVSWMLLKSRIRDASWLTAEEQHVLET
FT                   SIAAEQAAREAHGGAHLPAMKLLKDPQILLFCFLYFAIQLTIYAATFWLPTIIRKMGGL
FT                   SDFQVGMLNAIPWLIAMFAMYCFALLSAKWRFQQAWLAVALVIAACGLFASTSGNPVLS
FT                   FVAICFSAIGFKAAASLFWPIPQGYLDARVAAAVIALINSVGNLGGFFAPAAFGYLQQH
FT                   TGSITGGLYGLAVASLIAAAAGFLTRNRRVNHDALPESLQHKVH"
FT   gene            141645..142994
FT                   /locus_tag="Bphyt_4102"
FT   CDS_pept        141645..142994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4102"
FT                   /product="glucarate dehydratase"
FT                   /note="TIGRFAM: glucarate dehydratase; PFAM: Mandelate
FT                   racemase/muconate lactonizing protein; KEGG: bxe:Bxe_B0539
FT                   glucarate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4102"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18486"
FT                   /db_xref="GOA:B2TEG5"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR017653"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034593"
FT                   /db_xref="InterPro:IPR034598"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEG5"
FT                   /protein_id="ACD18486.1"
FT                   /translation="MSTKSSELNATPVVTELRVVPVAGRDSMLLNLSGAHGPFFTRNIV
FT                   ILRDSAGHTGVGEVPGGESIRKTIDDARPLVVGQSIGNLQAVLNKARTQFADRDAGGRG
FT                   LQTFDLRTTIHAVTALEAALLDLLGQHLGVPVAALLGEGQQRDEVEMLGYLFYIGDRKK
FT                   TDLEYASGADGRDDWERVRTEEAMTPEAVVRLAEAAQARYGFNDFKLKGGVLPGDAEIE
FT                   AVTALAERFPKARVTLDPNGAWSLAEAVRLCRDQHDVLAYAEDPCGAENGYSGREVMAE
FT                   FRRATGLPTATNMIATDWRQMGHAIQLQSVDIPLADPHFWTMQGSVRVAQMCNDWGLTW
FT                   GSHSNNHFDISLAMFTHVAAAAPGKITAIDTHWIWQDGQRLTRDPLRIVGGKVKVPQAA
FT                   GLGIELDMDEIEKAHALYQQHGLGARDDGVAMQYLIPNWKFDNKRPCLVR"
FT   gene            143071..143988
FT                   /locus_tag="Bphyt_4103"
FT   CDS_pept        143071..143988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4103"
FT                   /product="5-dehydro-4-deoxyglucarate dehydratase"
FT                   /note="TIGRFAM: 5-dehydro-4-deoxyglucarate dehydratase;
FT                   PFAM: dihydrodipicolinate synthetase; KEGG: bxe:Bxe_B1802
FT                   5-dehydro-4-deoxyglucarate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4103"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18487"
FT                   /db_xref="GOA:B2TEG6"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017655"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEG6"
FT                   /protein_id="ACD18487.1"
FT                   /translation="MTSPQELKAIVSEGLLSFPVTDFDAHGEFRADTYAARLEWLAPYG
FT                   ATALFAAGGTGEFFSLTKTDYTNVIRTATDTCRGKVPILAGAGGPTRVAIEYAQEAERL
FT                   GASGVLLMPHYLTEASQEGIAAHVEQVCKSVPNIGVIVYNRANSKLNADMLERLADRCP
FT                   NLIGFKDGVGEIEAMVTIRRRLGERFSYLGGLPTAEVYAAAYKALGVPVYSSAVFNFIP
FT                   KTAMEFYRAVAANDHATQGRLLDEFFLPYLAIRNRRAGYAVSIVKAGAKLVGHDAGPVR
FT                   APLTDLTDEESAQLDALIRKLGAQ"
FT   gene            complement(144136..145692)
FT                   /locus_tag="Bphyt_4104"
FT   CDS_pept        complement(144136..145692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4104"
FT                   /product="drug resistance transporter, EmrB/QacA subfamily"
FT                   /note="TIGRFAM: drug resistance transporter, EmrB/QacA
FT                   subfamily; PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bxe:Bxe_B0540 major facilitator superfamily (MFS) multidrug
FT                   efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4104"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18488"
FT                   /db_xref="GOA:B2TEG7"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEG7"
FT                   /protein_id="ACD18488.1"
FT                   /translation="MNPTATALPFRNALFAMLGIGLVNMLVALDQTVVSTALPSIVAEL
FT                   HGFEYYAWIASAYLLASVVTVPVFGRLGDYFGRKRFVIAAVITFTVASVLCGVANDMLF
FT                   LVIARGLQGVGGGMMVGTAFASIPDLFPDPRARVRWQVVMAAAYGIGTAAGPSLGGWMS
FT                   EHWGWRSTFLINLPVGAAALYFIWAHLPAFRRPHEGDVKIDWLGAALVAAVLGGLQAFI
FT                   EAVPKNGLTAGNLTLAACVIVGTIALLICEKRATHPIIPLDLFRDPQLVTLFTLGMLSG
FT                   FVMFSLIFFAPLLLQGGFGLSPQQAGLLATPIAACIALGSLLNTRIVIHMKKPTQILSI
FT                   GFALLLFAAIALAFANPDTPHVWIELPMAAVGIGLGFILNNLNVFGQEIAGRERFGITT
FT                   ALLQSTRMVGGMLGTSIVATVVQHHYRDVVARTMSVLGEPAASQWRPRFVDLRILIDEA
FT                   SRLKLIADMKPSGLDTLALIDTARDALVQSIHIGVWLTAVAALAAALLVQRISHVVFRK
FT                   S"
FT   sig_peptide     complement(145606..145692)
FT                   /locus_tag="Bphyt_4104"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.852) with cleavage site probability 0.833 at
FT                   residue 29"
FT   gene            146078..146386
FT                   /locus_tag="Bphyt_4105"
FT   CDS_pept        146078..146386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4105"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bam:Bamb_4557 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4105"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18489"
FT                   /db_xref="InterPro:IPR025421"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEG8"
FT                   /protein_id="ACD18489.1"
FT                   /translation="MKNPRKIWPMLSALVLLLGGCAAGGSQQSASHLSALQCQDLAALK
FT                   NNAPPTPERSRSELTALRSAGYDPSRWFDPYYPADLQAAQRQVDSWFAAECQHAPPA"
FT   sig_peptide     146078..146152
FT                   /locus_tag="Bphyt_4105"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.240 at
FT                   residue 25"
FT   gene            complement(146639..147094)
FT                   /locus_tag="Bphyt_4106"
FT   CDS_pept        complement(146639..147094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4106"
FT                   /product="3-dehydroquinate dehydratase"
FT                   /EC_number="4.2.1.10"
FT                   /note="PFAM: dehydroquinase class II; KEGG: bja:blr1201
FT                   3-dehydroquinate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4106"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18490"
FT                   /db_xref="GOA:B2TEG9"
FT                   /db_xref="InterPro:IPR001874"
FT                   /db_xref="InterPro:IPR036441"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEG9"
FT                   /protein_id="ACD18490.1"
FT                   /translation="MTELVYVLNGSNLNMLGKREPHLYGTTTLAQIQQQVEALAVRLEL
FT                   QCEFRQTNSEATMVDWLQEAFERDAAVIINPAGFSFASVPVFDAVKLIERPLIELHITN
FT                   IHKRDETYRHSLVSRAATGVICGLGANGYLVALQAMAMALGKSPSFG"
FT   gene            complement(147155..148531)
FT                   /locus_tag="Bphyt_4107"
FT   CDS_pept        complement(147155..148531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4107"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1; KEGG: rha:RHA1_ro08874
FT                   probable metabolite transporter, MFS superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4107"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18491"
FT                   /db_xref="GOA:B2TEH0"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEH0"
FT                   /protein_id="ACD18491.1"
FT                   /translation="MIQDTQQGTHAAMRTRAVTAAAVGTALEWFDFTLYGALAATVLPK
FT                   LFFPSMDSTSALLASLATFGVGLAARPLGAIICGHLGDKLGRRNLMLGTVTVMGLASML
FT                   MGLLPTYASIGVWAPVLLVLLRILQGFALGGESTGAQLMAIEHASADRRGKYSGLLGLC
FT                   SPLSQIMANGVLLLLSSMMSAQAFDSYGWRIPFILSFILVVVGVYIRLRVSETPAFVAL
FT                   RKTEVVHVGSPLRDALRLHWRTVLRWMLFFCGPAAIFYLIVVFSLSYITKTLAIPKQTG
FT                   FLLLMGANVCAIVGALAGGMLSDKIGRKKALAIGSIATLLMLFVYFQILDTKSFVPMLA
FT                   AMGFFLGFTQFQSGIQPVAFAEAFPTNVRYSGSALAYTGANLVAGGPMPVLAVWLFSVC
FT                   NGSPWGVVAVCVVFNVISLVMILTARETLGIDMNRTDSTAAVTGEADFTPAHVSNSHRT
FT                   "
FT   gene            148770..149552
FT                   /locus_tag="Bphyt_4108"
FT   CDS_pept        148770..149552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4108"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="PFAM: regulatory protein IclR; Transcriptional
FT                   regulator IclR; KEGG: pna:Pnap_2705 regulatory proteins,
FT                   IclR"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4108"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18492"
FT                   /db_xref="GOA:B2TEH1"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEH1"
FT                   /protein_id="ACD18492.1"
FT                   /translation="MPGVTERTLAVLEFLAAQMEGTPLAMIADELEIPRSACHRLLVDL
FT                   KQCGYVRQLREHGDYVLTTKLVGLGLGFLATSGIVDIAQTMLDRLAETSGELVRLAIVD
FT                   GDRLTWVAKAQGALKGLRYDPDMGMDTILSCSATGHAWMMTMTDERALELVTRQGFGQP
FT                   KQYGPNAPTTISGLLKFVHAARERGYATINEVFAPGMTAMAAPVQRRGYPAMGVISIAG
FT                   PLVRLDEKRMASLGSTLLAAASELAAASHASPLFNRGR"
FT   gene            complement(149526..150632)
FT                   /locus_tag="Bphyt_4109"
FT   CDS_pept        complement(149526..150632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4109"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; KEGG:
FT                   bmu:Bmul_1981 NAD-dependent epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4109"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18493"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEH2"
FT                   /protein_id="ACD18493.1"
FT                   /translation="MEKRALIIGASGIVGGNLADQLLSNGWHVAGLSRGRTPVSPAIES
FT                   ITADLQSADSVNEALAGQAFSHVFLTAWSRQATEKENIRVNGAMVRHVMDAVGPSGTLE
FT                   HAALVTGLKHYLGPFEAYATGAVPITPFREEQGRQPVDNFYYEQEDRLFEAAQRYDFSW
FT                   SVHRPHTIIGFALGNAMNMGVTLAVYATLCKQTGQPFIFPGSAAQWNSLTDMTDARLLA
FT                   RHLEWAATSANARNEDFNVVNGDVFRWKWMWSQIAGYFGIEAVPFDGETRPLEGRMQEA
FT                   GKAWADIAARFDLKEADIGKLASWWHTDADLGRPMEVLTDMTKSRQAGFLDYQSTPDSF
FT                   FALFDRLKAERIIPSDTRTRLAASIEQR"
FT   sig_peptide     complement(150573..150632)
FT                   /locus_tag="Bphyt_4109"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.667) with cleavage site probability 0.657 at
FT                   residue 20"
FT   gene            complement(150684..151547)
FT                   /locus_tag="Bphyt_4110"
FT   CDS_pept        complement(150684..151547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4110"
FT                   /product="Hydroxyquinol 1,2-dioxygenase"
FT                   /EC_number="1.13.11.37"
FT                   /note="PFAM: intradiol ring-cleavage dioxygenase; Catechol
FT                   dioxygenase domain protein; KEGG: bam:Bamb_3333 catechol
FT                   1,2-dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4110"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18494"
FT                   /db_xref="GOA:B2TEH3"
FT                   /db_xref="InterPro:IPR000627"
FT                   /db_xref="InterPro:IPR007535"
FT                   /db_xref="InterPro:IPR015889"
FT                   /db_xref="InterPro:IPR039390"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEH3"
FT                   /protein_id="ACD18494.1"
FT                   /translation="MRNLDENTITEAVLARHAHSGDERLKTIVTSLVRHLHDFAREVNL
FT                   TESEWEQGIRFLTDVGLITDDKRQEFILLSDTLGLSMLVTAMANRKPPGCTEATVFGPF
FT                   FVEGAPAYRNGDDVSNGARGEPCFVSGTVKGADGEAVANARIEVWQADADGFYDVQHAG
FT                   DDTHRARGVLHSLADGRYHFRSIVAEPYPIPHDGPVGRMLAALGRHPWRPAHLHFMITA
FT                   PGYERLVTHVFREGDQYLDSDAVFGVRSSLVAQWKHHEAGTAPDGTSMTTPFSTLEFDF
FT                   VLNRSV"
FT   gene            complement(151656..152333)
FT                   /locus_tag="Bphyt_4111"
FT   CDS_pept        complement(151656..152333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4111"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0541 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4111"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18495"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEH4"
FT                   /protein_id="ACD18495.1"
FT                   /translation="MKKYIALFAIAGTLLTSGCATVSTMSPTTSTSSVDTTKNSYALMT
FT                   VTLKNAYHTSYQPSPIVVNMERGAADSREDRLNFKFDDQATTTSDKGNHYFIRLPLAPG
FT                   KYVMRGITGQSGIFPIRGMFFTPLHEVVDIKPNSIVYLGHIDATIVERKDGELRAGPVI
FT                   PLVDQAVAGFSGGTWDISVSDQFDDDVTAFKKDFPALTNASIDREVLPAWDKKKATEWW
FT                   NNH"
FT   sig_peptide     complement(152259..152333)
FT                   /locus_tag="Bphyt_4111"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.230 at
FT                   residue 25"
FT   gene            complement(152561..153442)
FT                   /locus_tag="Bphyt_4112"
FT   CDS_pept        complement(152561..153442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4112"
FT                   /product="NmrA family protein"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; TrkA-N domain
FT                   protein; NmrA family protein; Male sterility domain; KEGG:
FT                   mrd:Mrad2831_0235 NmrA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4112"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18496"
FT                   /db_xref="InterPro:IPR008030"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEH5"
FT                   /protein_id="ACD18496.1"
FT                   /translation="MAILVTGSTGVVGKQVLEHLLAAGGAQVRALTRSPEKAQFPDGVT
FT                   AVQGDLSDVDGLRRAMNGVSTLFLLAPNAPDELTQALQTLSVAREAGVKGVVYLSVFKG
FT                   AEYVDVPHFTGKHTVERMIEHCDLPATVLRPAYFIQNDVRQKEPLLTHGVYGMPIGAKG
FT                   ISMVDVRDIGEAAARELLRRERSATRLPRETYELVGPDAITSETVASIWAEALGRSVRY
FT                   GGDDLDVLEQRLKAAAPGWLVYDMRLMMSRYQQDGAVASQAQIDHLATLLGRQPRSYRE
FT                   FAAEMAAAWKNG"
FT   gene            153559..154443
FT                   /locus_tag="Bphyt_4113"
FT   CDS_pept        153559..154443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4113"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: mlo:mll0238 probable
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4113"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18497"
FT                   /db_xref="GOA:B2TEH6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEH6"
FT                   /protein_id="ACD18497.1"
FT                   /translation="MDLTSLADFNAVALHGGFGPASRALDRPKATLSRRVAELEETLGV
FT                   RLIERGSRTLRLTEEGLALHERTRGLMAEIQEAGEAVASRAPVPRGRLRISAPVVFAHV
FT                   VLVRIATRFALAYPQVELEVVAEDRVVDPVEDGYDLVIRINPAPDQQLVGRRILGDELL
FT                   LVAAPTMSIPPWAAGDAAALAVPAVVSVAASANAIWSVRTESGPRSLAPMPVLRLSSLL
FT                   MVRNAVLDGVGAAMLPKLLVEQDVAAGRLVCWGVADGPPVEIWALYNSRRLLSAKVRAF
FT                   MDLLRDLPGRERQ"
FT   gene            complement(154499..155131)
FT                   /locus_tag="Bphyt_4114"
FT   CDS_pept        complement(154499..155131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4114"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0542 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4114"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18498"
FT                   /db_xref="InterPro:IPR002372"
FT                   /db_xref="InterPro:IPR011044"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEH7"
FT                   /protein_id="ACD18498.1"
FT                   /translation="MKRSAAEIITEYGPFEGMERVHGVTYDGQHVWFATGNALNAFDPE
FT                   SGKQVRSIDVAAHAGTAFDGEHLFQIAEDRIQKIDPKTGRVLATIPAPGGGADSGLAWA
FT                   EGTLWVGQYRERKIHQVDPQTGAILRTIESNRFVTGVTWVDGELWHGTWEGDESELRRI
FT                   DPRTGEVQERLEMPAGVSVSGLESNGGDRFYCGGGSSGKVRAVRRPK"
FT   gene            complement(155164..156384)
FT                   /locus_tag="Bphyt_4115"
FT   CDS_pept        complement(155164..156384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4115"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0543 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4115"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18499"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEH8"
FT                   /protein_id="ACD18499.1"
FT                   /translation="MDSLVTAAARALAAGDPLGALNRVALRDDAPALALRGIAMAQLGD
FT                   LVRAKALLRSAARAFGAREPVARARCVVAEAEIALASRDLNWPTKALDAACATLEAHGD
FT                   RLNAAHARYLAVRRLLLIGRLDEAERALAELDPTPFPPALRTAHELVVAGVALRRLQTK
FT                   AARAALERARRAADRASIPALTAEVDNAALVLNAPAARLLARGEERPLLLDEVEALLAS
FT                   KALIVDACRHVVRDAGTVVSLASRPVLFVLARALAEAWPDDVSRDVLVARAFRAKAADE
FT                   SHRARLRVELGRLRSVLRTVAGVSATPRGFALVPRHGHEVVVLARPVEDKHAPVLALLA
FT                   DGESWSSSALALALGASQRTVQRTLDTLAAQAKVQSLGRGRARRWMTPPMPGFTTTLLL
FT                   PAPLPID"
FT   gene            156492..157259
FT                   /locus_tag="Bphyt_4116"
FT   CDS_pept        156492..157259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4116"
FT                   /product="protein of unknown function DUF899 thioredoxin
FT                   family protein"
FT                   /note="PFAM: protein of unknown function DUF899 thioredoxin
FT                   family protein; KEGG: bxe:Bxe_B0544 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4116"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18500"
FT                   /db_xref="InterPro:IPR010296"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEH9"
FT                   /protein_id="ACD18500.1"
FT                   /translation="MTTKHSIGTREEWLAARLELLDAEKALTRQSDELARQRQALPWVR
FT                   IDKAYRFETDEGSASLTDLFRGRSQLLVYHFMFGPDYAAGCPSCSAVADGFNGSVVHLA
FT                   NHDVAMTAVSRAPLAKLQAYKRRMGWAFPWASSAGSDFNFDINVSFTEQQQRDGSVEYN
FT                   YQRGGHAMDTTPAPAPVVEFAAACGTDAPTYSLDRPGMSAFVLEDGAVFHTYSTYGRGV
FT                   DALWGMYQWLDRAPKGRNETGVWWRRHDEYEKH"
FT   gene            157460..159097
FT                   /locus_tag="Bphyt_4117"
FT   CDS_pept        157460..159097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4117"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; Cache type 2
FT                   domain protein; KEGG: bpd:BURPS668_A2780 methyl-accepting
FT                   chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4117"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18501"
FT                   /db_xref="GOA:B2TEI0"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR033480"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEI0"
FT                   /protein_id="ACD18501.1"
FT                   /translation="MVRFSFTQKLWLPLVVSLVALLAVSVSAAWLSRQTRIEERKNDLV
FT                   NVAHVGLSIVTEYAALAQSGALSEADARRQALERLRGIRYGEDGYFLVIDSTPRMVMHA
FT                   MKPALNGKDLAGTADADGRHHYVTFAAVAQKPNGGFVDYVFPHPQDPPSAAVGKIGYVV
FT                   RYAPWDWIIATGAYVDDIDAAFKESLYFVGGIFAVLALLLSALVSLTNRSIRRTIGGDP
FT                   VYVAQVAGEITRGNLAIPINLRHGDESSLLHTVYLMRDALAHTIEQIKGAADKVATGAR
FT                   EIAGGNTDLSARTENQAASLEETAASMEQMTAMVRQTAENAQTASQLTAGAEQIVNRGG
FT                   EMAAQAVSTMQEISTESHKMVEIISVIEGIAFQTNILALNAAVEAARAGDAGRGFAVVA
FT                   GEVRTLAQRSAAAAKEIRALISHAVDKVGTGAEFVGQTGATIHSAREAIAKVSGVMRDI
FT                   AAAAAEQSAGIDQVGDAVAQMDSVTQQNAALVEQAAAVAQTLTEQARLLQVSISQFNLQ
FT                   QHGADEAAGLLRVRRPAAEEARGFAAVV"
FT   sig_peptide     157460..157546
FT                   /locus_tag="Bphyt_4117"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.984 at
FT                   residue 29"
FT   gene            159365..160393
FT                   /locus_tag="Bphyt_4118"
FT   CDS_pept        159365..160393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4118"
FT                   /product="porin Gram-negative type"
FT                   /note="PFAM: porin Gram-negative type; KEGG: bxe:Bxe_B0545
FT                   outer membrane porin, OmpC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4118"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18502"
FT                   /db_xref="GOA:B2TEI1"
FT                   /db_xref="InterPro:IPR001702"
FT                   /db_xref="InterPro:IPR002299"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEI1"
FT                   /protein_id="ACD18502.1"
FT                   /translation="MGWRAGVASAALLFCLQSVAASDGGAGAVTLYGVLDTSLEITDPG
FT                   SGWTPRLDSGAYRGSRVGLRGSEPLGNGTDIIFTLENGFSSVDGTLQAPGVLFNRQAWI
FT                   GARNGWGELRFGRQYSPIYIPFKGDLDAFGAGTIASGLNNLSKITPYASNAIAYFSPVV
FT                   GGFSATLMTATRDPSEKDGNGIDGYYVTAAYQLDNFRLLYARQQTHGAGALRANLGGAT
FT                   YAIDKVRVWLAFFNGDGGTPLYHGAGGSLSAQYSFSPSARASLGYAHVRDYTGAGASAD
FT                   QFSVAFEYNFSRSLLFYFSGAYLANHDNASFTLRGVNVTGLPVSYPGAPVKGVQLGVLE
FT                   RF"
FT   sig_peptide     159365..159427
FT                   /locus_tag="Bphyt_4118"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.941 at
FT                   residue 21"
FT   gene            complement(160452..161798)
FT                   /locus_tag="Bphyt_4119"
FT   CDS_pept        complement(160452..161798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4119"
FT                   /product="L-sorbosone dehydrogenase"
FT                   /note="KEGG: bxe:Bxe_B2746 L-sorbosone dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4119"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18503"
FT                   /db_xref="GOA:B2TEI2"
FT                   /db_xref="InterPro:IPR011041"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR012938"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEI2"
FT                   /protein_id="ACD18503.1"
FT                   /translation="MRQLNRFALFMLLPLAACAAGPSSPADTGFGPSPLLPAPESSLMT
FT                   TVNIAPVRAPAVGFLPTAPNGFVVTQFGRGLTHPRWLYTLPNGDVLVAESNAPEQHDEG
FT                   SGIFGWVRKQVMKRAGAGTPSPDRIVMLRDTTGSGIADQQTVFLSGLHSPFGMALIGNQ
FT                   LYIADTDAILRFDYTPGATRIDTPGVKVADLPAGPINHHWTKNILADRSGKHLYVTVGS
FT                   NSNAGENGVDAEADRARILEFDVASGQMRPFATGLRNPNGMSWQPDSGALWTAVNERDD
FT                   LGNNLVPDYMTAVKDGAFYGFPYSYYGQHVDTRVKPQRPDLVATAIAPDYALGNHTASL
FT                   GLVFYDRTLFPAHYRGGAFVGQHGSWNRKPYSGYKVVFIPFVKGQPAGAPEDFLSGFLT
FT                   ADGHAVGRPVGVAVDKRGALLVADDVGNAVWRVAPRNDTGAAVGTPSAQ"
FT   sig_peptide     complement(161739..161798)
FT                   /locus_tag="Bphyt_4119"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.729 at
FT                   residue 20"
FT   gene            complement(161992..162774)
FT                   /locus_tag="Bphyt_4120"
FT   CDS_pept        complement(161992..162774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4120"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pna:Pnap_0632 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4120"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18504"
FT                   /db_xref="GOA:B2TEI3"
FT                   /db_xref="InterPro:IPR025333"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEI3"
FT                   /protein_id="ACD18504.1"
FT                   /translation="MMSTWLHNLPIWLMTLVAFGATFLVGAALHVITAMFAGGQHGRSY
FT                   GAISPALLSPIGIIFGLFIAFTAAQVWNDTARANAAVNTEAGALRSIVVMSAVLPQESQ
FT                   VELRKLVRDYIQYTATTEWPLMARGVVTLNVSPPSLNRAIQSTLSLAVNTPGQETAQRE
FT                   VVASLRQALEARRERILISRTQVSGVKWACLIFLGVCLLFAIALVHCENRLASAVAIGL
FT                   FSAVFATTILLILAHDRPFTGEIALTPEPLLQVIPAER"
FT   sig_peptide     complement(162691..162774)
FT                   /locus_tag="Bphyt_4120"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.942) with cleavage site probability 0.379 at
FT                   residue 28"
FT   gene            163269..163976
FT                   /locus_tag="Bphyt_4121"
FT   CDS_pept        163269..163976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4121"
FT                   /product="Carboxymethylenebutenolidase"
FT                   /EC_number="3.1.1.45"
FT                   /note="PFAM: dienelactone hydrolase; KEGG: bxe:Bxe_B0548
FT                   carboxymethylenebutenolidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4121"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18505"
FT                   /db_xref="GOA:B2TEI4"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEI4"
FT                   /protein_id="ACD18505.1"
FT                   /translation="MTQTAGSMITFSRPDGQQIQGYLAKPQRLEGAPAIVVIQEWWGVN
FT                   DQIRGVADRLAQCGYLALVPDLFRGKTTVEEEEAHHLLDGLDFGDAATQDVRGAVQYLQ
FT                   QHATKVGVTGFCMGGALTLLALCNIPEVSAGVVWYGFPPLEYIDASKIKAPLIGHWATQ
FT                   DDFFVSETVDALESKLKEANVDVEFHRYLAHHAFANETAVGPGRIPRTQFDPVWSQLAW
FT                   DRTLTFFGRTLWK"
FT   gene            complement(164104..164850)
FT                   /locus_tag="Bphyt_4122"
FT   CDS_pept        complement(164104..164850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4122"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: bxe:Bxe_B0549 putative short-chain
FT                   type dehydrogenase/reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4122"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18506"
FT                   /db_xref="GOA:B2TEI5"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEI5"
FT                   /protein_id="ACD18506.1"
FT                   /translation="MNDLTGKTALVTGASRGIGRASALALARAGAQVLVHYSSGEKEAD
FT                   AVVAEIRAAGGNAQKVAANLRAADGPHTLAKQVRAVIGHRLDILVANAGISKGVSIEDT
FT                   TVEDFDDLFAVNVRAPYFLVQQLLPVMCKGSSVVLLSSLAARAAVGTLSAYAATKGAVD
FT                   TLVKHFAAALGERGIRVNAVAPGVVETDMSNFTKTDTGRAATLGMQALKRVAQPDDIGG
FT                   AVAFLASDAARWVTGETLHVDGGSKL"
FT   gene            complement(164916..165812)
FT                   /locus_tag="Bphyt_4123"
FT   CDS_pept        complement(164916..165812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4123"
FT                   /product="alpha/beta hydrolase fold"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: bxe:Bxe_B0550
FT                   putative hydrolase, alpha/beta fold family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4123"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18507"
FT                   /db_xref="GOA:B2TEI6"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEI6"
FT                   /protein_id="ACD18507.1"
FT                   /translation="MNSTVASNDATAIRHTHQTAPTRYVDANGIRFAYRRFGKAGGVPL
FT                   VFNIHFTGTMDHWDPAVTNGLAQDREVILFNNAGISSTSGEVPESIEEMAANAAAFIKA
FT                   LGLQQVDVLGFSMGGLIAQTLAIAEPALVRRVILVGTGPRSGEAMQSLTPEAQEIFSAA
FT                   YARPDHLWLRVHFSPSDASQTAGRRFLQRFRQRSEGRDPEANEKVAPAQLAALAKWGAP
FT                   RENPFEYLKALRQPTLVVNGDHDVIIYSINSWILQQNLPNAQLIIYPDANHGSLYQYPE
FT                   RFVAHVSQFLADSGSAV"
FT   gene            166009..166908
FT                   /locus_tag="Bphyt_4124"
FT   CDS_pept        166009..166908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4124"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bxe:Bxe_B0551 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4124"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18508"
FT                   /db_xref="GOA:B2TEI7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEI7"
FT                   /protein_id="ACD18508.1"
FT                   /translation="MELRHLRYFVAVAETGSLTVAAERRLHTSQPSLSRQIRDLEDEVG
FT                   AELFSRSARGVELTAAGKAFLDHARLALSQVDAAIEAARRAARPSKQVFALGFLTGQEM
FT                   TWLPRAMQVLRDELPNIDVTVSSHYSPDLADALARGKLDLAFLRAEPGFDLDYRVVSSE
FT                   KLIVLMPSDHRLTERSAIRPEDFAGETFIMASNKARVLHAVIQRYLDENGITVAPGHDV
FT                   DNLAMAMSLVASTRGLALMPEYATNLLPWSVVSRPLEGETPTVDLVIGYSRSNTSPVLK
FT                   LFLSRADELMAHVSAEPR"
FT   gene            166985..168571
FT                   /locus_tag="Bphyt_4125"
FT   CDS_pept        166985..168571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4125"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0552 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4125"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18509"
FT                   /db_xref="GOA:B2TEI8"
FT                   /db_xref="InterPro:IPR005152"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEI8"
FT                   /protein_id="ACD18509.1"
FT                   /translation="MWIAIRNAALGLLACCILGACAGAPADSQCGEACNGRGQLLDHRV
FT                   TLKLSATEFAKLLASSAGGRQLVRIAGAPACGVEIVSFRYRTIGGAGEPTQASGALMIP
FT                   SGSSATCGGSLPLMLYAHGTTAYRNYNLADITRTDPANGDGAGEGISVAAMYAAQGYIV
FT                   VATNYAGYAGSDLPYHPYLNADQQSADVIDSLRAARAALADMKAEAGARENGKLFVTGY
FT                   SQGGFVAMATHRALQAAGVKVTASAPGSGPYALAATADALIEGEVNLGATLFSTLIVTG
FT                   YQHAYGNIYRQPGDFYEAAYAPAIETLLPNLQPLDKLFGTGKLPSAHLFNSVPPATQYA
FT                   SITPPASPPLTPPLLKPLFAAGFGDANLVRNAYRLTLLEDAAANPDGAFPNPTLAMKPA
FT                   ANPLHPLRQAFKRNDLRNWVPRAPVLMCGGASDPTVFFFNARVEQAYWQNANVPAGLTS
FT                   VLDVDSPVVGPGDPYARVKRGFAGAKAEVASQAVARGATDGGASAVLRAYHGELVASFC
FT                   TVAARAFFANF"
FT   sig_peptide     166985..167053
FT                   /locus_tag="Bphyt_4125"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.746 at
FT                   residue 23"
FT   gene            complement(168700..169302)
FT                   /locus_tag="Bphyt_4126"
FT   CDS_pept        complement(168700..169302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4126"
FT                   /product="phosphoesterase PA-phosphatase related"
FT                   /note="PFAM: phosphoesterase PA-phosphatase related; KEGG:
FT                   bxe:Bxe_B0055 membrane-associated phospholipid phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4126"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18510"
FT                   /db_xref="GOA:B2TEI9"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR033879"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEI9"
FT                   /protein_id="ACD18510.1"
FT                   /translation="MQTLEAFNQALFLMIDATLSTPAWCIDFARSIADYLIYLVPLCLT
FT                   AMWLSGDERQRETALRACCVTLLALGINQLIGLVWPQPRPFVLGIGHTFLDHAPDPSFP
FT                   SDHGTIFASIALTLLLGGVKRYGSLIVLSGLAVAWARIFIGVHFPLDMAGAVVVAAVAF
FT                   MLVAPPWRLAGPSMTRGLIALYRKLLAWPIERGWLSL"
FT   gene            169451..170692
FT                   /locus_tag="Bphyt_4127"
FT   CDS_pept        169451..170692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4127"
FT                   /product="amidase, hydantoinase/carbamoylase family"
FT                   /EC_number="3.5.1.87"
FT                   /note="KEGG: bxe:Bxe_B0554 allantoate amidohydrolase;
FT                   TIGRFAM: amidase, hydantoinase/carbamoylase family; PFAM:
FT                   peptidase M20; peptidase dimerisation domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4127"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18511"
FT                   /db_xref="GOA:B2TEJ0"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010158"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEJ0"
FT                   /protein_id="ACD18511.1"
FT                   /translation="MVRIDPDRLLSDLKQLRSFGATGPGVVRLALSPVDLASREWLAGR
FT                   MTEAGLEAAIDGVGTVFGRSRKSGPALVIGSHTDTQPTGGWLDGAMGVIYGLEIARALA
FT                   ENEATRHLAVDVASWIDEEGTFSGLLGSRSFVGENVDETIRDATNRQGQRLADVLATAG
FT                   LAGRPRARFEPGRQVAYLEPHIEQGGRLEAAGKSIGVVTTIVGLRELRLRFTGQRNHAG
FT                   TTPMAIRRDAGAALVAFIPQMNEAFAQLADADTVWTVGRIDLDPGSLSVVPGAAQMYLQ
FT                   FRDANAARLQAMEDRLAQLVRDFNARSSISVELTTIDEPMQPVTMHTVLADHLARAAEA
FT                   VAPGQWIRMPSGAAHDAQVIARCMPACMMFVPSIGGVSHDFIEDTAEAHIVLGCQVAAT
FT                   AAAAMLEEQWAKRS"
FT   gene            170674..171555
FT                   /locus_tag="Bphyt_4128"
FT   CDS_pept        170674..171555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4128"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   bam:Bamb_3914 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4128"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18512"
FT                   /db_xref="GOA:B2TEJ1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR041496"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEJ1"
FT                   /protein_id="ACD18512.1"
FT                   /translation="MGETVVSESGDFVVRTMSAGDVALALEWAAQEGWNPGLHDAECFR
FT                   TADPHGFFIGEWRGEPVACLSAVAYGEDFGFIGLYIVKPAFRGRGFGMRVWQHGMDYLR
FT                   NRNVGLDGVVAQQANYRKSGFQLAYRNIRFQGVAQDIVQGEPYADLLHASALPFESLND
FT                   YDRQCFPAARERFLAAWLAQPGVMTRVARVAVRNGQVAGYGVLRRCLTGYKIGPLFADS
FT                   NEIAARLFSALTSSIAGDLFFFDVPEINADAIALAERHGMTSVFETARMYTREQPAISI
FT                   ERVFGVTSFELG"
FT   gene            complement(171643..171948)
FT                   /locus_tag="Bphyt_4129"
FT   CDS_pept        complement(171643..171948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4129"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0555 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4129"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18513"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEJ2"
FT                   /protein_id="ACD18513.1"
FT                   /translation="MRMLLNIRIPHEPFNTMVREGTVGQVIGKILEEIKPEAVYFTEQS
FT                   GARGAVVVVDIDNASAIPALAEPWFLKFNADCELRIAMLPEDLQKAGLENLGSKWK"
FT   gene            complement(172109..172741)
FT                   /locus_tag="Bphyt_4130"
FT   CDS_pept        complement(172109..172741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4130"
FT                   /product="methylated-DNA/protein-cysteine
FT                   methyltransferase"
FT                   /note="TIGRFAM: methylated-DNA/protein-cysteine
FT                   methyltransferase; PFAM: methylguanine DNA
FT                   methyltransferase ribonuclease domain protein;
FT                   Methylated-DNA-[protein]-cysteine S-methyltransferase DNA
FT                   binding; KEGG: bxe:Bxe_B0556
FT                   methylated-DNA-(protein)-cysteine S-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4130"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18514"
FT                   /db_xref="GOA:B2TEJ3"
FT                   /db_xref="InterPro:IPR008332"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR023546"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEJ3"
FT                   /protein_id="ACD18514.1"
FT                   /translation="MTYAYKLMDSPVGQLKLVANGERLAAILWEHDKPNRVRLGELIEA
FT                   NDRPVLIETERQLNEYFAGTRHEFDLPLTFQGTDFQKQVWAALLTIPFGQTRSYSEIAT
FT                   QIGNVNAVRAVGAANGKNPISIVAPCHRVIGASGDLTGFAGGLANKMLLLSLEAGQTSF
FT                   EAEADGQTDMFALEQRATVKTQVKSEAQTKPARHAPSRGTQASLFGN"
FT   gene            173034..174371
FT                   /locus_tag="Bphyt_4131"
FT   CDS_pept        173034..174371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4131"
FT                   /product="serine/threonine protein kinase"
FT                   /note="SMART: tyrosine protein kinase; serine/threonine
FT                   protein kinase; leucine-rich repeat-containing protein
FT                   typical subtype; Protein kinase ATP binding, conserved
FT                   site; KEGG: bxe:Bxe_B0557 serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4131"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18515"
FT                   /db_xref="GOA:B2TEJ4"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001245"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEJ4"
FT                   /protein_id="ACD18515.1"
FT                   /translation="MTTTLDHLRAGQLAGTRRLKLACGLTEFPREIFDLADTLEVLDLS
FT                   GNALTSLPDDLPRLRKLRILFGSDNPFTELPEVLGQCSQLSMVGFKANRIRHVSGKALP
FT                   PQLRWLILTDNEIEVLPAEIGRCSQLQKLMLAGNRLRTLPEELAACSQLELLRLAANQL
FT                   DGLPDWLLRLPRLSWLAYAGNPFSEALEAAALTDTPSVAIAWHDLKLDAPLGEGASGVI
FT                   YRAELAGRHGASRSVAVKLFKGAVTSDGLPDCEMAACIRAGDHTNLIPVAGKVKDHPAG
FT                   THGLVMELIDPQFTNLAGPPSLESCTRDIYDADTRFDMASALGIAYGIASAACHLHEQG
FT                   IMHGDLYAHNILYGGEGRALLGDFGAASFYALGDRRIGLALQRLEVSAYGCLLEELLER
FT                   CDWPEASANIRALLVELKDNCLSEAIDSRPLFDEITARLLALMGDR"
FT   gene            174451..175440
FT                   /locus_tag="Bphyt_4132"
FT   CDS_pept        174451..175440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4132"
FT                   /product="periplasmic binding protein/LacI transcriptional
FT                   regulator"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; KEGG: bxe:Bxe_B0558 ABC sugar
FT                   transporter, periplasmic ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4132"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18516"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEJ5"
FT                   /protein_id="ACD18516.1"
FT                   /translation="MMQKTPRSMPSWRMRRRVVIAGALAAAGIGGAADAAATPGGKLKI
FT                   ALVLKSLGDPFTIAMASAAQNYQQHYASQFDLTVRGTATESDTTGQIRMVEEMIKAKMN
FT                   AIVIAPTDSKALTAVVARAIKAGVIVVSIDNPLDEAFQDAAGISVPFVGPNNRKGAQQV
FT                   SNYLAERLKTGDQVGVIEGSSADRNAQQRTDGCRDAMNAAGINIVAVQTGDWEYGKGRD
FT                   AASKMLSEHPQIRGLMCGNDNMAMGAVDAVRDAGRTGGVYVTGYNDIDAIKPLIADGRV
FT                   LATVNQFAARQAVFGVDVALKAVTEQRKQSELSSVIETPLQLVTAANH"
FT   sig_peptide     174451..174558
FT                   /locus_tag="Bphyt_4132"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.947 at
FT                   residue 36"
FT   gene            complement(175511..175942)
FT                   /locus_tag="Bphyt_4133"
FT   CDS_pept        complement(175511..175942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4133"
FT                   /product="PRC-barrel domain protein"
FT                   /note="PFAM: PRC-barrel domain protein; KEGG: bxe:Bxe_B0559
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4133"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18517"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEJ6"
FT                   /protein_id="ACD18517.1"
FT                   /translation="MKAKTLICATALAAICASQGAYAQIAGLQPLGGTVEQTNALLKGW
FT                   SVRRALVDEPVYNDLNDKIGSIYDVIISPDRKATYAVVSVGGFLGMGKHYVAIPVDHFE
FT                   IRDGNLFLAGATKDALKSVPEFEYNKLEKATKPRKVKAE"
FT   sig_peptide     complement(175871..175942)
FT                   /locus_tag="Bphyt_4133"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 24"
FT   gene            176204..177379
FT                   /locus_tag="Bphyt_4134"
FT   CDS_pept        176204..177379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4134"
FT                   /product="glycosyl transferase family 9"
FT                   /note="PFAM: glycosyl transferase family 9; KEGG:
FT                   bxe:Bxe_B0560 putative heptosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4134"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18518"
FT                   /db_xref="GOA:B2TEK0"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEK0"
FT                   /protein_id="ACD18518.1"
FT                   /translation="MGWKSLLIETPVWLMGRFYPPRFDPSRDTPREILVLRPNDFGELL
FT                   TTTPLFEALRKRFPTTRLIAGVGSWGRPILENNPFVDEIVEIDAPWNNKLVEDRSHGNV
FT                   LRFLWKSPQVIALRARGGFDVGIDVLGSYMGALLMMRTGVRYRIGVRGYRGGWSGCQAF
FT                   IEFAARQCGRAALAQGELIGATALPEARPQLFLTDDERATASQIWSAGNVPGRRTVRLI
FT                   VGVGAGVATKAWDARQVGAALARIAQTLEQAGDACDIVIVGSKADQARAVEAIAAAGSG
FT                   VPVRSLAGEVPMRVMFALAEEANVVLTNSTMLMHVAAAFRRPTVAVIGGSITRPDRHDA
FT                   IWGYPPPYRSVSPEQYVAGEPARNWPSVERVVQAVLEAVATQQRAQVDAAA"
FT   gene            177481..177885
FT                   /locus_tag="Bphyt_4135"
FT   CDS_pept        177481..177885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4135"
FT                   /product="protein of unknown function DUF1486"
FT                   /note="PFAM: protein of unknown function DUF1486; KEGG:
FT                   bxe:Bxe_B0561 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4135"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18519"
FT                   /db_xref="GOA:B2TEK1"
FT                   /db_xref="InterPro:IPR009959"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEK1"
FT                   /protein_id="ACD18519.1"
FT                   /translation="MDTPDLYKLYRDYIGCLNKQDWPNLGQYVDDDVHYNGQRIGLSGY
FT                   REMLERDFREIPDLYFNIQLLISDPPYIASRLGFVCTPVGTFLGLAVNGKRVSFTENVF
FT                   YQFRNGKIEQVWSVIDKAAIEAQLESPGAA"
FT   gene            complement(177919..179145)
FT                   /locus_tag="Bphyt_4136"
FT   CDS_pept        complement(177919..179145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4136"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: bja:blr2205 putative dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4136"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18520"
FT                   /db_xref="GOA:B2TEK2"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEK2"
FT                   /protein_id="ACD18520.1"
FT                   /translation="MKRIVVIGAGFAGLWSAIGAARKLDELRVPADQVEMVVVNGTPYH
FT                   SIRVRNYEQNLDETRVPLADVLGPIGVRLVEGEVSGIDSANGRIAVQTQGPTQTLPYDR
FT                   LVIAAGSQLVHPDIPGLTEHAFDVDTFSGAAKLATHLRGLPSLANAASPFTAVVVGAGL
FT                   TGIELAAELPARLRGIAGDAHRDAVHVVLADRSAKIGQAMGGAQPVIERAMDALGVEML
FT                   AGVSLQSVDADGVELTNGRRIDAATVIWCGGMRANALTAQIPVTLDPFGRLPVDAFMRV
FT                   ENVPHVFAAGDCARVLIDGARPSVMSCQHSRPMGRYAGHNVVCDLLGGEMLPLHIDWYT
FT                   TILDLGPWGAVYTEGWDRHLVSEGDAAKATKQTINCIRIYPPRTRLRDDILQAAAPVVQ
FT                   TPPPTAAAR"
FT   sig_peptide     complement(179080..179145)
FT                   /locus_tag="Bphyt_4136"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.840) with cleavage site probability 0.307 at
FT                   residue 22"
FT   gene            179375..179836
FT                   /locus_tag="Bphyt_4137"
FT   CDS_pept        179375..179836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4137"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; KEGG:
FT                   bcm:Bcenmc03_1671 transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4137"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18521"
FT                   /db_xref="GOA:B2TEJ7"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEJ7"
FT                   /protein_id="ACD18521.1"
FT                   /translation="MKSTDQPASTDVKLSDFLCFAVYSANLAFGKAYKPILEELGLTYT
FT                   QYITIIALWEEDNQTVSSLGEKLFLESNTLTPILKKLEAAGYVERQRDPEDERQVRVGL
FT                   TKSGRRLREKGLNMDLVEATGLAPDEFSKVQKAIVTLRNNLVKAVQNGG"
FT   gene            complement(179969..180475)
FT                   /locus_tag="Bphyt_4138"
FT   CDS_pept        complement(179969..180475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4138"
FT                   /product="peptide methionine sulfoxide reductase"
FT                   /EC_number="1.8.4.11"
FT                   /note="TIGRFAM: peptide methionine sulfoxide reductase;
FT                   PFAM: Methionine sulfoxide reductase A; KEGG: bxe:Bxe_B0562
FT                   methionine sulfoxide reductase A"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4138"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18522"
FT                   /db_xref="GOA:B2TEJ8"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEJ8"
FT                   /protein_id="ACD18522.1"
FT                   /translation="MTTQTETAILAGGCFWGMQDLLRRYPGVLSTRVGYTGGDVPNATY
FT                   RNHGTHAEALEIVFDPSQISYRKILEFFFQIHDPTTKNRQGNDTGMSYRSAIFYLDDEQ
FT                   KRVAENTIADVEASDLWPGKVVTEVAPAGPFWEAEPEHQDYLERIPNGYTCHFVRPNWK
FT                   LPERG"
FT   gene            complement(180519..180611)
FT                   /pseudo
FT                   /locus_tag="Bphyt_4139"
FT   gene            complement(180638..180910)
FT                   /locus_tag="Bphyt_4140"
FT   CDS_pept        complement(180638..180910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4140"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A2488 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4140"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18523"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEJ9"
FT                   /protein_id="ACD18523.1"
FT                   /translation="MKTKFVAALLLALSASAAAPAFASGYGPAPFYRPSVGAPASQRGQ
FT                   SAQTVAASNDDAGAAQAAYGGVVSGQSESASRVALAPRDNLYARH"
FT   sig_peptide     complement(180839..180910)
FT                   /locus_tag="Bphyt_4140"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.992 at
FT                   residue 24"
FT   gene            complement(180996..181421)
FT                   /locus_tag="Bphyt_4141"
FT   CDS_pept        complement(180996..181421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4141"
FT                   /product="OsmC family protein"
FT                   /note="PFAM: OsmC family protein; KEGG: reh:H16_A1665
FT                   predicted redox protein, regulator of disulfide-bond
FT                   formation"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4141"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18524"
FT                   /db_xref="GOA:B2TEK3"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR019953"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEK3"
FT                   /protein_id="ACD18524.1"
FT                   /translation="MTKIEKVLLTGKTHTTFSGRGGRVDLNLSAGKGAGADITFPAVEA
FT                   HPTAEQLFAGAWSACYISAIGLVAQAKKVTLPSDLSVDIEVDLGMTGDAYLLQARFNVS
FT                   VPGVAREVAEAIAHEAHQICPYSKATRGNIDVVVNVA"
FT   gene            181701..182837
FT                   /locus_tag="Bphyt_4142"
FT   CDS_pept        181701..182837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4142"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0563 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4142"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18525"
FT                   /db_xref="GOA:B2TEK4"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEK4"
FT                   /protein_id="ACD18525.1"
FT                   /translation="MIPEDDRKIDADAQNRAASDGIRGEAAGEGGRGVIRSAATWLEQL
FT                   DPGTHRRIKGLRLVTAYGIAAALGTLQDVTHGLPGATLVGSLAGNFALWASVSEARVSR
FT                   PESSRDLAFLCAAAVLGAAMFIAFAPILQTLGAAGPELTLVTGAFLVGYLKRFGILGAG
FT                   MGSQIFIGQLLAYNIHLTPVDMPAVLVAGLIAMLASIVPRLLSGPAERPALTVLSPVDM
FT                   PDRWKLSAELIMGLQAASGALVVVVLNETIGLKESAWAITASTYVVAGSASGTAERVRR
FT                   RIIGTLVGVPLGLACLPLVEHVPLLAWAAVAAAMIIYAMALPERYDIACGAFAVTLIVT
FT                   LAIGGVHSISFLGARAWETLLGGVVGLLAAKFIFPLRV"
FT   gene            complement(182877..183788)
FT                   /locus_tag="Bphyt_4143"
FT   CDS_pept        complement(182877..183788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4143"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bam:Bamb_1614 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4143"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18526"
FT                   /db_xref="GOA:B2TEK5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEK5"
FT                   /protein_id="ACD18526.1"
FT                   /translation="MQRQFEDVLLGSIELFCLAAELESFTEAANAASVTPAAVSRTVAR
FT                   LEERLGVRLFVRTTRQIRLTDAGRRYFEQCRLALAQLAEAEREATGQQTAPTGVLRISM
FT                   PTPYGHYRVLPLLAEFRQRYPGVTVETHLSNRNIDFGEEGFDLAIRGAAPGDSGLIART
FT                   IEDAELVVVASPAYLRGAAKLKTPDDLVHHDCVQYALPSTGRNLPWLFKVEDEVVETMT
FT                   SGGYTSSGDVLAGATLARHGAGIFQTYRFIVEKDIAAGTLKELLIPYGGCSRPFVLLYP
FT                   HARHLSSRVRSFVDFLMEKLGS"
FT   gene            183954..185054
FT                   /locus_tag="Bphyt_4144"
FT   CDS_pept        183954..185054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4144"
FT                   /product="2-nitropropane dioxygenase NPD"
FT                   /note="PFAM: 2-nitropropane dioxygenase NPD; KEGG:
FT                   bur:Bcep18194_A4869 2-nitropropane dioxygenase, NPD"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4144"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18527"
FT                   /db_xref="GOA:B2TEK6"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2TEK6"
FT                   /protein_id="ACD18527.1"
FT                   /translation="MTDQTGKRALLPLLGIDKPIIQAPMAGVSTPALAAAVCNAGGLGS
FT                   LGVGAMNADGARKVIRETRALTDKPFNINVFCHRPAQADAAVEQQWLSWLAPHFEKYGA
FT                   TPPAKLSDIYTSFLADPAMLAVFLEEKPAIVSFHFGLPSADVIAELKKAGIRLLASATN
FT                   LQEAAQVEAAGVDAIVAQGIEAGGHRGVFDPDAFDDRLGTFALTRLLAKECRLPVIAAG
FT                   GIMDGAGIAAALALGAQAAQLGTAFVACTETSIDEGYRRALLGEAARRTTFTAAISGRL
FT                   ARSMANSFTALGADPRSPEPATYPIAYDAGKALNAAAKAKGEFGYGAHWAGQAAALARS
FT                   LPAAELVAQLERELKQSIEQLRQFAN"
FT   gene            complement(185095..185331)
FT                   /locus_tag="Bphyt_4145"
FT   CDS_pept        complement(185095..185331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4145"
FT                   /product="4-oxalocrotonate tautomerase"
FT                   /note="PFAM: 4-oxalocrotonate tautomerase; KEGG:
FT                   smd:Smed_3914 4-oxalocrotonate tautomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4145"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18528"
FT                   /db_xref="GOA:B2TEK7"
FT                   /db_xref="InterPro:IPR004370"
FT                   /db_xref="InterPro:IPR014347"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEK7"
FT                   /protein_id="ACD18528.1"
FT                   /translation="MPIVTIQVTREGSKPGTNAVTADEKARLIAGVSQVLLDVLNKPLA
FT                   ATFVVIEEVDMENWGWGGLPVEAYRKQLAQKPG"
FT   gene            complement(185392..186102)
FT                   /locus_tag="Bphyt_4146"
FT   CDS_pept        complement(185392..186102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4146"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: reh:H16_B1786 short-chain alcohol
FT                   dehydrogenase of unknown specificity"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4146"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18529"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEK8"
FT                   /protein_id="ACD18529.1"
FT                   /translation="MSTSQKVVVVTGASQGIGAELVNAFRKLDYRVVATARSVKPSEDP
FT                   NILTVAGDIGEPATAQRVIREAIARFGRIDTLVNNAGIFVAKPFTSYTAEDYAKVTAVN
FT                   LNGFFFITQLAIAEMEKHGSGHVVSISTSLVDHAIDGVPSVLASLTKGGLNAATKSLAI
FT                   EYAKKGIRANAVAPGIIKSPMHAEETHAALGALHPVGHMGEMSDIVNAVLFLDSAPFVT
FT                   GEILHVDGGQSAGH"
FT   gene            complement(186321..187484)
FT                   /locus_tag="Bphyt_4147"
FT   CDS_pept        complement(186321..187484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4147"
FT                   /product="Patatin"
FT                   /note="PFAM: Patatin; KEGG: reu:Reut_A0386 patatin"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4147"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18530"
FT                   /db_xref="GOA:B2TEK9"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR021095"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEK9"
FT                   /protein_id="ACD18530.1"
FT                   /translation="MSNETHVEHQTGASDTPHSPPDIPGQIVLVFQGGGALGAYQAGVY
FT                   QALHDGKVEPHWVIGTSIGAINGAIIAGNLPENRMARLTRFWNGVARQGMEAANWLPGL
FT                   ANWLRDFVTVTQGVPSFFTPQLQSWAGLQARVRSDQAAFYSTGPLRETLASLVDFDYLN
FT                   QKTTRLTVGTVNVRSGRMRYFTNRDALLDVEHVMASAAFPPGFPAVQLEGESYWDGGIY
FT                   SNTPLEAVLDDRPRRDSVIFSVQLWPSSGPEPESILQVMSRQRDIQYSSRAESHLDRQK
FT                   QIHRLRHVIRELGQHLPEAARNDPQVRELLGWGCGTTMRVLELDAPAFDNDDLNRDIDF
FT                   SSAGIERRWLAGYEDTVRLLKRAPWRETLDPMEGLSVFRMASAESQQ"
FT   gene            188110..189792
FT                   /locus_tag="Bphyt_4148"
FT   CDS_pept        188110..189792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4148"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein;
FT                   OmpA/MotB domain protein; KEGG: rme:Rmet_1701 secretion
FT                   protein HlyD"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4148"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18531"
FT                   /db_xref="GOA:B2TEL0"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEL0"
FT                   /protein_id="ACD18531.1"
FT                   /translation="MIRRTHVFAACLVLTAFATLSGCHEKEAPAAARPPVNVGVVDIAL
FT                   RDVPVVFDYVGQTESSQQVEIRARVNGFLEKRVYQEGSMVHQGDVMFVMDRKPFQASLD
FT                   AARAEFAQQKARLDTAQANLNRVRPLVAKNALSQKDLDDSIGQQQAAAAALEQARANVT
FT                   SANLNLGYTTITAPVTGLSSFAKKQDGSYIDSTNSLLTYVAKLDPMWINFSLSENEMLQ
FT                   LRTQTANGTLKLPQIDDLEAVIVLADGSIYPQRGHIAFRDASLSSETGTYLIRAAVPNP
FT                   DGALRPGQFVRIKLLGAERSAAVAVPQGAILQGPRGEYVWTVDKDNKAQQRAIETGEWN
FT                   GNDWVVNSGLRVGDRVVIDNTLRLMPGAAVNAHVVPMPAASVNIAALSGGGAGPAGGGG
FT                   GGTSSNAASVAGQTDASAASGTVNGAAGASANAAAQANPKGTSANATNPSALPAGQTAV
FT                   FFALGSASLDSQSADALAGVARRLLAAPGSRAVISGYTDSSGSYEANVKLAAARAATVR
FT                   SALIVAGVDVARIDMRRPARIVASDAPDKSRRVDVTLAPSTGG"
FT   sig_peptide     188110..188187
FT                   /locus_tag="Bphyt_4148"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.763 at
FT                   residue 26"
FT   gene            189796..192963
FT                   /locus_tag="Bphyt_4149"
FT   CDS_pept        189796..192963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4149"
FT                   /product="transporter, hydrophobe/amphiphile efflux-1
FT                   (HAE1) family"
FT                   /note="TIGRFAM: transporter, hydrophobe/amphiphile efflux-1
FT                   (HAE1) family; PFAM: acriflavin resistance protein; KEGG:
FT                   rme:Rmet_1702 hydrophobe/amphiphile efflux-1 HAE1"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4149"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18532"
FT                   /db_xref="GOA:B2TEL1"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004764"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEL1"
FT                   /protein_id="ACD18532.1"
FT                   /translation="MKFAHFFIDRPIFASVLSIILVVAGTVAMFNLPIAQFPDIAPPTI
FT                   TVSATYPGASAEVVAQNVAAPLEQQVNGADNMMYMNSSSSSTGNMTLTAYFNIGTDPSL
FT                   AQVDVQNRVNLALPTLPDSVTAQGVSVQKRSSAFMMVIAIYSPDNAFDQSYVANYANVY
FT                   VLDALKRIPGANQASIFGSADYAMRIWIKPDRMAKLSITVADVQQAISNQNQQFSAGRL
FT                   GQSPTNAPVQQTFPVATKGRMTKPADFDNIILRAGSGDASTIRIKDIGHAELGAKDYSL
FT                   RGRYNGKTATLIAVYQQPGANALQVAKQVHATLEQLQKAFPPGLKYEVALDTTEFVQES
FT                   IGEVIHTLRDAVILVILVVFIFLQSFRATLVPLLAVPVSILGAFIGMLVFGFSVNMLTL
FT                   FGMVLAIGIVVDDAIVVIENVERNMTEFGLPPKEAAKHAMDEVTGPVIAIVLVLLAVFI
FT                   PVAFLSGITGQLYKQFAVTIAVSVVISGIVALTLSPALAAILLKPGTHKKNRFFLWFNK
FT                   RFDRLTQGYGRAVQLAIRRVALSILLIVAMVAATAGLFKHIPSSFLPTEDQGYLLGAVV
FT                   LPDAASLDRTGNLSQRAEQWFAKQPAVKSVAAPIGYSLIDSQYKSNAGTLFITLKGFKD
FT                   RGENGTAQDLIRDANKAFSGYTDGVVVPLNPPSIPGLGTTGGFEFWLQSTGDGSYQNLE
FT                   EKVRAFIAKARQNPALRGVNSTINTNSRQLLVEVDRERAESLGVPIQDIYAALQTMFGS
FT                   SYVSQFPKSSRLFQVIVQAEPQYRTQPDDIQQLYVRNRSGDMVPIKAVTTVRFVPGADI
FT                   VTRFNNFPAAKITGDAAPGHSSGESIAAMEQIAHEVLGEGYSYAWSGQAYEEKQAGSTA
FT                   ILVFGFALLMVFLILAAQYEKWSLPIGVLLAVPFAIFGALIGILLRGMEDDVYFQIGLT
FT                   VLIALAAKNAILIFEFAVEMREKEALSPYDAALKAAKLRLRPIIMTSLAFILGCVPLAI
FT                   ASGASAASRRSLGTGVIFGMLGATVIALFFIPMFFWGLETLSSRGKKAPAPDAGPPVSP
FT                   GPREGGT"
FT   gene            192960..194378
FT                   /locus_tag="Bphyt_4150"
FT   CDS_pept        192960..194378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4150"
FT                   /product="RND efflux system, outer membrane lipoprotein,
FT                   NodT family"
FT                   /note="TIGRFAM: RND efflux system, outer membrane
FT                   lipoprotein, NodT family; PFAM: outer membrane efflux
FT                   protein; KEGG: rme:Rmet_1703 RND efflux system, outer
FT                   membrane lipoprotein, NodT"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4150"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18533"
FT                   /db_xref="GOA:B2TEL2"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEL2"
FT                   /protein_id="ACD18533.1"
FT                   /translation="MRFPRCRLLAAVCACWFAGCTVGPDYHRPAVDTPSSFRYASPDAE
FT                   VVDQGAVQWWSQFNDPVLDGLIQRALDQNKDLAIAAARVDEFYGRLMTTRAGLFPQVGA
FT                   NFGGGRGRSVPAPGFAPAVGNQVQLDVMASWEIDLFGRLRRLTEAARADYLGTQAAQQA
FT                   TRIALISSVATSYLLLRDLDQRLEIAKSTLASRADALSLFQERFTGGVVSQLQVSQAKS
FT                   EYESAQASVYAFQQQIAQQENALSLLLGDNPGPIPRGKPLTQLSAPAIPAGLPSSLLER
FT                   RPDILQAEQALVSANASIGAARAQYFPSISLTGMFGAASTALSGLWTGPARIWSFAGAI
FT                   SQPIFTGGAITGSVRTAEAQQQEALFSYEQAIQSAFADVENALVGVARVRDQLQATNRQ
FT                   VEALAQYASLARDLYEGGYTSYLEVLDAERSLFNAQLQQSQLQDQQLAEIVALYKALGY
FT                   GWNVDSGSQTPTRG"
FT   sig_peptide     192960..193028
FT                   /locus_tag="Bphyt_4150"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.657) with cleavage site probability 0.549 at
FT                   residue 23"
FT   gene            complement(194405..194839)
FT                   /locus_tag="Bphyt_4151"
FT   CDS_pept        complement(194405..194839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4151"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0566 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4151"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18534"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEL3"
FT                   /protein_id="ACD18534.1"
FT                   /translation="MLCFSLLIAHVAKVFTPMPSSVRNSLIWIFDAFERDPTFISKRMF
FT                   GSDAAYIDGLLCLIAADRDKPWNGLLVCTSHERHAALIHEMPALRPHPVLGKWLYIAQD
FT                   DPAFESAAEELTALVLARDPRIGVEPKPRARGKKSKLPKA"
FT   gene            complement(194862..195305)
FT                   /locus_tag="Bphyt_4152"
FT   CDS_pept        complement(194862..195305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4152"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0567 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4152"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18535"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEL4"
FT                   /protein_id="ACD18535.1"
FT                   /translation="MESHPFRVLAALLVSSAGFCPAVSHAYALDAQFDCQARPHTFITQ
FT                   LIDDNYIESKPMRVDKNSVNAFRPVHGSDMTVFGFRVYAVLGYEPDDDMFKKGRGQALA
FT                   GPLYGVVLSAPSESVETRVRAAGSTAKVHSVIPLLLTALICTD"
FT   sig_peptide     complement(195225..195305)
FT                   /locus_tag="Bphyt_4152"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.896 at
FT                   residue 27"
FT   gene            complement(195477..196301)
FT                   /locus_tag="Bphyt_4153"
FT   CDS_pept        complement(195477..196301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4153"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0568 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4153"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18536"
FT                   /db_xref="GOA:B2TEL5"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR039556"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEL5"
FT                   /protein_id="ACD18536.1"
FT                   /translation="MSRTVAEKRAAFKALHTSGCFILPNPWDAGSARYLHTLGFQALAT
FT                   TSSGFAWSTGHADNSLPRDAILTHLRKIVEATDLPVNADFENGFGSTPNEVAESVRLAI
FT                   ETGVAGLSIEDSTGNAAAPLFSIEVAVERISAARRAIDENGGDTLLVGRAENFFAGSPD
FT                   LDDAIARLKAYSEAGADCLYAPGIQTREQIEAVVAAVAPKPVNLLIGSTSPFTLQDVAA
FT                   LGVRRISVGGALARAAWGGFMQAAQSLAQGRFDGFAGAAPGSLLNELFEKRG"
FT   gene            complement(196631..197530)
FT                   /locus_tag="Bphyt_4154"
FT   CDS_pept        complement(196631..197530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4154"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bxe:Bxe_B0570 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4154"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18537"
FT                   /db_xref="GOA:B2TEL6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEL6"
FT                   /protein_id="ACD18537.1"
FT                   /translation="MELKLLRAFLTVAELRHFGHAAEALYVSQPALSKQIVALEASLGA
FT                   RLFERGRHGAELTIFGEGFLADAEALVRDADNILARAREASSGTRGYLRVGLGLSTLTE
FT                   APQLIAQFRKLHPNVSVTLNDLSSAEQSRRLLGGKLDVGFLRLPADAGLSTLPILDEAL
FT                   ALAIPQYARWKRVPSNLQELNEPGFIALSRGRGPGLAAQIDHWCGEHGFVPKVIQQADD
FT                   IQSVLAGVAAGVGAAFLPSRAQYLLRDARVLPLRDAAARWRVALAWQTTRDDPVVANFV
FT                   AFVRAAKKSLRAGSAAPG"
FT   gene            197662..198579
FT                   /locus_tag="Bphyt_4155"
FT   CDS_pept        197662..198579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4155"
FT                   /product="Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase"
FT                   /note="PFAM: Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase; KEGG: bxe:Bxe_B0571 putative
FT                   carbon-nitrogen hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4155"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18538"
FT                   /db_xref="GOA:B2TEL7"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEL7"
FT                   /protein_id="ACD18538.1"
FT                   /translation="MSLVSRPGDAAHNVARIADCLALAAKKEVGLVVFPETCVGGYASM
FT                   AKLHRAELDALAEPLDGPSIRAVADAVEGSGVAAGVGFLERAADDRLFNSYVVCLPGGM
FT                   RHCHRKLHAFGHRRISSGDRFTVFDTAWGVRVGILIGGDNYLVENMRMTALMGATLLIA
FT                   PHRSDGANRTGDRRTQAGSIGQSLPRLLSARAGDNGMFVVFSDGVEISGSGQSSGAAMI
FT                   VDPCGRILAASRARDALVSADLDRGLIDGSAGQQWLTARRPELYGLLTRSGDHRAADFE
FT                   PRGATSRGAIALSFAQVSRNRPIR"
FT   gene            complement(198610..199482)
FT                   /locus_tag="Bphyt_4156"
FT   CDS_pept        complement(198610..199482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4156"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bxe:Bxe_B0572 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4156"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18539"
FT                   /db_xref="GOA:B2TEL8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEL8"
FT                   /protein_id="ACD18539.1"
FT                   /translation="MEHVDWDDLRILVAIAREGTMRSAAAACDLSAPTLSRRLTELERR
FT                   LGEPLIDRVPSGCSVTAFGAKVLAWAEQMEDLAHQIERAADVNGGAPAHGTVRINAVEW
FT                   PSYILLKLLGSFQDRLPGLAIEVLTSRRPYSLARREADIALWSECPEEGDLYVRRIGKI
FT                   RFGLFGSRDYYLRHKAAIVKKEWDKLSFVGYDDRQPDHPATQWLKALPGAPAPSLRSSY
FT                   GMGVFDGVLGGSGLGILAQLAGDTTSDLVCVEKHIKALDQDVWMVLHPALRDSERIRTV
FT                   ANLIAEIFR"
FT   gene            199674..200639
FT                   /locus_tag="Bphyt_4157"
FT   CDS_pept        199674..200639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4157"
FT                   /product="periplasmic binding protein/LacI transcriptional
FT                   regulator"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; KEGG: bxe:Bxe_B0573 ABC sugar
FT                   transporter, periplasmic ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4157"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18540"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEL9"
FT                   /protein_id="ACD18540.1"
FT                   /translation="MIRHFLPARRRAIAAGAAFLAVSILPMPAAFAQAAHKPKVALVMK
FT                   SLANEFFLTMETGAKDYQKQNPAKFDLVTNGIKDETDTANQIRIVEQMIVSKVDALVIA
FT                   PADSKALVPVLKKAVDAGIIVVNIDNKLDNDVLKSKDLNIPFVGPDNAKGAQKVGDYLA
FT                   KHLKSGDNVGIIEGVTTTTNAQQRTAGFKQAMAAGGMKVVALQSGEWEIDKGNAVASQI
FT                   LNANPDVKALLCGNDNMAIGAVSAVRAAGKAGKVQIVGYDDINAIKPMLKDGRVLATAN
FT                   QYAAKQAVFGIDTALKALSEHKKQSELSGVVETPVDLVTK"
FT   sig_peptide     199674..199772
FT                   /locus_tag="Bphyt_4157"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.895 at
FT                   residue 33"
FT   gene            200712..202325
FT                   /locus_tag="Bphyt_4158"
FT   CDS_pept        200712..202325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4158"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bxe:Bxe_B0574 ABC sugar transporter, fused ATPase
FT                   subunits"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4158"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18541"
FT                   /db_xref="GOA:B2TEM0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEM0"
FT                   /protein_id="ACD18541.1"
FT                   /translation="MSTPISSLADAAPVLRVHGIGKTYAEPVLADVSLDLHAGEVLALT
FT                   GENGAGKSTLSKIIGGLVTPTTGSMTLAGAAYTPASRKDAEALGVRMVMQELNLLPTLS
FT                   VAENLFLNRLPQRGIFGWIDRAKLREDARHAMAQVGLDAIDPDTLVGTLGIGHQQMVEI
FT                   ARNLIGDCRVLILDEPTAMLTAREVDLLFEQVERLKARGVALVYISHRLEELKRIARRA
FT                   AVLRDGRLVHVDEMANLTTDRLVTLMVGRDIGDRIDLGERRIGEMTFKVSGMTREPVVR
FT                   DVSFEVKAGEIFGISGLIGAGRTELMRLIYGADRADAGTVSIVREGGALEPVTIASPSD
FT                   AVKHGIALITEDRKGEGLLLTQPIAANISLGHLRSVSSKGVVDGRREASLARRQIDAMR
FT                   IRSSGPAQPVSELSGGNQQKVVIGRWLARDCTVLLFDEPTRGIDVGAKFDIYALMGALA
FT                   REGRALVVVSSDLRELMAICDRIAVMSAGRMTGLFERGNWTQDALLAAAFAGYAKRDDM
FT                   LHEPIEPDAKAPGESKLVEY"
FT   gene            202328..203329
FT                   /locus_tag="Bphyt_4159"
FT   CDS_pept        202328..203329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4159"
FT                   /product="Monosaccharide-transporting ATPase"
FT                   /EC_number="3.6.3.17"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   bxe:Bxe_B0575 ABC sugar transporter, inner membrane
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4159"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18542"
FT                   /db_xref="GOA:B2TEM1"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEM1"
FT                   /protein_id="ACD18542.1"
FT                   /translation="MTVETSLPTLQNEPPKNAKPLGTRLGLSNYLGLLGALLGMIVLFS
FT                   LLSSHFLTYDTFSTIANQIPDLVVMSIGMTFVLIIAGIDLSVGSVLALGAALTSVAALQ
FT                   WHWPALPAALLGMAGATLTGCVTGAITVAWRIPSFIVSLGVLEAARGLAYQLTNSRTAY
FT                   IGDAFDFLSNPVAFGISPAFIIAIVVMVAAQFVLTRTVFGRYLVGIGTNEEAVRLAGVN
FT                   PRPYKIAVFAMMGLLAGLASLFQISRLEAADPNAGQGIELQVIAAVVIGGTSLMGGRGS
FT                   VTSTFFGVLIISVLAAGLAQIGATEPTKRIITGAVIVVAVVLDTYRSRRRAG"
FT   gene            203468..204400
FT                   /locus_tag="Bphyt_4160"
FT   CDS_pept        203468..204400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4160"
FT                   /product="ribokinase"
FT                   /note="TIGRFAM: ribokinase; PFAM: PfkB domain protein;
FT                   Phosphomethylpyrimidine kinase type-1; KEGG: bxe:Bxe_B0576
FT                   putative ribokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4160"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18543"
FT                   /db_xref="GOA:B2TEM2"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011877"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEM2"
FT                   /protein_id="ACD18543.1"
FT                   /translation="MSKETKQGRVLVVGSINTDLVARAPHLPRPGETIGGHEFSQVAGG
FT                   KGGNQAVAAARIGAQVAMVGCVGKDANGAQRVKDLEAEGIDCSGIEVHPGQPTGVAMVT
FT                   VSDDGQNTIVVVAGSNGELTPESVARHEAAIKACDVVVCQLETPWDSVHATLALARRLG
FT                   KITVLNPAPATGPLPAEWLPLVDYLVPNEVEAAILAGLPVESQSGARRAATELQQGGAR
FT                   NVIVTLGAQGAYLLVEGGEGMHFPAPQVQAVDTTAAGDTFIGVFAAQLASRQPLESAIS
FT                   LAQRAASISVTRAGAQPSIPTRAEVDSAA"
FT   gene            204550..205626
FT                   /locus_tag="Bphyt_4161"
FT   CDS_pept        204550..205626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4161"
FT                   /product="Inosine/uridine-preferring nucleoside hydrolase"
FT                   /note="PFAM: Inosine/uridine-preferring nucleoside
FT                   hydrolase; KEGG: sus:Acid_1342 inosine/uridine-preferring
FT                   nucleoside hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4161"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18544"
FT                   /db_xref="GOA:B2TEM3"
FT                   /db_xref="InterPro:IPR001910"
FT                   /db_xref="InterPro:IPR023186"
FT                   /db_xref="InterPro:IPR036452"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEM3"
FT                   /protein_id="ACD18544.1"
FT                   /translation="MMSLGLAACGGSISTTDPLANAPKVIIDSDFNTMGDDGQLFAMTT
FT                   QLMGQGKVNLLGLTVVTGNDWLLQEESDALKAVERMGVQNVVGVYGGADYPLRYDVASI
FT                   RAQQAANPNGYFGAWSRPEPTQQSQLVAPPDGFAVSTKLQAQGAADFMIQTIKRYPNQV
FT                   TILEVGPPTNLATAIMKAPEIVPLIKRIVYMGGAMAVPGNANAVGELNWWFDPLAVRTV
FT                   LQTSIPQAVIPLDVTNTVPLTQSVYDQIVNNPSKQTAVTRAYGIANAGAFASNTDLFDT
FT                   LTIAYFLDPTYATQTKSAYLDIDTVSGEDQGRVTVYPDQPAASASPQKITYVTQFDNNR
FT                   FFSLYVDLLTRPVPITLP"
FT   gene            206098..207810
FT                   /locus_tag="Bphyt_4162"
FT   CDS_pept        206098..207810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4162"
FT                   /product="putative CHASE2 sensor protein"
FT                   /note="KEGG: bxe:Bxe_B0577 putative CHASE2 sensor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4162"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18545"
FT                   /db_xref="GOA:B2TEM4"
FT                   /db_xref="InterPro:IPR007890"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEM4"
FT                   /protein_id="ACD18545.1"
FT                   /translation="MTTQKKKRGPKGEKVEGIEWLHLLGRAALSVLLGLALALVVPTRF
FT                   TEEMGAQTMARYAAPFSGYLFDIERGKAAAKDPVKWNKREITVLAIDREALRARGEGWP
FT                   ARYPFYSWLLGYLNKYRPTGLFIDVILSQPGNKDCNGSGKATGFSGFKKANACYCTNDI
FT                   DDFGDFRQAVTGLISSNVPVFLAARREPDNTLVTNAAIDSDSAFKSLRRVGVEFSAHSV
FT                   DRLAWTYPLVYAGKEPGDIQTTHPVAPSAAAPELLDSSKGQCTASAAFAIFSEVYETEK
FT                   KLIVPCNESKSMSITWPLDTAADGLLWQESADEESEARHGMPRILRADLGDDDEEMYCT
FT                   SSGNLSTLLKRAEVRALFRPSSRPLCVHYRTIHASQLERMSPEDLKKAFSNHFVMIGTS
FT                   FAYSNDLILSPLQDRIPGVFLHAVALDNLLSRGDKLENVEAWELDFHTSANRWGRLLSL
FT                   GAVGFGLIFFTVFLKKEARKKFARFHRERTHWRKPLHWHWWAAKGTTAAFNITLFVTSF
FT                   IVLVAFGVLMILLGNWMLVPFLLISHVLACTIAVEWLEWSEHLFNWITDSKED"
FT   gene            207813..208193
FT                   /locus_tag="Bphyt_4163"
FT   CDS_pept        207813..208193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4163"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0578 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4163"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18546"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEM5"
FT                   /protein_id="ACD18546.1"
FT                   /translation="MNKVRDTRPRLRHASLAAASLAMIAVTLGNVAAADEQPYIYAPQP
FT                   GATVKLYNSPGDKESAMDAPSLPLHATGPSQHQFYPVTVNGRSYWVNGLDVKVVRKAQA
FT                   QCSQSAGVQSAATLGAATNRCQ"
FT   sig_peptide     207813..207917
FT                   /locus_tag="Bphyt_4163"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.554 at
FT                   residue 35"
FT   gene            208268..209902
FT                   /locus_tag="Bphyt_4164"
FT   CDS_pept        208268..209902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4164"
FT                   /product="peptidase M48 Ste24p"
FT                   /note="PFAM: peptidase M48 Ste24p; KEGG: bxe:Bxe_B0579
FT                   putative Zn dependent protease"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4164"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18547"
FT                   /db_xref="GOA:B2TEM6"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEM6"
FT                   /protein_id="ACD18547.1"
FT                   /translation="MPGALSNLNLGGGSPKGPTLDTVGSIPPPPARDWPDIKLDLMNAR
FT                   ADGWGLVPMPEMEAYLNGLLATIKKTAGTPNYPGSVHIISEIGLNANSSAGGNIFVSIG
FT                   WLQSAESEDEIFAILSHEFGHIYLNHHAIFDARTAGDTSLAIVSLAWTVTNKSPTSNTW
FT                   TGVDNIAVVQTLGTRVLFPAWQRSVEEQADRFGATISLRCGYSYVDGFKAFFERVIAYD
FT                   QDAKARRQKLREKQLQAGREKAGQQAAAQARTQPIAPAVGGGAAQTVNQLTSIGELREA
FT                   VSQYTSARVGAQASVAESLFDARAVIDDQISAQLETLHDDHGDPAAREDNLTALVRPML
FT                   GDKLPDARTEPWNAARKRGSTPLILAHYKSISDMQDLQAAANYSQALQVATTIASGPTA
FT                   DHAYPVFLLSNMMTLSRSAPPDTQAQVLRRNLTSRDRSWAVQTNLANRIGQKDPKQGEA
FT                   FLLQQFDYFGRTSVTWPNVISWYREHGDINRAKQLATTCWTEHPEMRAACVAASQAPAQ
FT                   KKSDDQAGGFSKAVDKMLDQAKGLLPK"
FT   gene            210328..210588
FT                   /locus_tag="Bphyt_4165"
FT   CDS_pept        210328..210588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4165"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4165"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18548"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEM7"
FT                   /protein_id="ACD18548.1"
FT                   /translation="MTKFLRTTLIAGLIALPTAAFAQPATPIDEMQVEMVAYEVGGVDL
FT                   TQMSPHTAPAIAIGGTHANASPVELLHPGYDVGLKSIYLRH"
FT   sig_peptide     210328..210396
FT                   /locus_tag="Bphyt_4165"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 23"
FT   gene            complement(210607..211944)
FT                   /locus_tag="Bphyt_4166"
FT   CDS_pept        complement(210607..211944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4166"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; KEGG: pol:Bpro_3675
FT                   periplasmic sensor signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4166"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18549"
FT                   /db_xref="GOA:B2TEM8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEM8"
FT                   /protein_id="ACD18549.1"
FT                   /translation="MLKSLRNQLVIALGAVVSLFAILQGVSSYQFCVAGMSAVLDLRME
FT                   QVASRLRVGFGEGIPTVPARGSQDARDIFIVMWKDGETQPVRTTEPSLLLPRNAVEGFS
FT                   SPIVNGEGWRIYTARDGAQTVQVAQRLSVRHEIEETAATKTLWPIVVLIPLVWAAVIFV
FT                   VSRSLRELNRLGNKVRDIDVNHLQALPLARVPTELLPFIRSINLMIERLARSIESERKF
FT                   ISDAAHELRTPLTALQLQADNLQRDVMPSNQERFRALQGGIARSSNLISQLLRLARADA
FT                   PPVGQSMTRAMISVDVSAAVVNAISDVLPIAMQRGIDIGADEMVSAKVRAIELDIGTVI
FT                   KNLVSNAVRYTPDGGTIDLSTRVHDGMVSVEVKDTGSGIDETLLPRVFDRFFRANTDIE
FT                   GSGLGLSIVKAIVTRYGGTVTLRNRDDGQSGIVATVSLPIEPDGAG"
FT   sig_peptide     complement(211873..211944)
FT                   /locus_tag="Bphyt_4166"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.963) with cleavage site probability 0.369 at
FT                   residue 24"
FT   gene            complement(212053..212787)
FT                   /locus_tag="Bphyt_4167"
FT   CDS_pept        complement(212053..212787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4167"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: bxe:Bxe_B0580
FT                   putative transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4167"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18550"
FT                   /db_xref="GOA:B2TEM9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025996"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEM9"
FT                   /protein_id="ACD18550.1"
FT                   /translation="MKEATSRRKTSAPLKTPAPAHTSTDHASREKPYHHGALPHALLEA
FT                   AEVVLRRDGIRGLTLRAIAREAGVSHTAPQHHFGDTAGVLSELAASGHRRLAATMAEQA
FT                   DGIEAGQARRKAIARGYVSFAVANPDLLHLMSRNEMLDAQRPALVQARLASARALAGVV
FT                   IAPTDHAEEDKSSFGRITAAQATAMTAAWAYVHGLALLLIDGRLNALAASADGIRSAED
FT                   LVEAAIEHVQIVPAYPTGKGRK"
FT   gene            complement(212852..213016)
FT                   /locus_tag="Bphyt_4168"
FT   CDS_pept        complement(212852..213016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4168"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4168"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18551"
FT                   /db_xref="GOA:B2TEN0"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEN0"
FT                   /protein_id="ACD18551.1"
FT                   /translation="MVDVLEWLIDISVASANAAATGSIFLLLVGVAGETRRHVVKRREA
FT                   PQRNALARL"
FT   gene            213252..213458
FT                   /locus_tag="Bphyt_4169"
FT   CDS_pept        213252..213458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4169"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4169"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18552"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEN1"
FT                   /protein_id="ACD18552.1"
FT                   /translation="MEKKRSRISREALCPPIGALLRYQARIVRVVAEARGQRAMIESLD
FT                   TTGRTFVSTVKWNSLRELGAQLF"
FT   gene            213778..215289
FT                   /locus_tag="Bphyt_4170"
FT   CDS_pept        213778..215289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4170"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bxe:Bxe_C1350 ABC sugar transporter, fused ATPase
FT                   subunits"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4170"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18553"
FT                   /db_xref="GOA:B2TEN2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015861"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEN2"
FT                   /protein_id="ACD18553.1"
FT                   /translation="MTPLISVKRLSKRFPGVRALHEVQFELVAGEVHALMGENGAGKST
FT                   LMKILAGVYTRDTGEILYEGQPVDFQSPREAQAVGVGIIHQELQLMNHLTIAQNMFIGR
FT                   EPRGRLGLFLDEDKLNAQAHDILARMHVTLDPRALVSSLTVARQQMVEIAKALSFDSRV
FT                   LIMDEPTSALNDAEIAELFRIIRDLKKRGVGIIYISHKMDELKQIADRVTVLRDGEYVA
FT                   TVAVKDTTVQAIIGMMVGRTLTDAAPSQHIANQGEVALEVTRLNAGPLVRDVSFALRKG
FT                   EILGFAGLMGAGRTEVARAVFGADPIESGEIVVKGVKATIRNPSDAVARGIGYLSEDRK
FT                   RFGLATGMSVESNIVMSNLRKFLSLNFFLRRTQIRKTAAHFINLLAIRTPSATQEVRLL
FT                   SGGNQQKIVIAKWLERDCDVLFFDEPTRGIDVGAKSEIYKLLRSLADQGKAIVMISSEL
FT                   PEILRMSDRIVVMCEGRITGELAAAGATQERIMQLATQREPLNVA"
FT   gene            215307..216332
FT                   /locus_tag="Bphyt_4171"
FT   CDS_pept        215307..216332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4171"
FT                   /product="Monosaccharide-transporting ATPase"
FT                   /EC_number="3.6.3.17"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   bxe:Bxe_C1349 ABC sugar transporter, inner membrane
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4171"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18554"
FT                   /db_xref="GOA:B2TEN3"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEN3"
FT                   /protein_id="ACD18554.1"
FT                   /translation="MTSQSDTSALGNKKTFSGLRARVFTPTALQKLLAFGSLILLLVFF
FT                   SFASPAFMQMDNMLGILQATAVNGVLAIACTFVIITGGIDLSVGTLMTFTAVICGVFLT
FT                   YWHLPMWTGVLAAIGTGAICGTVSGTLTAKMKIPPFIATLGMMMLLKGLSLVVSADKPI
FT                   YFTDTENFYMISQDSLIGDLLPSLPVPNAVLILFFLAVVSSITLNRTALGRYTFALGSN
FT                   EEAVRLSGVNVDRWKIAIYGLSGAICGIAGLLIASRLNSAQPALGQGYELEAIAAVVIG
FT                   GTSLSGGAGTILGTIIGAFIMSVLTNGLRIMSVAQEWQIVVTGLIIILAVYGDILRRKK
FT                   S"
FT   sig_peptide     215307..215453
FT                   /locus_tag="Bphyt_4171"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.978) with cleavage site probability 0.975 at
FT                   residue 49"
FT   gene            216418..217356
FT                   /locus_tag="Bphyt_4172"
FT   CDS_pept        216418..217356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4172"
FT                   /product="periplasmic binding protein/LacI transcriptional
FT                   regulator"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; KEGG: bxe:Bxe_C1348 ABC sugar
FT                   transporter, periplasmic ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4172"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18555"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEN4"
FT                   /protein_id="ACD18555.1"
FT                   /translation="MLKRKLIGVVVGVGALIGGTSVTYADTYIPLISKGFQHQFWQAVK
FT                   SGAEQSAKEHNVRITFEGPETEAMVDKQIDMLSAALAKKPQALGIAALDSKAAIPLLKR
FT                   AQASKIPVIAFDSGVDSDIPLTTCATDNLAAAALAADKMAEAIGNAGEVGVIVHDQTSR
FT                   TGIDRRDGFLNEMKSKHPNIKIVSVQYGGGDHLKSAEIAKTMIQANPNLKGIFGANEGS
FT                   AEGAAIGVKESGKKLVLIGYDSGKEQKDDINSGLMAGAITQNPVGIGKCVVDSAVKALK
FT                   GEKLPKKVDTGFYWYDKTNMTDPKIAAVLYD"
FT   sig_peptide     216418..216495
FT                   /locus_tag="Bphyt_4172"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.991 at
FT                   residue 26"
FT   gene            217467..218765
FT                   /locus_tag="Bphyt_4173"
FT   CDS_pept        217467..218765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4173"
FT                   /product="Mandelate racemase/muconate lactonizing protein"
FT                   /note="PFAM: Mandelate racemase/muconate lactonizing
FT                   protein; KEGG: bxe:Bxe_C1347 putative mandelate
FT                   racemase/muconate lactonizing enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4173"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18556"
FT                   /db_xref="GOA:B2TEN5"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR018110"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034610"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEN5"
FT                   /protein_id="ACD18556.1"
FT                   /translation="MPTITRLSVRDIRFPTSRSLDGSDAMNAAPDYSAAYVTLETDSPD
FT                   ALTGHGLTFTIGRGNEICVAAVEALAPLIVGKRLEDIAANMGAFWRALTSDSQLRWIGP
FT                   DKGAIHLATAAVVNAAWDLWAKAEGKPVWKLLVDMSPEELVRCLDFRYVTDAITPQEAI
FT                   AMLHRHAKTRGEREKEMLAQGYPAYTTSAGWLGYDDDKIRRLAREGVAQGWTHFKQKVG
FT                   GNLDEDMRRARILREEIGEDRKLMMDANQVWDVDEAVANMRRLAQFDPWWIEEPTSPDD
FT                   ILGHAAIRQRLRQIGVATGEHCHNRVMFKQLLQAQAIDFCQVDSCRLGGLNEVIVVLLM
FT                   AAKFGVPVCPHAGGVGLCEYVQHISLFDYICVSASLENRVLEYVDHLHEHFVDPVVIRN
FT                   GRYMPPQRSGYSIEMHAASLDEYDFPEGVAWRG"
FT   gene            218767..218856
FT                   /pseudo
FT                   /locus_tag="Bphyt_4174"
FT   gene            complement(219017..219985)
FT                   /locus_tag="Bphyt_4175"
FT   CDS_pept        complement(219017..219985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4175"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; Oxidoreductase
FT                   domain; KEGG: oan:Oant_0791 oxidoreductase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4175"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18557"
FT                   /db_xref="GOA:B2TEN6"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEN6"
FT                   /protein_id="ACD18557.1"
FT                   /translation="MTDRVRWGVLGAAKIANNFVVPALQRSRNGRVTMVASRDLARAQA
FT                   FATKHDIARVSASYEEVIASQDVDAIYIPLPTASHFEWCKKALLGGKHVLCEKPIAMNT
FT                   AEVEELIALRDQTGLVCGEAFMVAHHPQWAYVRDSLAQGLIGELKLVEGSFTYFNDDPG
FT                   ALKNNLALGGGGVRDIGVYPVVTARLATGLEPDRIQSEIVLDPRFGTDRFARCVADFPG
FT                   FTLSFYCGTQMARRQHMMFHGTKGWLSVDAPFNPGSYGPAKVRHRRDATGSEHTQEFSD
FT                   VDQYQAMVEDFSNTVIGGTAGLVFSLESSLANQRVIDQILR"
FT   gene            complement(220027..221211)
FT                   /locus_tag="Bphyt_4176"
FT   CDS_pept        complement(220027..221211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4176"
FT                   /product="Xylose isomerase domain protein TIM barrel"
FT                   /note="PFAM: Xylose isomerase domain protein TIM barrel;
FT                   KEGG: ecm:EcSMS35_4680 AP endonuclease, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4176"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18558"
FT                   /db_xref="GOA:B2TEN7"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR013097"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEN7"
FT                   /protein_id="ACD18558.1"
FT                   /translation="MSRPTGPVRHMVFCRFRADVTPARRLAFFEQIRRLTEVPGIAFTN
FT                   FQCGPNVSPEGYGMNFADGFMMDFESGQPASRISPIRRIRRSARVCSKRSMAARKACSY
FT                   SISIWKLMRNLQGRLDLCSINTATLGHREPLSRTIDRIAKAGFGGIAPWRREVEEADLV
FT                   QIARQIKALDLTVTGYCRSTYLPAATSAEFKANVEANRAALRDAAILGARCFVMVVGGL
FT                   PEGSRDLDGARNQVSEGIEMLLETARDCGVPLALEPLHPVYAADRAVLNTIAQALEICE
FT                   RVDRDRSGMLGVAVDVYHCWWDPALTASIEAAGRAGRILAYHACDWLRETRDVLLDRGM
FT                   MGDGVIDLPAVRQTIESAGYEGLVEVEIFSAQDWWLRDPDEVLAICADRLQNFC"
FT   gene            complement(221214..222383)
FT                   /locus_tag="Bphyt_4177"
FT   CDS_pept        complement(221214..222383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4177"
FT                   /product="protein of unknown function DUF993"
FT                   /note="PFAM: protein of unknown function DUF993; KEGG:
FT                   sme:SMc04402 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4177"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18559"
FT                   /db_xref="InterPro:IPR009334"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEN8"
FT                   /protein_id="ACD18559.1"
FT                   /translation="MNLSIKLPAASGTMETYRVEGAPLEVRSPARAFNRIAYSAAHVVA
FT                   DPLRAGELNGAPAIDWERTIAYRRYLLQQGLGIAEAMDTAQRGMGLPWSTALELITRSI
FT                   EGTRDIPGAAIASGCGTDHIAPASVTNCDQVIRAYAEQLEAVQRVGGRVILMASRALAR
FT                   VARTPDDYRRVYREVLAMCDQPVILHWLGEMFDPELAGYWGANEFADAAQVCLDIIGTS
FT                   ASKVDGIKISLLDEQKEIAFRQRLPHGVKMYTGDDFNYPALIAGDGMHFSHALLGIFDA
FT                   IAPAASQALSALAANDHASFNALLAPTVPLSRHIFRAPTQYYKTGVVFLAYLNGFQDHF
FT                   FMPGGHHGMRPPAYLADVFRLADQARLLRDPADAVARICRVMAPLGCGD"
FT   gene            complement(222391..223170)
FT                   /locus_tag="Bphyt_4178"
FT   CDS_pept        complement(222391..223170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4178"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: vei:Veis_0844 short-chain
FT                   dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4178"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18560"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEN9"
FT                   /protein_id="ACD18560.1"
FT                   /translation="MSARPIALVTGSRRGIGRAIAVELGLAGFDVALTDAAASQELEDA
FT                   VREVERTGARAIALISDLADIDSHTGTLREIEATLDGQIDCLVNNAGVSVMSRGDLLDV
FT                   TPESFDRCIAVNTRGTFFLTQAFAKHCLARSGGAVAPHPSVITITSSNAIAASPLRGEY
FT                   CVSKAGLSMANTLFSLRLAEHGISVYEVQPGLIETEMTAPSRARYDAQIEQGLTAIKRW
FT                   GTPQEVATTVRTLATGGLPYSVGQAIRIDGGLLVTKY"
FT   gene            complement(223167..224312)
FT                   /locus_tag="Bphyt_4179"
FT   CDS_pept        complement(223167..224312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4179"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase type 2 domain; KEGG: vei:Veis_0882
FT                   acyl-CoA dehydrogenase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4179"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18561"
FT                   /db_xref="GOA:B2TEP0"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEP0"
FT                   /protein_id="ACD18561.1"
FT                   /translation="MKLSDTHQQIRETTRRFAQEVIRPITEELDRDERFPAEIYTQMGE
FT                   LGLFGITVPEAFGGAGLDVTAYALVMEELSRGYASVADQCGLLELVGTLLSVHGTDSQR
FT                   AKYMQPLLRAKLRPAYCITEADAGTDVSGIRTTAMRTPDGWELSGAKLWIHNAPVADVA
FT                   FVLARTDPAAGRRGMSIFIVDCALAGVSKGAKEHKMGQRASQVGELHFDRVKLPQDALL
FT                   GQEGRGFHIMMSVLDKGRVGIAALAVGIAQAGLEAALDYAQTRKQFGSHIAEFQGIQWM
FT                   LADMATDIQAARLLVHDAAERLEAGERASIACSMAKCFAGDTAVKHSANAVQIFGGSGY
FT                   IRGYEVERLYRDAKITQIYEGTNQIQRTIVARDLIANGATL"
FT   gene            224526..226088
FT                   /locus_tag="Bphyt_4180"
FT   CDS_pept        224526..226088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4180"
FT                   /product="coenzyme A transferase"
FT                   /note="PFAM: coenzyme A transferase; KEGG: vei:Veis_0883
FT                   coenzyme A transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4180"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18562"
FT                   /db_xref="GOA:B2TEP1"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR014388"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEP1"
FT                   /protein_id="ACD18562.1"
FT                   /translation="MDAAAAAEQIFDGATIALAGSGGGLLEPDAVLAALEQRFLQTGHP
FT                   RDLTVVHALGIGDGKSSGLSRFAHAGMVRRVIGGHWSWSPAMQQMAKDNAFEAYSFPAG
FT                   AISTLLREIGAGRPGLVTHVGLRTFVDPRLDGGKINARASEELVELIELDGREYLRYKP
FT                   FKVDFAIVRGSSADANGNVTLRREPADLDTYAAALAAHNSGGRVIVQVKERTTQGYVPA
FT                   RLVRIPGILVDTLVAAREQVQCVVADYDPALSGESLSPIDDGFYETPTGIRYIIAARAA
FT                   QELHAGQSANFGFGIPGGIPGVLAQQGRLGTFWGSVEQGIHNGAMLDGPMFGTARNAEA
FT                   ILSSVDQFDFYSGGGVDITFLGMGEMDGEGNINVSKLGATVVGPGGFIDITQGARKIVF
FT                   CGSFEAKGLQVEKAGAGVKIVSHGSVPKLVERVQHVTFSGEQARIAKQEVLYVTERAVF
FT                   RLEESGVRLIEVAQGVDVERDVLARMSFRPLVDEALLAQGKNEAREVDANEVDANEAHA
FT                   KVA"
FT   gene            complement(226144..226827)
FT                   /locus_tag="Bphyt_4181"
FT   CDS_pept        complement(226144..226827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4181"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: rde:RD1_0515
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4181"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18563"
FT                   /db_xref="GOA:B2TEP2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041474"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEP2"
FT                   /protein_id="ACD18563.1"
FT                   /translation="MTLASTPPGRALKTAKAGATQPPRQRDPEVTRARILEAAKKEFAK
FT                   LGLAGARVEAIATRAKANKRMIYHYFGSKEELFQAVLEDAYADIRSAELKLNLDHLSPE
FT                   DAIVALTTHTWNYYLKNPEFMTLVNSENLHKARHVKKSERFKELHHGFISMLQRIIDRG
FT                   VEAGVFRAGVDARQLHITMAAVGYYYLTNRFTSGVIFDIDFMSKEALKNRLDFNIETVL
FT                   RLLRP"
FT   gene            227041..228549
FT                   /locus_tag="Bphyt_4182"
FT   CDS_pept        227041..228549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4182"
FT                   /product="Aldehyde Dehydrogenase"
FT                   /note="PFAM: Aldehyde Dehydrogenase_; KEGG: sme:SMa1415
FT                   probable aldehyde"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4182"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18564"
FT                   /db_xref="GOA:B2TEP3"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEP3"
FT                   /protein_id="ACD18564.1"
FT                   /translation="MSNLNELAATLRLPAEPLRTPMFIDGKDYAGNTGEFVTRKSPGHG
FT                   VPVTATPRACVDDLNAAVASARRAFDDGRWSRLSGEQRATVLLKTARLIRDKVETLAYL
FT                   ETLESGKPIGQSRGEINAAAGIWEYAAGLARVVHGDSHDTLGADLFGLTVRQPIGVVGI
FT                   VTPWNFPFFILSERLPFVLAAGCTAVVKPAELTSTTTLKLAALLTEAGLPDGVVNVVTG
FT                   LGAVVGQALAEHMDVDMMSFTGSTPVGRSVLAAAGGNMKKVGLELGGKNPQIVFADADL
FT                   DDAADAIAFGICFNAGQCCVSGSRLVVHRSVEEELVARVKAVFEKVRVGDPLDASNHVG
FT                   AIVEARQFDKIRGFIDAGRRDGAQLVHGGESTSHGERFFIQPTLFRNVQPQSALAQEEI
FT                   FGPVLSVTSFDTFEEAIQLANGVPYGLAASIWTRDLQGAISSFREVQAGRIWVNCTITG
FT                   GPEMPIGGVKQSGIGRETGRYGVEEYTELKSVHVQLGKRPRWIA"
FT   gene            228645..230318
FT                   /locus_tag="Bphyt_4183"
FT   CDS_pept        228645..230318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4183"
FT                   /product="glucose-methanol-choline oxidoreductase"
FT                   /note="PFAM: glucose-methanol-choline oxidoreductase; FAD
FT                   dependent oxidoreductase; GMC oxidoreductase; KEGG:
FT                   vei:Veis_0884 glucose-methanol-choline oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4183"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18565"
FT                   /db_xref="GOA:B2TEP4"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR012132"
FT                   /db_xref="InterPro:IPR027424"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEP4"
FT                   /protein_id="ACD18565.1"
FT                   /translation="MYDYVIVGGGAAGCALAARLTEDAGNRVLLLEAGPADTDPYIHMP
FT                   VGFFKMTGGPLTWGYRTTAAEHTQRRQIPFAQGRVLGGGGSINAMVYTRGQPADYDGWE
FT                   RDGCTGWGFRDGVLPYLRRMEDNERLCNEYHGVGGPLGVSDLISVNELTKAFVLAGQEA
FT                   GMPYNSDFNGAQQEGVGVYQVTQRSGKRCSAAVGYLRDARSRPNLTVRTDCLVSRIVIE
FT                   KGRAVGVEFAPRGERANVTIARAEREVIVTAGAIGSPKLLMLSGIGRAEDLERVGVKPV
FT                   HALNGVGQNLQDHFDIDIVYELNGPYSLDKYAKKHMMLLAGLEYKLFNKGPVTSNIAEG
FT                   GAFWYSDSSVPTPDLQFHFLPGAGVEAGVPPVPSGSGCTLNSYFLRPRSRGSVTLHSAD
FT                   PADAPLIDPAYIRDPYDLKVAVDGIRQSREIMSQHALRKYIRSEHFPGGLVRTQAEYET
FT                   YAQQYGRTGYHPVGTCKMGVDEMSVVDPQLRVRGIEGLRVADSSVMPRIVSSNTNAPTL
FT                   MIAEKAADLIRGLAAQPAAVKGALASTSGRVARESAAAAV"
FT   gene            230445..231524
FT                   /locus_tag="Bphyt_4184"
FT   CDS_pept        230445..231524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4184"
FT                   /product="periplasmic binding protein/LacI transcriptional
FT                   regulator"
FT                   /note="KEGG: vei:Veis_0885 periplasmic binding protein/LacI
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4184"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18566"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="PDB:2RJO"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEP5"
FT                   /protein_id="ACD18566.1"
FT                   /translation="MNRQDQRAGVSRRDFIKLGAGAAFAVAGGGMSGLSFGAGQTTLAC
FT                   SFRSLTNPYYTAFNKGAQSFAKSVGLPYVPLTTEGSSEKGIADIRALLQKTGGNLVLNV
FT                   DPNDSADARVIVEACSKAGAYVTTIWNKPKDLHPWDYNPNYVAHLSYDGVAYGEETATQ
FT                   LFKSMGGKGGVVALGGIFSNVPAIERKAGLDAALKKFPGIQLLDFQVADWNSQKAFPIM
FT                   QAWMTRFNSKIKGVWAANDDMALGAIEALRAEGLAGQIPVTGMDGTQPGLVAIKSGELV
FT                   ASVDWDPFWLGGIGLSMGLQAKEKKIDLATLPKDRRESFCTATFVTKTNVQDVIARAAS
FT                   PKAEWNNLYARVAGPVVYR"
FT   sig_peptide     230445..230558
FT                   /locus_tag="Bphyt_4184"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.989 at
FT                   residue 38"
FT   gene            231521..232549
FT                   /locus_tag="Bphyt_4185"
FT   CDS_pept        231521..232549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4185"
FT                   /product="Monosaccharide-transporting ATPase"
FT                   /EC_number="3.6.3.17"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   vei:Veis_0886 inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4185"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18567"
FT                   /db_xref="GOA:B2TEP6"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEP6"
FT                   /protein_id="ACD18567.1"
FT                   /translation="MNKLTATPSRHAVQAARSPASVHGPAAVRALLRRYSPLLVLMALG
FT                   LCIGVLNHDFFDPMNLSRIAIAAVIPLTIALGGTFVIQLGSIDLSAEGIVAVAAIAVSM
FT                   LVENSYNDNHFGLWVLAIGVAAGVVLGLANGVLHVFLRIPSFITTLAVGFVATGIGTAV
FT                   LSGNTIRVSDTALRAISITRYFGLPLSVWIGVLALGLAWFVHRHTILGRHTLAIGGGED
FT                   LARLSGVRISRVRIAVFALAGAFYGVAGILAVAQYGQGHAMIADGQLFVAITAIVVGGT
FT                   SLAGGNGGPLNTLIGTLVVVVLANGMVLLGVPPYVQQGIQGVLIIVAVTLALNRSRRRI
FT                   VK"
FT   gene            232568..234067
FT                   /locus_tag="Bphyt_4186"
FT   CDS_pept        232568..234067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4186"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: vei:Veis_0887 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4186"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18568"
FT                   /db_xref="GOA:B2TEP7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEP7"
FT                   /protein_id="ACD18568.1"
FT                   /translation="MLTLRNVTKRFPGVLALNDVSIEIRPNEIVGLIGENGAGKSTLMK
FT                   LLTGGYRQDSGEILRDGKPLVIKNPRDATSEGIAMVYQEQSILPNLTVAENLFLGREEP
FT                   FLTLGRVNWTKLKRAAIAELATVHLDIDPLTLCEDLTFGQRQMVELAKALSLASHTDGM
FT                   PVILLDEPTSVLEAAEIEILFRLVRELKARASFVFVSHRLDELLSLSDRVYVMKDGKVV
FT                   AGMASADASVGQLHELMVGRTMDGQYYRENLQKPCRGEVALSVRNASLGHTLKGVSFDV
FT                   HCGEVFGVAGVVGSGREELCRVIAGLESLDAGEVLVGETRLRAQATHAVSLGIGYVPRE
FT                   RKVEGLVTQMSVAENLTLPRLAAVSRSGVVNKRSERAVANEWIERLHIKTPGPSASCRN
FT                   LSGGNQQKVVLAKWRFAGSRILVLDHPTRGLDVGAKEEVYQLIRELTAEGVAVVLTGDT
FT                   LEEILGLSHRVMVMRDGRAQKILACEVGHKPSQIDVVEHMV"
FT   gene            234075..235034
FT                   /locus_tag="Bphyt_4187"
FT   CDS_pept        234075..235034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4187"
FT                   /product="Monosaccharide-transporting ATPase"
FT                   /EC_number="3.6.3.17"
FT                   /note="PFAM: transport system permease protein;
FT                   inner-membrane translocator; KEGG: vei:Veis_0888
FT                   inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4187"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18569"
FT                   /db_xref="GOA:B2TEP8"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEP8"
FT                   /protein_id="ACD18569.1"
FT                   /translation="MAQMNASLKARLGDNAPFIALIALYLLIEIAQPTFLAPSTQLGLL
FT                   ADSSTLFIMAAGTTFVVLLGSIDLSLQAVASLSSVIVAMLLPRYGAWAAVVALAASFGI
FT                   GLLSGVIQTVLRIPSFIATLAVGGIASAAALTLSGTRSIGISDEMRNASLGWTTGSSFG
FT                   MPHEIMLALVVFLLCVFLHRSTVFGRHVDAIGAGEPAAIASGVRVPVTRCLVFATSSLF
FT                   AGLAGVIMAGRLGSGSPTLADQFLLPAIAAVIVGGTALTGGAGGVGRTLIGALLVSVAR
FT                   VGMTFVGISVFAQQIVFGVILIVAVTVAFDRSKVLIIK"
FT   gene            235088..235837
FT                   /locus_tag="Bphyt_4188"
FT   CDS_pept        235088..235837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4188"
FT                   /product="Electron transfer flavoprotein
FT                   alpha/beta-subunit"
FT                   /note="PFAM: Electron transfer flavoprotein
FT                   alpha/beta-subunit; KEGG: bxe:Bxe_A0998 electron transfer
FT                   flavoprotein, beta-subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4188"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18570"
FT                   /db_xref="GOA:B2TEP9"
FT                   /db_xref="InterPro:IPR000049"
FT                   /db_xref="InterPro:IPR012255"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR033948"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEP9"
FT                   /protein_id="ACD18570.1"
FT                   /translation="MKVLVAVKRVVDYNVKVRVKSDGTGVDIANVKMSMNPFDEIAVEE
FT                   AVRLKEAGVATEVIAVSAGVTQSQETLRTALAIGADRAILIESSQELQPLAVAKLLKAL
FT                   VDKEQPSLVILGKQAIDDDSNQTGQMLAALAGLPQATFASKVVVADGKATVSREVDGGA
FT                   ETLSLKLPAVVTTDLRLNEPRYVTLPNIMKAKKKPLEVLKPEDLGVDVTPRLTTLKVVE
FT                   PPKRSAGVKVPDVKTLVEKLKTEAKVL"
FT   gene            235852..236784
FT                   /locus_tag="Bphyt_4189"
FT   CDS_pept        235852..236784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4189"
FT                   /product="Electron transfer flavoprotein alpha subunit"
FT                   /note="PFAM: Electron transfer flavoprotein
FT                   alpha/beta-subunit; Electron transfer flavoprotein alpha
FT                   subunit; KEGG: bxe:Bxe_A0999 electron transfer
FT                   flavoprotein, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4189"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18571"
FT                   /db_xref="GOA:B2TEQ0"
FT                   /db_xref="InterPro:IPR001308"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR014731"
FT                   /db_xref="InterPro:IPR018206"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR033947"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEQ0"
FT                   /protein_id="ACD18571.1"
FT                   /translation="MTNLVIAEHDNASIKAATLNTVAAAQKIGGDIHVLVAGHNAQAAA
FT                   DAAAKIAGVSKVLLADAPQLEAGLAENVEATVLNIAKDYTHILAPATAYGKNITPRIAA
FT                   KLDVAQISDITAVDSADTFERPIYAGNAIATVQSADPIKVITVRTTGFDAVAAEGGSAT
FT                   VEKIEAAADSGISSFVSREVTKLDRPELTSAKVIVSGGRGLGNGENYTKVLEPLADKLN
FT                   AALGASRAAVDAGFVPNDYQVGQTGKIVAPQLYIAVGISGAIQHLAGMKDSKVIVAINK
FT                   DEEAPIFSVADYGLVGDLFDAVPDLTTSV"
FT   gene            236940..237956
FT                   /locus_tag="Bphyt_4190"
FT   CDS_pept        236940..237956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4190"
FT                   /product="Pyridoxal 4-dehydrogenase"
FT                   /EC_number="1.1.1.107"
FT                   /note="PFAM: aldo/keto reductase; KEGG: bxe:Bxe_A2190
FT                   putative aldo/keto oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4190"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18572"
FT                   /db_xref="GOA:B2TEQ1"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEQ1"
FT                   /protein_id="ACD18572.1"
FT                   /translation="MDPVAKRKWPRSGLETTLMGFGAAPIGNIFRPISEEDSAALIKAA
FT                   WDAGVRYFDTAPMYGHGLSEARCGQALRWYPRDQFVLSTKVGRLLKPRKRAEINFTPWV
FT                   DGLPFDMRFDYSYDGVMRSIEDSLQRMALEHIDIALIHDIDLFTHGDGQPQVFEAAMNG
FT                   AAKALLKLRDEGVVKAVGVGVNEWQVAHEAIRRSDFDCLLLAGRYTLLEQDALDGFLPL
FT                   CEERQVSVVLGGGYNSGILATGAVPGAKYNYAPAPEAILERVRKIEQVCRDFSVPLKAA
FT                   SLQFVLGHPAIPTNIPGVRSVAQLEDNLQTFRADIPAEFWAELKRRGLIREDSPTPR"
FT   gene            complement(238054..239127)
FT                   /locus_tag="Bphyt_4191"
FT   CDS_pept        complement(238054..239127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4191"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; Rhodanese
FT                   domain protein; KEGG: bur:Bcep18194_B0182
FT                   beta-lactamase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4191"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18573"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="PDB:5VE3"
FT                   /db_xref="PDB:5VE4"
FT                   /db_xref="PDB:5VE5"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEQ2"
FT                   /protein_id="ACD18573.1"
FT                   /translation="MLIFRQLFDQQSSTYTYLLADSTTREAVLIDPVFEQVRRDAALIE
FT                   ELGLHLLYTIDTHVHADHVTGAWMLNRRIGSRIAISAASGAEGADRYLSHGDKVEFGTR
FT                   YLTVRATPGHTDGCITLVLDNETMAFTGDCLLIRGTGRTDFQRGDAHTMFRAVHGQIFT
FT                   LPTACLLYPAHDYRGLTVTSVGEERRFNPRLGGELCEEDFTGYMTNLHLPHPKQIDVAV
FT                   PANLKCGLAASVPTQMTEPDWAPLTCSFAGIWEINAQWLEENLRAVEIVDVREPEEFNG
FT                   PLGRIPAARLISLGELAGRTAELTKDRPIVTVCRAGGRSAQATVMLRQAGFERVANLPG
FT                   GMLRWRAEGRVVENGSV"
FT   gene            complement(239273..239929)
FT                   /locus_tag="Bphyt_4192"
FT   CDS_pept        complement(239273..239929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4192"
FT                   /product="Peroxidase"
FT                   /EC_number="1.11.1.7"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; Redoxin domain protein; KEGG:
FT                   bur:Bcep18194_B0181 peroxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4192"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18574"
FT                   /db_xref="GOA:B2TEQ3"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEQ3"
FT                   /protein_id="ACD18574.1"
FT                   /translation="MSIRLGEDAPDFTAETTEGTIHFHEWIGDHWAVLFSHPKDFTPVC
FT                   TTELGYLAGLKPEFDKRNTKIIGLSVDPVSDHTEWVKDIAETQGHAINYPLIGDSDLKV
FT                   AKLYDMIHPEASGGGPRTAVDNATVRSVFLIGPDKKVKAMLVYPMSAGRNFDEVLRLLD
FT                   ALQLNAKHTVATPVNWKPGEDVIIPTSVSNDAATQKYPQGFKTVKPYLRYVAQPK"
FT   gene            complement(240281..241123)
FT                   /locus_tag="Bphyt_4193"
FT   CDS_pept        complement(240281..241123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4193"
FT                   /product="putative 10 TMS drug/metabolite exporter, DME
FT                   family, DMT superfamily"
FT                   /note="KEGG: bxe:Bxe_A3474 putative 10 TMS drug/metabolite
FT                   exporter, DME family, DMT superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4193"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18575"
FT                   /db_xref="GOA:B2TEQ4"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEQ4"
FT                   /protein_id="ACD18575.1"
FT                   /translation="MLSYTGGLVLVAALLHASWNAMLHGNRDRFLSMTWMSIAIAAVAT
FT                   LAILFTPLPASAAWPYLAASGLVHIVYNVSLVRAYRRGDLAQAYPIARGSSPLLVTLGA
FT                   ALFAHEAIGPLHALGIAMISGGIIALALQGGRVSRVGALAALATGASIALYTVIDGIGV
FT                   RLSGGEALAYTAWMFLFYWLMPVLFVAMRGLAALWTPIRAAPIAVASSLAGGMVSIAAY
FT                   GIVIWAMQSGAMGTVSALRETSVVFAVLIGRVILREAVSARRWLACVVVAAGAVCLGL"
FT   sig_peptide     complement(240950..241123)
FT                   /locus_tag="Bphyt_4193"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.950) with cleavage site probability 0.508 at
FT                   residue 58"
FT   gene            241250..242158
FT                   /locus_tag="Bphyt_4194"
FT   CDS_pept        241250..242158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4194"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bxe:Bxe_A3473 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4194"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18576"
FT                   /db_xref="GOA:B2TEQ5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEQ5"
FT                   /protein_id="ACD18576.1"
FT                   /translation="MKRALPPLNALRAFEAAGRLGSFKEAAAELHVTHGAVSQHVRALE
FT                   EWLGASLFERHNRRVALTTAAKTYLAEIGPLFEELARATARYGFPDTLSRTLSVNAPAT
FT                   FTLRWLVPRLATFRAAHPDVNVNVQTSNESLESLKETYDVIVRGGPDTFYGYSMRPFLS
FT                   EERIPVCSPALLQRLPLRTPDDMRQHTLLHTSSLPRVWPDWLASAEIPALRPAAALSFD
FT                   HFFLTLQAAIDGIGIAMGPTALVADDLASGRLVAPFAGPRLPSRSYCTYVPDAKSADEL
FT                   VLLFRAWLEREAMHSQAQTAL"
FT   gene            242363..242686
FT                   /locus_tag="Bphyt_4195"
FT   CDS_pept        242363..242686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4195"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B3177 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4195"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18577"
FT                   /db_xref="GOA:B2TEQ6"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEQ6"
FT                   /protein_id="ACD18577.1"
FT                   /translation="MMFRGLCKVVAIAFVTNQALTTIFTYFVQQLDSAPPHQAVWIFSC
FT                   VTCGMVTLWLQADARRAFGFAREKGFVKKSGEDTQGVQIADDCPKRWLVVLHIELNPAS
FT                   IQG"
FT   gene            complement(242720..243685)
FT                   /locus_tag="Bphyt_4196"
FT   CDS_pept        complement(242720..243685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4196"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding"
FT                   /note="PFAM: D-isomer specific 2-hydroxyacid dehydrogenase
FT                   catalytic region; D-isomer specific 2-hydroxyacid
FT                   dehydrogenase NAD-binding; KEGG: sen:SACE_1944 D-isomer
FT                   specific 2-hydroxyacid dehydrogenase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4196"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18578"
FT                   /db_xref="GOA:B2TEQ7"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEQ7"
FT                   /protein_id="ACD18578.1"
FT                   /translation="MNDKSLIKVAVLDDYQNVALSMADWSPLTNRAEVTVFNDHVADIG
FT                   NLIQRLQPFDVICAMRERTPLPREVIESLPNLKLIASTGAGNTSIDQDAAAERGIEIRH
FT                   TGYSSTPTIEMTWALILAMARNIPLENQSVRQGGWQLSLGDELAGKTLGLLGLGRVGSA
FT                   VGIIGRAFRMNVVAWSQNLTEERAAEKGVQRVSKDELFSTADFLSIHVRLGERTTGLVG
FT                   AAEFAQMKPTSRLINTSRGPIVDSAALLTALTTGQITGAALDVYDVEPLDNPHPLRELP
FT                   NVLATPHIGYVSKELYRTFYGDTVRNIVQWLDESGGSARG"
FT   gene            complement(243740..244396)
FT                   /locus_tag="Bphyt_4197"
FT   CDS_pept        complement(243740..244396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4197"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4197"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18579"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEQ8"
FT                   /protein_id="ACD18579.1"
FT                   /translation="MPCRCLRSTCWHFFGCRCQAAALLRCMVFTSNFDVQENSGKDSTA
FT                   VWRWRREAAGRQVRAGTYSPTEPRRLLRSDSALQTDVRSGIATNAASSRFRSSGRLDSP
FT                   VIFPANFRFRIRPLPDSTDAARTVPHATRSTGTRPGKFGRPTSQKRRRPRQQPRPNRTA
FT                   ACRCSRIVSRADLSVICIWTDYDSDGRHRIYRLRWLGERLWPVSLNHSASWTTRS"
FT   gene            complement(244374..244943)
FT                   /locus_tag="Bphyt_4198"
FT   CDS_pept        complement(244374..244943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4198"
FT                   /product="isochorismatase hydrolase"
FT                   /note="PFAM: isochorismatase hydrolase; KEGG: reh:H16_B0623
FT                   amidase related to nicotinamidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4198"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18580"
FT                   /db_xref="GOA:B2TEQ9"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEQ9"
FT                   /protein_id="ACD18580.1"
FT                   /translation="MQIPAIVPEQTALVVMHYQTDIMRLFPSVAPALLANTRKLCDAAR
FT                   AKGVGVYFARIHFSPGYPEVSPLNRNGQGIKQLGLFVDDEIAPELGQRATEPLIIAHRA
FT                   SVFFGTDLQARLSAQGIDTLIMVGIASTGVVLSSVAYASDADFRLFTVKDCCYDPDQVV
FT                   HDHLFSTAFDSRTTVLSLVDALSLLA"
FT   gene            245467..245748
FT                   /locus_tag="Bphyt_4199"
FT   CDS_pept        245467..245748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4199"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A2488 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4199"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18581"
FT                   /db_xref="UniProtKB/TrEMBL:B2TER0"
FT                   /protein_id="ACD18581.1"
FT                   /translation="MYVRSIAAVLVASIALLTDPAFAGGDDQTSSYRNDVATSVAHRGQ
FT                   TAQAKAAAEGHGGVVDVNHSGVGGSESGKSQSGRRAPGDSINPMYHGG"
FT   sig_peptide     245467..245538
FT                   /locus_tag="Bphyt_4199"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.852 at
FT                   residue 24"
FT   gene            245946..246491
FT                   /locus_tag="Bphyt_4200"
FT   CDS_pept        245946..246491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4200"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: reu:Reut_B4332 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4200"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18582"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:B2TER1"
FT                   /protein_id="ACD18582.1"
FT                   /translation="MKNRTRFLTAILAVLVFIALLFVPLPQRIALDTRIVTVASIQRSP
FT                   TVVFGYVTTPAHWPAWHPSSLAVSGSVDHPLDLGEQVTEEFRVAGRRGRVVWTVAEREP
FT                   PGKWSIEGTIDGRPAGTVTYSLTLTESGTRFEREFTYRAPSLWFAIFNWLVLRARIQSE
FT                   SDTAVSQLKGLLEASPQQ"
FT   sig_peptide     245946..246038
FT                   /locus_tag="Bphyt_4200"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.739 at
FT                   residue 31"
FT   gene            246679..247119
FT                   /locus_tag="Bphyt_4201"
FT   CDS_pept        246679..247119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4201"
FT                   /product="nuclear protein SET"
FT                   /note="PFAM: nuclear protein SET; KEGG: bxe:Bxe_C1219
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4201"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18583"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="UniProtKB/TrEMBL:B2TER2"
FT                   /protein_id="ACD18583.1"
FT                   /translation="MRRVIVRRSSVHGKGVFAMRPLAAGECVLEYRGELTSWREAVRRH
FT                   RREGVAGHTFLFGLSDGRVIDGSRGGNSARWLNHACAPNCETVEDDGRIFIHTIRPIEA
FT                   GEELFIEYLLATDDPLDEDVRAQYACRCAVVGCRRSMLAAVT"
FT   gene            complement(247214..247465)
FT                   /locus_tag="Bphyt_4202"
FT   CDS_pept        complement(247214..247465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4202"
FT                   /product="Transglycosylase-associated protein"
FT                   /note="PFAM: Transglycosylase-associated protein; KEGG:
FT                   reh:H16_B2506 hypothetical membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4202"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18584"
FT                   /db_xref="GOA:B2TER3"
FT                   /db_xref="InterPro:IPR007341"
FT                   /db_xref="UniProtKB/TrEMBL:B2TER3"
FT                   /protein_id="ACD18584.1"
FT                   /translation="MLSFIGTLIVGLVVGLIARAVKPGDDRMGLIMTIVLGIAGSLIAG
FT                   YVGRALGWYQPGQAAGWVASIIGAIILLVIYGLVRRRS"
FT   sig_peptide     complement(247403..247465)
FT                   /locus_tag="Bphyt_4202"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.694) with cleavage site probability 0.689 at
FT                   residue 21"
FT   gene            247652..249604
FT                   /locus_tag="Bphyt_4203"
FT   CDS_pept        247652..249604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4203"
FT                   /product="lipid A ABC exporter family, fused ATPase and
FT                   inner membrane subunits"
FT                   /note="KEGG: mms:mma_1194 ABC-type multidrug transport
FT                   system, ATPase and permease components; TIGRFAM: lipid A
FT                   ABC exporter family, fused ATPase and inner membrane
FT                   subunits; PFAM: ABC transporter transmembrane region; ABC
FT                   transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4203"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18585"
FT                   /db_xref="GOA:B2TER4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR011918"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:B2TER4"
FT                   /protein_id="ACD18585.1"
FT                   /translation="MQLFSCSRRFAAAQSIDESAVARNVGHASPRSFACLASRRLQSTE
FT                   YSIRLGILMPDAMTSPPPSRRISPLFALFPFLRPYAGRWALAFFALVTSASATLVLPVA
FT                   FKYLIDRGFASGDRGHIDRYFLALFVVSLVLATATALRFYLVSWLGERVTADLRRAVYD
FT                   HVLSMSPQFFETTQTGEVLSRLTADTTLIQTVVGTSLSLGLRNFFLLTGGVAMLAVTSP
FT                   VLSGYIIATLVVVIAPIVIFGRRVRRLSRASQDKIANTSALAGEVLNAMPTVQSYTQEP
FT                   FEARRYGGAVETAFETALTRIRARAWLTAVVIVLVFTAIVFVLWLGAQAVLAGRMTAGQ
FT                   LSQFILYAVFTAGAVGAVAEVWGDLQRAAGATERLLQLLAARSPVLQAETTVALPARGE
FT                   GIRFDDVSFSYPSRPGIAALSSLSLEVRPGEHVALVGPSGAGKTTLFQLLLRFYDPQAG
FT                   RILINGVPTRDVPLVELRREIGVVLQESVIFSGSVLDNIRYGAPEATLAQVQQAADMAA
FT                   AAGFIEELPEGYDTFLGERGVRLSGGQRQRIAIARAILKNPPILLLDEATSALDAASER
FT                   LVQKALDNAAQNRTTLVIAHRLATVQQADRIIVLEQGRIVAQGRHAELLLSSPLYAQLA
FT                   ALQFGEQLGQTAPAQ"
FT   gene            249687..249788
FT                   /pseudo
FT                   /locus_tag="Bphyt_4204"
FT   gene            249924..251138
FT                   /locus_tag="Bphyt_4205"
FT   CDS_pept        249924..251138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4205"
FT                   /product="Phytanoyl-CoA dioxygenase"
FT                   /note="PFAM: Phytanoyl-CoA dioxygenase; KEGG: sme:SMc00164
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4205"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18586"
FT                   /db_xref="GOA:B2TER5"
FT                   /db_xref="InterPro:IPR008775"
FT                   /db_xref="UniProtKB/TrEMBL:B2TER5"
FT                   /protein_id="ACD18586.1"
FT                   /translation="MDRSHDRIEKREQSWYRERDCALNEFVALLEDDDHGPTRYAAEIT
FT                   QRIPIYDCPQLDGMTRDASQRAQLQAEWARVLHDGAGVLVLRRAFVDTGPVDDATAVFE
FT                   SIIRSEREQGSSAADHFAKAGANDRIWNAQEKLCLRAPEVFAEYFSNPMLMIMSEAWLG
FT                   PCYQMTSQVNVVRPGGAAQQAHRDYHLGFQTAERAERYPAHVHRMSPFLTLQGAVAHSD
FT                   MPVESGPTKLLPYSQRYHEGYLAWRRAEFRAYFEDHFVQLPLSKGDVVFFNPALFHAAG
FT                   ANRTADVQRMANLLQVSSAYGRAMEVLDRRGMCEALYPVLRERRASGRISDTEITAAIA
FT                   SCAEGYPFPTKLDRDPPIGGLAPESQQELMHRGLDEEWDPARFTLALNEHAARHCSTNP
FT                   QSGTS"
FT   gene            complement(251525..252061)
FT                   /locus_tag="Bphyt_4206"
FT   CDS_pept        complement(251525..252061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4206"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bam:Bamb_4781 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4206"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18587"
FT                   /db_xref="InterPro:IPR024311"
FT                   /db_xref="UniProtKB/TrEMBL:B2TER6"
FT                   /protein_id="ACD18587.1"
FT                   /translation="MFPPSPVPENAMTSLHQTLRAAALVALAICLAVPESFAQTPPGVA
FT                   GSWSLVSLTVSRSGSDVDVLGPHPSGQLIFGSDGRYVLLGVRADLPKFASGNRLSGTSE
FT                   ENERIVQGNFAHFGTYTVDPAGQVIVFRIQKSTFPNWDGDVQQRPFTLDGDRLTYVTPG
FT                   SFGYGASKVVWQRMK"
FT   sig_peptide     complement(251945..252061)
FT                   /locus_tag="Bphyt_4206"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.969) with cleavage site probability 0.968 at
FT                   residue 39"
FT   gene            complement(252165..254402)
FT                   /locus_tag="Bphyt_4207"
FT   CDS_pept        complement(252165..254402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4207"
FT                   /product="aldehyde oxidase and xanthine dehydrogenase
FT                   molybdopterin binding"
FT                   /note="PFAM: aldehyde oxidase and xanthine dehydrogenase
FT                   a/b hammerhead; aldehyde oxidase and xanthine dehydrogenase
FT                   molybdopterin binding; KEGG: bxe:Bxe_C1225 putative
FT                   xanthene dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4207"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18588"
FT                   /db_xref="GOA:B2TER7"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:B2TER7"
FT                   /protein_id="ACD18588.1"
FT                   /translation="MSTLPDSVLSVIGQPQARVDGPLKVSGSATYTSDVNLPDLLIAVP
FT                   VCSTIASGRLVSLDIADAEAMPGVHAVLHRDNIGRFYRLSGNSMETGFVDEARPPFEDD
FT                   IIRYYGQYIAVVIADTFEAASAASAAIGARYEVTPHDVRDELEADDKPKVESERGDPNR
FT                   AFDTAPATLDATYVTPTETHNPIELHATIADWDGENYTFYETTQAIAVHLGTLSQMLGV
FT                   PKEKIRVISRYLGSGFGGKLWMWPHSLLAAAATRQTGRPVKLVVSRKMMFQNVGHRPVT
FT                   QQRVRVSAERDGKLTSLQHDYVNHTAIADDYQESCGEVTPLIYSTPNLRVTSGVTRRNV
FT                   GSPTSMRGPGAVPGLYAIESAMNELAHVLNLDPVELRLRNEPRIDESTGLPFSSRHLTE
FT                   CLRMGAERFGWSRRTPGVGSMQRDGLTLGWGVGACVWPGLRFSAAADVDLRADGSARVV
FT                   CGTQDIGTGTYTVLAQLVAEETGIPLERIEVGLGDSVLPLGPISGGSAATASVIPAVLD
FT                   AVRAATKLLLSRAAAVDGSPFKGASEDELAFSAGYVHRKGETPERGVPFGQILEAAKMR
FT                   AASGSGSAKGGFDDPLKKRFSIYSYGAHFAEVTWQPEIARLRVSRVVTVIDGGRIVNPR
FT                   AARNQIEGAVVMGVGMALFEHTMYDKQTGAPINSNLADYVVATNADTPELDVTFLDHPD
FT                   TVFNELGARGIAEIGLAGIASAITEATHHATGVRVRKLPIMIEDLLAAEMT"
FT   gene            complement(254427..255434)
FT                   /locus_tag="Bphyt_4208"
FT   CDS_pept        complement(254427..255434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4208"
FT                   /product="molybdopterin dehydrogenase FAD-binding"
FT                   /note="PFAM: molybdopterin dehydrogenase FAD-binding; KEGG:
FT                   bxe:Bxe_C1224 putative oxidoreductase, molybopterin binding
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4208"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18589"
FT                   /db_xref="GOA:B2TER8"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036683"
FT                   /db_xref="UniProtKB/TrEMBL:B2TER8"
FT                   /protein_id="ACD18589.1"
FT                   /translation="MEIFQLSRANGVRDAITAGATSATAQQGAQVRFLAGGTTLLDLMK
FT                   LNVEQPTQVIDISRLPLDRIEALPDGGVKIGATARNADLALHPLIRAPYAVLSQALLAG
FT                   ASAQLRNMATTGGNLLQRTRCVYFRDTAMPCNKREPGSGCPAIQGFNRTLAILGASDAC
FT                   IATNPSDMNVALTALDATIHVEGTGGARSIAIDDFFVLPGTTPQRENVLDAGDLITHVT
FT                   LPPLPAGARSVYLKLRDRASYEFALASAAVVVTLDGGRIGHVRVALGGVGTRPWHALEA
FT                   EAVLRGAAPDAATFRKAADAALANAKPQSQNGFKVELARRCIVHALTQATAATP"
FT   gene            complement(255446..255994)
FT                   /locus_tag="Bphyt_4209"
FT   CDS_pept        complement(255446..255994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4209"
FT                   /product="(2Fe-2S)-binding domain protein"
FT                   /note="PFAM: ferredoxin; [2Fe-2S]-binding domain protein;
FT                   KEGG: bxe:Bxe_C1223 putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4209"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18590"
FT                   /db_xref="GOA:B2TER9"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:B2TER9"
FT                   /protein_id="ACD18590.1"
FT                   /translation="MMQQTASKTPQQSADPDAVRTTRQPSANATMPVELTVNGNLYTLS
FT                   LDPRTTLLDALREHLHLTGTKKGCDHGQCGACTVHVNGRRVNACLLLACAHAGDEITTI
FT                   EGIGQPEALHPMQAAFVECDGYQCGYCTSGQIMSAVALLGEAVGPDDAEVREAMSGNLC
FT                   RCGAYQNIVAAIQRVRGQS"
FT   gene            complement(256392..257069)
FT                   /locus_tag="Bphyt_4210"
FT   CDS_pept        complement(256392..257069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4210"
FT                   /product="ThiJ/PfpI domain protein"
FT                   /note="PFAM: ThiJ/PfpI domain protein; KEGG: sme:SMb20212
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4210"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18591"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B2TES0"
FT                   /protein_id="ACD18591.1"
FT                   /translation="MKILLVLTSHNVLGDTGKPTGFWLEEFTAPYYAFTDAGAEVTVAS
FT                   PKGGQPPIDPKSDDPDNQTDTMLRFKKDPATQKALANSVKLADVKAADYDTIFYAGGHG
FT                   PMWDLTNDKNSIALIEDFYNAGKPVAAVCHGPCVLFKATYEGQPLVKGKRVTGFTNDEE
FT                   EAVGLTKVVPFLVEDELKRLGGHFEKVENWAVLTVVDGRLITGQNPASSGPTAKELLKV
FT                   LQA"
FT   gene            257654..257941
FT                   /locus_tag="Bphyt_4211"
FT   CDS_pept        257654..257941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4211"
FT                   /product="protein of unknown function DUF1330"
FT                   /note="PFAM: protein of unknown function DUF1330; KEGG:
FT                   bur:Bcep18194_C7348 protein of unknown function DUF1330"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4211"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18592"
FT                   /db_xref="InterPro:IPR010753"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:B2TES1"
FT                   /protein_id="ACD18592.1"
FT                   /translation="MATYIVFTKESTQDQAELDIYQSKVGETFKGHPVTVLAAYGPQQV
FT                   LEGDAPEGVVIVQFPSTEAARAWYDSPAYQEVAQHRFKGARYRAVLVEGV"
FT   gene            complement(257979..258413)
FT                   /locus_tag="Bphyt_4212"
FT   CDS_pept        complement(257979..258413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4212"
FT                   /product="DGPFAETKE family protein"
FT                   /note="PFAM: DGPFAETKE family protein; KEGG: bam:Bamb_4525
FT                   DGPFAETKE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4212"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18593"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:B2TES2"
FT                   /protein_id="ACD18593.1"
FT                   /translation="MRVMVMVKATAESEAGQMPGTELIEAMGRYNEELVKAGIMLGGDG
FT                   LKPSSKGVRVKFSGKDRTVVDGPFAETKELIAGYWIWQVQSMEEAIEWVRRCPNPMASD
FT                   SEIEIRPFFEAADFGEAFTPELQEHEERLRQQIESKQSKD"
FT   gene            complement(258560..259804)
FT                   /locus_tag="Bphyt_4213"
FT   CDS_pept        complement(258560..259804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4213"
FT                   /product="Citrate synthase"
FT                   /note="PFAM: Citrate synthase; KEGG: bch:Bcen2424_3209
FT                   citrate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4213"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18594"
FT                   /db_xref="GOA:B2TES3"
FT                   /db_xref="InterPro:IPR002020"
FT                   /db_xref="InterPro:IPR016142"
FT                   /db_xref="InterPro:IPR016143"
FT                   /db_xref="InterPro:IPR036969"
FT                   /db_xref="UniProtKB/TrEMBL:B2TES3"
FT                   /protein_id="ACD18594.1"
FT                   /translation="MRNWITLTEAARQLGVQAQTIYAYVSRGNIAVMPDPNDPRKSLYR
FT                   AEDVAGLCRKKQVGRKREALAAGTIFGTEPCIYSGITTFSKGRPYYRGRDSIRLSDTAT
FT                   LEDVAAILWNARGPVSFEPGDLPLQGDERGRQCAFTSLAALAASGHSTLGRTDSALHVE
FT                   AGRLVALIAQAFGARSDADAQTTHERLALGWGQGREGAELIRRAMVLVADHETTSSAFA
FT                   ARITASTGASLPGCLLTGLATLSGPLHGDASGRVRAVFDDVARLGAEHVVVHHLQSATP
FT                   IPGFGHHLYPDGDARAAALLDVLDPPRELTSFINKVVELTGFKPNIDIALAALAAQLAL
FT                   PRDASFALFATARSVGLLAHCIEQLRVGKVIRPRGRYTGRALEDASPALPADGAEKALD
FT                   PATLDKNRVFKVVER"
FT   gene            complement(259900..260289)
FT                   /locus_tag="Bphyt_4214"
FT   CDS_pept        complement(259900..260289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4214"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: bam:Bamb_6375
FT                   glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4214"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18595"
FT                   /db_xref="GOA:B2TES4"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B2TES4"
FT                   /protein_id="ACD18595.1"
FT                   /translation="MMEFKWDHLQLCSADAEATAAWFARCLNAEIVRRPGRVDLRIGSI
FT                   NLFITALAGAQTGRADSKRKQGIDHFGVVVDDLDAAFEHLSRCDAEIVEPIKQVRPGVR
FT                   ACFVRSPGDILVEILERRPAEMTFT"
FT   gene            complement(260315..261631)
FT                   /locus_tag="Bphyt_4215"
FT   CDS_pept        complement(260315..261631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4215"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1; KEGG: bam:Bamb_6376 major
FT                   facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4215"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18596"
FT                   /db_xref="GOA:B2TES5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2TES5"
FT                   /protein_id="ACD18596.1"
FT                   /translation="MKVVEEQTLSARNPAYADTTKRSKVRYVVLSMLLAATILNYVDRS
FT                   ALGIVAPGLSKGLALDKMQMGELFAAFGLAYSIGLVPGGVLTDVLGSRVAYALSLLGWS
FT                   FATLTQGLATGYHMLLGSRLAIGALEAPAFPSNARAVTLWFPARERGFATSVYVMGQYI
FT                   GTPLFTGLLLWISAAYGWRMVFYVTGGVGILFSLFWYRVYRDPHQHASVNAAELQYIND
FT                   GSTAARKPREKFDWRMALKLLSYRQILAICVGKFCNNTLLVFFTTWFMTYLIEARHMSM
FT                   IKVGIFQALPFIGATAGILLAGSLSDFFIRRGVSISTARKTPLIVGTLLGASIVLVNFV
FT                   ESNEAVIAILTIAFFAQGVGSMSWAAVSEIAPRQYVGLTSSITSLAANIAGVTTPLMIG
FT                   YITHHTGHFYWALNLMGAICLLGAFSYSVLLGKLSRIEL"
FT   gene            complement(261686..262444)
FT                   /locus_tag="Bphyt_4216"
FT   CDS_pept        complement(261686..262444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4216"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; KR domain protein;
FT                   KEGG: bam:Bamb_4042 short-chain dehydrogenase/reductase
FT                   SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4216"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18597"
FT                   /db_xref="GOA:B2TES6"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2TES6"
FT                   /protein_id="ACD18597.1"
FT                   /translation="MPASKKFAAVTGAGSGIGRAAAVALANAGFAVALIGRRTEPLLET
FT                   KETIGMAGGEAHVFQADVADAASVEQAFSRIAEAFGRLDVLFNNAGRNAGAVPLEDYDA
FT                   DFWNDVVATNLTGVFLCARSAYRLMKAQSPQGGRIINNGSISAHSPRPHTIAYTATKHA
FT                   VTGITRSIALDGRAFNIACGQIDIGNAATSLTERMNRGVMQADGRVAPEARMDVTHVAN
FT                   AVVHMASLPLEANVLNMTIMASAMPFVGRG"
FT   sig_peptide     complement(262376..262444)
FT                   /locus_tag="Bphyt_4216"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.471 at
FT                   residue 23"
FT   gene            262759..263721
FT                   /locus_tag="Bphyt_4217"
FT   CDS_pept        262759..263721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4217"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding"
FT                   /note="PFAM: D-isomer specific 2-hydroxyacid dehydrogenase
FT                   catalytic region; D-isomer specific 2-hydroxyacid
FT                   dehydrogenase NAD-binding; KEGG: bam:Bamb_6378 D-isomer
FT                   specific 2-hydroxyacid dehydrogenase, NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4217"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18598"
FT                   /db_xref="GOA:B2TES7"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2TES7"
FT                   /protein_id="ACD18598.1"
FT                   /translation="MSENNRTRLLIARKVPTAVANRAEAEFHAFVTESDMDAWSVVDFC
FT                   KKHATPAVLIGKKSGLQAEHIAALPSTVKIIANASAGFDHMDVAAARERGIVVTNAPDA
FT                   LTECTADFSLLLVLAACRRASEYERIMRNGWGKSFGMTEMLGTRVNGKTLGIVGFGRIG
FT                   RAVAKRAQGFGMRVIYTDINRAAASLENGATFYNSLDEMLPHCQVLTLHVPGGGVPLMT
FT                   KREFALLPAGAVFVNAARGALVDEDALYEALTSGHLFGAGLDVYRNEPNVDKRFAGLDN
FT                   VFLTPHMASATMETRDQMGFTALDNVAAVLNERPALNPV"
FT   gene            complement(263954..264427)
FT                   /locus_tag="Bphyt_4218"
FT   CDS_pept        complement(263954..264427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4218"
FT                   /product="PRC-barrel domain protein"
FT                   /note="PFAM: PRC-barrel domain protein; KEGG: bxe:Bxe_B2570
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4218"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18599"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="UniProtKB/TrEMBL:B2TES8"
FT                   /protein_id="ACD18599.1"
FT                   /translation="MGSINPQGDTRRGAEIVGGGMGEGPGPDIMAAATLDGNKVMSSDG
FT                   EHVGKISDIMLDVRNGRIAYAVLSEGGFLGMGSTLHAIPWSALTLDTDEKCFIVDITAQ
FT                   RLKDDPGFDKDHWPTMADAKWGESTYSYYNRQPYWSATHDVVESDPAIRPSEH"
FT   gene            complement(264498..264728)
FT                   /locus_tag="Bphyt_4219"
FT   CDS_pept        complement(264498..264728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4219"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bte:BTH_II0963 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4219"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18600"
FT                   /db_xref="UniProtKB/TrEMBL:B2TES9"
FT                   /protein_id="ACD18600.1"
FT                   /translation="MQILPNTPATRISSHRGYGLRASTTPTGDGLHSADLVIEQPGRPP
FT                   RAFASLDLFYDHEQAMQYATVWGRIWVDSKT"
FT   gene            complement(264867..265595)
FT                   /locus_tag="Bphyt_4220"
FT   CDS_pept        complement(264867..265595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4220"
FT                   /product="haloacid dehalogenase, type II"
FT                   /note="TIGRFAM: haloacid dehalogenase, type II;
FT                   HAD-superfamily hydrolase, subfamily IA, variant 2
FT                   (HAD-like); PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: bam:Bamb_3446 haloacid dehalogenase, type
FT                   II"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4220"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18601"
FT                   /db_xref="GOA:B2TET0"
FT                   /db_xref="InterPro:IPR006328"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B2TET0"
FT                   /protein_id="ACD18601.1"
FT                   /translation="MPNSPEIKALLFDVFGTVVDWRSGVARDVGQFLSRHAVAIDSFAF
FT                   ADAWRRQYAPAMEEIRSGRRQFVRLDVLHKENLLKVLADYGVDNSSISAAELDELNHAW
FT                   HRLDAWPDSVEGLLRLKRHFMIAPLSNGNIRLMIDMAKRAALPWDAILGAEVVRAYKPS
FT                   PQVYVDTVEILGLNPAEVCMVAAHNSDLAAARQCGLKTAFVVRPVEHGPDQQSDLHAEQ
FT                   RWDFAAVDMNDLATQLGCPT"
FT   gene            265743..266261
FT                   /locus_tag="Bphyt_4221"
FT   CDS_pept        265743..266261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4221"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A0242 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4221"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18602"
FT                   /db_xref="GOA:B2TET1"
FT                   /db_xref="UniProtKB/TrEMBL:B2TET1"
FT                   /protein_id="ACD18602.1"
FT                   /translation="MKTLDAMSRAGRAVALVVLSAALSGCYYYVPYGYVPYGVVPTAAA
FT                   PQQYSFSTAATAADGAAVSDATVATNTYIAPAVPAFVAPAYYPVAYPYYGSPAWWGPSV
FT                   SLSFGYWGGCCYGGGRYGYWGRHGYGYWGHGYSGGWGGHGGWGGRGYPGHGMGGGHYWG
FT                   SGGGHGRSH"
FT   gene            complement(266288..266614)
FT                   /locus_tag="Bphyt_4222"
FT   CDS_pept        complement(266288..266614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4222"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B1018 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4222"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18603"
FT                   /db_xref="GOA:B2TET2"
FT                   /db_xref="InterPro:IPR001801"
FT                   /db_xref="InterPro:IPR037150"
FT                   /db_xref="UniProtKB/TrEMBL:B2TET2"
FT                   /protein_id="ACD18603.1"
FT                   /translation="MDEQKRLSMIAYLRRKMTTVGIKVADLKAAIAEDRARQKSARYRS
FT                   AFGDTWDGKGDMPQWLKQATSAGQSLTHFAIDKPSASASRQRPAIDWSRDPFAGTRLAT
FT                   VRAS"
FT   gene            267165..267416
FT                   /locus_tag="Bphyt_4223"
FT   CDS_pept        267165..267416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4223"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4223"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18604"
FT                   /db_xref="UniProtKB/TrEMBL:B2TET3"
FT                   /protein_id="ACD18604.1"
FT                   /translation="MKLRLMVASAFGLFVMAGFAYAQSMPDAAQPAPQQSAATQADSSP
FT                   STGMEAYGGTPDTRMQSGARHARPCRVDPQCNVFFGGS"
FT   sig_peptide     267165..267233
FT                   /locus_tag="Bphyt_4223"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.995 at
FT                   residue 23"
FT   gene            complement(267662..268183)
FT                   /locus_tag="Bphyt_4224"
FT   CDS_pept        complement(267662..268183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4224"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A1905 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4224"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18605"
FT                   /db_xref="UniProtKB/TrEMBL:B2TET4"
FT                   /protein_id="ACD18605.1"
FT                   /translation="MDDRFDRRELLLHLGDILAALNCLNDANEPGASVAHLVKKHASLE
FT                   HFAFLHALSPTMTTSEFGTRVARSFFSWPSELLEADLNRDTLASTVQQNLFEANPDGWN
FT                   AYLGYVRKKVKWFGTALSNHGKDALAEPSHDVPNETSPIEPPVKVEPTAQADARDEKRG
FT                   WPWPEPRSKS"
FT   gene            complement(268356..268850)
FT                   /locus_tag="Bphyt_4225"
FT   CDS_pept        complement(268356..268850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4225"
FT                   /product="phasin family protein"
FT                   /note="TIGRFAM: phasin family protein; PFAM: Phasin family
FT                   protein; KEGG: bte:BTH_I1867 phasin family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4225"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18606"
FT                   /db_xref="InterPro:IPR010127"
FT                   /db_xref="InterPro:IPR018968"
FT                   /db_xref="UniProtKB/TrEMBL:B2TET5"
FT                   /protein_id="ACD18606.1"
FT                   /translation="MSTLIPQQLVAAQQSSLEALFGLTNKAFEGFEQLVALNLQVGKAV
FT                   LAENQEIVTKALSAGNPGALFALQASLSQPVAEKVVAYGRRVHEIVSGVQSEITAAATA
FT                   QGQQFQRDAQGFVESLQKNTPAGSESAVAAWNSVLSAANATYESANKAAKQFVSSVSAV
FT                   H"
FT   gene            269225..269713
FT                   /locus_tag="Bphyt_4226"
FT   CDS_pept        269225..269713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4226"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: xau:Xaut_2221 NUDIX
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4226"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18607"
FT                   /db_xref="GOA:B2TET6"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:B2TET6"
FT                   /protein_id="ACD18607.1"
FT                   /translation="MPSLERVRPAMLIDSVWRMALRLGFQFARVWWHLRRPHHEGALVA
FT                   IYVGQALLLVKSSYRAEWNFPGGSVHPGEAPDAAARREMEEEIGLSTGRLLPAGSACGI
FT                   WDGRRDRVHFFELRLDCMPALRLDNREIVAARLASPEEMHSIALTKAVTAYLGKDGRC"
FT   gene            complement(269803..270717)
FT                   /locus_tag="Bphyt_4227"
FT   CDS_pept        complement(269803..270717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4227"
FT                   /product="ornithine cyclodeaminase/mu-crystallin"
FT                   /note="PFAM: ornithine cyclodeaminase/mu-crystallin; KEGG:
FT                   bxe:Bxe_A1829 putative ornithine cyclodeaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4227"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18608"
FT                   /db_xref="InterPro:IPR003462"
FT                   /db_xref="InterPro:IPR023401"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2TET7"
FT                   /protein_id="ACD18608.1"
FT                   /translation="MQFITDDHVRRLITMRDAIAELRIALAEHGAGRAPVQPRVRTKGE
FT                   HVSVSMMGAILPSRGVCGAKVYSTHGGRFDFVVPLFSSDDGCLISILHGDALTEFRTAA
FT                   VTRIASDALARPGARVLAVFGTGRQARAHIRALADGSSIERVLIVGIDHVAQTVAEMQA
FT                   LFPDKLIEASHAQAAARAADVIVTATRSATPLFDGTWVKPGVFIAAIGSSKPDARELDD
FT                   ALLARANTLVVESLEQARSEAGDLLMAAPGVVAWDDIIELGAVLANRRIEPRARGDVTI
FT                   FKSLGFGLADVALAGLITRRMSN"
FT   gene            complement(270764..271756)
FT                   /locus_tag="Bphyt_4228"
FT   CDS_pept        complement(270764..271756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4228"
FT                   /product="L-asparaginase, type II"
FT                   /EC_number="3.5.1.38"
FT                   /note="KEGG: bxe:Bxe_B2492 putative
FT                   asparaginase/glutaminase; TIGRFAM: L-asparaginase, type II;
FT                   PFAM: Asparaginase/glutaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4228"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18609"
FT                   /db_xref="GOA:B2TET8"
FT                   /db_xref="InterPro:IPR004550"
FT                   /db_xref="InterPro:IPR006034"
FT                   /db_xref="InterPro:IPR020827"
FT                   /db_xref="InterPro:IPR027473"
FT                   /db_xref="InterPro:IPR027474"
FT                   /db_xref="InterPro:IPR027475"
FT                   /db_xref="InterPro:IPR036152"
FT                   /db_xref="InterPro:IPR037152"
FT                   /db_xref="InterPro:IPR040919"
FT                   /db_xref="UniProtKB/TrEMBL:B2TET8"
FT                   /protein_id="ACD18609.1"
FT                   /translation="MTAKANIVVIGTGGTIAGQGKASVNTSTYMCSVLGIDEILGSIPH
FT                   AGELANLRAEQLLQTGSENFNNTHLLAIGNRVAELLARNDVDGVVITHGTDTIEETAYF
FT                   LHLTLKSAKPVVVVGSMRPPSAMSSDAALNLYDALAVATHPSSRGLGTLVVANNEIHTA
FT                   RDVVKSNSFKLDAFRSPYGALGYVIEGAPRYYRRPARAHTLDTPWSITTLRSLPKVDIV
FT                   YAYGALEPGAISAITANARGLIYVGTGNGNVASHLIDPLRDAARRGVHVVRASRTGSGI
FT                   VLHNGAQPDHEYGWLTVDDQIPQKARILLTLALTQTDDTAALQAVFERY"
FT   gene            complement(271815..273062)
FT                   /locus_tag="Bphyt_4229"
FT   CDS_pept        complement(271815..273062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4229"
FT                   /product="D-amino-acid dehydrogenase"
FT                   /EC_number="1.4.99.6"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   reu:Reut_A2589 D-amino acid dehydrogenase small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4229"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18610"
FT                   /db_xref="GOA:B2TET9"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B2TET9"
FT                   /protein_id="ACD18610.1"
FT                   /translation="MRILIIGAGVIGLSSAYYLSRAGYDVTVADRHAEVASETSFGNGG
FT                   QLSYSYVAPLAGPGVVSKLPRWLTQRDSPVRFRPKLSVEQWRWCFEFLSACTRARSELT
FT                   TQKLLSLSFLSRTLMHELIAAEPSLDFDFVRSGKLVLHRDANAMQSAVDLLAFQRTLGC
FT                   EQQALSADACVEIEPALAHARSFLAGGIHTPSEDTADCRRFCKGLEAVLRERGVRFLMN
FT                   TPIDGLKFGAKGVEAICDGAPLAADRIVVASGAGAAQLLKPLGIRVAIYPIKGYSLTFD
FT                   LQPHITAPHVSITDFARKVVYARLGERLRVGGIADIGGYSLDADPARFATLRKETATLF
FT                   PEVAQSAASGEWTGLRPATPHGLPIVGPTRYPNLWLNVGHGALGFTLATGSAALLADGL
FT                   AGSNNRELSSAFVLSH"
FT   gene            complement(273265..274356)
FT                   /locus_tag="Bphyt_4230"
FT   CDS_pept        complement(273265..274356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4230"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; ThiJ/PfpI domain protein; KEGG: pol:Bpro_1392
FT                   transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4230"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18611"
FT                   /db_xref="GOA:B2TEU0"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEU0"
FT                   /protein_id="ACD18611.1"
FT                   /translation="MPTARSSSPASPATAPTAHELVEQLDALPRALQARPSRSEAELSV
FT                   GILLWPRFPMLSLAGLCDALRHAADRGDQSRQLRCLWTIVGVQAEAVEASCGIPVRVQS
FT                   AFPDVTQFDYVVVIGGLLPHLDQVDRRYWDYLQQAAQAGIPLVGMCTGSFVLARAGLLE
FT                   DRVACVHSFHLDDYRRMFPSLRVITHADYLIDGNRITCAGGISVVELAARLISLHCGPD
FT                   RASKVIHQMTVSRQGGSSFVERRAALGYLSVDDATVRHAVLLMEENLEAPLNIAVIAKM
FT                   IGTSVRNLERAFMSEMNASPNEFYRRMRLRYARWMLVNTARKITDIAYECGFADSAHFI
FT                   RAFREAYGVTPGKLRASRSVATS"
FT   gene            274599..275753
FT                   /locus_tag="Bphyt_4231"
FT   CDS_pept        274599..275753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4231"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   bxe:Bxe_A4327 ABC branched chain amino acid family
FT                   transporter, periplasmic ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4231"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18612"
FT                   /db_xref="GOA:B2TEU1"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEU1"
FT                   /protein_id="ACD18612.1"
FT                   /translation="MSKSTALGRGMATVGILGTLAAAAVGAARADEMVKIGEAAPVTGP
FT                   ASYLGKDTENGARLAIEEINQKGLVIGGQKVTLVFDAQDDAGDPRQATQVAQKLVDDKV
FT                   VAVVGHMQSGSTIPASKIYNDAGVVQVSPSATNPAYTLQGFKTAYRVVATDAQQGPTLA
FT                   DYAAKTLKVKTVAIVDDSTAYGQGLAVEFERQAKANGVTVLSHDASTDKAVDFRAILTK
FT                   IKGEKPDAIMYGGLDGTGGPFAKQAKQLGITIKVLAGDGLCADDLAKLAGDAADNVICS
FT                   IAGAPLLKMAEGPAFVERYKKRFGYAPVLNSPFAYDAVGVIVAAMKRAQSTDSAKILAA
FT                   MPATDYHGVLGETQFDSRGDLRHGVISLYKYVGGKQALLGVVEK"
FT   sig_peptide     274599..274691
FT                   /locus_tag="Bphyt_4231"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.881 at
FT                   residue 31"
FT   gene            276083..276619
FT                   /locus_tag="Bphyt_4232"
FT   CDS_pept        276083..276619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4232"
FT                   /product="Hemerythrin HHE cation binding domain protein"
FT                   /note="PFAM: Hemerythrin HHE cation binding domain protein;
FT                   KEGG: bxe:Bxe_B2480 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4232"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18613"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEU2"
FT                   /protein_id="ACD18613.1"
FT                   /translation="METTKQDKTETGSGAPDALAFLEAEHRAVEKLFTAFEKAADDDLE
FT                   AKSALAQRACEELSIHTMLEEELLYPAAQEALPDSDAIDVEEAYIEHFLVKTLIAKFET
FT                   MKAGDKGFDATFKVMSEMVGHHVEEEEEELFPELRKTPCDLRALGEKMAKRKAELQGKL
FT                   DAAGSKLVGDKTLAG"
FT   gene            277858..279399
FT                   /locus_tag="Bphyt_4233"
FT   CDS_pept        277858..279399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4233"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: psb:Psyr_1002 ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4233"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18614"
FT                   /db_xref="GOA:B2TEU6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEU6"
FT                   /protein_id="ACD18614.1"
FT                   /translation="MSMALELVGIHKSFDGFIALSDAQFDVRWGELHALLGENGAGKST
FT                   LMNVAAGLYAPETGTISVGGQPVRLSGPGDAARIGIGMVHQHFKLVSRFTVAENILLGI
FT                   SMGGAQPRYGKRLAKVREAICSQCATLGFEIDPDRRISQLSVAEQQRVEILKVLLAGAR
FT                   ILVLDEPTAVLTGQEAARLLETMRLLASKGSAVVLVTHKMADVRRYADRVTVMRSGRTV
FT                   NTFRPSEMSQAEVVRLAVGEVVAPEKPSIDAANRDRAEPRLLLRGVRSAASRTGTRQGL
FT                   PALDGVDLTVHAGEIYGLAGVGGNGQSELMQAIMGLLPLDEGTMVIEGAGDLRRASSVD
FT                   RRDMGIACIPADRQTFALAGLLSVVENFAIGQVHAGHYGNPLWLDYRRMEADAAKAVKH
FT                   FDVLGVRSLRQSVSLLSGGNAQKLVIAREFSRRPRVVLAHSPSRGLDVRASAQVHARLR
FT                   AARDEGAAVLIISEDLDEVLALADRAGVMVRGRIVGNFSAPVDRQAIGQAMVAHS"
FT   gene            279424..280617
FT                   /locus_tag="Bphyt_4234"
FT   CDS_pept        279424..280617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4234"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   psp:PSPPH_1052 branched-chain amino acid ABC transporter,
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4234"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18615"
FT                   /db_xref="GOA:B2TEU7"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEU7"
FT                   /protein_id="ACD18615.1"
FT                   /translation="MTNTVPSNQTEVRMPDSALDGESSTSFASLEATPTPRRACRTSLL
FT                   ARRYALELRQETPRRKQAVVLAFSVTVGLAVCVAILMTAGISASDLFNEFIVETLGDAD
FT                   NFRAVLFQAAPMVMVGLAAALSFRAKFWNLGLEGQMVWGAIGATAVALADAGTPETRLW
FT                   LMGAAALVCGALWTVLPLLLRMRLGISEIISTLMLNYVAANLLLNLVYGQWKDPRDSFP
FT                   HSRNFLAAERLPSIASGYSSAILLAVLFALAAWWFLHRSRAGIYVRFVNVNARAAEAMG
FT                   VPVRNVVAGVVLLSGALAGFAGFTVTAAQAGRLTQDFYSGYGFSGILIAFLARNNPIAA
FT                   SVVALLVAALFVTGRSLQVLYQIPFSMVQLIQAILVIVVAASDFFTRYRLSPVGVAE"
FT   gene            280614..281540
FT                   /locus_tag="Bphyt_4235"
FT   CDS_pept        280614..281540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4235"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   psb:Psyr_1004 inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4235"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18616"
FT                   /db_xref="GOA:B2TEU8"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEU8"
FT                   /protein_id="ACD18616.1"
FT                   /translation="MNLLFSWIGNVPDAAVPFALAALGLIVSERAGVLSLGAEGIMLVG
FT                   ALAGIGTQLTVHNAGIALLMSMIAGGAISVLFAVMVVWLRVNQVIAGLALVFFCQGLTS
FT                   LLGTLAGWINRPVSGLQPIALGPVARLPLVGSLFNQNLVVYLTPLIFAVVTWYLNRTVG
FT                   GLRLRSVGESPPAADAAGVAVLRVRFLAIMAGSTLVGLAGGYISVAGTHMWIADMTGGR
FT                   GWIAVALVIFARWSPGRALIGALLFGGIEALIPQMAAAGISMPQYYVLCAPYLITLAVM
FT                   IQGAIVRRGSDETPCALGEPYVREERR"
FT   gene            281719..282801
FT                   /locus_tag="Bphyt_4236"
FT   CDS_pept        281719..282801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4236"
FT                   /product="basic membrane lipoprotein"
FT                   /note="PFAM: basic membrane lipoprotein; KEGG: psa:PST_3583
FT                   bmp family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4236"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18617"
FT                   /db_xref="GOA:B2TEU9"
FT                   /db_xref="InterPro:IPR003760"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEU9"
FT                   /protein_id="ACD18617.1"
FT                   /translation="MNSRFLLVAMSMACCGVATTAYADGFTLKAKPKIAMVYFSSKNDA
FT                   GWTQSFDEARVRMEAALGEKIPYVESIPEDAAVVVPAVEQLIKRGNNIIIGTAFGYSDA
FT                   FKDLAKRHPDVAFLDAAGTTNGPNLESFYGRTYESQYLCGMAAAAVSKTGKLGFVAAHP
FT                   FGVVNWTINAYELGARKVNPNAVLTVVYTGAWDDPVKERAAATALIDQGDDVLGAHTDS
FT                   PTVQLVAQERGVYATGHHRDMRQYAPKSTVCSSVWVWDKFLIPEIRKIEAGNWQPAPYG
FT                   AFIEMKDGGTDIAGSGNAVPADKQALIKAERDAIIKGKQIYAGPLSDRDGQLRVSAGQV
FT                   LSDKDLWKMEWFVKGVITQK"
FT   sig_peptide     281719..281790
FT                   /locus_tag="Bphyt_4236"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 24"
FT   gene            282980..283302
FT                   /pseudo
FT                   /locus_tag="Bphyt_4237"
FT   gene            283325..283900
FT                   /locus_tag="Bphyt_4238"
FT   CDS_pept        283325..283900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4238"
FT                   /product="S-(hydroxymethyl)glutathione synthase"
FT                   /EC_number="4.4.1.22"
FT                   /note="KEGG: bam:Bamb_5797 glutathione-dependent
FT                   formaldehyde-activating enzyme; TIGRFAM:
FT                   S-(hydroxymethyl)glutathione synthase; PFAM:
FT                   glutathione-dependent formaldehyde-activating GFA"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4238"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18618"
FT                   /db_xref="GOA:B2TEU3"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="InterPro:IPR014185"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEU3"
FT                   /protein_id="ACD18618.1"
FT                   /translation="MTRAIHLSVDHGIQKGASDFGGGTLRCSCTNDPVEVHVDTQVLYN
FT                   HACGCTQCWKPEHTLSSVVGVVPREKVAVTSHREKLKVRDDTALIQRDARTACGTHLYG
FT                   RIENKERAFYGLDFIQTELSTEAGWDGPGFAPFVSSIIESGTAPSSMVEVRQTPREKGL
FT                   EPYDCLSPALMDILAAHSAKAKSTHSEA"
FT   gene            283903..284733
FT                   /locus_tag="Bphyt_4239"
FT   CDS_pept        283903..284733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4239"
FT                   /product="S-formylglutathione hydrolase"
FT                   /EC_number="3.1.1.1"
FT                   /note="KEGG: har:HEAR2036 S-formylglutathione hydrolase;
FT                   TIGRFAM: S-formylglutathione hydrolase; PFAM: putative
FT                   esterase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4239"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18619"
FT                   /db_xref="GOA:B2TEU4"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR014186"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEU4"
FT                   /protein_id="ACD18619.1"
FT                   /translation="MERIEQHASYGGYQEVWKHASSTLGCEMRFGLYLPNAALRGQKCP
FT                   VLYWLSGLTCTEQNFITKAGAQRYAAEHGLIIVAPDTSPRGDDVPDDPGYDLGKGASFY
FT                   INAAQEPWATHYRMYDYVVDELPALVEAEFPANGARAISGHSMGGHGALTIALRNPGRY
FT                   RSVSAFSPIVAPTEVPWGRKAFRAYLGEDREVWKQYDTVELLKSAVERLPLLVDQGEGD
FT                   EFLEEQLKPQLLRAACEAAAHPLRLNLRPGYDHSYYFISNFIGEHIAHHAGALR"
FT   gene            complement(284936..286489)
FT                   /locus_tag="Bphyt_4240"
FT   CDS_pept        complement(284936..286489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4240"
FT                   /product="transcriptional regulator, GntR family with
FT                   aminotransferase domain"
FT                   /note="PFAM: regulatory protein GntR HTH; aminotransferase
FT                   class I and II; KEGG: bpt:Bpet4036 transcriptional
FT                   regulator, GntR-family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4240"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18620"
FT                   /db_xref="GOA:B2TEU5"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEU5"
FT                   /protein_id="ACD18620.1"
FT                   /translation="MIAYAPPSAAHVPANNKISANDCEATTLSIASSPRREWTLLELLR
FT                   IERQRGVSLVKQIVASLDALVDSGRLRPGTKTPSVRELAKSLDVSTFTVAEAYDVLVSR
FT                   GVLSSRPGSGYFVTSRAAHVTALLDEPPKRKEAASGSWLPVLVWNQDPDLQPVGSGVLP
FT                   PEWCSESTLLQAVRQAIKMPAERLVGYGHPLGFQRLRQLLARGFTERFCPVSPEQIILT
FT                   NGVSHGLDLVVRTILQPGDTVFVEEPGYFNTNHLLRSHGVRMLGVPRGADGLHVDKLAA
FT                   MAAEHRPKAIFLSSVLQNPLSSTLPASQAYRVIALAEQYDFLIVEDDIYRDLASPSDPS
FT                   LTSLDGLNRVICLGGFSKTIAPSLRTGFILCPDHLVSGIVRTKMASGLTTSELNERCIY
FT                   EVLADPGHRRYIDRLRMRLANDREQFLSFLSEVGITPLATPRGGLFVSAGWRIQPTAQF
FT                   NAELITAEARAAKIALVGGDLFMLSPSTDSVWFRFNVAYCGSPELQHFLRGISARVPKA
FT                   "
FT   gene            complement(286772..287502)
FT                   /pseudo
FT                   /locus_tag="Bphyt_4241"
FT   gene            287713..288102
FT                   /locus_tag="Bphyt_4242"
FT   CDS_pept        287713..288102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4242"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: psa:PST_3582 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4242"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18621"
FT                   /db_xref="GOA:B2TEV0"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR041581"
FT                   /db_xref="PDB:2RBB"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEV0"
FT                   /protein_id="ACD18621.1"
FT                   /translation="MADLSYVNIFTRDIVALSAFYQQVFGFQEIESIRSPIFRGLDTGK
FT                   SCIGFNAHEAYELLQLAQFSETSGIKFLLNFDVDTKEAVDKLVPVAIAAGATLIKAPYE
FT                   TYYHWYQAVLLDPERNVFRINNVLL"
FT   gene            288118..289092
FT                   /locus_tag="Bphyt_4243"
FT   CDS_pept        288118..289092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4243"
FT                   /product="ferredoxin"
FT                   /note="PFAM: ferredoxin; oxidoreductase FAD/NAD(P)-binding
FT                   domain protein; Oxidoreductase FAD-binding domain protein;
FT                   KEGG: mms:mma_2506 oxidoreductase/oxygenase, VanB family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4243"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18622"
FT                   /db_xref="GOA:B2TEV1"
FT                   /db_xref="InterPro:IPR000951"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEV1"
FT                   /protein_id="ACD18622.1"
FT                   /translation="MKSSETFEVEVRGIRIEAETVRSFELWPVSGELPPFTAGAHIDVH
FT                   LSHGMTRQYSLTNSLERHRYVIAVQRDPGGAGGSMSMHDSVALGSRLIVSAPRNYFPLN
FT                   EAAVHSVLIAGGIGVTPLLAMVRRLCQLGLSWDFYYCARVPARAAFLSELKELAATTYP
FT                   DRALHCVFDGEAGVTSLNLGDVRAAHRPDSDFYCCGPAPLMDAFSTTFASLPPERVHLE
FT                   YFKAPVADTLGEAEGAFTVTLSRQGKTLVVPPNRSILEVLRENGVPMLSSCRQGICGTC
FT                   ETRVVEGVPDHRDHVLTPAERASNQTMMICVSRCKGEALTLDI"
FT   gene            289194..290252
FT                   /locus_tag="Bphyt_4244"
FT   CDS_pept        289194..290252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4244"
FT                   /product="Rieske (2Fe-2S) domain protein"
FT                   /note="PFAM: Rieske [2Fe-2S] domain protein; KEGG:
FT                   mms:mma_2504 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4244"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18623"
FT                   /db_xref="GOA:B2TEV2"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEV2"
FT                   /protein_id="ACD18623.1"
FT                   /translation="MTNLADIKINVEKGEVPELFTAMRKYWHAVAYSGQLKDKPLGVTL
FT                   LGESVVIARLNGEVRAMHGRCPHKGTALALGEVVDGKIECPYHGWQFDGGGKCVRVPAR
FT                   EELTEGMNVSIDCYYAAEHVGIIWVALEKPIAPLPDFPELSDPSFRIQQGPSYEWATSA
FT                   PRRLENFVDFAHFPYVHDGTIGARDNPAVETVKVWREGHVLRFDRSGYLPPNPDLYKFL
FT                   FPVRETDRVTPVNAYHIFLPATVHASFRMPNDKRYVLFMSASPVTEDLTRIFWWQARDF
FT                   RTEPMEDRFFIELEDTILGEDKAIIESQRPKWFSFNGENRDDRETPVRGSDIVSIEYRR
FT                   WLFENFTASQKS"
FT   gene            290385..291500
FT                   /locus_tag="Bphyt_4245"
FT   CDS_pept        290385..291500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4245"
FT                   /product="Rieske (2Fe-2S) domain protein"
FT                   /note="PFAM: Rieske [2Fe-2S] domain protein; KEGG:
FT                   mms:mma_2504 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4245"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18624"
FT                   /db_xref="GOA:B2TEV3"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEV3"
FT                   /protein_id="ACD18624.1"
FT                   /translation="MTVGNVKEVPVLTRENELDVEGEARVYRSLRHFWHVVAYSHEVTD
FT                   KPVGFTLLEKDIVIVRLNGEISVFDDICPHRGTRLSLGHVRDGCRLECPYHGWQFDQEG
FT                   ELTLAPQRPDLAGQLRARTRKYLSVEKYGMVWACLEDKPHFPLPDYPVWDNPEFHYVAV
FT                   SPAEDWDCSAPRRVENYTDYSHFAILHDGFLADRTVPQVPPHDVFRNGNKLENVQGEGA
FT                   WVRVPIDSAAWGGKDKPADPYLRMYFKWRVFMPLTCVYDISFQDGNRYHLLFHPTPMGP
FT                   RKTRNFTVSHRDFGDKAKANEELGDFVKLIYDQDRWVVESQRPEELPEDLTKEMHVKGV
FT                   DKYSVEYRMWLLELARELTKPVIHLHQESVK"
FT   gene            291497..291706
FT                   /locus_tag="Bphyt_4246"
FT   CDS_pept        291497..291706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4246"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fre:Franean1_1634 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4246"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18625"
FT                   /db_xref="GOA:B2TEV4"
FT                   /db_xref="InterPro:IPR001080"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEV4"
FT                   /protein_id="ACD18625.1"
FT                   /translation="MRVEVDMKKCICAGMCVSLAPTLFDLDGNSRLMVIKSECSSPGDI
FT                   KEAQDAKACCPVEAIRLTDLCRTE"
FT   gene            291726..292955
FT                   /locus_tag="Bphyt_4247"
FT   CDS_pept        291726..292955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4247"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: rha:RHA1_ro02653 probable
FT                   FAD-dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4247"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18626"
FT                   /db_xref="GOA:B2TEV5"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028202"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEV5"
FT                   /protein_id="ACD18626.1"
FT                   /translation="MQNAIKSTSRRVAIVGGGLAALRCTEELRRGGHDGRIAIVTAEPH
FT                   LPYDRPPLSKDVLLGAKEFDEVQYRDDAFYRDHQVDMYLSHPATELRILEREVVANGSA
FT                   IAFDDLLICTGASPRSFPLKSNCDGIYTLGRIEDTLRLRAALRSGAPRVVILGAGFIGA
FT                   EVASCARSLGLETTIVNLAATPLERAVGPEMGGMLSALHADHGVRLLCSVSIAEIFGDG
FT                   RVEELLLTNGERIACDILVIGIGSTPNIGWLEGSGLELANGIVCDAALSAGPPGIYAAG
FT                   DVAWWPNGLFGRGMRCEQWTNAAEQGRHVARNILAGHEGRTPFVGSNYFWSDQYGKRIQ
FT                   FAGSEVADEVKIVKGSYGEGHFLAYYRKGDQLCGALALNEPKSLMLAKQQIEKRSRWDL
FT                   ALEAMGHCVP"
FT   gene            293291..294607
FT                   /locus_tag="Bphyt_4248"
FT   CDS_pept        293291..294607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4248"
FT                   /product="aminotransferase class-III"
FT                   /note="PFAM: aminotransferase class-III; KEGG: tel:tlr0408
FT                   omega-amino acid:pyruvate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4248"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18627"
FT                   /db_xref="GOA:B2TEV6"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEV6"
FT                   /protein_id="ACD18627.1"
FT                   /translation="MQKSSGPALGSYWMPFTANRDFKQHPRMLVSAEGMYYKDIDGKPV
FT                   LDATAGLWCVPLGHRQPKIVKAVQEAVSTLDYGPSFQVGHPAVFAFAERLIDYSGNRFG
FT                   QVFFTNSGSESVDTALKIAIGYHRACGDATRTRLIGRERGYHGVGFGGISVGGISANRR
FT                   GFGSLLTGVDHLPHTYNLEHNAYTRGEPTWGSHLAEDLERIVALHDASTIAAVIVEPVA
FT                   GSTGVLVPPKGYLKRLREICTAHGILLIFDEVITGFGRLTTPFAADYFDVEPDMITSAK
FT                   GLTNGVVPMGAVFVKSHVHDAFMHGPDGIELFHGYTYSGHPLACAAGLASLDIFAECDV
FT                   LAHARGIAGYWEDAVHALKGLPHVKDLRNLGLIAAIELDSIPGRIGARAFDAFRRAFAD
FT                   GLLIRVTGDTIALSPPLVLEKTHIDEMFEKIAAILRALD"
FT   gene            294653..296158
FT                   /locus_tag="Bphyt_4249"
FT   CDS_pept        294653..296158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4249"
FT                   /product="methylmalonate-semialdehyde dehydrogenase"
FT                   /note="TIGRFAM: methylmalonate-semialdehyde dehydrogenase;
FT                   PFAM: Aldehyde Dehydrogenase_; KEGG: bbr:BB0868 putative
FT                   methylmalonate-semialdehyde dehydrogenase [acylating]"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4249"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18628"
FT                   /db_xref="GOA:B2TEV7"
FT                   /db_xref="InterPro:IPR010061"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEV7"
FT                   /protein_id="ACD18628.1"
FT                   /translation="MTNLETISHFINGQRTASLRNAETQAVFNPALGEAVAQVAMGSAE
FT                   DIHAAVGAAAAAFPAWSARPPLARARILAKYLQLMQQHTDTLAQMLTREHGKTLDDARG
FT                   EVARGLEVVEFAVGIPHLLKGEFSDQISRGIDAWSIRQPLGVVAGITPFNFPAMVPMWM
FT                   FPIALACGNTFVLKPSERDPSCSLLHAELLKEAGLPDGVFNVVQGDKAVVDALLDHPEV
FT                   QAVSFVGSTPIAEYVYARASANGKRAQALGGAKNHLVVMPDADMAMATDALIGAAFGSA
FT                   GERCMAISVAVAVGDVGDRLVAALAERTRALKIDDGTAPGAEMGPVITAAARERIESLI
FT                   GAGVADGATLVVDGRDYRVPGRESGFFVGGTLFDHVTPEMTVYREEIFGPVLCVVRVPN
FT                   VAAAVELINAHEYGNGVAVFTRDGGVAREFTRQVQIGMVGVNVPVPVPMAFNSFGGWKR
FT                   SLFGDHHIYGPEGVRFYTRHKAVMQRWPDTITAGAEFAFPQHN"
FT   gene            296186..297607
FT                   /locus_tag="Bphyt_4250"
FT   CDS_pept        296186..297607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4250"
FT                   /product="dihydropyrimidinase"
FT                   /EC_number="3.5.2.2"
FT                   /note="KEGG: pna:Pnap_4021 dihydropyrimidinase; TIGRFAM:
FT                   dihydropyrimidinase; PFAM: amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4250"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18629"
FT                   /db_xref="GOA:B2TEV8"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR011778"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEV8"
FT                   /protein_id="ACD18629.1"
FT                   /translation="MSVLIRGGVVVNADGETRADVLCEKGRIVAVGTGLAAGADTEVID
FT                   AGGQYVMPGGIDPHTHMQLPFMGTVTADDFFTGTAAGLAGGTTTIMDFVIPSPQESLMG
FT                   AFKKWRGWAEQACSDYTFHVAVTWWDESVHADMGTLVNQHGVNSFKHFMAYKNAIMADD
FT                   EILVKSFRRALELGAVPTVHAENGELVFQLQQELLQAGVTGPQAHPLSRPPVVETEAVQ
FT                   RAIAIANVMNTPLYIVHVSCAESVEAIALARSRGQRVFGEALAGHLVIDDSVYTHPDFD
FT                   FAAGHVMSPPFRSKAHQAALWNGLQAGSLHTTATDHCTFCAAQKATGRDDFTRIPNGCG
FT                   GVEDRMSVIWDTGVNGGRLTPSEFVKVTSANVAQIFNMYPRKGVIAVGADADVVVWDPE
FT                   ATRTISARTQHARGGFNVFEGRVVRGNPSHTVSNGKVVYAQGDLRAVKGAGRYVERKPF
FT                   GPIFDALQRKRQSAA"
FT   gene            297675..298835
FT                   /locus_tag="Bphyt_4251"
FT   CDS_pept        297675..298835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4251"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB; KEGG: cps:CPS_4049 FO synthase subunit
FT                   1"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4251"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18630"
FT                   /db_xref="GOA:B2TEV9"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR019939"
FT                   /db_xref="InterPro:IPR034405"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEV9"
FT                   /protein_id="ACD18630.1"
FT                   /translation="MLSRAEAIALDQVSAGELHQLMRRACRVREKAWGATVTYSRKVFI
FT                   PLTNLCRDKCGYCTFARQPDEPGAGYLAPDQVMAIARRGEALGCKEALFSLGEKPELVY
FT                   PQARAVLDALGYATTMDYVIAMSERILAETSLIPHVNAGTLTRAEIVRLKAVCGSVGLM
FT                   LENVSRRLVQRGMAHYACPDKVPVQRLRTLDMAGVERIATTTGILIGIGETWVERIDSL
FT                   LAIAELHTRHGHIQEVIVQNFRAKPGTMMATWNEPGHEDMLRTLAVARLLLPTDISLQA
FT                   PPNLAEAFEDYLDSGINDWGGISPVTADYINPERAWPAIHDVARRSHGRGLGLAERLTV
FT                   YPRYLCQPDFVGAAPARALGCQARPDGLALHQYEAMPMAASAECAA"
FT   gene            298832..300139
FT                   /locus_tag="Bphyt_4252"
FT   CDS_pept        298832..300139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4252"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG:
FT                   pde:Pden_1115 radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4252"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18631"
FT                   /db_xref="GOA:B2TEW0"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR019940"
FT                   /db_xref="InterPro:IPR020050"
FT                   /db_xref="InterPro:IPR034405"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEW0"
FT                   /protein_id="ACD18631.1"
FT                   /translation="MNAMTDRDWLDFLAARRNGDDPSALLSAASAPVRFILSRHLEGAE
FT                   ISRDEGRVLFEADGEDLKAVVATADHVRRERVGDVVSFVVTRNINFTNVCYMGCRFCGF
FT                   AKRREEEGAELLSMDEVARRADVARQRGATEVCIQGGLHPDLTDHHYLDILAAIKARVP
FT                   EMHIHAFSPFEIWYGSKKRRQAAADYLRELKAAGLGSIPGTAAEILDTDVRRQLTRNKL
FT                   SAQAWVEIVRAAHGVGLRSTSTMMYGHVDGPGHWAAHIDLLRSIQKETGGFTEFVPLGF
FT                   VHSEAPLYMEHEIPGVRAGATLVEHIKVHAIARLMLAGWIDNIQVSWVKLGPQTGQALL
FT                   AAGANDFGGTLMDESISRSAGASFGEEITAAEMVSIIRDAGREPVRRSTLYVPLERYVD
FT                   HDPVALPPLKARAYDPIRFLRNRPQAGCDNEELAHA"
FT   gene            300132..301136
FT                   /locus_tag="Bphyt_4253"
FT   CDS_pept        300132..301136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4253"
FT                   /product="protein of unknown function UPF0052 and CofD"
FT                   /note="PFAM: protein of unknown function UPF0052 and CofD;
FT                   KEGG: rxy:Rxyl_0958 LPPG:Fo 2-phospho-L-lactate
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4253"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18632"
FT                   /db_xref="GOA:B2TEW1"
FT                   /db_xref="InterPro:IPR002882"
FT                   /db_xref="InterPro:IPR010115"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEW1"
FT                   /protein_id="ACD18632.1"
FT                   /translation="MRDTGYPARIVLLAGGVGGARMALGLSAELATGSLSIVANIGDDE
FT                   DFYGLRVCPDLDTLLYTLSGKVDPMQGWGVEGDNTRALGVLGELGAPVWMKLGDADMGL
FT                   HVWRTWRLAFGESLTSVMAEASARFGVPGYLLPACDAPVPTEIVCDEGPLRFQQWFVAH
FT                   RAAPPVREVRYCGAEDRCATPEVLRAIEQADLIVIAPSNPLLSIEPMLALGGLREALQT
FT                   SGAPCVAVSPLIGGKAVKGPLDRMLDDMGLPGGNAGIAKRYEGLLHGLVIHTDDAADSA
FT                   GLQARGLAVLSAETRISSCPASVRLARTLLAWVRDGLPARQSIHGEMQKEVTI"
FT   gene            301133..301774
FT                   /locus_tag="Bphyt_4254"
FT   CDS_pept        301133..301774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4254"
FT                   /product="protein of unknown function DUF121"
FT                   /note="PFAM: protein of unknown function DUF121; KEGG:
FT                   cps:CPS_4046 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4254"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18633"
FT                   /db_xref="GOA:B2TEW2"
FT                   /db_xref="InterPro:IPR002835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEW2"
FT                   /protein_id="ACD18633.1"
FT                   /translation="MKTLLAIPMKAPARAKTRLAPAMDDSQRAQLAVRLFERTLAFFRR
FT                   NWPDFDVVAVTDDATQIAPLAARHGAGVLLEVCEAGLSAAAGLALQHAWTGGYERLVIV
FT                   PGDVPVWLRAEVRQMLSLSQRHGLTLAESHDGGTNFLALAPPQRFTFHYGPQSAALHTR
FT                   SGLECGLSVARCQLPFLARDIDTAEDCLVLAHARRCRRGPRLSAFNGAPP"
FT   gene            301771..302550
FT                   /locus_tag="Bphyt_4255"
FT   CDS_pept        301771..302550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4255"
FT                   /product="F420-dependent oxidoreductase"
FT                   /note="TIGRFAM: F420-dependent oxidoreductase; PFAM:
FT                   protein of unknown function DUF129; KEGG: cps:CPS_4045
FT                   putative F420-dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4255"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18634"
FT                   /db_xref="GOA:B2TEW3"
FT                   /db_xref="InterPro:IPR002847"
FT                   /db_xref="InterPro:IPR008225"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEW3"
FT                   /protein_id="ACD18634.1"
FT                   /translation="MNAGSNTMELVALPGIPGVREGDDVGDLVADAMARTGRQWQTGDI
FT                   VVIAQKIVSKAEGRTRRLADIYPSHMAWEYASVSDKDPRKVQAMLDESVDVVRVAKVGP
FT                   DGLMITRHRHGWVCANAAIDESNVGEDGTMLLLPVDPDASAAEVARKLEARGGIKAGVI
FT                   ISDTFGRAWRRGLVNVAIGAANVPVIVDWIGRVDAYGRPLQISQPAFADEVAAAAGLLM
FT                   GKDSFTPVVLVRGLSWDIDNGAHARQLVRPLEEDLFQ"
FT   gene            302547..303227
FT                   /locus_tag="Bphyt_4256"
FT   CDS_pept        302547..303227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4256"
FT                   /product="NADPH-dependent F420 reductase"
FT                   /note="TIGRFAM: NADPH-dependent F420 reductase; PFAM: NADP
FT                   oxidoreductase coenzyme F420-dependent; KEGG: pde:Pden_1119
FT                   NADPH-dependent F420 reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4256"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18635"
FT                   /db_xref="GOA:B2TEW4"
FT                   /db_xref="InterPro:IPR010185"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEW4"
FT                   /protein_id="ACD18635.1"
FT                   /translation="MNIAILGGTGPQGQGLALRFAMAGINVALGSRDGSRSAEIACDLN
FT                   AKLLGLQSCARIDGFENSDAVAAADQIVMLAVPYAGHDATLRTVAPALDGKILVDLVVP
FT                   LTPGDPRGVTMPPEGSATEAAQALLGDKVRVVGGLHNVSAHTLNHLDQPINCDVLVCGN
FT                   NIEAAEAVMELVGRIGVRTYYAGPALAARCVEAITPLLIRLNISKKVPFSHAGIRIWAP
FT                   GLPA"
FT   gene            303260..304261
FT                   /locus_tag="Bphyt_4257"
FT   CDS_pept        303260..304261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4257"
FT                   /product="Luciferase-like monooxygenase"
FT                   /note="PFAM: Luciferase-like monooxygenase; KEGG:
FT                   pde:Pden_1120 luciferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4257"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18636"
FT                   /db_xref="GOA:B2TEW5"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR022315"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEW5"
FT                   /protein_id="ACD18636.1"
FT                   /translation="MQFGICFKGFVEPDRARALVRLAEAQGFDYCWFYDSHILWRESFV
FT                   AMAMCMEHTTRMRFAPCVTNPDVREWSLAASLYGSLALQSKGRIDIGLGRGDSSRRVMG
FT                   KKPASMDRVAAFTHAVKGMVRGDEVKYEDAEAPVRLPWATGYELPVWIAAYGPIALKCA
FT                   GEHGDGLILQIADPGLCKWFTDQAVAAGKDVGRDMSKYRVQAAAPAYFGDMDECIEATK
FT                   WFPAMVGNHVADIVDKYGKDSHLVPKSLTSYIEKRRGYDYSKHGQSDNPYLDFITPDVV
FT                   ESFCVLGTPDQHIEKIGKLRAAGVTQFNIYLDNGDEAQIIETYGDKIIPAFR"
FT   gene            304405..305643
FT                   /locus_tag="Bphyt_4258"
FT   CDS_pept        304405..305643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4258"
FT                   /product="amidase, hydantoinase/carbamoylase family"
FT                   /EC_number="3.5.1.87"
FT                   /note="KEGG: aav:Aave_0970 amidase,
FT                   hydantoinase/carbamoylase family; TIGRFAM: amidase,
FT                   hydantoinase/carbamoylase family; PFAM: peptidase M20"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4258"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18637"
FT                   /db_xref="GOA:B2TEW6"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010158"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEW6"
FT                   /protein_id="ACD18637.1"
FT                   /translation="MKDLRIDGERLWRSLMDLAAIGATPKGGVKRLALTELDKQGRDLV
FT                   VSWGRAAGLAITVDRIGNIFMRRAGTDPDAPPVASGSHIDTQPTGGKFDGNYGVLAALE
FT                   VMRTLDDAGVKTCAPLEVAIWTNEEGSRFVPVMMGSGVFCGAFTLEHAYAARDIEGKRV
FT                   RDELEAIGYLGDEEPGKHPLGAYFEAHIEQGPVLEDEGKVIGVVPGVLGLSWYDCEVRG
FT                   MEAHAGPTPMAIRKDALQVATRVMQEVVAIANRYPPYGRGTVGFVQTFPNSRNVIPGSV
FT                   KFSIDLRNVNDALLNQMHDEMLAFIDRTQSESGLSIGIERVSYYRPCEFHPQCVDAVRR
FT                   ATGALGYPTMDVVSGAGHDAVYTARVAPSGMIFVPCKDGISHNEIEDARSDHLEAGCNV
FT                   LLHSMLERAGQVS"
FT   gene            305711..306829
FT                   /locus_tag="Bphyt_4259"
FT   CDS_pept        305711..306829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4259"
FT                   /product="NAD(P)(+) transhydrogenase (AB-specific)"
FT                   /EC_number="1.6.1.2"
FT                   /note="PFAM: alanine dehydrogenase/PNT domain protein;
FT                   KEGG: reh:H16_A0850 NAD(P) transhydrogenase subunit alpha
FT                   1"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4259"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18638"
FT                   /db_xref="GOA:B2TEW7"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR007886"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEW7"
FT                   /protein_id="ACD18638.1"
FT                   /translation="MLIGIPREIREGEARVAATPETVKKYVAQGHRVIVQSGAGVRASL
FT                   RDAAYEAVGARIGTASEAMGAGLVLKVRAPEPAELAMMTPGAVLVGMLNPFDMENEVRM
FT                   VAAGIIAFALEAAPRTTRAQSMDVLSSQANIAGYKAVLVAAHHYQRFMPMLMTAAGTVK
FT                   AARVLILGAGVAGLQAIATARRLGAVIEASDVRPAVKEQIESLGAKFLDVPFLTDEERE
FT                   IAQGAGGYARPMPADWMRRQAELVHERAKQADIVITTALIPGRTAPVLLQEASVQQMKP
FT                   GSVVVDLAAAQGGNCPLTVPDEVVERHGVILVGHTNLAAMVAADASALYARNVLDFLKL
FT                   ILDKEGKLVIDRQDDIVAACLMTGQEQVDLAS"
FT   gene            306840..307196
FT                   /locus_tag="Bphyt_4260"
FT   CDS_pept        306840..307196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4260"
FT                   /product="NAD(P) transhydrogenase subunit alpha 2"
FT                   /note="KEGG: reh:H16_A0851 NAD(P) transhydrogenase subunit
FT                   alpha 2"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4260"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18639"
FT                   /db_xref="GOA:B2TEW8"
FT                   /db_xref="InterPro:IPR024605"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEW8"
FT                   /protein_id="ACD18639.1"
FT                   /translation="MELVNHTVINLIIFVLAIYVGYHVVWTVTPALHTPLMAVTNAISG
FT                   IIIVGAMLAAGLTEGSVGRVAGTLAVALAAVNVFGGFLVTQRMLEMFRKKSPKAQPQAE
FT                   RQTHAGGKAAEAAR"
FT   gene            307193..308656
FT                   /locus_tag="Bphyt_4261"
FT   CDS_pept        307193..308656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4261"
FT                   /product="NAD(P)(+) transhydrogenase (AB-specific)"
FT                   /EC_number="1.6.1.2"
FT                   /note="PFAM: NAD(P) transhydrogenase beta subunit; KEGG:
FT                   reh:H16_A3131 NAD(P) transhydrogenase subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4261"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18640"
FT                   /db_xref="GOA:B2TEW9"
FT                   /db_xref="InterPro:IPR012136"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR034300"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEW9"
FT                   /protein_id="ACD18640.1"
FT                   /translation="MNGLSMNSVTLLYLGASVCFIQALKGLSHPTTARRGNVFGMSGMA
FT                   IAAVTTLLLIVKLKNEFLAAGTAQSPVGLGLILIFGALVVGGGIGAYAAKQVEMTRMPE
FT                   LVAAMHSLIGLAAAFIAVAAVAEPAAFGITQAASHEIPLGNRIELFIGCFVGAITFSGS
FT                   VIAFGKLAGRFKFRLFQGAPVVFAGQHWLNLLLAVAMISFGCLFAQSQDWLPFLLMLAI
FT                   AFVLGVLIIIPIGGADMPVVVSMLNSYSGWAAAGIGFSLNQPMLIVAGSLVGSSGAILS
FT                   YIMCRAMNRSFFRVLLGGFGGATAAAADQLQRPVKAGSADDAAFLLGNAETVVIVPGYG
FT                   LAVARAQHALKELTEMLKGKGVSVKYAIHPVAGRMPGHMNVLLAEAEVPYDQVFEMEDI
FT                   NSEFGQADVVLVLGANDVVNPSAKTDPNSPIAGMPILEAYKAKTIIVNKRSMAAGYAGL
FT                   DNELFYMDKTMMVFGDAKKVVEDMVKAVH"
FT   gene            308738..309683
FT                   /pseudo
FT                   /locus_tag="Bphyt_4262"
FT   gene            309881..310831
FT                   /locus_tag="Bphyt_4263"
FT   CDS_pept        309881..310831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4263"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: mms:mma_1670 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4263"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18641"
FT                   /db_xref="GOA:B2TEX0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEX0"
FT                   /protein_id="ACD18641.1"
FT                   /translation="MQLDMRLVMAFSLVMRSGSLTQAEAISGVSKATLSRQLQVLEEEL
FT                   GVTLFNRRARGMSPTEAARAFHTHCEQILADVSGRLEVAREQLQELGSGIGGELSIKAD
FT                   SEFSTTFAAHVTKLFMARHPNVKLNLDVADYPGCAKAEEIDGYICAELPDIPDLVGKLL
FT                   GQISCGLYASPAYLKQKGTPVTPMDLTCHDSIVIRSTSGNKDTLMLYSQGGSQPYLPKA
FT                   NVTTNDHWIMKTFCIDGFGIALLPDFFVQPELSQQLLVPVLPEWKPQPRRIYCAYQKQR
FT                   FAGRKLSDLITLMADCIKDIDTFSGYVGRSSSGSS"
FT   sig_peptide     309881..309952
FT                   /locus_tag="Bphyt_4263"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.845) with cleavage site probability 0.330 at
FT                   residue 24"
FT   gene            310978..311538
FT                   /locus_tag="Bphyt_4264"
FT   CDS_pept        310978..311538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4264"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   bvi:Bcep1808_7045 transposase, IS4 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4264"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18642"
FT                   /db_xref="GOA:B2TEX1"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEX1"
FT                   /protein_id="ACD18642.1"
FT                   /translation="MLKAGSAVDATLIAAPSLTKNGCGTRDPGMQSTQKGGNWYFGMKM
FT                   HVGVDADSGLVHTFIGTAVDVHDFNVAQALLHGEETDVYADAGHQGIGKRSGTDAVRWH
FT                   VAMRPAKRRKLDPSDSLDAIYDQIARLKAGVRAKVEHPLSILKRQFGYLKMPYRGLMKN
FT                   TAQITILFALGNLWMARSALRKA"
FT   gene            312409..313455
FT                   /locus_tag="Bphyt_4265"
FT   CDS_pept        312409..313455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4265"
FT                   /product="porin Gram-negative type"
FT                   /note="PFAM: porin Gram-negative type; KEGG:
FT                   bur:Bcep18194_A5230 outer membrane protein, (porin)"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4265"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18643"
FT                   /db_xref="GOA:B2TEX2"
FT                   /db_xref="InterPro:IPR001702"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEX2"
FT                   /protein_id="ACD18643.1"
FT                   /translation="MCNQATSMAIGLCASIVLACTSQATMAQSSVTLYGILDVSVQLTT
FT                   RADGQHSAINLQNYGSVPTIFGLHGSEDLGGGVSAIFELSQSFSMTNGKSGIPGDAFGW
FT                   QSYVGLKGGFGTVTAGRQFSVLFDETVMFDPTYFAAYGGQAQLNPLSDIIVNNSIKYLS
FT                   NSYGGFVFEGLISTDGVAGNFASGRTLELGMQYSRGPFNMSVALREKNGSEMETAGSSG
FT                   KTERIGVIGAAYKIGPATLLAGVERTTGDLSPVKTVIWGGGRYDVTPALQFRAAVYQTL
FT                   SKNPQTGDPTLYVAGAVYSLSVRTQTYLNVGYSRNSAHSSQTVYEYGDAPLNGANQFAV
FT                   MLGITHKF"
FT   sig_peptide     312409..312492
FT                   /locus_tag="Bphyt_4265"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.899 at
FT                   residue 28"
FT   gene            complement(314233..314828)
FT                   /pseudo
FT                   /locus_tag="Bphyt_4266"
FT   gene            complement(315315..317000)
FT                   /locus_tag="Bphyt_4267"
FT   CDS_pept        complement(315315..317000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4267"
FT                   /product="phosphoesterase"
FT                   /note="PFAM: phosphoesterase; KEGG: bmn:BMA10247_A1822
FT                   phosphoesterase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4267"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18644"
FT                   /db_xref="GOA:B2TEX3"
FT                   /db_xref="InterPro:IPR007312"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEX3"
FT                   /protein_id="ACD18644.1"
FT                   /translation="MFSRAFLFGVSGIAMAVSLYACGGSGSNGLTPVSAQNQLTTATPI
FT                   KHVVVIYNENVSFDHYFATYPNATNPSGEPAFTAAAGTPSVNGLSGTLLTNNPNFINTL
FT                   NGAGATNPFRLDRTQAATADQNHAYTAEQQAYNNGAADLFPKFTGKGSSGGAGAFATTG
FT                   QVMGYYDGNTVTAMWNWAQHFAMSDNAYTDTFGPSTPGALEVVAGQTNGVQLVKTSQQP
FT                   FNLTTASHSYYVNDGQGGVTLINDVDPANDLCSSTTDQILMSGKNIGDLLNAKGITWGG
FT                   FMGGFNLATTNSNGTTGCKRSTVTPAVGQPTADYIPHHNWFQYYASTANPQHLRPSATA
FT                   AIGYTLQSDGKTVDPANHQYDSDDFFAAVKAGNYPSVSFIKAPAFQDGHAGYSDPLDEQ
FT                   AFTAKVVNFLQQQPDWKSTAVIVAWDDSDGWYDHAYANPTSSSFDAQADQLNGAGKCGT
FT                   GTAPNGVNGAAVNGRCGPGTRIPFLVISPWAKVNYVDHTPISQASVVRFIEDNWLGSQR
FT                   IGGGSFDATAGSIMGLFNFSGSGNNPTVFVDPNLGSVVSSVPAI"
FT   sig_peptide     complement(316935..317000)
FT                   /locus_tag="Bphyt_4267"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.758 at
FT                   residue 22"
FT   gene            317481..318581
FT                   /locus_tag="Bphyt_4268"
FT   CDS_pept        317481..318581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4268"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xac:XAC3089 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4268"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18645"
FT                   /db_xref="InterPro:IPR011040"
FT                   /db_xref="InterPro:IPR036278"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEX4"
FT                   /protein_id="ACD18645.1"
FT                   /translation="MTWQKMSFLRHVSFVILSFLSVQSSAKSGNNSDAIVSTEVVNPPQ
FT                   NIAFCHASTVAFSQGHLVAAWLAGSKEAANDVGVWVARFSGNQWSPPVRVADGRSPDGE
FT                   ALTVINPILFSPKRGPLMLFYRRGKLPADWHPLRMTSLDGGATWTKPVALDPGISGPAK
FT                   DKPVELSNGVVIAGSSTEYDGWKIHFERSMDGGNTWHVVYPAVGLPTVQAIQPTILDHR
FT                   HGQLQALVRTKSGFVFSTKSSDWGKTWSALARLDIPNSNSGLDAVTLTDGRDLIVTNPL
FT                   PYVEGRWDRHKLSVLISADHQTYRDVLDLENEAGQEFSYPAVIQSPDGMVHITYTWKKI
FT                   YIKHVVLDPKRIYASRSTLSAATGHQ"
FT   sig_peptide     317481..317561
FT                   /locus_tag="Bphyt_4268"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.985 at
FT                   residue 27"
FT   gene            318663..319337
FT                   /locus_tag="Bphyt_4269"
FT   CDS_pept        318663..319337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4269"
FT                   /product="ABC-type uncharacterized transport system
FT                   periplasmic component-like protein"
FT                   /note="KEGG: mag:amb1293 ABC-type uncharacterized transport
FT                   system"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4269"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18646"
FT                   /db_xref="InterPro:IPR010412"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEX5"
FT                   /protein_id="ACD18646.1"
FT                   /translation="MARFDDRSCSQQIFMINSVVDLLRKRVLVLQHAAAAACCMLVAAP
FT                   LAAHPHVWITYASVAQMHGSTLNAVQEKWTFSQGFPVSIVGDLADMPKAGSLGPRYVNI
FT                   FKQQAFDSLKGADYFTHVFVDGKPVRFGEPRNFAVSIDDGRIVYTFELPLADKVDVRLA
FT                   QVQLGIWDETFFVDFQPPPKGALPVVFDAAAPKTCTAQPLEDKAHPIFGGTIYPLSVKL
FT                   AC"
FT   gene            319331..320455
FT                   /locus_tag="Bphyt_4270"
FT   CDS_pept        319331..320455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4270"
FT                   /product="high-affinity nickel-transporter"
FT                   /note="PFAM: high-affinity nickel-transporter; KEGG:
FT                   mag:amb1292 ABC-type uncharacterized transport system"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4270"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18647"
FT                   /db_xref="GOA:B2TEX6"
FT                   /db_xref="InterPro:IPR011541"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEX6"
FT                   /protein_id="ACD18647.1"
FT                   /translation="MLNVSLRRGIRYSALIVIALVIVAARSVGAQTVDVFGRTSTGTPS
FT                   AANVQTPASQTAPEDHLVALEPLRRAVAASIALQSRLNAQLQDKLAEQRNGANMQAAWI
FT                   LMLLSFGYGVLHALGPGHGKLVIGTYLISHRARVGHAVALSMWSACVQAISAICLVGGA
FT                   AWLAHAGLGGVMTHAATLDLVSYFSLLCVGLFTAWSIVTRRDCCDEGRVTLVHKRRPGL
FT                   FATEHADDDTQQGAYLAVRMPPRRRSINWTWADKRAGNTWIARQIVLTGLAVGARPCVG
FT                   AIFVLIAALANGIFIIGVLSVFTMAAGVSLTVLAIGLASLGMNRAVSSRSVARREALQT
FT                   IRTRFALAGAVFITLFAAWQVFALLAGWQVAGLV"
FT   sig_peptide     319331..319423
FT                   /locus_tag="Bphyt_4270"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.970 at
FT                   residue 31"
FT   gene            complement(320572..321891)
FT                   /locus_tag="Bphyt_4271"
FT   CDS_pept        complement(320572..321891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4271"
FT                   /product="protein of unknown function DUF323"
FT                   /note="PFAM: protein of unknown function DUF323; KEGG:
FT                   bxe:Bxe_B0605 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4271"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18648"
FT                   /db_xref="GOA:B2TEX7"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR017806"
FT                   /db_xref="InterPro:IPR024775"
FT                   /db_xref="InterPro:IPR042095"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEX7"
FT                   /protein_id="ACD18648.1"
FT                   /translation="MNRDPAPHHPLVQRLIEARQVTDALFSIVKPEFLYERPIRERHRI
FT                   VFYIGHLEAFDRNLFDQRLCDLPAFDPQLDQLFAFGIDPVDGGFPTDQPGDWPSLDVVR
FT                   SYGLRAREQIDRELDALTHAAGLGRNGAQADASEQLLNVAIEHRLMHAETLAYMLHQLP
FT                   LAQKVTELREPVVTRAESRDALSSMVSIPAGATVLGMPRDGGRFGWDNEFGEMRVEVPA
FT                   FEMDRHMVTNGAFREFIEAGGYREPKWWSEKDWAWKEAEHIEHPACWSRHEAGGEGDAW
FT                   TLRTMFDEVPLPLDWPAYVSHAEASAYARWAGKALPTEAQWQRAAHGAPHAASGNFDFR
FT                   SWDPRPVDEYPDNVSAFGVEGQFGNGWEWTSTVFDALPGFEAFPFYLGYSANFFDGQHY
FT                   VIKGGSARTAQCMLRPAFRNWFQPHYQYVYAGFRCVRSCE"
FT   gene            complement(322022..322678)
FT                   /locus_tag="Bphyt_4272"
FT   CDS_pept        complement(322022..322678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4272"
FT                   /product="transcriptional regulator, Crp/Fnr family"
FT                   /note="PFAM: cyclic nucleotide-binding; regulatory protein
FT                   Crp; KEGG: bxe:Bxe_B0606 transcriptional regulator, Crp/Fnr
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4272"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18649"
FT                   /db_xref="GOA:B2TEX8"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018335"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEX8"
FT                   /protein_id="ACD18649.1"
FT                   /translation="MRQLCMPQGLSPEELMKLETLICSARSVQRGEALYRSGDRFDNIY
FT                   AVRSGSMKTVMTHRDGREQVTGLRLAGEALGLDGISDDVHACSALALEDSTVCIVPYTA
FT                   LKSLCREIGSMQERMHKLLGEQIVREAAQMMVLGSLSADERVAAFLLDVSERNARRGYS
FT                   SAEFNLRMTREDMGSYLGMTLETVSRTLSRFQKRGLIDTQGKHIRIVDLDGLRQV"
FT   gene            complement(323082..323549)
FT                   /locus_tag="Bphyt_4273"
FT   CDS_pept        complement(323082..323549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4273"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein; KEGG: bxe:Bxe_B0607
FT                   putative universal stress-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4273"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18650"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEX9"
FT                   /protein_id="ACD18650.1"
FT                   /translation="MYTRILVAVDGSNTSRRAFEAALALAKASGAVLQPLYVVENTPMY
FT                   FEAPGYDPSVLRNRLAEEGKELGAEFAKAMAEQGVKGELVVSEASTIDDVSVVVLKAAA
FT                   DFNADLLVMGTHGRRGFQRLILGSVAERCVRQASLPVLLIPSAAGKSGNAD"
FT   gene            323839..324528
FT                   /locus_tag="Bphyt_4274"
FT   CDS_pept        323839..324528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4274"
FT                   /product="GntR domain protein"
FT                   /note="PFAM: regulatory protein GntR HTH; GntR domain
FT                   protein; KEGG: atu:Atu4191 transcriptional regulator, GntR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4274"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18651"
FT                   /db_xref="GOA:B2TEY0"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEY0"
FT                   /protein_id="ACD18651.1"
FT                   /translation="MNERKTTGLPDKIYGDILNRIVEGEYKEGERLPTEHALAERFATS
FT                   RPTVREALARLRADGIIMTRHGSGTTVARRPDPDVRRFAPLETLSDIRRCYEFRIVTEA
FT                   GAAEQAALKADADDIAAIQHAWDQLERIIETQGIGAKDDFMFHLAVARASKNPFFITVM
FT                   SFIEEQILFSMNLSRNLSLVKTVARQRLVQEEHRAVLDAIRRKDAPGAASAMRAHLENA
FT                   LERMFGS"
FT   gene            complement(324705..325298)
FT                   /locus_tag="Bphyt_4275"
FT   CDS_pept        complement(324705..325298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4275"
FT                   /product="autoinducer synthesis protein"
FT                   /note="PFAM: autoinducer synthesis protein; KEGG:
FT                   bxe:Bxe_B0608 putative autoinducer synthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4275"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18652"
FT                   /db_xref="GOA:B2TEY1"
FT                   /db_xref="InterPro:IPR001690"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR018311"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEY1"
FT                   /protein_id="ACD18652.1"
FT                   /translation="MQTAIRIGMRQEFDNADINEMYRLRARVFHGRLGWDIPTIAGMEI
FT                   DGYDALGPHYMLIQADDGQVRGCWRLMPTEGPNMLKDTFPQLLHGAAAPVGRHIWELSR
FT                   FAIETGGEEQSFGFADLTMQAIHELVTFADQMGITRYVTVTTTPIERLLRKTGIDISRL
FT                   GSPLQIGVERAVALDIAVSPKTRTALFGPMAVAA"
FT   gene            325453..325770
FT                   /locus_tag="Bphyt_4276"
FT   CDS_pept        325453..325770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4276"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0609 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4276"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18653"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEY2"
FT                   /protein_id="ACD18653.1"
FT                   /translation="MELIENHWQPQTGVQTRPAEPSTAVDRVLIIAYRKKKKESQRRFW
FT                   ARFGVTQSRGSRFESGAEIPPPVSILLGLYFTKTVSDADLGRAERVLYSRDAAALLNPG
FT                   Q"
FT   gene            complement(325754..326458)
FT                   /locus_tag="Bphyt_4277"
FT   CDS_pept        complement(325754..326458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4277"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="PFAM: regulatory protein LuxR; Autoinducer-binding
FT                   domain protein; KEGG: bxe:Bxe_B0610 transcriptional
FT                   regulator, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4277"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18654"
FT                   /db_xref="GOA:B2TEY3"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR005143"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036693"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEY3"
FT                   /protein_id="ACD18654.1"
FT                   /translation="MAPLLDAADEAEWFGAIAGLAETWGFDKLLIAMLPRPTIRLEDAY
FT                   VRSTYSPTWRRTYDEQGLVHIDPTVAHCATRATPLIWSPDIFKTAPQLSMYEEARAHGL
FT                   RSGITLPIHGPNQEAGMMCFVNDNNPNDEFWRHINVALPNLVLLRDLVIDTSQRHLNTH
FT                   AQTLLPKLTPRERECLKWTARGKSTWEISHILNCSEAVVNFHMKNIRTKFGVNSRRAAA
FT                   VIAAQLGLIDPG"
FT   gene            327147..328088
FT                   /locus_tag="Bphyt_4278"
FT   CDS_pept        327147..328088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4278"
FT                   /product="Gluconolactonase"
FT                   /EC_number="3.1.1.17"
FT                   /note="PFAM: SMP-30/Gluconolaconase/LRE domain protein;
FT                   KEGG: bxe:Bxe_B0611 gluconolactonase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4278"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18655"
FT                   /db_xref="GOA:B2TEY4"
FT                   /db_xref="InterPro:IPR005511"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013658"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEY4"
FT                   /protein_id="ACD18655.1"
FT                   /translation="MTDNTRRYPDPSIRVFDPRFKPLILASASVECLYQGARWSEGPVW
FT                   FGDGRYLLWSDIPNDRILRWDEPSGTVSTFRQSSNNANGHTRDRQGRLVSCEHLTRRVT
FT                   RTEYDGSITVLAERYRGKRFNSPNDVVVKSDGSIWFSDPTFGIDGFYEGERQESELPAC
FT                   VYRIDGQSGEVTVVADDVLGPNGLAFSPDESVLYIVESRGEPHRTIRAFDVEGTGGALS
FT                   NNRVLIDAGPGTPDGFRVDVHGNLWCGWGMGTDELDGVRVFTSQGEPLGHIALPERCAN
FT                   VCFGGRHRNRLFMAASHGLYSLYVNTQGVQGG"
FT   gene            328328..329497
FT                   /locus_tag="Bphyt_4279"
FT   CDS_pept        328328..329497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4279"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: bch:Bcen2424_1684 extracellular solute-binding
FT                   protein, family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4279"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18656"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEY5"
FT                   /protein_id="ACD18656.1"
FT                   /translation="MTVSDRLALRLVSVCLAASAAFASAAHAADPVTLNIVDVAGDLQL
FT                   TQKGFEAFKAKYPNLVANLTFTNAPAPQLPGKIKAMQAAGRSDIDLVLTGTDALAAGIE
FT                   QGLWMKLLPENAAAFPGVLDKYAPGPRKMQDLAQGYGLEVAYMPAGPLLEYNPAKVSDP
FT                   PKTPEQLLQWCKAHPDKLIYARPANSGPGRTFLMGLPYVLGDKDPQDPIHGWDKTWAFL
FT                   KQLNDCIPYYPGGTSAVMKELGEGTRDMTVTVTGWDINPRALGIVPAEFRVQAFDNMTW
FT                   VNDAHYMVIPKGVPKEKIDVLYKLMNFMLEPAQQAMTYDDGYFYPGPAIKGVSVEQAPA
FT                   HSQDVLKKYGRPEYVKLLAEHPHVLPLNAAAMVAAFKKWDTEIGAQKTK"
FT   sig_peptide     328328..328414
FT                   /locus_tag="Bphyt_4279"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 29"
FT   gene            329586..330665
FT                   /locus_tag="Bphyt_4280"
FT   CDS_pept        329586..330665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4280"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; TOBE domain protein;
FT                   Transport-associated OB domain protein; SMART: AAA ATPase;
FT                   KEGG: bur:Bcep18194_A4846 ABC transporter, ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4280"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18657"
FT                   /db_xref="GOA:B2TEY6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEY6"
FT                   /protein_id="ACD18657.1"
FT                   /translation="MKHHFEQLRLDSVSRSFTNAEGQAIAALRGLDLTIQRGEFIALLG
FT                   PSGCGKSTALNCIAGLQPLTSGGIWLDDKRIDVLPPEKRGFGMVFQNYALFPHMSVLDN
FT                   VGFGLKMRGIGKSEAVRRVREALQLVQLVGHERKLPGQLSGGQQQRVAIARAIVIEPPL
FT                   ILMDEPLSNLDTKLRIEMRAEIRRIHSQLERATLYVTHDQDEALSMADRIVVMREGVVQ
FT                   QVATPKEVYTRPQNLHVARFMGYRNVAEFELEGMQGESVMVSAHGVRLLGTPMAGFNSK
FT                   RVSVALRPEDMERATPGAENAFDALVTTVEYGGRDSLLRVKTAFGDIWARVGGEFEEGE
FT                   RISLRVPPSRTLVYDAEAV"
FT   gene            330662..331540
FT                   /locus_tag="Bphyt_4281"
FT   CDS_pept        330662..331540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4281"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bam:Bamb_1592
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4281"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18658"
FT                   /db_xref="GOA:B2TEY7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEY7"
FT                   /protein_id="ACD18658.1"
FT                   /translation="MNTPTLSPPLVPRDAKAWLVAPALLFVVALFIYPFAYGLMLSFRP
FT                   MNGGSLWANYLAFFTDTSMWPTIFVTLKLSVPATLINVGVSVPVAFALRRYSRYQKFVT
FT                   TLLVIPVTLGTVLIADGMLTYFGPNGWFPQALQGLHLYTREVRLTHNFWGVLISLIVSG
FT                   FPFAFLLTLSYVTGIDPTLAAAAATLGASPWQQFRRIYLPLLVPGLTMAACLSFVQAFS
FT                   VFPSAVLLGAPAGPTRVMSIAAAEAAFESYDYSLASAIAMVMGFVQLLVVAALLGARRF
FT                   FYSGPTTGGKG"
FT   gene            331540..332478
FT                   /locus_tag="Bphyt_4282"
FT   CDS_pept        331540..332478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4282"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bcm:Bcenmc03_1659
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4282"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18659"
FT                   /db_xref="GOA:B2TEY8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEY8"
FT                   /protein_id="ACD18659.1"
FT                   /translation="MTTDHRATQPSWSASTSNDHDDGAREPERRTGHTRQRTSVPGRIW
FT                   RVLVWGAMVFFLVNVVLLIATVAVNSIATRWFGTLLPQGFTLHWYAQAWSDFQLASVLW
FT                   VTVEVVGAVVLLSVLLGVPAAYALARVQFPGKRIAMLIFLLPLMVPPVTYGIPMATVMY
FT                   KVGLAGTLSGVILANLVPALPFVILVMTPFIEQIDPNLEAAARIFGANTFRYFRYVLLP
FT                   LLVPGMLAAGLLVLVRTIGMFELTFFTAGPATQTLVVALYYAVFSTGVRAPQSIDAMAM
FT                   IYMAITLIWVLIALQFVSPTQIVSRVKEQKR"
FT   gene            332491..334296
FT                   /locus_tag="Bphyt_4283"
FT   CDS_pept        332491..334296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4283"
FT                   /product="Dihydroxy-acid dehydratase"
FT                   /EC_number="4.2.1.9"
FT                   /note="PFAM: dihydroxy-acid and 6-phosphogluconate
FT                   dehydratase; KEGG: bpt:Bpet2679 dihydroxy-acid dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4283"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18660"
FT                   /db_xref="GOA:B2TEY9"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEY9"
FT                   /protein_id="ACD18660.1"
FT                   /translation="MSRACGVAKDIVEQTLTKRKKPEELRSHRWYGVNDLRSFGHRSRT
FT                   AQMGYDREEYAGKPVIAILNTWSEINACHTHFKQRVEEVKRGIWQAGGFPVELPVQTLS
FT                   EPFQKPTTMLYRNFLAMEAEETLRSYPADGVVLMGGCDKTTPGLLMGAISMDLPAIFLP
FT                   AGPMLRGNWNGVTLGSGSDVWKYWAELRAGTITQDDWQGIEGGIARSPGHCMTMGTAST
FT                   MTSAAEALGFTLPGFASIPAADSRHAQMAAKTGKRIVEMVWEDLKPSDLITAGSVDNAV
FT                   TTCLALSGSTNAIVHMIALARRAGIELTLDRYDDIARRTPVLANVRPTGAYLMEDFFYA
FT                   GGLRALLAELGELIDRSQKTVNGRTLGENLEGAEIFNDDVIRRRDKPLLPNSGLAVLRG
FT                   NIAPDGAVIKPGAAEPHLLVHTGRAVVFKDYNDMAARIDDDTLDIDENSLIVLQHAGPV
FT                   GAPGMPEWGQLPIPRKLLQKGVRDMVRISDARMSGTSYGACVLHVAPESFIGGPFALVE
FT                   SGDMIELDVPRRKLNLLVTDDELARRKAAWVRPAPRFTRGYGAMHQVHVMQANQGCDFD
FT                   FLQRGGAQAAPDADVAKDTGEPEIH"
FT   gene            complement(334402..335007)
FT                   /locus_tag="Bphyt_4284"
FT   CDS_pept        complement(334402..335007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4284"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   bxe:Bxe_B0613 short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4284"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18661"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEZ0"
FT                   /protein_id="ACD18661.1"
FT                   /translation="MKKIVVIGATGTLGQAVSAELKARHEVIEVGATRGQYHVDSTDPA
FT                   SVERLFREIGKVDGVVTATGRVYFGPLPEMSIEQFWVGLRDKLMGQINVVLTGQQYVND
FT                   GGSFTLTSGILAEEPILQGASATTVNLALEGFVRGAAIEMPRGIRINLVSPTVLTEAMD
FT                   AYAPYFRGFEPVTAQRAAMAYLRSVEGAQTGRVYRVGY"
FT   sig_peptide     complement(334948..335007)
FT                   /locus_tag="Bphyt_4284"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.973) with cleavage site probability 0.669 at
FT                   residue 20"
FT   gene            complement(335224..335679)
FT                   /locus_tag="Bphyt_4285"
FT   CDS_pept        complement(335224..335679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4285"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0614 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4285"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18662"
FT                   /db_xref="InterPro:IPR021551"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEZ1"
FT                   /protein_id="ACD18662.1"
FT                   /translation="MMNSDIKKPADATQPAATSRANTAELHNDRTHDSTVDTDGKNLEA
FT                   ARIAGHSPISPDEITTSNATLTNSVPESLDGMAGFDSRVGGNHLLLALEPGYTVIDKGM
FT                   VAPQGAYSADHQYDDPRPVGSRQDRGRIHYALNHLRPTRLIELHRVK"
FT   gene            336000..336233
FT                   /locus_tag="Bphyt_4286"
FT   CDS_pept        336000..336233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4286"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0615 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4286"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18663"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEZ2"
FT                   /protein_id="ACD18663.1"
FT                   /translation="MHFDAAFTHRGYLLNCAPARAVDGTWQPYVVISRSSDGELVANRF
FT                   FPTDLRFREEAAAIAHARDWAVRWIDASSVTI"
FT   gene            336360..337286
FT                   /locus_tag="Bphyt_4287"
FT   CDS_pept        336360..337286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4287"
FT                   /product="Serine O-acetyltransferase"
FT                   /EC_number="2.3.1.30"
FT                   /note="KEGG: bxe:Bxe_B0616 serine O-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4287"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18664"
FT                   /db_xref="GOA:B2TEZ3"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR042122"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEZ3"
FT                   /protein_id="ACD18664.1"
FT                   /translation="MPNVPTQNWGLEQIVADLRASREQLHRTRHPLGIRELPSREAVVN
FT                   IVAGLRAALFPTHYGAPDLTDETVDYYVGHTLESTLRLLAEQIRRALRFLPEFGETPDV
FT                   DLQARAFDIAREFGTQLPGIRALLVSDIQAAFTGDPAAQHITEILLCYPGVWAMTHHRL
FT                   AHALHRLGVPLLARFINEIAHSATGIDIHPGATIGPSFFIDHGTGVVIGETAIIGERVR
FT                   VYQAVTLGAKSFAADLDGTLVKGNARHPIVEDDVVIYAGATILGRVTIGRGSVIGGNVW
FT                   LTHSVPPGSSVSQGKIREGERSDEGRQ"
FT   gene            337430..338251
FT                   /locus_tag="Bphyt_4288"
FT   CDS_pept        337430..338251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4288"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; AraC protein arabinose-binding/dimerisation;
FT                   KEGG: bxe:Bxe_B0617 transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4288"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18665"
FT                   /db_xref="GOA:B2TEZ4"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEZ4"
FT                   /protein_id="ACD18665.1"
FT                   /translation="MSRGRVHMPRCAIGGVEATVAETAHAFPRHSHDRFGVGVIVSGGH
FT                   RSASGRGLVEARANDAIMVNPGEVHDGSPLDERGRAWRMLYFEPSMLVTAASELTGAAA
FT                   REIELTQPVAHDPLLKRLFERLFAVAVEAPIMSDDLAREEALLELFGHVVRVHATRPTR
FT                   SWSADALGPIARAKARIDDDPSSPLTLADLAADSGMSRFQLLRGFAHEMGLPPHAYRMQ
FT                   RRVVLARQWIARGATLADAAAAAGFADQSHMTRAFVRLLGVTPANYAAALR"
FT   gene            complement(338297..338812)
FT                   /locus_tag="Bphyt_4289"
FT   CDS_pept        complement(338297..338812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4289"
FT                   /product="membrane-bound metal-dependent hydrolase"
FT                   /note="PFAM: membrane-bound metal-dependent hydrolase;
FT                   KEGG: bxe:Bxe_B0618 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4289"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18666"
FT                   /db_xref="GOA:B2TEZ5"
FT                   /db_xref="InterPro:IPR007404"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEZ5"
FT                   /protein_id="ACD18666.1"
FT                   /translation="MASSKAHHATGFAAGVIAAAIVARIGGGGSFHVGVLLSFIAGVIG
FT                   STAPDWLEVAWWSRARRLWITHRTLTHWGVGWLALLAVSYHWLGHSAYAAPAFGFACGG
FT                   LMHLFADWPNPLGVPWIAGRHSLNLWNSGHCDLIVVAASWAAAWFIGQHVWLHGVHGAA
FT                   LLQHLRIG"
FT   gene            complement(338952..339422)
FT                   /locus_tag="Bphyt_4290"
FT   CDS_pept        complement(338952..339422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4290"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0619 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4290"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18667"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEZ6"
FT                   /protein_id="ACD18667.1"
FT                   /translation="MSLRLNGGFVAKHDVALYRVALRPRPTFPRTTGDADDRTMKRLLL
FT                   LAPAAAALAALAGCGSSSGPARDASLPMIYVSSQHAPAYIADCLESRLSRVRTSHVGSA
FT                   TEIAVGSDSNNSYFVTLTPSNAGSVIKVMHPANAPDDPPEPEMRFDIARCAT"
FT   gene            complement(339621..340772)
FT                   /locus_tag="Bphyt_4291"
FT   CDS_pept        complement(339621..340772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4291"
FT                   /product="porin Gram-negative type"
FT                   /note="PFAM: porin Gram-negative type; KEGG: bxe:Bxe_B0620
FT                   outer membrane porin, OmpC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4291"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18668"
FT                   /db_xref="GOA:B2TEZ7"
FT                   /db_xref="InterPro:IPR001702"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEZ7"
FT                   /protein_id="ACD18668.1"
FT                   /translation="MKKTLIAAGLLSAVAISAHAQSSVTLYGTLDAGLVYSNNQGGHSN
FT                   WQQGSGSVSNTYFGLRGSEDFGGGLHAIFTLENGFNLNNGQNTESNTMFNRQAFVGLQS
FT                   DQYGALTLGRQYDSVVDYLAPLSEAGAGYGNNLAAHPLDNDNLDNSFSIKNAVKYTSAN
FT                   YAGLKFGGLYGFSNSAGDFSNNRAWSVGASYDNGPLSVAAAYLQLNQSGSSNLSGAVSQ
FT                   GDGTAAVAANLQRTYGAGINYTYGPATVGFVYTHTQLDGITGVDVGGTTLPGVAGTNLH
FT                   LDNYEVNGRYALTPDLSLAASYTFTDGKMSGSNGSGDPKWHTVSLQGDYSLSKRTDVYV
FT                   EGVYQHASGELGNFGSNVAAINTLAPSSTGNQVAAAVGLRHRF"
FT   sig_peptide     complement(340710..340772)
FT                   /locus_tag="Bphyt_4291"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.976 at
FT                   residue 21"
FT   gene            341401..341937
FT                   /locus_tag="Bphyt_4292"
FT   CDS_pept        341401..341937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4292"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0621 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4292"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18669"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEZ8"
FT                   /protein_id="ACD18669.1"
FT                   /translation="MTDLPLPSSDTAEDLTTEGASELGETVHEARLWRDDGWTARVIKN
FT                   EDDEGWAVAMIKDGEAEPALVGPWTMGRNKKDPKPLDTSAFNTLVKTASEVLRRHEQQL
FT                   RAQLHKEVRVASADGNDELDITLDIVPDEDEPYALLTALDTFGEQLAQVQVAPNFKLSK
FT                   ASAAAWVENEFRRPG"
FT   gene            342154..344106
FT                   /locus_tag="Bphyt_4293"
FT   CDS_pept        342154..344106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4293"
FT                   /product="putative exported alkaline phosphatase"
FT                   /note="KEGG: bxe:Bxe_B0622 putative exported alkaline
FT                   phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4293"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18670"
FT                   /db_xref="InterPro:IPR008557"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEZ9"
FT                   /protein_id="ACD18670.1"
FT                   /translation="MAEPLDLSRRKALKLLVGAPMLPLGGLATASMLTACGGSDELATP
FT                   VKPVANFVSAAFASMAAPTLADPAAMAKTTVGSTLTVQLSDGSSRAFKLAYQPFFVTGD
FT                   SVPNVKGGTILAGGYFDINNQPIVDKSVAGKERQFYSDCPDGSSLIRLDNPTVKGLKGN
FT                   AVFAVVQFEYTTRDQSLVSMYGQLPSPIAVLTLDQDPATGKLTLAGYSNVDTSKAHGLW
FT                   ITCGASLSPWNTHLSSEEYEPDATTIASNSQFKGFSRSLYGDETTANPYHYGHLPEVTV
FT                   NPDGTGTIKKHYCLGRISHELIQVMPDKRTVLMGDDATNGGLFMFIADREADLSAGTLY
FT                   VAKWTQVSASGAGAATLSWIKLGHASSDEIEALANQLRASDIMDVATKDPLDPAYTKIN
FT                   YNGTFNWVRVKPGMTQAATFLETHRYAALAGGSMGFTKLEGTTVNIKDKVLYSAMSRIE
FT                   KSMVRGNAASTDVAVDKTISAGAVYALNMKGGQRDRSGAAIDSEWVPVDMAAPAALVGE
FT                   DLSTADALGNTANPERIANPDNLKFSEKLRTLFIGEDSGMHVNNFLWAYNVDTKTLARV
FT                   LSCPAGAESTGLHAVDEINGWTYVMSNFQHVGDWESPLHDKVKSTLDPLVRANYKDRFG
FT                   ATVGYLTADPAGIRL"
FT   sig_peptide     342154..342261
FT                   /locus_tag="Bphyt_4293"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.830) with cleavage site probability 0.376 at
FT                   residue 36"
FT   gene            344204..344794
FT                   /locus_tag="Bphyt_4294"
FT   CDS_pept        344204..344794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4294"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: xac:XACb0003 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4294"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18671"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF00"
FT                   /protein_id="ACD18671.1"
FT                   /translation="MQWISILRQGYIDVASVRYGLSHLVASFFTLAIPASGKFAATTAT
FT                   VHVEYTSHCVSVGPGAQSPLDFEAPGSGRRIFDRRQVARAFCAERYRWSLRLPAIVAQL
FT                   GERRCYFTGHSNWLVIEDITDRGQPVEYEVFFRLRRMGASALRLVIESAYVRDVTRGKA
FT                   GTPRNRRSIVRFRVMAAKILRGKSIRDPSLNRR"
FT   gene            complement(345059..345493)
FT                   /locus_tag="Bphyt_4295"
FT   CDS_pept        complement(345059..345493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4295"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bvi:Bcep1808_5556 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4295"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18672"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF01"
FT                   /protein_id="ACD18672.1"
FT                   /translation="MKRFLSSVLLALAAAALPLASYATALDVPLACNESGHQFIADLAD
FT                   QQLIDPKPTRVESNSINAFSPTSGANLTAYGFRVFAVVGYEKDDPMFRVGDGEPVARSA
FT                   YGVVVFGSEAKVRNAIAGTGSTAIVHRVAPLITAIFCKRS"
FT   sig_peptide     complement(345416..345493)
FT                   /locus_tag="Bphyt_4295"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.724 at
FT                   residue 26"
FT   gene            345740..346441
FT                   /locus_tag="Bphyt_4296"
FT   CDS_pept        345740..346441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4296"
FT                   /product="CDP-alcohol phosphatidyltransferase"
FT                   /note="PFAM: CDP-alcohol phosphatidyltransferase; KEGG:
FT                   bxe:Bxe_B0624 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4296"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18673"
FT                   /db_xref="GOA:B2TF02"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF02"
FT                   /protein_id="ACD18673.1"
FT                   /translation="MNSRPQTPINVPPPRTWDARLARRLVTPLVNTWVTPNHLTTLRLL
FT                   IGLAGALCLAHGEFAWANAGALLIVLSNFVDHTDGELARIGGKSSRIGHFYDLACDALV
FT                   TVMLFVGMGVGAGATHIAGLKIAPGVLGAVAGVAIALIFFLRMRIEEMAGKAGTRQASV
FT                   GGFETEDVLYLLPIVTLTSVVLPFVVVASIGAPLFAVWVVVDYWRVARRAASAPPVAAG
FT                   TAETRQMWASE"
FT   gene            346438..347250
FT                   /locus_tag="Bphyt_4297"
FT   CDS_pept        346438..347250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4297"
FT                   /product="2OG-Fe(II) oxygenase"
FT                   /note="PFAM: 2OG-Fe(II) oxygenase; KEGG: bxe:Bxe_B0625
FT                   oxidoreductase, 2OG-Fe(II) oxygenase family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4297"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18674"
FT                   /db_xref="GOA:B2TF03"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF03"
FT                   /protein_id="ACD18674.1"
FT                   /translation="MSTQAENDLIARDAVEHSPAASPAPNADRAVASRTRGFDNLRLRK
FT                   DFAEQGAFLYLEDFLAPEVTAQLVHSARSLLDEVNRNYLPGHKQGGSVSRHTIDRLAPF
FT                   IAELYRSKELIGWLEQLSGDKLQLSPADDPHAYALYYYTRPGDHIGWHYDTSYYDGRRY
FT                   TLLLGVIDESSCRLDYELHTRNPDVADQPGSVQIPPGGLVFFDGDKLRHRITPAGANEM
FT                   RVSLTFEYVTDPNMRPWRRFISNMKDAIAYFGFRQVFRQMTRRGKDRA"
FT   gene            347247..348266
FT                   /locus_tag="Bphyt_4298"
FT   CDS_pept        347247..348266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4298"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0626 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4298"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18675"
FT                   /db_xref="GOA:B2TF04"
FT                   /db_xref="InterPro:IPR022791"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF04"
FT                   /protein_id="ACD18675.1"
FT                   /translation="MSRAALILLSIGTALFVGLLAWQGFGSVASTLLTAGWGLALVAAF
FT                   HLVPVLLDAGAISVLFHPRRDGIHHDLTWRDALFARWIGESVNSLLPAGQIGGPVVMVR
FT                   QLSQRGMRMRDAAAAITVSTTAQALAQIIFALGGLLLFGAYAAHGALHDLQTATLIATG
FT                   VLGAMIVGFYYAQRRGLFGRLLGVVSKVFGKRDWSSLMTRAEAVDAAVQAMYRERGRVA
FT                   ASFAMSLLGWIVGTVEVWLALRFLGHPVDWVDALLLESLGQAIRGAAFMIPGSLGVQEG
FT                   GYLLLAPLVGLPPDAALALSLAKRAREILLGLPGLLVLHFSERSWQRRRALGRVPVVD"
FT   sig_peptide     347247..347336
FT                   /locus_tag="Bphyt_4298"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.452 at
FT                   residue 30"
FT   gene            348294..349058
FT                   /locus_tag="Bphyt_4299"
FT   CDS_pept        348294..349058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4299"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0627 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4299"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18676"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF05"
FT                   /protein_id="ACD18676.1"
FT                   /translation="MRAIILAAGLGLRLQQPPEAQFPKCLLQFDGMSLLERHLQMLETA
FT                   GVTEVVLALGFQPESVQAELERINWPHQVETVLNTRYDLGSVLTVHTVADALTRGGDVL
FT                   LMDADVLYDERILAALVAGETVNRLLIDRDFEAGDEPVKLCLKDGVPVELRKQLAVNLE
FT                   YDTIGESVGFFRFRQETAQRFAQIVAGYVDSGRANLPHEEAVRDLLLERSQVFDTADVT
FT                   GAPWIEIDFPNDVARASTEILPQLQPLVSASR"
FT   gene            349284..350687
FT                   /locus_tag="Bphyt_4300"
FT   CDS_pept        349284..350687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4300"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bxe:Bxe_B0628 major facilitator superfamily (MFS) multidrug
FT                   efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4300"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18677"
FT                   /db_xref="GOA:B2TF06"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF06"
FT                   /protein_id="ACD18677.1"
FT                   /translation="MPLALGTFIVPLIVACAMFMENVDGTVIVTSLPVLARDLGQDPIT
FT                   LKLAVTAYVIGLGVFIPICGWVADRFGSRTVFRAAIGVFMAGSLMCAASTSLGTFVVAR
FT                   FVQGIGGAMMVPVGRIIIFRSVPKSDFIRAVNYLTVPALLGPVVGPPLGGFITTYLHWR
FT                   LIFFINIPIGLLGIWLANKHIANVREAHPGRLDWTGFFLSASGASLFMLGLSLVGGELV
FT                   SNTVSVGMCVIGVVLLTLYALYASRVELPVLDLRLLRIPSFHASVVGGSLFRIGLGAVP
FT                   FLLPLALQEGLGMTAFKSGSITCASAFGSIFMKAAASRILERFGFRTVLMFNAGCAGLA
FT                   IAVYGLFFPGTPHWLIWCVVLFGGFFPSLQFTSLNTLAYADIPSRDVGRATSVASVIQQ
FT                   ISLGLGVTIAGIVLQISHNVQGHSAIVFSDFWPAFLVVGLFSFMSIPITARLPHGAGDE
FT                   IARGSRGNA"
FT   gene            350909..352642
FT                   /locus_tag="Bphyt_4301"
FT   CDS_pept        350909..352642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4301"
FT                   /product="gamma-glutamyltransferase"
FT                   /EC_number="2.3.2.2"
FT                   /note="KEGG: bxe:Bxe_B0629 gamma-glutamyltranspeptidase;
FT                   TIGRFAM: gamma-glutamyltransferase; PFAM:
FT                   gamma-glutamyltranspeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4301"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18678"
FT                   /db_xref="GOA:B2TF07"
FT                   /db_xref="InterPro:IPR000101"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF07"
FT                   /protein_id="ACD18678.1"
FT                   /translation="MKLFRNVKSSASGFALVALVSVSTGFLEATPAIAKPPAKAQPAVL
FT                   TASAIAVADKFSADAAEQIFKEGGNAVDAAVAIAFTLAVTYPEAGNIGGGGFMTLYVDG
FT                   KPYFLDYRERAPLAATRNMYLDDKGEVIKGMSLFGYRAVGVPGTVDGMWQAQRRFGKLK
FT                   WKQVLAPAIHYARDGFEVSQQLQERRDEAAKEFAGKTNFDTYFGNLKQGVNFKQPDLAA
FT                   VLQRISDQGAKDFYQGKTADLIAASMRGHGLITKADLQQYKAVWREPIQADWNGYRVYT
FT                   APPPSSGGIGLVQLLKMKADIAPDFKGVALNSAQYVHLIAEIEKRVFADRAQYLGDPDF
FT                   YKVPVAQLTDDAYIAKRAGEVNPNAPSDTKSIQAGLGTSMPEKAETTHFSVIDKWGNAV
FT                   SNTYTINGYFGSGVVADRTGIVLNDEMDDFSAKPGVANMFGVVGSDANAIEPKKRPLSS
FT                   MTPTILTKDGKVSLVIGTPGGSRIFTSIFQVINNVYDYNMPLQQAVAAMRFHHQLLPPN
FT                   TIFWEPYKPIDGELAKQIEAKGYTLKGQDFSGDIQAIKIDGNTPEAAADPRGRGVTRVI
FT                   Q"
FT   sig_peptide     350909..351013
FT                   /locus_tag="Bphyt_4301"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.696 at
FT                   residue 35"
FT   gene            complement(352770..353813)
FT                   /locus_tag="Bphyt_4302"
FT   CDS_pept        complement(352770..353813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4302"
FT                   /product="2-alkenal reductase"
FT                   /EC_number="1.3.1.74"
FT                   /note="PFAM: peptidase S1 and S6 chymotrypsin/Hap;
FT                   PDZ/DHR/GLGF domain protein; KEGG: bxe:Bxe_B0630 putative
FT                   serine protease"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4302"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18679"
FT                   /db_xref="GOA:B2TF08"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF08"
FT                   /protein_id="ACD18679.1"
FT                   /translation="MGSRPRFVDDLSRAASDAPGPETLNPFSDDALLDAYSRTVIGALE
FT                   RVQQAVAFIAVERRLPGQPSGRGRGSRGGTGSGFLFTPDGYLLTNSHVVHGATHITVTL
FT                   ADGAKFDADLVGDDPGSDLAVLRIGSPEPLAHVELGESSKLRVGQIAIAVGNPLGLAQT
FT                   VTTGVVSALGRSLRSNSGRMIYDVIQTDAALNPGNSGGPLINSAGQVIGVNTAIIPGAQ
FT                   AICFATAIDTAKWVIMQIFAHGRVRRAYIGVAGTTRPLSRRVQRYFGLSSESGVHVMEI
FT                   VKGSPAALGGLRTDDTIIAIDTQAVQDVDSLQRTLDASRIDRPVNVTVLRGAQRLELTL
FT                   TPVEQAS"
FT   gene            354105..354503
FT                   /locus_tag="Bphyt_4303"
FT   CDS_pept        354105..354503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4303"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: bxe:Bxe_B0631 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4303"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18680"
FT                   /db_xref="GOA:B2TF09"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF09"
FT                   /protein_id="ACD18680.1"
FT                   /translation="MNPAATSPSSSGPTEPQIESISAITLATRDMPRAVLFYEALGFPM
FT                   KFGGPQEAFTSFAFGGSYLNLIVDTRAPVAWWGRVIIYVSDVDALYRKALAAGLKPSLE
FT                   PSDAPWGERYFHITDPDGHELSFAKPLR"
FT   gene            354660..355586
FT                   /locus_tag="Bphyt_4304"
FT   CDS_pept        354660..355586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4304"
FT                   /product="protein of unknown function DUF344"
FT                   /note="PFAM: protein of unknown function DUF344; KEGG:
FT                   bxe:Bxe_B0632 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4304"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18681"
FT                   /db_xref="GOA:B2TF10"
FT                   /db_xref="InterPro:IPR016898"
FT                   /db_xref="InterPro:IPR022486"
FT                   /db_xref="InterPro:IPR022488"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF10"
FT                   /protein_id="ACD18681.1"
FT                   /translation="MKEQDPRPEAELMAERQRRFEEDLIDAYDEELEMEVDDRIIDGAE
FT                   GFTPEHREARKMYFRELFRLQGELVKLQDWIVQTGHRLVVIFEGRDAAGKGGAIKRITQ
FT                   RLNPRVCRVAALPAPNNRERTQWYFQRYVSHLPAGGEMVLFDRSWYNRAGVERVMNFCS
FT                   DEEYEEFFRSVPEFEKMLARSGVQILKYWFSITDEEQEIRFQNRIHDPLKQWKLSPMDL
FT                   ESRRRWEAYTQAKEVMLQRSHILEAPWWVVQAVDKKRARLNCIHHLLSQVPYHEIEHSQ
FT                   IELPSRVYHDEYSRQPVPASMIVPEVY"
FT   gene            complement(355696..357282)
FT                   /locus_tag="Bphyt_4305"
FT   CDS_pept        complement(355696..357282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4305"
FT                   /product="phosphate transporter"
FT                   /note="PFAM: phosphate transporter; KEGG:
FT                   bur:Bcep18194_B0357 phosphate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4305"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18682"
FT                   /db_xref="GOA:B2TF11"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF11"
FT                   /protein_id="ACD18682.1"
FT                   /translation="MPELSYPQPGTAAGKGRNISLIIFLAVILVGAVYCAVHLLDDLQP
FT                   VRESSVLPYLLLGIALLIALGFEFVNGFHDTANAVATVIYTHSLAPNFAVVWSGSWNFL
FT                   GVLTSSGAVAFGVLQLLPVELILQVGSSAGFAMVFALLIAAIIWNLGTWWFGLPSSSSH
FT                   TLIGSIIGVGLMNQLMHGTDGTSGVDWNQALGVGKSLLFSPLVGFLAAGLLLLILKAVV
FT                   RIPALYAEPKGKEPPPFWIRCLLILTCTGVSFAHGSNDGQKGMGLIMLILIGTVPTAYA
FT                   LNKAVTPAETQTFLAVAHETSATLAKYTQGATPSANPRADVEAYVRTHQLTPATVPALR
FT                   QLTDIIAGQVGTSGSMAAVPQGIVDNVRNNMYVASEAIRLMAKNKQPAFSPEDAKTIGN
FT                   FKTQTDHATKFIPTWVKVAVAIALGLGTMVGWKRIVVTVGEKIGKQHLTYGQGASAELV
FT                   AMLTIGAADMYGLPVSTTHVLSSGVAGTMAANGSGLQWGTVRSLILAWVLTLPVSIALA
FT                   AGLYWVFRAVF"
FT   gene            complement(357489..358082)
FT                   /locus_tag="Bphyt_4306"
FT   CDS_pept        complement(357489..358082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4306"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: reu:Reut_C6188 short chain
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4306"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18683"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF12"
FT                   /protein_id="ACD18683.1"
FT                   /translation="MRILIVGATGLIGGEVVKLLAAEHDIVTASRKGSDLHVDLSNKGS
FT                   IESMYQQAGTLDAVICTAGAAKFAPLDSLSDDDFSFSLTNKLMGQVNLVRCGAAHVSQG
FT                   ACFTLTSGTLAQHPMEGSAAVSIVNAGVEAFARSAALELRGKARVNVVSPGWVAETLES
FT                   MGRDPSQGVPVAVVAQAYKRSLNGSASGDVISAS"
FT   gene            358349..359230
FT                   /locus_tag="Bphyt_4307"
FT   CDS_pept        358349..359230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4307"
FT                   /product="CHAD domain containing protein"
FT                   /note="PFAM: CHAD domain containing protein; KEGG:
FT                   bxe:Bxe_B0637 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4307"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18684"
FT                   /db_xref="InterPro:IPR007899"
FT                   /db_xref="InterPro:IPR038186"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF13"
FT                   /protein_id="ACD18684.1"
FT                   /translation="MKRDNPKGEKRSADSEPAVKAHSAQEAFSSYAAPLVDHAIEYANA
FT                   VREDPSPEALHKLRVSLRRLRSLWWAFEPLLESGENTRQRALYKYLATAAGKTRDWDIL
FT                   IELLTRDDNGARSGTGEIAPKLQDARGAALTTSRETLSNADVKHLLREALSTASKELNT
FT                   AHERTPLRKFAEQRVAASERSLKKRMKRARRAKRSNYVAFHNVRKAGKKLRYLLEFFGP
FT                   ILSGGRKRTLKRLKQIQKRFGTLNDVVASEMLLRDNAALLAGAGDPEAALHWLGKERKR
FT                   RMRSAAGLLRKL"
FT   gene            complement(359257..360294)
FT                   /locus_tag="Bphyt_4308"
FT   CDS_pept        complement(359257..360294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4308"
FT                   /product="putative DedA-like transmembrane protein"
FT                   /note="KEGG: bxe:Bxe_B0639 putative DedA-like transmembrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4308"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18685"
FT                   /db_xref="GOA:B2TF14"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF14"
FT                   /protein_id="ACD18685.1"
FT                   /translation="MVEFPSSAVSTWGGAVVFLNVLLTRLGVPIPAVPVLLFAGSAIAA
FT                   GTLSFWPVLGAAVLGALLGDGAWFTAGRLYGRKLIAALGRLSPAVDAKVDKARALFERF
FT                   GVPLVSISKFVPGLALITPPLMGTTAVDARIYAAWDVAGALAWAAFWLLGGAAAERQLH
FT                   MLLEFVKARGGTVIDILLASALLYLVFRLQQRRRERRRFREAAAAQAAGGWLRLAPPPK
FT                   VLDARPQAPSIEAPCRIPGALALDPHSPEQIDGALRAHDTVIYCICPDSATAVEITQRM
FT                   RYNGYTRIRALRGGLDAWQRRGFPVEPLALTDEPGTGNRAAASLGEARGAITLRGFAPR
FT                   STQGT"
FT   gene            360587..361492
FT                   /locus_tag="Bphyt_4309"
FT   CDS_pept        360587..361492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4309"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: bxe:Bxe_B0640 putative transmembrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4309"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18686"
FT                   /db_xref="GOA:B2TF15"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF15"
FT                   /protein_id="ACD18686.1"
FT                   /translation="MNSRYAGYLYCALAMIGVGSTVVVSKPIAAGLPPFSATALRFAIA
FT                   FPLFVLAMRWRGVRWPRLDRRDTLLVIAQAGAGSVGYTVLLISGMKLASAADAGVIAGT
FT                   LPAVSAGVAVLALGERPAPALIGAILLATAGVLVCTVHPGEFSAPHAVSSLAGNALVFL
FT                   AIVCEALFILLNRKLSTAVAPLPLSALMCGIGFAVALVPACFEKPWALPVDASALGGVL
FT                   YYALVPTVVGFVLWYAGAARISGAEAGLMTALVPVSAVALAAMVLGEPVSAAQLAGVAC
FT                   VLGAVLLATFGQLRMRRSAA"
FT   sig_peptide     360587..360664
FT                   /locus_tag="Bphyt_4309"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.735) with cleavage site probability 0.577 at
FT                   residue 26"
FT   gene            complement(361526..362164)
FT                   /locus_tag="Bphyt_4310"
FT   CDS_pept        complement(361526..362164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4310"
FT                   /product="GTP cyclohydrolase I"
FT                   /EC_number="3.5.4.16"
FT                   /note="PFAM: GTP cyclohydrolase I; KEGG: bxe:Bxe_B0641 GTP
FT                   cyclohydrolase I"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4310"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18687"
FT                   /db_xref="GOA:B2TF16"
FT                   /db_xref="InterPro:IPR001474"
FT                   /db_xref="InterPro:IPR018234"
FT                   /db_xref="InterPro:IPR020602"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF16"
FT                   /protein_id="ACD18687.1"
FT                   /translation="MTSSKAKKTKPITATERPSREEAEAAVRVLLRWAGDDPAREGLID
FT                   TPARVVRSYEEFYAGYQVDPREILARTFSEVDGYDEMIVLKDIRFESYCEHHMVPIIGR
FT                   AHVAYLPQHRVVGISKLARLVDAFAKRLQIQEKMTVQIADTLNEVLQPAGVGVILEAAH
FT                   QCMSTRGVHKAGVTMVTSRMLGTFRTDPSTRREFLSIVGNPGVVAVANT"
FT   gene            complement(362288..363217)
FT                   /locus_tag="Bphyt_4311"
FT   CDS_pept        complement(362288..363217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4311"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bxe:Bxe_B0642 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4311"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18688"
FT                   /db_xref="GOA:B2TF17"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF17"
FT                   /protein_id="ACD18688.1"
FT                   /translation="MSESNLDLNLIPFLVAMEDTRNVSRAAEQLGVSQPRVSTALGKLR
FT                   EYFDDPLFVRTSKGMEPTPRALAILPAARDALLRIEKGMLDVQEFDPATSTHTFSIALS
FT                   DVGEIVFLPRLLQLFAERAPFANLRSVTVSPSQVERGLESGDVDLAIGYFPDLAGNNFF
FT                   QQRLFSHRFICLMRTGHPLSKAPLTLAQYVASGHAVVRSEGRSQEILEQYLEKKRIKRR
FT                   AVLETPHFMSLPFILARTDLLATVPHAIGFAYVSEHASITLVEPPLPLPHFDLRQHWHR
FT                   KFHNDPRGGWLRSVVAELFNDAMDEWPK"
FT   gene            363604..364311
FT                   /locus_tag="Bphyt_4312"
FT   CDS_pept        363604..364311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4312"
FT                   /product="3-oxoacid CoA-transferase, A subunit"
FT                   /EC_number="2.8.3.5"
FT                   /note="KEGG: bxe:Bxe_B0643 3-oxoadipate CoA-transferase
FT                   subunit A (PcaI); TIGRFAM: 3-oxoacid CoA-transferase, A
FT                   subunit; PFAM: coenzyme A transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4312"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18689"
FT                   /db_xref="GOA:B2TF18"
FT                   /db_xref="InterPro:IPR004163"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR012792"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF18"
FT                   /protein_id="ACD18689.1"
FT                   /translation="MINKIFESLQSAVADVNDGATVMIGGFGTAGMPSELIDALIEQGA
FT                   RELTIVNNNAGNGDIGLAALLKAKRVRKIICSFPRQSDSYVFDALYRAGELELELVPQG
FT                   NLAERIRAAGAGIGGFFTPTGYGTKLAEGKETRLIDGRHYVLEAPLHADFALIKAYRGD
FT                   RWGNLTYRKTARNFGPIMATAAKTAIVQVSQVVPLGELDPENIVTPGIFVQRVIEVPQA
FT                   AHAPMPNPHDAAA"
FT   gene            364325..364984
FT                   /locus_tag="Bphyt_4313"
FT   CDS_pept        364325..364984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4313"
FT                   /product="3-oxoacid CoA-transferase, B subunit"
FT                   /EC_number="2.8.3.6"
FT                   /note="KEGG: bxe:Bxe_B0644 3-oxoadipate CoA-transferase
FT                   subunit B (PcaJ); TIGRFAM: 3-oxoacid CoA-transferase, B
FT                   subunit; PFAM: coenzyme A transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4313"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18690"
FT                   /db_xref="GOA:B2TF19"
FT                   /db_xref="InterPro:IPR004164"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR012791"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF19"
FT                   /protein_id="ACD18690.1"
FT                   /translation="MKKLTRDEMAKRVALDIPEGAYVNLGIGVPTLVANHLDADKEIFL
FT                   HSENGLLGMGPAPAKGEEDDELINAGKQHVTLLTGGCYFHHADSFAMMRGGHLDFCVLG
FT                   AFQVSAKGDLANWHTGAPDAIPAVGGAMDLAIGAKQVYVMMEHLTKQGESKIAAECSYP
FT                   VTGVGCVDRIYTDLAMIDVTDRGLVVREIFSDIDFDALHKLTGVPLIDGTQAAHAA"
FT   gene            365077..366456
FT                   /locus_tag="Bphyt_4314"
FT   CDS_pept        365077..366456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4314"
FT                   /product="3-carboxy-cis,cis-muconate cycloisomerase"
FT                   /note="TIGRFAM: 3-carboxy-cis,cis-muconate cycloisomerase;
FT                   PFAM: fumarate lyase; KEGG: bxe:Bxe_B0645
FT                   3-carboxy-cis,cis-muconate cycloisomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4314"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18691"
FT                   /db_xref="GOA:B2TF20"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR012789"
FT                   /db_xref="InterPro:IPR019468"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF20"
FT                   /protein_id="ACD18691.1"
FT                   /translation="MLDSSARLTGLLCGTQPMNDIWAPRATLQRMLDVEAALARASAAH
FT                   QVIPQTAVAAIEAACQADQLDADALARDAALGGNLAIPLVKQLTARVKAADAEASKYVH
FT                   WGATSQDIIDTATVLQLRDTFDLLDSSLQSTCDAVAKLAATHRTTPMIGRTWLQQALPI
FT                   TLGLKFAQWLDALLRHRERLDALRARALVLQFGGAAGTLASLRDAAPQVTQSLAKELGL
FT                   TVPTLPWHTQRDRIAETAALFGMLIGTLGKIARDISLQMQTEIDELAEPAAAGKGGSST
FT                   MPHKRNPVGCAAVLTAATRAPGLVATVFAGMVQEHERALGGWQAEWDALPDLARLAGGA
FT                   LANIEQIAAGLNVNVPRLAANLDVTHGLILGEAVMLALGDSIGRLDAHHLVERASKAAI
FT                   RDGQTLFDVLAADPAVTAHLPLERLKQLLDPAQYVGQAHAYVDAALALHTTRSQRDHSR
FT                   E"
FT   gene            366462..367253
FT                   /locus_tag="Bphyt_4315"
FT   CDS_pept        366462..367253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4315"
FT                   /product="3-oxoadipate enol-lactonase"
FT                   /note="TIGRFAM: 3-oxoadipate enol-lactonase; PFAM:
FT                   alpha/beta hydrolase fold; KEGG: bxe:Bxe_B0646 3-oxoadipate
FT                   enol-lactonase (PcaD)"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4315"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18692"
FT                   /db_xref="GOA:B2TF21"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR026968"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF21"
FT                   /protein_id="ACD18692.1"
FT                   /translation="MPYAAVNGTELHYRIDGDRHGNAPWIVLSNSLGTDLSMWASQVAA
FT                   LSKHFRVLRYDTRGHGHSEAPKGPYTIEQLTGDVLGLMDTLKIARANFCGISMGGLTGV
FT                   ALAARHGNRFERVVLCNTAARIGSPEVWVPRAAKARSEGMLALADAVLPRWFTADYIER
FT                   EPVVLALIRDVFVHTDKEGYASNCDAIDAADLRPEAPGIKLPALVISGTHDLAATPAQG
FT                   RELAQSIPGARYVELDASHISNIEKADAFTKTVVDFLTEQK"
FT   gene            367250..367645
FT                   /locus_tag="Bphyt_4316"
FT   CDS_pept        367250..367645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4316"
FT                   /product="4-carboxymuconolactone decarboxylase"
FT                   /EC_number="4.1.1.44"
FT                   /note="KEGG: bxe:Bxe_B0647 4-carboxymuconolactone
FT                   decarboxylase (PcaC); TIGRFAM: 4-carboxymuconolactone
FT                   decarboxylase; PFAM: Carboxymuconolactone decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4316"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18693"
FT                   /db_xref="GOA:B2TF22"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR012788"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF22"
FT                   /protein_id="ACD18693.1"
FT                   /translation="MNDEDRYEAGLDVRRAVLGSAHVDRSLANRNELTEEFQNFITRYA
FT                   WGEIWTRDGLPRHTRSLLTIAMMVALNRSEELALHLRAAKNNGVTREQIKEVLLQTAIY
FT                   CGVPAANSAFHLADKLFREDDAAAAQP"
FT   gene            368163..369011
FT                   /locus_tag="Bphyt_4317"
FT   CDS_pept        368163..369011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4317"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: bxe:Bxe_B0650
FT                   ABC polysaccharide efflux pump, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4317"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18694"
FT                   /db_xref="GOA:B2TF23"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF23"
FT                   /protein_id="ACD18694.1"
FT                   /translation="MSFTYKHDGREESHPRAHFRDLFLLPWQQRQLIVALTRRDILSRY
FT                   RGSIMGLAWSIVQPLIMLAMYTVVFGTLLKSRWPGTDNSFQFAVILFVGLILFNFFAEC
FT                   LNRAPTIITTNANYVTKVVFPLEILPWITVASAAFHFLTSFAVWLVFALCVYGKLQWTI
FT                   VFLPALFIPLAFVGVGVGWLFAATGVYVRDLTYVTTLLSSLLMFLSPVFYALDTLTPAF
FT                   RALILTNPLTFIIEQARAVMIAGELPDFVGIAIYLSCSIGFAWICLAWFQKTREGFADV
FT                   L"
FT   gene            369012..370382
FT                   /locus_tag="Bphyt_4318"
FT   CDS_pept        369012..370382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4318"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bxe:Bxe_B0651 ABC polysaccharide efflux pump, ATPase
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4318"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18695"
FT                   /db_xref="GOA:B2TF24"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029439"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF24"
FT                   /protein_id="ACD18695.1"
FT                   /translation="MPMLMEMNQVGKPETTIQVTNASKRFDIYETPLDRLKHIVFPKRT
FT                   GYSREFWALRDVSLSVTRGETVGIIGRNGSGKSTLLQIICGTLRPTQGDIAINGRVAAL
FT                   LELGAGFNLEFSGRENVYLNAAMLGMTSDQIERKFASIEQFAEIGDFIDQPVKTYSSGM
FT                   YVRLAFAVAIHVEPAVLIIDEALAVGDARFQAKCFNKIKELKESGVTILFVSHDVGSVR
FT                   TLCERAVWLDGGRVRMEGGAFAVTAQYTQFMSEGLGESEAIGISSQPAGSAAGLDEEAK
FT                   QNGQTAQNAGRPAATASDEPINHWGTHIGSIVSSQVLDSAGRRQSVFTAFEPMIVRLAI
FT                   QIPEGVDRRALSVAFSIKDTKGTDLIVRTTHDEKGIDFEFDGSEFEIEFRLRNQLNTGR
FT                   YLLVAALEDRSTAVPQYYEYIEGACYFSSYIENDRYGLFLPDITEKIRMDETPLLRR"
FT   gene            370431..373142
FT                   /locus_tag="Bphyt_4319"
FT   CDS_pept        370431..373142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4319"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   amt:Amet_3452 glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4319"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18696"
FT                   /db_xref="GOA:B2TF25"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF25"
FT                   /protein_id="ACD18696.1"
FT                   /translation="MDGQEAMPNITRRQTLAPVTKRSASISDADALITQHEQIAEEQRL
FT                   ARRDRYTLAKRLSDALSEIHSLKRSLNDASSELGLEVRERERVQGALSEVFESSSWKVT
FT                   APMRRIASAVYALAARGKTQAPAVASVPMHDVLPVAGGDYETHTRAQAAYFGNYAKDPS
FT                   KQRRHQISRLLSAHPDRRGVLLCPVAYDLSLKQRPDHIMAEFAKAGYLCVMLEFGGLYP
FT                   VIQPKTKNLYVSNMVEDFLGYFQDEPVTLYLHWPGFKYVAEICRAALTIYDVLDDLTIF
FT                   ANYSDVMRCDHEVLLQIANVCLFSSNRLYEANRAKVTNALLLENGVYPEDFIHGERERC
FT                   DVPPELYEMVANRKVVGYHGAISELLDFDLLDEIVRLSGIVLLFVGPVVAFEPQYSVEV
FT                   QERMARLKTFDNFIHLGPKPYDELKHYLAWIDVGIVPFVVSEKTDPVSPLKLFEYLAAG
FT                   KPVIGTPTRTIREYEHAMIVASGIDFVDAVASGDWSTAYTEASAEVAGAHAWPVLHAPL
FT                   LRQVNARNVTRLSAPSARRTMKVDIINVNFYDWNGETVYKGGAERYVYDLAVVLHGMRC
FT                   EVRLLQNAREPFERDFRGVKVVGVKAADNFDFDMMSSNYAEYCADVDLIIASPTELAAS
FT                   LGKTRRVISINHGIHWDGASNNLATFDRGRYETLFRALRNSDQCVCVDTNFINWVRTYD
FT                   WALANTLTYVPNYVDLESFRSQPKNFEAEELCVLLPRRLYEARGLYLTINAFDLLFSRR
FT                   ADIRLVLCGQAVDRDAEAVKAFMARHSQRVTWTEYDMEEMHKAYVDSHIVLVPTMYSEG
FT                   TSLSCIEALATNNAVIATNVGGLPNLIVDGYNGKLIRADYIELATAIEELADDRVRLAR
FT                   LAAHGLESSAAFAKKEWENRWREVIESTLTVD"
FT   gene            373209..374396
FT                   /locus_tag="Bphyt_4320"
FT   CDS_pept        373209..374396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4320"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; KEGG: bxe:Bxe_B0652
FT                   putative glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4320"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18697"
FT                   /db_xref="GOA:B2TF26"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF26"
FT                   /protein_id="ACD18697.1"
FT                   /translation="MTDINSKQYWDHRFSTDWVSAGGHGQTRFFATLAAKLMPDWFKDL
FT                   VLREQWNICDWGCAEGQGVDELSKWLGVNSITGVDISEVAIAKAQAFFPHRHFKAQSLD
FT                   NLDDYDVIFSSNTLEHFDSPFDVVARLAEHTKRFLVLLLPFQEYDRIPEHFFTFDLDNI
FT                   PVCPVPGFAAVACRVVDAAKINIDYWNGKQILVVYARLSALGHTQPDLRNFFTGDDTYE
FT                   AFALERSQSIAQQHASEREQFAAQLAQTHSEHAATTARLESTENTLQQVCAELDAQKAA
FT                   LKRSQETLAERDQVLGELKQAISEREQTVRELTRAITERDQTMGEASQECRALSTEIAS
FT                   LHACIERYEIEGEQCAALLTEARAHADAVERQLNTMLRSKTWRLRSAICRLVGRA"
FT   gene            374463..375566
FT                   /locus_tag="Bphyt_4321"
FT   CDS_pept        374463..375566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4321"
FT                   /product="UDP-N-acetylglucosamine 2-epimerase"
FT                   /EC_number="5.1.3.14"
FT                   /note="PFAM: UDP-N-acetylglucosamine 2-epimerase; KEGG:
FT                   bxe:Bxe_A3733 UDP-N-acetylglucosamine 2-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4321"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18698"
FT                   /db_xref="GOA:B2TF27"
FT                   /db_xref="InterPro:IPR003331"
FT                   /db_xref="InterPro:IPR029767"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF27"
FT                   /protein_id="ACD18698.1"
FT                   /translation="MKKRKIIVTIGTRPEAVKMAPLVKQLQREEWADCRVLATAQHRGM
FT                   LDQVLRLFEIEADIDLDIMQPSQSLPMLTSRLMVRLDDVLAAEQPDVLLAQGDTTTVLT
FT                   AALASFYRRVPVGHVEAGLRTGDLSNPFPEEMNRVVASRLARWHFAPTETAKTNLLTEG
FT                   IDAANVFVTGNTVIDALLDVAARCDGATPFKGDSRLILVTSHRRENFGEAFQNILRAIK
FT                   TIADNNPDVHVLYPVHPNPNVRETAYAQLGNHPRITLCEPLDYLPFVAAMKRAYLILTD
FT                   SGGVQEEAPALGKPVLVLRRETERPEAVAHEVVRLVGTEYADIVSNTQRLLDDPAEYGR
FT                   MARGVSPYGDGQASERIVSVLRDHFRV"
FT   gene            complement(375588..376316)
FT                   /locus_tag="Bphyt_4322"
FT   CDS_pept        complement(375588..376316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4322"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: bxe:Bxe_B0653
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4322"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18699"
FT                   /db_xref="GOA:B2TF28"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041474"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF28"
FT                   /protein_id="ACD18699.1"
FT                   /translation="MSSTAARKPGATGIRAKQAQDTRAKILKAAIKVFAKQGYASGRVE
FT                   SISKAARSHDRMIYYYFGSKEQLFVEVLETIYTQFNEAESKLDLDLDDPVHGLEQMVEF
FT                   VWQYYLDHPEFVTLLSSENLHQGKHAKKSLKLKEISGYAISVVQKLLDAGQAQQVFRSD
FT                   VKARDVYLMIASLGYFYNANQYTLGAFLGEPLMDKASLDHWREVIKDTVLRAVRSSLPA
FT                   QAGATALTVALNEAGQNSEA"
FT   gene            376678..378306
FT                   /locus_tag="Bphyt_4323"
FT   CDS_pept        376678..378306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4323"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0654 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4323"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18700"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF29"
FT                   /protein_id="ACD18700.1"
FT                   /translation="MSSYGNPTMTEHTKVDFGADSVDGETASTPGPTVLEKAAPRSERM
FT                   ASNKIECNACPVLCQISEGRTGACDRYANADGRLIRVDPVVFLSRASSSSTAEANAAIE
FT                   FGASSESEVQDSAAGQALFVTGVGASSTYPDYKPAPFIVASKLDDVDMITVVTEGIFSY
FT                   CSFKVKIDTDRFLGPEQSNVRCHGEIVGHVTTAEYGSQMLSLGGVHHLTGGSKKEGRVT
FT                   CDMMLALGNKEAVELSIDGGASLVIRAGAAPIVDGVEEQRMRVGCGSATIGIFAKQWFG
FT                   HADEVVVVDDHITGVLTEHQAGRCLGMTRSGVKIRGRKSTPGRYFQVANPGTGWGGTDI
FT                   QDPLAIVEGFDPAVAKPGMRLLMVSTTGEHAQWYELDQNLVPRVAAMPDTVRRTVERIG
FT                   ENCEPSLATVLFLGGAGGSLRAGATENPVLLTRAIKQKLVNVTCGGAPAYVWPGGGITV
FT                   MVDVARMPDRSFGTVPTPAIVAPIEFTMTYDAYRDLGGHLDAVRSLESVLANGPEHTEG
FT                   APRARRTLARNPDNPWPPAMPPMLG"
FT   gene            378359..379297
FT                   /locus_tag="Bphyt_4324"
FT   CDS_pept        378359..379297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4324"
FT                   /product="protein of unknown function DUF375"
FT                   /note="PFAM: protein of unknown function DUF375; KEGG:
FT                   bxe:Bxe_B0655 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4324"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18701"
FT                   /db_xref="GOA:B2TF30"
FT                   /db_xref="InterPro:IPR003374"
FT                   /db_xref="InterPro:IPR007183"
FT                   /db_xref="InterPro:IPR024932"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF30"
FT                   /protein_id="ACD18701.1"
FT                   /translation="MNPTRTRLDATRWHWQHGPIDLILSADGTPQAVQAAYEACWARFV
FT                   DVLAELGGELKQLKQPVSSQAALHDNALQGPVARRMWSACHPHRARYITPMAAVAGSVA
FT                   DELITAFAREGVSRAFVNNGGDIALYLTEGQQYRVGVFADLASFSAVRLSRDQALDANL
FT                   TLDASLAVRGIATSGWRGRSFSLGIADSVTVLARNAAAADAAATVIANAVDLDHEGILR
FT                   RPASSLKDESDLGDMLVTVDVPTLPQPLVDFALARGVEAARRLLDQGLIEGAALFLQGR
FT                   VRVAGIHDTSGLVLQSAQTKTEAPCLKYAAC"
FT   gene            379273..379863
FT                   /locus_tag="Bphyt_4325"
FT   CDS_pept        379273..379863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4325"
FT                   /product="protein of unknown function DUF1185"
FT                   /note="PFAM: protein of unknown function DUF1185; KEGG:
FT                   bxe:Bxe_B0656 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4325"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18702"
FT                   /db_xref="InterPro:IPR009569"
FT                   /db_xref="InterPro:IPR035936"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF31"
FT                   /protein_id="ACD18702.1"
FT                   /translation="MFEIRRVLTHVEDIFHEFGPAPAQPLRRGAIAAVMTNPFAGRYEA
FT                   KIEHAMEALKPIGFDMAQRLLAAMAVPHASIESYGKGAIVGARGELEHGALWHVPGGYA
FT                   MRELLEKNGVPTNAIVPSTKKVGAPSTALDVPLTHVNASYVRSHFDAIEVRVPGAPAAD
FT                   ELVYILVMSTGQRVHARVGGLAKEAIVGKDGLR"
FT   gene            379937..380521
FT                   /locus_tag="Bphyt_4326"
FT   CDS_pept        379937..380521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4326"
FT                   /product="protein of unknown function DUF1185"
FT                   /note="PFAM: protein of unknown function DUF1185; KEGG:
FT                   bxe:Bxe_B0657 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4326"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18703"
FT                   /db_xref="InterPro:IPR009569"
FT                   /db_xref="InterPro:IPR035936"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF32"
FT                   /protein_id="ACD18703.1"
FT                   /translation="MAIKLRKLVVQVDETRIEMGQAVEPPARRAVAIAVIDNPYAGRYE
FT                   AKLDALIEAGEELGALLGNKCVEALGIAPGEAQSYGKAAIVGEAGELEHAAAILHPKLG
FT                   APLRIAVEKGAALVPSAKKMGTLGTAIDVPLGHKDAAFVRSHFDAIEARVSDAPRANEI
FT                   VVAVAVTASGRPLPRIGGLQVSEIKGEDGLR"
FT   gene            380697..382637
FT                   /locus_tag="Bphyt_4327"
FT   CDS_pept        380697..382637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4327"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   bxe:Bxe_B0658 ABC branched chain amino acid family
FT                   transporter, fused inner membrane subunits"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4327"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18704"
FT                   /db_xref="GOA:B2TF33"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF33"
FT                   /protein_id="ACD18704.1"
FT                   /translation="MLSNLLVQLVNGLADASTLFLVAAGLSLIFGVTRIVNFAHGSFYM
FT                   FGIYVAYSIASRFGHTTGGFWLSVLAAALVVAVLGALVEMVVLRRIYQAPELFHLLATF
FT                   ALVLIFRDAALWLWGPEDLFGPRAPHLAGAVDFLGHPLPTYDIALIVIGPVVLLLLWYA
FT                   LTRTRWGTLVRAATQDREMLGALGINQAWLFTGVFFVGAFLAGLGGALQGPRMSANLSL
FT                   DLETIGNAFVVVVVGGMGSIPGAFIAALIIAEIKALCIGIGHVTIFGVGLSLSRFTLVA
FT                   EFVVMAVVLVVRPWGLLGRASAAVRGMAAPETPLRPAGKRLKWLAAIALLVLVLAPLAA
FT                   NAFPYMPVLLVEILIAVLFATSLHFIMGPGGMHSFGHAAYFGLGAYGAALFLKVLNLPM
FT                   EAALLLGPLLAVAGALVFGWFCVRLSGVYLAMLTLAFAQIVWSVVFQWDDVTGGSNGIL
FT                   GLWPSNWLSSPVAFYYVTLVCAVIGVWLLRKMLFSPLGYAMRASRDSVLRAEAIGIDVK
FT                   RVQWAAFVIASLFCGLAGSLYAFSKGTISPEVISVSRSVDGLVMVLLGGLQTLTGPIVG
FT                   AAVFTWLQDTVARQTDYWQALLGFAILLLVIAFPQGIVGFIRERFGDDSADSADKSAVS
FT                   PSRRAAIKEGL"
FT   gene            382634..383443
FT                   /locus_tag="Bphyt_4328"
FT   CDS_pept        382634..383443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4328"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bxe:Bxe_B0659 ABC branched chain amino acid family
FT                   transporter, ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4328"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18705"
FT                   /db_xref="GOA:B2TF34"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF34"
FT                   /protein_id="ACD18705.1"
FT                   /translation="MSLLRVSGLCKSFGGLKAVDDVSFDLEAGQLLALLGPNGAGKSTC
FT                   FNMVNGQLPPSSGSIRLDGQELVGMRPRDIWRLGVGRTFQIAATFNSMTVIENVQMALV
FT                   SRERKTFGLWKPAGARYADEALALLDQVGMASDAHRACGVLAYGDVKRVELAIALANRP
FT                   KLLLMDEPTAGMAPKERNELMALTKRLVTEHKIGVLFTEHSMDVVFAYADRLIVLARGK
FT                   LIAEGDADTIRNDPRVQEVYFGTGKTFQPHAPLHDAAGGHQGQGALQ"
FT   gene            383440..384153
FT                   /locus_tag="Bphyt_4329"
FT   CDS_pept        383440..384153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4329"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bxe:Bxe_B0660 ABC branched chain amino acid family
FT                   transporter, ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4329"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18706"
FT                   /db_xref="GOA:B2TF35"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF35"
FT                   /protein_id="ACD18706.1"
FT                   /translation="MSEPMLKVSGLNAFYGRAHILFDVGLEVGRGEVVALMGRNGAGKS
FT                   TTMKAVMGLLPRRQGEVSFRGQNITALPPYKIARMGMGFVPEDRRVFADLTVMENLATG
FT                   RQPPRDGAPQWTPEKLFRLFPNLGEMPQRPGGQMSGGEQQMLTVSRTLMGNPYLVLLDE
FT                   PSEGVAPVIVEQMANMILELKREGLSILLSEQNLHFAELVSDRAYVLEKGQIRFGGTIG
FT                   ELAQNETVRRAYLSV"
FT   gene            384232..385431
FT                   /locus_tag="Bphyt_4330"
FT   CDS_pept        384232..385431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4330"
FT                   /product="amidohydrolase"
FT                   /note="PFAM: amidohydrolase; Amidohydrolase 3; KEGG:
FT                   bxe:Bxe_B0661 putative amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4330"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18707"
FT                   /db_xref="GOA:B2TF36"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF36"
FT                   /protein_id="ACD18707.1"
FT                   /translation="MAAETLTGLSGKVAVTNIGLLLSGDIDQPILDADTLVIDDGVIVA
FT                   VGKEKDCDLEGARTTVDCKGTTVAPGLIDSHVHPVFGDWTPRQNQMGWIESNLNGGVTT
FT                   MISAGEVHLPGRPKDVLGVKALAITAQRSFEGMRGAGVGGGVKVMAGAPVIEKGMVEED
FT                   FKELSEAGVKLLGEIGLGSVKGGEEAAQMVAWARKYGIQSTIHTGGPSIPGSGLIDRDV
FT                   VLAADADVIGHINGGHTSLSYRHVCDLCEQSSRALEIVHNGNERIALLTARHAIELKCP
FT                   HRIILGTDSPAGSGVQPLGILRMIALISSLADVPAEIAFCFATGNTARQRNLRQGLIEV
FT                   GRPADLVFMDRAQHTAADTLLESVQLGDIPGVGMVMIDGLIRCRRSRNTPPATEVPVVL
FT                   "
FT   gene            385463..385981
FT                   /locus_tag="Bphyt_4331"
FT   CDS_pept        385463..385981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4331"
FT                   /product="(2Fe-2S)-binding domain protein"
FT                   /note="PFAM: ferredoxin; [2Fe-2S]-binding domain protein;
FT                   KEGG: bxe:Bxe_B0662 putative oxidoreductase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4331"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18708"
FT                   /db_xref="GOA:B2TF37"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF37"
FT                   /protein_id="ACD18708.1"
FT                   /translation="MNRPAPLLLNVNGATHLVSADADTPLLYLLRNDLALNGPKFGCGL
FT                   GECGACTVLLDGMPTRACVTTAKVALGREITTLEGLGTRAALHPVQQAFIEEQAAQCGY
FT                   CLNGMIMTAKALLDRDPHPSVETIRRELSRNLCRCGTHVEIVRAVQRAAELLDAQGAAR
FT                   VAVHEGVRA"
FT   gene            385978..389601
FT                   /locus_tag="Bphyt_4332"
FT   CDS_pept        385978..389601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4332"
FT                   /product="Isoquinoline 1-oxidoreductase., Gluconate
FT                   2-dehydrogenase (acceptor)"
FT                   /EC_number="1.3.99.16"
FT                   /EC_number="1.1.99.3"
FT                   /note="PFAM: cytochrome c class I; aldehyde oxidase and
FT                   xanthine dehydrogenase molybdopterin binding; KEGG:
FT                   bxe:Bxe_B0663 isoquinoline 1-oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4332"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18709"
FT                   /db_xref="GOA:B2TF38"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF38"
FT                   /protein_id="ACD18709.1"
FT                   /translation="MTGPDFSVDRRSAPPSRQQLYDAQSVLIVTRAPQAPVKPAIGQPG
FT                   SRSSFVPTEADMFLVVRDDGSVVAFNGHVDLGTGIGTALAQIVAEELDVPLTRVSIVLG
FT                   HTREAPNQGPTIASATIQISAVPLRHAAAQARQFLLAEAAARFNVSVEQLDVRDGVVYR
FT                   RDGGAAAKGIGYGELISGKRVELQLATDAPLKSPDTYKIVGKSTPRVDIPAKATGELSF
FT                   VHDVRVPGMLHGRVVRPPYAGVAQGDFMGNSLLQVDEDSVSELPGIVKVVVIRDFVGIV
FT                   AEREEVAQQAAKRLRVQWKEVEGLPSLETSEEVEAALRANPAKRRDLVIEGDVDAALAQ
FT                   DSARTLERTYVWPFQMHASIGPSCAVADYREGALKVWSGTQNPHSLRADLALLMSMDEA
FT                   HIEIVRMEAAGCYGRNCADDVAADAALLSRATGSPVRVQLSREDEHAWEPKGAAQLMDV
FT                   RGALNAEGELAAYDFATRYPSNDAPTLALLLTGTISAQPQVFEMGDRTAVPPYDYRSMR
FT                   IVCDDTPPIVRASWLRGVSALPNTFAHESFIDELAVEAGIDPVEFRLKHLTDPRAIELV
FT                   KAVAEKAGWEARSAERNAELKDEEGDIARGRGIAYARYVHSKFPGFGAAWSAWVADVEV
FT                   NRKSGDLAVTRVVVGQDTGTMVNPDGVRHQIHGNVIQTTSRALKERVTFGENAVTSQEW
FT                   GAYPILTFREVPVIDVVMMPRHGEPPMGAGESASLPGAAAIANALFDATGVRFRRPPFT
FT                   PETIRAALADAQAEDKAARRKKRWRFGFLGALAAGAAGWLGALSLAPHAIAPITPPLAS
FT                   AFAPELVARGKLLASLGNCAVCHTAHNGVPNAGGKPLDTPFGTVYSTNITPDGQTGIGN
FT                   WSLEAFVRAMRQGISRDGHRLYPAFPYTSFQNTSDDDLKALYAYLMAQTPVRSHPPETK
FT                   LAYPFSVRPLMSAWNALFLGRTTFTASTTQTAQWNRGAYLVNGLGHCGACHTPRNAFGA
FT                   EKTGAAFMGGGMADGWEAPALSALSTAPVPWSEDELFSYLRNGHAPLHGVAAGPMAPVV
FT                   GDLAALPDSDIRAMATYLASLNPLEPNADPVAMARQYEQASAISGAPAGLGARLFDGAC
FT                   AACHHTGGGPQLFGAHPSLALNTNLHSATPDNLIRVILDGIGSPARPELGTMPAYRDSF
FT                   NDVQVAELVSYLRQQFAGGKPAWQDVAARVARIRATPRRAD"
FT   gene            389675..390883
FT                   /locus_tag="Bphyt_4333"
FT   CDS_pept        389675..390883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4333"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   bxe:Bxe_B0664 ABC branched chain amino acid family
FT                   transporter, periplasmic ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4333"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18710"
FT                   /db_xref="GOA:B2TF39"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF39"
FT                   /protein_id="ACD18710.1"
FT                   /translation="MTTRAGWISRLMVPTVLSLAALSASAQQTIKIGEINSYKAQPAFL
FT                   GPYKNGWNLALDQVNAAGGVLGKQLEVVSRDDNGNPGDTIRVAQELIAREQVQLLFGGF
FT                   LSNTGLALTDFAKQKKIFFLAAEPLTDKIVWADGNKYTYRLRPSTYMQVAMLVPEAAKL
FT                   HKKRWALVYPNYEYGQSAVATFKKLLTAAQPDVQFVAEQATPLGNVDAGAVTQAIADAK
FT                   PDAIFNVLFGADLGKFVREGNTRGLFKDRSVVSLLTGEPDYLDPLGAEAPTGWIVTGYP
FT                   WYSIDTAANKKFVDAYQAKYHDYPRLGSVVGYSALMSIAAGIKKAGSVDPDKLAAAFKG
FT                   LGVDTPFGPITYRAQDNQSTMGAYVGVTGLKDGKGVMTSYRYIDGASVQPSDAEVKKLR
FT                   PAE"
FT   sig_peptide     389675..389755
FT                   /locus_tag="Bphyt_4333"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.990 at
FT                   residue 27"
FT   gene            complement(391009..391260)
FT                   /locus_tag="Bphyt_4334"
FT   CDS_pept        complement(391009..391260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4334"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0668 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4334"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18711"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF40"
FT                   /protein_id="ACD18711.1"
FT                   /translation="MKIPTVRAAAHIEGVHWIAEYAEDVHEIRVFREGQEVDVHNAPST
FT                   LFGDEENAGSKSTADHRAVEAAVLAYLKRFVIEHDAEE"
FT   gene            391439..391993
FT                   /locus_tag="Bphyt_4335"
FT   CDS_pept        391439..391993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4335"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: sigma-70 region 2 domain protein; sigma-70
FT                   region 4 domain protein; Sigma-70 region 4 type 2; KEGG:
FT                   bxe:Bxe_A1388 sigma-24 (FecI)"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4335"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18712"
FT                   /db_xref="GOA:B2TF45"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF45"
FT                   /protein_id="ACD18712.1"
FT                   /translation="MTERDTDITATVVRERTRLVNFIRRRIRDPDDAEDILQDVFHEFV
FT                   QAYRLPAPIEQASAWLFRAARNRIVDRFRKKKEQPLADLSASGDDADSEYRLDLDLPAH
FT                   DAGPEALYARALLLKALQDALDELPANQREVFVAHELEGRSFKEMAAESGVTLNTLLAR
FT                   KRYAVLHLRARLQAICDELGI"
FT   gene            392006..392314
FT                   /locus_tag="Bphyt_4336"
FT   CDS_pept        392006..392314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4336"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_C6639 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4336"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18713"
FT                   /db_xref="GOA:B2TF46"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF46"
FT                   /protein_id="ACD18713.1"
FT                   /translation="MNFRIRCAGKALLVVVAIGVLGWVVMTLWNWVIPALFVGARAIDF
FT                   AHALGLLVLSRILFGGFRGHGGWRERRRWRKWEAMTPEEREHFQTAWRSGRDRRAGD"
FT   gene            392317..392613
FT                   /locus_tag="Bphyt_4337"
FT   CDS_pept        392317..392613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4337"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: bur:Bcep18194_C6638 4Fe-4S ferredoxin,
FT                   iron-sulfur binding"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4337"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18714"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF47"
FT                   /protein_id="ACD18714.1"
FT                   /translation="MREKSAAECKQMPGVIAPVVDLTRCEGKGDCMEVCPENVFEIRRI
FT                   DEADYRGLDLMHRLKLRVHGMKVAYTPNAHACRSCGLCVTACPERAIKLARTA"
FT   gene            392706..393422
FT                   /locus_tag="Bphyt_4338"
FT   CDS_pept        392706..393422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4338"
FT                   /product="O-methyltransferase family 3"
FT                   /note="PFAM: O-methyltransferase family 3;
FT                   Methyltransferase type 11; KEGG: bur:Bcep18194_C6637
FT                   O-methyltransferase, family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4338"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18715"
FT                   /db_xref="GOA:B2TF48"
FT                   /db_xref="InterPro:IPR002935"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF48"
FT                   /protein_id="ACD18715.1"
FT                   /translation="MASSTTGLLQRLHEQSQTEVIARARAQFQGSSQEFQDLAEEYEML
FT                   APRLRGRFLETLGLSSEDFEASQGTPLSLAVSAETGRFLRNMVLSHKPARILELGSSCG
FT                   VSTLYFAEALRMLGSGVVVATELDAVKCAQLRAHVRTAGVQAYVDLREGDVFQTVSGLD
FT                   GTFDMVFIDVWASSYLSLFKQIERLLRPGSIVLADNMYTAEDAVRPYKHYLDGNPRFST
FT                   TTLDFESGVEFTVVVS"
FT   gene            393591..394109
FT                   /locus_tag="Bphyt_4339"
FT   CDS_pept        393591..394109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4339"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0669 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4339"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18716"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF41"
FT                   /protein_id="ACD18716.1"
FT                   /translation="MPEKKTIERAKSDKRAGKASSTQAGEFIKEQVDKVRAGKHGVRSA
FT                   KQAIAIGLSEARRAGVAVKSPKKGTASEATRKKAATDNAAGQHKSATKKSTESTAKRSR
FT                   AATNALKREGSAGASRAALSKQTKTAAAKRPAASRSAAAKKAAATKGAAGRSAAAKKAA
FT                   QTRASRTHH"
FT   gene            complement(394320..395648)
FT                   /locus_tag="Bphyt_4340"
FT   CDS_pept        complement(394320..395648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4340"
FT                   /product="aminotransferase class-III"
FT                   /note="PFAM: aminotransferase class-III; KEGG:
FT                   bxe:Bxe_B0670 beta alanine--pyruvate transaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4340"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18717"
FT                   /db_xref="GOA:B2TF42"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF42"
FT                   /protein_id="ACD18717.1"
FT                   /translation="MTSRPVIDDLSSFWMPFTANRQFKAAPRLLESAKGMYYRSTDGRE
FT                   VLDGCAGLWCVNAGHGREEIVAAITEQLSTLDFAPTFQMGHPLAFEAATKVAELMPEGL
FT                   DRIFFTNSGSESVDTALKIALAYHRSRGEGQRTRLIGRERGYHGVGFGGISVGGIAPNR
FT                   KTFSGALLPAVDHLPHTHNLEHNAFTKGQPAWGAHLAEELERIVTLHDASTIAAVIVEP
FT                   VAGSTGVLIPPQGYLQKLREICTKHGILLIFDEVITAFGRVGKATASEYFGVTPDLITM
FT                   AKAINNAAIPMGAVAASRTIHDSIVNGGAQGAIELFHGYTYSAHPVATAAAVATLDLYK
FT                   REGLFERAATLAPTFEAAAHSLRGAKHVKDVRNLGMIAGVELESRDGAPGARAYEAFVK
FT                   CFEAGVLVRFTGDILAFSPPLIINEEQIAHIFKTVGDVLATVQ"
FT   gene            395907..397322
FT                   /locus_tag="Bphyt_4341"
FT   CDS_pept        395907..397322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4341"
FT                   /product="transcriptional regulator, GntR family with
FT                   aminotransferase domain"
FT                   /note="PFAM: regulatory protein GntR HTH; aminotransferase
FT                   class I and II; KEGG: bxe:Bxe_B0671 transcriptional
FT                   regulator, GntR family with aminotransferase activity"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4341"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18718"
FT                   /db_xref="GOA:B2TF43"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF43"
FT                   /protein_id="ACD18718.1"
FT                   /translation="MIELQLERDRRAAPTLVDQVVQGFARAIEGQSLRAGALLPSVRQL
FT                   AQSHDLSTFTVTEAYSRLVSMGLVVARRGSGYRVAARSQSARVAATDWQPPSITATWLL
FT                   SDVFADHSVPIKAGGGWLPNEWINETGLQHALRAMSRVPAARLGDYGHPYGFAPLRERI
FT                   AEQLDRRGLPVDVSNILLTQGATQGLDLIVRTLLRAGDAVIVEDPGYCNLLQILKLAGL
FT                   VVHGVPRTPAGVDTDVLEALVAEHKPKAIFVNTTLQNPTGATFGMSAAFRLLQIAERQR
FT                   MWVIEDDVSRELAPSGAPLFAAMEGLQRVLYVGGFSKTVTPGLRCGYVVAERAVLRELA
FT                   RTKMAVGLTSSEAIERIVDKVLLEGRYARHVEAVNERLKLAHATVEDRLDSLGLELFHR
FT                   PRAGLFLWARLPIEAERAGEVATAALTHGIWLAPGSYFRPDDAPSAWFRFNVPYSTDDA
FT                   LWRFIERVGQGTL"
FT   gene            complement(397332..397955)
FT                   /locus_tag="Bphyt_4342"
FT   CDS_pept        complement(397332..397955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4342"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   bxe:Bxe_B0672 amino acid efflux pump, RhtB family, LysE
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4342"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18719"
FT                   /db_xref="GOA:B2TF44"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF44"
FT                   /protein_id="ACD18719.1"
FT                   /translation="MSYLSLSALPAGILFALVTTITPGPNNTMLLASGVNFGFRRTLPH
FT                   LSGISAGVVLLMLSVGIGLGEAFVHFPVLYTVLEVASVAYLLYLAWKIGTSGELKMKKG
FT                   ERRPMKFYEAIAFQWVNPKAWMMVLTAATTIHLSESYSMNAIAMAVIFYVIGFPCICLW
FT                   AGFGTAMRQVLSDPKRLRIFNVAMALLLVLSLYPIALKLIGQSA"
FT   sig_peptide     complement(397905..397955)
FT                   /locus_tag="Bphyt_4342"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.678) with cleavage site probability 0.260 at
FT                   residue 17"
FT   gene            398332..399021
FT                   /locus_tag="Bphyt_4343"
FT   CDS_pept        398332..399021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4343"
FT                   /product="oxidoreductase FAD/NAD(P)-binding domain protein"
FT                   /note="PFAM: oxidoreductase FAD/NAD(P)-binding domain
FT                   protein; KEGG: bur:Bcep18194_B0419
FT                   ferredoxin/oxidoreductase FAD/NAD(P)-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4343"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18720"
FT                   /db_xref="GOA:B2TF49"
FT                   /db_xref="InterPro:IPR000951"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023950"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF49"
FT                   /protein_id="ACD18720.1"
FT                   /translation="MHDKFLSVVVTRKWQLAESYHAVELQTRCRSELPSFDDGSCVTLV
FT                   RDDVICKEKIYPLCRFTSRPRAYVIAVRQDDADTDAKTADISLSQGDEAFIVTTRSPTV
FT                   ILDGRTQSLLFAGGVGAASIAGIATRLALAGQKFELHNFARSPERAVFRNELDALKSES
FT                   RVYHHFGLDADRLEQATSHAISPVQANTQIYCSGPPAFMDLIERQARDWVYPANIHKIF
FT                   LGDRRSA"
FT   gene            399589..399789
FT                   /locus_tag="Bphyt_4344"
FT   CDS_pept        399589..399789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4344"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bte:BTH_II0363 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4344"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18721"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF50"
FT                   /protein_id="ACD18721.1"
FT                   /translation="MKFSVKDEIRSDDIPTLEHAMKTVDADAKVNVDIDTKTVSVDSWL
FT                   MPEEFLVAFVDEDFDATIVEA"
FT   gene            complement(399976..400737)
FT                   /locus_tag="Bphyt_4345"
FT   CDS_pept        complement(399976..400737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4345"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; KR domain protein;
FT                   KEGG: bvi:Bcep1808_3959 short-chain dehydrogenase/reductase
FT                   SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4345"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18722"
FT                   /db_xref="GOA:B2TF51"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF51"
FT                   /protein_id="ACD18722.1"
FT                   /translation="MKLSGNTIFITGGTSGIGRALAEAFHRKGNKVIVSGRRKALLDDV
FT                   ANTNPGIDTVELDVDDPAQIQNVANELITKYPSLNVVINNAGIMPFDDVTGPFDDAQAV
FT                   HLINTNLLGPARISGAFVEHLKTRPEAVIINNSSVVAYIPMAMAALYSATKAAIHSYSL
FT                   SQRFALRETSVRVLEIAPPWVDTDLVHKSGDPRAMQVEPFIAEIMALLESATTEVVVEA
FT                   ARQLRTSAGPNEHGIVDYFNQMILDNPLPTP"
FT   sig_peptide     complement(400669..400737)
FT                   /locus_tag="Bphyt_4345"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.864) with cleavage site probability 0.861 at
FT                   residue 23"
FT   gene            complement(400778..401656)
FT                   /locus_tag="Bphyt_4346"
FT   CDS_pept        complement(400778..401656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4346"
FT                   /product="NmrA family protein"
FT                   /note="PFAM: NmrA family protein; KEGG: mlo:mlr1895
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4346"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18723"
FT                   /db_xref="InterPro:IPR008030"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF52"
FT                   /protein_id="ACD18723.1"
FT                   /translation="MQQRNYLVTAAAGKTGVHTVRHLLEGGHGVRALVHREDERSAALR
FT                   KAGAEVIVGDLLEHDDAIRATEGVSGAYLCYPVRPGFIQATAYFADAARRANLDVVVNM
FT                   SQISAREDSKSHAARDHWIAERVLDWSGVPTVHLRPTFFSEWLTFPWVRDPIVKEGKIA
FT                   LPYGNGRHAPISAEDQARVIAAILAQPSTHIGKTYPLYGPVELSQQEIADAVGNVSGRK
FT                   IVYSPTSIEDYRKHLETYGLPEFMIQHFLEVAIDYQNGIFAGTNDVIEKITGQAPQTID
FT                   AFVAANREAFQ"
FT   gene            complement(401818..402390)
FT                   /locus_tag="Bphyt_4347"
FT   CDS_pept        complement(401818..402390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4347"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: cak:Caul_5130
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4347"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18724"
FT                   /db_xref="GOA:B2TF53"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF53"
FT                   /protein_id="ACD18724.1"
FT                   /translation="MRKSRVETAETRQRIVDVAARKFQLNGISATGLADVMSEAGLTHG
FT                   GFYRHFESKDQLVAEACATAATNIVATLEEAASDSDVEEGFRAIVERYVSTGHRDNVSG
FT                   GCPLAGMGSELSHGDENTRAAASQGFRDLVEVVAKRLDPQRSEATESKAVFAVTAMIGA
FT                   ITMSRILTDSDASASVLQQVKQHLDAI"
FT   gene            complement(402574..403284)
FT                   /locus_tag="Bphyt_4348"
FT   CDS_pept        complement(402574..403284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4348"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: ajs:Ajs_4292 short-chain
FT                   dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4348"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18725"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF54"
FT                   /protein_id="ACD18725.1"
FT                   /translation="MSKSQKVVVVTGASQGIGAEVVKAFRKLDYRIVANSRSIKPSDDP
FT                   NILCIAGDIGDPATARRVITEGVARFGRIDTLVNNAGIYIGKPFTEHTAQDYAAVVNVN
FT                   MTGFFHITQLAVAEMEKHSSGHVVSVTSSTADNAISGGYSVLAALTKGGLNAATKSLAI
FT                   EYAKKGIRVNAVAPGIIKTPMHAPETHEALGAFHPLGHMGEASDIADAILFLDTAPFIT
FT                   GEILHVDGGQSAGR"
FT   gene            complement(403391..404143)
FT                   /locus_tag="Bphyt_4349"
FT   CDS_pept        complement(403391..404143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4349"
FT                   /product="NmrA family protein"
FT                   /note="PFAM: dihydrodipicolinate reductase;
FT                   dTDP-4-dehydrorhamnose reductase; NmrA family protein;
FT                   KEGG: reu:Reut_A1579 NAD-dependent
FT                   epimerase/dehydratase:dTDP-4-dehydrorhamnose
FT                   reductase:NmrA-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4349"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18726"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF55"
FT                   /protein_id="ACD18726.1"
FT                   /translation="MKIVVIGGSGLIGSRLVTLLGEAGHEAVAASPRTGVNAVTGEGLS
FT                   NALVGADVVMDVTNAPSWEPQAVLDFFRTSARNLGKAEAAAGVRHHVALSIVGCDRSPK
FT                   NAYFAAKVAQEELIRAAGVPYTIVRATQFMEFIGGIADFSTVDGTVRIGEGLFQPIAVD
FT                   DVVANLAQVALAAPQNGTVEIAGPDRAPFAEIVSRFLKSVGDARPVVTDRDALYYGDRV
FT                   EEQSLVPLGDARIGRVSLDQWFARAKNG"
FT   gene            404332..405861
FT                   /locus_tag="Bphyt_4350"
FT   CDS_pept        404332..405861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4350"
FT                   /product="transcriptional regulator, GntR family with
FT                   aminotransferase domain"
FT                   /note="PFAM: regulatory protein GntR HTH; aminotransferase
FT                   class I and II; KEGG: bam:Bamb_5788 transcriptional
FT                   regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4350"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18727"
FT                   /db_xref="GOA:B2TF56"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF56"
FT                   /protein_id="ACD18727.1"
FT                   /translation="MTVPTPALTIEIDRQQQLPIYLQICERFRTAIAAGHLRPGDRVPA
FT                   LRGLATQLNTARGTVELAYTILVDEGYLQMRGAAGTFVSASLPASVTRSSRAQGVQAAR
FT                   ARQGAAGADSPQPPPESRDGRAAPRQAALTVAMSGEPRPLQPGLPALDAFPRKVWNRLV
FT                   AQRARSGERAMLAYPDPSGYRPLREHIATYLGLSRGVTCLPEQVFVTGGFRATLELVLR
FT                   SLARADDRVWFEDPGYLLARDFLTETGVQLVPVPVDGEGIDVERGTLLDAQARFAVVTP
FT                   SHQSPLGHTLSLARRMALLDWAGKASRWIIEDDYDSEFRYLGRPLPALKSLDRRDRVIY
FT                   CGTFSKVMFPGLRLAYVVVPERAVERVGKVAHSMNAGSPMLLQAAVADFIAQGHFARHL
FT                   KRMRALYAERRVLIVHALEKAFGERLIVDLPPGGIQFAVQFAEGPDGPVDDVAVAARAR
FT                   KAGLAVLPLSIWHANSRARRTRRGLVMGFANIADADEAGRLARTLRACLDG"
FT   gene            complement(405979..406653)
FT                   /locus_tag="Bphyt_4351"
FT   CDS_pept        complement(405979..406653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4351"
FT                   /product="NAD(P)H dehydrogenase (quinone)"
FT                   /note="PFAM: NAD(P)H dehydrogenase (quinone); KEGG:
FT                   mms:mma_1228 acyl carrier protein phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4351"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18728"
FT                   /db_xref="GOA:B2TF57"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR023048"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF57"
FT                   /protein_id="ACD18728.1"
FT                   /translation="MRILLINASPHGEASHGYRFADEIVGMLHGHAAPAASAITVVERD
FT                   LAAAPLPPIARDYARAVTSRAPDTAHFDVSEQLIGEIETTDALIINTPMHNFTVPAALK
FT                   LWIDYTLRIHRTFASTPEGKVGLMRDRPTIVIVGSGGVHSGERARQTDFLTPYLRYALG
FT                   SIGIHSVQFLLLQGLVMGEATVAKALDAARVQLTGDAVFVSLAAQASRCARTAAGSTAR
FT                   SA"
FT   gene            complement(406650..407117)
FT                   /locus_tag="Bphyt_4352"
FT   CDS_pept        complement(406650..407117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4352"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   pfl:PFL_2190 PhnO-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4352"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18729"
FT                   /db_xref="GOA:B2TF58"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF58"
FT                   /protein_id="ACD18729.1"
FT                   /translation="MPASLRFVHLDTPELLLPAFDVMRQLRPHLTDAHSFAAQVARQHA
FT                   DGYRLLAASDASGIVGLAGYRILTNLLYGRFVYVDDLVVDGKLQRDGIGAQLLDAVRQI
FT                   AREAGCVQFVLDTGLHMPLAQRFYFRNGLLARGMHFVEPLAPLSPASALTP"
FT   gene            complement(407235..408149)
FT                   /locus_tag="Bphyt_4353"
FT   CDS_pept        complement(407235..408149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4353"
FT                   /product="transcriptional regulator, LysR family"
FT                   /EC_number="4.2.1.1"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bcm:Bcenmc03_6414 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4353"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18730"
FT                   /db_xref="GOA:B2TF59"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF59"
FT                   /protein_id="ACD18730.1"
FT                   /translation="MRSSSENLSSGISVFAAVVDAGTFAAASELLGMSPPGVSRAIARL
FT                   EKRLKTRLFNRTTRAVSLTEEGRRFYEQVMPHLRGMEEAAAAAAGGAATVRGKLRINLD
FT                   PVFSRIILGPKLDEFMDAHPELELELIARDQLGDLVMDGFDLALRFGEPRSSSLIARKL
FT                   LDTAVVTVAAPSYLARRGRPAEPQELGLGMHRCLEFRNPDTGKPYPWEFHRKRKKIVVE
FT                   TNGRLTVNDPSALLNACLAGSGVAQMLLLGGEHLIREGRLVNLFPDWPDERFPLYAYHP
FT                   SRHHTPARTRVFLDFIVALTRTG"
FT   sig_peptide     complement(408084..408149)
FT                   /locus_tag="Bphyt_4353"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.796) with cleavage site probability 0.340 at
FT                   residue 22"
FT   gene            408334..409197
FT                   /locus_tag="Bphyt_4354"
FT   CDS_pept        408334..409197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4354"
FT                   /product="NmrA family protein"
FT                   /note="PFAM: NmrA family protein; KEGG: bam:Bamb_6112 NmrA
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4354"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18731"
FT                   /db_xref="InterPro:IPR008030"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF60"
FT                   /protein_id="ACD18731.1"
FT                   /translation="MYAITGITGKVGGAVARTLLAAGQPVRAVVRDATRARSWAERGCE
FT                   VVTANMDNAGSLTAAFEGTQGVFILPPPEFDPSPGFPEARAVIDAVRGALQSVAPGKVV
FT                   CLSTIGAHATETNLLTQLTLMEQALRDLPMPVTFLRPGWFMENAAWDVAPARDNGVISS
FT                   FLQPLDRAVPMVATADVGRVAAQLLLQTWRGVRVVELEGQRVSPNDLAQTFAKVLGCPV
FT                   RAEAVPRETWDALFRSQGMKEPLPRMRMLDGFNEGWICFEGDPADIVKGEVELETVLRD
FT                   LVSQSV"
FT   gene            409401..409805
FT                   /locus_tag="Bphyt_4355"
FT   CDS_pept        409401..409805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4355"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: bur:Bcep18194_C7168
FT                   glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4355"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18732"
FT                   /db_xref="GOA:B2TF61"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF61"
FT                   /protein_id="ACD18732.1"
FT                   /translation="MTDITTSMKLNHMSFPSSDVSATATFFENHLGCTVAARGTSWFLK
FT                   RPGFDIVIDDAAGHPVEWPHNFHIGFELASLDEVRALYEQMAGAGVVMKTGVFKHERGS
FT                   RFFCEVPGGVLVEINTRSDADEKYRGTFDL"
FT   gene            complement(409847..410698)
FT                   /locus_tag="Bphyt_4356"
FT   CDS_pept        complement(409847..410698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4356"
FT                   /product="alpha/beta hydrolase fold"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: bxe:Bxe_B0682
FT                   putative hydrolase, alpha/beta fold family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4356"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18733"
FT                   /db_xref="GOA:B2TF62"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF62"
FT                   /protein_id="ACD18733.1"
FT                   /translation="MNARTDLSVLAVPELSFATIASGICVPYVECGEGEPLVFVHGSLC
FT                   DYRYWNAQTAALSQHFRCISVSLSHYWPASEACIQGEFGWQTHVGELAEFIEAIDLGPV
FT                   HLVGHSRGGCVAFHVARDYPRLVKTLTLADPGGPLQIDGMPDATLPATTNVLRARVAEL
FT                   IESQQIDAGLELFVDSVSMPGAWRKSPVAFRTMAIDNAGTLPKQLRDPLPAYSRETARG
FT                   VKCRTLLIDGQRSPRMFRNNVDKLAEWIDYAERQTIAGASHGMNVSNAGAFNRLVQAFV
FT                   NF"
FT   gene            410794..411645
FT                   /locus_tag="Bphyt_4357"
FT   CDS_pept        410794..411645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4357"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bxe:Bxe_B0683 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4357"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18734"
FT                   /db_xref="GOA:B2TF63"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF63"
FT                   /protein_id="ACD18734.1"
FT                   /translation="MKALDLDVMTMIVAVADAGNISRAAEVVHRSQSAVSMQIKTLETA
FT                   LGKPLFVRKPRNVVPTQDGEVLLTYARRMLALRDEAWAAVVRPDVTGRVSIGVPDDYAS
FT                   SLLPPILKKFSATYPKVEIQVVGLPSVALAPMVKDGSVDLVCATRVKGLSGEFIRHEPM
FT                   EWAAAPSADEIWRERPLPIAVFLPGSVARENAIRSLERAKIPYRTSYESPSLLGLLSMA
FT                   EAGLAIVPLARCAVPAHFTLLGRAHGLPEITALEMVLARSTASNRPPCDFLAEKIVSEL
FT                   RR"
FT   gene            complement(411677..412609)
FT                   /locus_tag="Bphyt_4358"
FT   CDS_pept        complement(411677..412609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4358"
FT                   /product="cobalamin synthesis protein P47K"
FT                   /note="PFAM: cobalamin synthesis protein P47K; cobalamin
FT                   synthesis CobW domain protein; KEGG: reh:H16_B0869
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4358"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18735"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF64"
FT                   /protein_id="ACD18735.1"
FT                   /translation="MNAIPLVVIGGYLGAGKTTLLNHILSNAGSRRITVLVNDFGSINI
FT                   DASLIRQRTDDVINLENGCVCCSIGGRLVEALLAISSRTDAPDLLIIEASGVSDPVRIA
FT                   QIGLLDRAFRLDGIVVLVDAERVEETLADPYVGDIAQRQIAGATAIVLNKMDLLGEPAR
FT                   EAVKARVEALANSRVIVQTTHAAVPLGLVFEEGHPLPARSIGAMPLSASPTPRDLCSFS
FT                   FVTNAYLSRKKLKEALRSFSAKLLRAKGFVRLESDGALHELHVVGNRVVIIASPARTCA
FT                   QSQIVLIGMFDREDESIARAALKAAEVGA"
FT   gene            complement(412606..414264)
FT                   /locus_tag="Bphyt_4359"
FT   CDS_pept        complement(412606..414264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4359"
FT                   /product="Amidohydrolase 3"
FT                   /note="PFAM: amidohydrolase; Amidohydrolase 3; KEGG:
FT                   bmu:Bmul_6052 amidohydrolase 3"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4359"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18736"
FT                   /db_xref="GOA:B2TF65"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="InterPro:IPR033932"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF65"
FT                   /protein_id="ACD18736.1"
FT                   /translation="MTQREEKCPTQVFVAKKIVTMNPMQPYATHVAIRDGKILSVGGAD
FT                   DVKQWGDAEIVDTFSDKVLMPGFVEGHCHLMEGAMWDAVYVGYYDRRGPDGRRWPGLTS
FT                   LDAVIERLKAAQAEMASADAPLLAWGFDPIFFGTQRLSVRELDTVSAERPIVILHASVH
FT                   LMNVNSPMLARAGIDEETDIDGIDKDESGQPTGELQEFAAMFPVYRVIGAGLSIAASES
FT                   TKAIWNFGRVAQLAGVTTATDLVNDFSETGNRNLREVTASADFPVRIVPAFAPQRSPEG
FT                   GAQRVLSAMETATPKLHFGPVKFIVDGSIQGFTARLKWPGYLNGKPNGLWLIPPSQFVE
FT                   VFTPFHEAGLQLHVHTNGDEATELVLDAFERLLTLHPRRDHRHTLQHCQMADASQLARA
FT                   ASLGLCINFFSNHIYYWGDAHYTQTMGADRANRMNAAESARRLGIPFAFHSDAPITPLN
FT                   PLFTAWCASQRETASGRVLGANERVPIADALRAITLGAAYTLKMDHLVGSIEVGKFADF
FT                   AVLAEDPAEVAPQRLKDLEVWGTVLGGRIFQAPAG"
FT   gene            complement(414298..415683)
FT                   /locus_tag="Bphyt_4360"
FT   CDS_pept        complement(414298..415683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4360"
FT                   /product="Na+/solute symporter"
FT                   /note="PFAM: Na+/solute symporter; KEGG: reh:H16_B0867 APC
FT                   transporter, SSS family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4360"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18737"
FT                   /db_xref="GOA:B2TF66"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF66"
FT                   /protein_id="ACD18737.1"
FT                   /translation="MATAVFLGFLAFSLYLAIRSNKGRGPQSVHDFFVASRQFGAYLVF
FT                   FLAAGEIYSIGTMVGFPGGIYAKGPTYGVWFLGYILLAYPVGYFIGPKIWQAGKRYNAI
FT                   TLPDLFKGHFQSRALELIVAGSAIVFLLPWGQLQFTGLVAALNGLGWNFKPLYLILFAA
FT                   LLAFTYIAIAGVRASAYIAVLKDILMVVAIVVTGVAVSMEVGVTEVFHAASQHVSNRMN
FT                   SHQLTFSMSTMLFQSLGFYVMPFAVQNFFTAKSANTIRRTQVAMPLYMLMYPFLVVASY
FT                   YAISQNLHLASPNEAFFAAAIRLLPGWLLGLVAAGASLSGLLVLAGICLAIGPIVTRNL
FT                   LPGMPEARQKTSAKVVIVLYLLVSIVMTLLTPNLMLTLINTTYYGVTQFFPGVMVVLFG
FT                   LRVRPSAIASGMLTGQLLAVILYVMQIDLGGFNLGLVCLGVNLLVLTAVNLTAKPSRAH
FT                   ALS"
FT   gene            complement(415696..415905)
FT                   /locus_tag="Bphyt_4361"
FT   CDS_pept        complement(415696..415905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4361"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: reu:Reut_B5755 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4361"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18738"
FT                   /db_xref="GOA:B2TF67"
FT                   /db_xref="InterPro:IPR021741"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF67"
FT                   /protein_id="ACD18738.1"
FT                   /translation="MLKLFIGLGIPYLGVVGLLPWVASVDRFVLGVPFIYAWIFAWFIL
FT                   TSGCLMICWRVFDCRHDESHPQNS"
FT   gene            416189..416599
FT                   /locus_tag="Bphyt_4362"
FT   CDS_pept        416189..416599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4362"
FT                   /product="protein of unknown function DUF1486"
FT                   /note="PFAM: protein of unknown function DUF1486; KEGG:
FT                   bxe:Bxe_B0684 putative taurine dehydrogenase, small
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4362"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18739"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF68"
FT                   /protein_id="ACD18739.1"
FT                   /translation="MAQTQTPLQHVTAETLAAFSDAFNRHDANALMTFMTDDCVFDAAG
FT                   GPEVFGTRFVGREATRAAFEAVFKTFPDAHWGQGRHYVSGERGVSEWVFTGTHAEGWRI
FT                   EAEGCDLFEFRDGLIAVKRAFRKERPKQNLAR"
FT   gene            416613..418028
FT                   /locus_tag="Bphyt_4363"
FT   CDS_pept        416613..418028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4363"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   bxe:Bxe_B0685 putative taurine dehydrogenase, large
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4363"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18740"
FT                   /db_xref="GOA:B2TF69"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF69"
FT                   /protein_id="ACD18740.1"
FT                   /translation="MEHSEIERVAQGMPSGRADDTRYDPAYDPLVSPGPGWGKQYAPTY
FT                   WVATAGTPPEDDGPITADVDVDVAIIGGGYTGLATALCLAREHGIKAVVLEANKTSWGC
FT                   SSRNGGQGQNASGRLSRSQWIERWGKDVALKMHDEIQEGFDNFKSLVAEIDCDPQPGGH
FT                   FLIAHRPRIMQKLAAEAKVWKDVFGYPSELIDKQTFQREYVNDHEAAGALHEPEGIGIH
FT                   ALKLAFGYLRLAREAGAKVHPASPVLGWETINGVHHLRTPGGIVRARAVGIATGAYTAQ
FT                   TLHNSLRSRIMPILSNSMVTRPLTKQEIDACNFRTTQVLTDTRTLRFYYRFLPDNRLQI
FT                   GSRSAITGADAPNSRHYDLLMEGMLRKFPALRGVAIDYSWWGWVDVSHDMMPRVYQPDP
FT                   MQTVYYALGYGGNGVSYSQQAGRRLAERIAGKGAKQTLPIFTSPLPGHPFAPFRRIGQR
FT                   MLYQLYFRRDEKP"
FT   gene            418298..419728
FT                   /locus_tag="Bphyt_4364"
FT   CDS_pept        418298..419728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4364"
FT                   /product="amino acid permease-associated region"
FT                   /note="PFAM: amino acid permease-associated region; KEGG:
FT                   bxe:Bxe_B0686 beta-alanine/gamma-aminobutyrate-H+
FT                   symporter, AAT family, APC superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4364"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18741"
FT                   /db_xref="GOA:B2TF70"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF70"
FT                   /protein_id="ACD18741.1"
FT                   /translation="MQRSTDTTELKAGLKQRHMTMIALGGVIGAGLFVGSGVVVQQAGP
FT                   AAVLSFLITGALVVLVMRMLGEMACAMPAVGSFYEYARLAFGGKRASGNLAGFLTGWMY
FT                   WYFWVIVVAVEAVAGAKLVQFWLPDVPAWAISLVLLVTLTATNLVSVGSYGEFEFWFAS
FT                   IKVAAIMVFLFLGGMYVLGLWPAAKHVTAVLPTLLSHGGLMPKGIGPVLSGAVAATGFY
FT                   FGAEIVTIAAAEAQEPAKAVAKATNSVITRVLVFYVGSILLVVALVPWNSPKMATPYVS
FT                   ALDAMGIPAAASVMNAIVLTAVLSALNSGLYAASRMIFALTRHGDAPAALAKVNRRGVP
FT                   VRAILIGTVFGYASVVMSYVSPDTVFAFLVNSYGTVAIFVYVLIAISQLKLRARIERDA
FT                   PEKLRVRMWCYPYLTWVAIIGMVGILVAMAFIPEQRQPLWFGVASLGVLLLAYLLRVRK
FT                   PDAGFGEPDTLEYRHHHH"
FT   gene            419869..420858
FT                   /locus_tag="Bphyt_4365"
FT   CDS_pept        419869..420858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4365"
FT                   /product="Cobaltochelatase"
FT                   /EC_number="6.6.1.2"
FT                   /note="PFAM: ATPase associated with various cellular
FT                   activities AAA_5; KEGG: bxe:Bxe_B0687 putative cobalt
FT                   insertion protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4365"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18742"
FT                   /db_xref="GOA:B2TF71"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR025865"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF71"
FT                   /protein_id="ACD18742.1"
FT                   /translation="MTDIVTGKPDRMVSVRTLFGIDSGLMVPAFSERDDHVPEIDEVYR
FT                   FNPEVTLAILAGFMRERRVMVQGLHGTGKSTHIEQVAARLNWPCVRVNLDGHISRLDLV
FT                   GKDAIIVRDDVQITEFQEGIVPWALQRPMALIFDEYDAGRPDVMFVIQRILERDGKFTL
FT                   LDQNRVIHPHPYFRLFATTNTVGLGNLNGLYHGTQLLNHAQLDRWNVVATLNYLPRAEE
FT                   AGIVLARVPELADEAGRALIESMISVAELTRKGFATGDLSTLMSPRTVIDWAENCQIFR
FT                   DPAMAFRLTFVNKCDEAERPIVAEYFQRCFDRELESAAEREMRSTVPQ"
FT   gene            420855..422591
FT                   /locus_tag="Bphyt_4366"
FT   CDS_pept        420855..422591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4366"
FT                   /product="Cobaltochelatase"
FT                   /EC_number="6.6.1.2"
FT                   /note="PFAM: Cobalt chelatase CobT subunit; KEGG:
FT                   bxe:Bxe_B0688 putative cobalamin biosynthesis CobT protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4366"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18743"
FT                   /db_xref="GOA:B2TF72"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR006538"
FT                   /db_xref="InterPro:IPR025861"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF72"
FT                   /protein_id="ACD18743.1"
FT                   /translation="MMPAERQAARRAEQRQNLCAAAVRALTGDAELHYRAGRLFRGLRP
FT                   VHLHAPHLRMDAQPDDLRSLRGAADGAALRLTHSDAKLHASLCPAEPAEPVERLLFELF
FT                   EQLRCEALVPASMPGLAQNLRHRFETWSRAFYRTGWTDGHLGILLYTVAQIVWSRLSGW
FT                   PVLEETEGLIEATRAAITPTLGVPLAALRRHRTEQGEFAIHALELARLVSQMMRDARAQ
FT                   SVEGEDEQAPEDDEAVRSMFALWFDTDEGEQVDMGLAATGDSRVLRDAEHRYLAYTTRY
FT                   DREFMPGSRIRSELLTEYRDQLDKRIAAQRINVPRLAYALKAALAVPQRDGWSFGEEHG
FT                   RIDGRRLAQLVSSPAERRLFLLERYKPLADCVVSFLIDCSGSMRTYIEPVALLVDVLTR
FT                   ALDQAGVASEVLGFSTGAWNGGRARQDWLAGGRPSHPGRLNEVAHLVFKDAATSWRRAR
FT                   ADIAALFKADLFREGVDGEAVDWACTRLRTRAEARRILVVISDGSPMDSATAQVNDTYY
FT                   LDNHLKQVVERNEAARDVELLGLGVGLDLSPYYRRCLAVDLSTPPDMPLFTELVGWIGA
FT                   RR"
FT   gene            complement(422613..423374)
FT                   /locus_tag="Bphyt_4367"
FT   CDS_pept        complement(422613..423374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4367"
FT                   /product="protein of unknown function DUF81"
FT                   /note="PFAM: protein of unknown function DUF81; KEGG:
FT                   bxe:Bxe_B0689 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4367"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18744"
FT                   /db_xref="GOA:B2TF73"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF73"
FT                   /protein_id="ACD18744.1"
FT                   /translation="MIVQKLLPLLALMGVASYFQTITGFGLSMIVIGAASGLDLAPVTS
FT                   LAALLSLVTLANSATALPGKLHHIDWRAVGAATLGILPSVVAGVLVLDLLSNAASSMLQ
FT                   LLLGAVVLYGGLSAALRPTPLACRSGNRSFFVSGLFGGLLSGMFGVSGPPLIFQFYRQP
FT                   LSLVQIRYALIVIFTVTSTIRTMFSAYLGQLDADLWMQAAFAVPVVALMTLVARQYPPP
FT                   LSSVMTRRIAYAILVVIGGSLILHALQQLLR"
FT   sig_peptide     complement(423261..423374)
FT                   /locus_tag="Bphyt_4367"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.711) with cleavage site probability 0.235 at
FT                   residue 38"
FT   gene            complement(423371..424405)
FT                   /locus_tag="Bphyt_4368"
FT   CDS_pept        complement(423371..424405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4368"
FT                   /product="phosphate acetyltransferase"
FT                   /note="TIGRFAM: phosphate acetyltransferase; PFAM:
FT                   phosphate acetyl/butaryl transferase; KEGG: bxe:Bxe_B0690
FT                   phosphate acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4368"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18745"
FT                   /db_xref="GOA:B2TF74"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR004614"
FT                   /db_xref="InterPro:IPR012147"
FT                   /db_xref="InterPro:IPR042112"
FT                   /db_xref="InterPro:IPR042113"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF74"
FT                   /protein_id="ACD18745.1"
FT                   /translation="MKAINRIIEQARRSPMRIVLSEAEDPRVLQAAQRATREGIARILL
FT                   VGDATRIREAAAGFDVDLSGMELVDPATSALASSYADELFALRSKKGMTLEQARKEILN
FT                   PLCFANLMVRLGHADGSVSGAVNTTADVVRTAIQIIGIAPSFKLVSSFFLMMLCEPFHT
FT                   LKGGLIFSDCALVVEPDAAQLAEIAMAAADSARSLLMDEPRVAMLSFSTSGSAHHAAVD
FT                   KVVNATHIVQERRPHLAIDGDVQLDAAIVSEIALRKVKHSQVEGHANVLVFPSLEAGNI
FT                   GYKLAERIGGAKAIGPLLQGLRKPANDLSRGCSADDIYYVTAVTAVQAQAALTHPDALT
FT                   PSHT"
FT   gene            complement(424554..426386)
FT                   /locus_tag="Bphyt_4369"
FT   CDS_pept        complement(424554..426386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4369"
FT                   /product="sulfoacetaldehyde acetyltransferase"
FT                   /note="TIGRFAM: sulfoacetaldehyde acetyltransferase; PFAM:
FT                   thiamine pyrophosphate protein domain protein TPP-binding;
FT                   thiamine pyrophosphate protein central region; thiamine
FT                   pyrophosphate protein TPP binding domain protein; KEGG:
FT                   bxe:Bxe_B0691 sulfoacetaldehyde acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4369"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18746"
FT                   /db_xref="GOA:B2TF75"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR017820"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF75"
FT                   /protein_id="ACD18746.1"
FT                   /translation="MSEQNPSPRDATADNRASGPQAMTPSEAFVETLAANGVTDMFGIM
FT                   GSAFMDAMDIFAPAGIRLIPVVHEQGAGHMADGYSRVSGRHGVVIGQNGPGISNCVTAI
FT                   AAAYWAHSPVVIVTPEAGTMGIGLGGFQEAKQLPMFQEFTKYQGHVTHPARMAEFTGRC
FT                   FDRAMAEMGPTQLNIPRDYFYGQVKVEIPQPQRLDRGAGGEQSLNEAAELLAQAKFPVI
FT                   ISGGGVVMADAIEECKALAERLNAPVVNSYLHNDSFPANHPLWCGPLGYQGSKAAMKLL
FT                   SRADVVIALGSRLGPFGTLPQHGMDYWPTNAKIIQIDADHKMLGLVKKISVGICGDAKA
FT                   AAVALTERLAGRKLASDATREERGAQIASEKAAWEKELDDWTHERDAYSLDMIEEQKQE
FT                   RTPGGGTYLHPRQVLRELEKAMPEDVMVSTDIGNINSVANSYLRFNKPRSFFAAMSWGN
FT                   CGYAFPTIIGAKVAAPHRPAVSYAGDGAWGMSLMETMTCVRHNIPVTAVVFHNRQWGAE
FT                   KKNQVDFYNRRFVAGELDNQSFAAIARAMGAEGIVVDRLEDVGPALKRAIDAQMNHGKT
FT                   TIIEIMCTRELGDPFRRDALSKPVRMLDKYKDYV"
FT   gene            complement(426574..428031)
FT                   /locus_tag="Bphyt_4370"
FT   CDS_pept        complement(426574..428031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4370"
FT                   /product="phosphonoacetaldehyde dehydrogenase"
FT                   /note="TIGRFAM: phosphonoacetaldehyde dehydrogenase; PFAM:
FT                   Aldehyde Dehydrogenase_; KEGG: bur:Bcep18194_B1988 aldehyde
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4370"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18747"
FT                   /db_xref="GOA:B2TF76"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR017656"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF76"
FT                   /protein_id="ACD18747.1"
FT                   /translation="MNAIFKPRMPSAVRHEAMRIGGERVTRAEVIEVFNPYTRELVGTV
FT                   PNATVDDVRHAFEYAHAYRAKLTRYERAQILRRAADIVRERTNEIADLITAESGLCKKD
FT                   SLYEAGRVSDVLVFGANEALKDDGQIFSCDLTPHGKQRRVYTQREPLLGVICAITPFNH
FT                   PMNQVAHKIVPSIATNNRIVVKPSEKVPLSTCLLAEILYSAGLPQQMLQVVTGDPKDIA
FT                   DELITNPRVDLITFTGGVAIGKYIANKMGYRRAVLELGGNDPIIVMEDADLDEASTLAV
FT                   SGSYKNSGQRCTAIKRMLVHEAVADRFVELLVEKTRAIRYDDPADPATDMGTVIDEDSA
FT                   KFFEAQVNDAVSRGAKLLLGNVRRGALYSPTVVDHVTADMPLVRYETFGPVSPVIRFRD
FT                   IDEAIRLSNSTDYGLSSSVCTNRLDYITRFIAELEVGSVNVREVPGYRLELTPFGGIKD
FT                   SGLGYKEGVQEAIKSFTNVKTYSLPWQ"
FT   gene            complement(428227..429147)
FT                   /locus_tag="Bphyt_4371"
FT   CDS_pept        complement(428227..429147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4371"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bxe:Bxe_B0692 ABC taurine
FT                   transporter, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4371"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18748"
FT                   /db_xref="GOA:B2TF77"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF77"
FT                   /protein_id="ACD18748.1"
FT                   /translation="MFSSKSAHAVLHGEAAQMETNSPIEPPRRPGRGPRMLAKKPARPG
FT                   DTFGVPGQGSSVATSLITVAAFIALWFAATNLHWIKPLFLPSPQAVYAKFIYVATEGFA
FT                   NSTLAQHTGISLLRVFGAFALACVTAIPVGVMMGVSRFARGAFDPPIEFYRPLPPLAYL
FT                   PLIIIWFGIGEFSKVLLIYLAIFAPLAIAARAGVRSVSIEQIHAAYSMGASRTQVVLYV
FT                   ILKSAMPEIFTGMRIGIGVGWTTLVAAEMVASNSGLGFMVLNAAEFLASDVVIMGIIVI
FT                   GFFALCFDLLMRYIERVLVPWKGKV"
FT   gene            complement(429140..429955)
FT                   /locus_tag="Bphyt_4372"
FT   CDS_pept        complement(429140..429955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4372"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bxe:Bxe_B0693 ABC taurine transporter, ATPase
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4372"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18749"
FT                   /db_xref="GOA:B2TF78"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015859"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF78"
FT                   /protein_id="ACD18749.1"
FT                   /translation="MENMTVRNVSVVFPGRRPGQTVQALDDINLTIRSGDFVVALGASG
FT                   CGKTTLLSLMAGFIAPSRGELLLGGEPIAGPGADRGVVFQKHALLPWLNVIDNAEFGLK
FT                   LQGVPRAQRREIAVRNLALVGLQDFHKHMIYQLSGGMQQRVGIARALTCDPAMLLMDEP
FT                   MAALDALTRETIQELLLDVWKKTNKMFFFITHSVEEALFLASRLIVMSPRPGRITHTYE
FT                   LDFNRRFLESRDARAIKSSPDFIAMREQVLNIIYGDEKMHAAEAGVAHV"
FT   gene            complement(429989..431047)
FT                   /locus_tag="Bphyt_4373"
FT   CDS_pept        complement(429989..431047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4373"
FT                   /product="taurine ABC transporter, periplasmic binding
FT                   protein"
FT                   /note="KEGG: bxe:Bxe_B0694 ABC taurine transporter,
FT                   periplasmic ligand binding protein; TIGRFAM: taurine ABC
FT                   transporter, periplasmic binding protein; PFAM:
FT                   Substrate-binding region of ABC-type glycine betaine
FT                   transport system; SMART: extracellular solute-binding
FT                   protein family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4373"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18750"
FT                   /db_xref="GOA:B2TF79"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR010068"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF79"
FT                   /protein_id="ACD18750.1"
FT                   /translation="MKRHKNSTLRPWFQWTARCVLSLVCAATACFATTPAHAEDKEITI
FT                   AYQQIVDPWVVGIANGSIEKATGYKINWRQFESGAKVATALASGDVKVGVIGSSPLAAA
FT                   VSQGLDLQLFWILDNINQAEAMVVRNGSGITKPADLKGKTIGVPFVSTTHYHTMFALQH
FT                   WGINPSDLKILNMQPNQIVAAWSRGDIDAAYVWDPALAELKKSGKVLITSGDLSKLGKP
FT                   TFDGIAVDRKWGEEHKDFMAKLVKAIADADQQYRSNPSQWNASSPQAAAIAKMIGGSPA
FT                   DVPASLALYAFPTLSEQASAQWLGGGTTSRAALALKDTSEFLKSQKQIGTVLPDYSKFV
FT                   TPAYAEAAAQLK"
FT   sig_peptide     complement(430931..431047)
FT                   /locus_tag="Bphyt_4373"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 39"
FT   gene            431369..432895
FT                   /locus_tag="Bphyt_4374"
FT   CDS_pept        431369..432895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4374"
FT                   /product="putative transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR HTH; KEGG:
FT                   bxe:Bxe_B0695 transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4374"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18751"
FT                   /db_xref="GOA:B2TF80"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF80"
FT                   /protein_id="ACD18751.1"
FT                   /translation="MSSRTATALWTQRFQRPTDSNMSLQGQIRQMLVAAILDGQLPPQT
FT                   ALPSSRELADQLSVARNTVVLAYQQLVEEGYLISRERSGHFVNPAMLEGRHGFKAVHTV
FT                   PGSEQEHASARPDWAQRVQRRPSAQRNIVKPGNWQDYEFPFIYGQFDQSLFPTNDWREC
FT                   CMKSLSVMEIRNWAPDLIGRDDDTLIQQIRTRVLPRRGVFAMPDEIVITMGCQQALYLI
FT                   ADLLARERTTVGFENPGYPDARNIFENRNAQLIPLPVDEGGVRPVDDAHLFAQCDYVYV
FT                   TPSHQCPTTATMPIERRHALLELAQKHDFVLIEDDYESENNFSGLPHPALKSLDKADRV
FT                   IYIGSLSKTFAPGLRLGYIVGPRELVQELRALRRLMVRHPAAYIQRAFATFLSLGHHDA
FT                   LLRRLAHAYRERALALMAALDTHMPEARHIPITGGASCWVQGPPWLDAVRLADDAEQHG
FT                   ILIELGGVFFMDGLEQKNCFRMGFSAIKLDKIDAGVRLLAELVRKQKPAL"
FT   gene            complement(432938..433690)
FT                   /locus_tag="Bphyt_4375"
FT   CDS_pept        complement(432938..433690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4375"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="PFAM: regulatory protein IclR; Transcriptional
FT                   regulator IclR; KEGG: bxe:Bxe_B0696 transcriptional
FT                   regulator, IclR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4375"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18752"
FT                   /db_xref="GOA:B2TF81"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF81"
FT                   /protein_id="ACD18752.1"
FT                   /translation="MTKADTPTLRAFALLEHLVNSDGPVSLADIAQDVALPKASLHRML
FT                   ASLEAGGLVIREPGQKNAYVIGPRLAQLALGVVMHSGARRLRHAILARLVADLGETCNL
FT                   TMLHETEVLYLDRMEAPWPLRLDLKPGSHVPAYCSASGKLLLAMLPREQRSALVRALKL
FT                   ERFTQNTITDPELLEAELDRTAHKRIAIDNEEFLAGIVCVAAPVIDENGTCIAAIAVHA
FT                   PVSRAPLSRALEFVPRLQEAAKELAATF"
FT   gene            complement(433809..434645)
FT                   /locus_tag="Bphyt_4376"
FT   CDS_pept        complement(433809..434645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4376"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="PFAM: regulatory protein IclR; Transcriptional
FT                   regulator IclR; KEGG: bxe:Bxe_B0697 transcriptional
FT                   regulator, IclR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4376"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18753"
FT                   /db_xref="GOA:B2TF82"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF82"
FT                   /protein_id="ACD18753.1"
FT                   /translation="MQALCSSPRGEPLAEDSRALRALAVLEQLAGAGQPFSLSQLSLRL
FT                   HIPKATLMRLIESLETQGYVMHLPDSRGTDRGITLGPKAAQLALTTLSNNTFGRACRSL
FT                   LRSLVDALGETCNLTALDRDTVLYLERVETTEPLRLHLQPGTRVPLHCTASGKLFLSQM
FT                   PPAERRPVLARLTLERRTQGTLTELNLLEAELDRLAARGIGIDNEELVRGMVAVAVPVR
FT                   DAAAGHVLAALAIHAPTARASLNDLLKAVPKLKDAALKLAPLLSAGPSAEHPYHER"
FT   gene            434851..436506
FT                   /locus_tag="Bphyt_4377"
FT   CDS_pept        434851..436506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4377"
FT                   /product="glucose-methanol-choline oxidoreductase"
FT                   /note="PFAM: glucose-methanol-choline oxidoreductase; GMC
FT                   oxidoreductase; KEGG: bxe:Bxe_B0698 putative
FT                   glucose-methanol-choline oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4377"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18754"
FT                   /db_xref="GOA:B2TF83"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR012132"
FT                   /db_xref="InterPro:IPR027424"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF83"
FT                   /protein_id="ACD18754.1"
FT                   /translation="MADRFDFVVVGAGSAGCVLANRLSEGGRYSVCLLEAGPADRFMWI
FT                   HIPIGYGKTMFHPVYNWGFYTDPDPNMHNRRLYWPRGRTLGGSSSINGLIYVRGQRDDY
FT                   DNWARLGNRGWSWQDCLPYFKRLEHNELGEGPTRGVDGPLWASTIKQRHELVDAFIEAS
FT                   NSLGVASIDDFNTGDQEGVGYYQLTTRRGFRCSTAVAYLKPARQRQNLHVETDAMASKI
FT                   LFEGTRACGVQYRQHGELREVRANREVILTAGALQSPQLLQLSGVGPAALLREFGIPVV
FT                   ANRAGVGENLQDHLQIRLIYEVTKPITTNDQLRSWTGRAKMGLQWALMRSGPLAVGINQ
FT                   GGMFCRALPEESATPDTQFHFSTLSADSAGGNVHDFPGCTYSICQLRPESRGAVRIRSA
FT                   DPREAPSIQPNYLDTDLDRRTTIAGVRFARRVAAAQPMAGLMKREVRPGADAQTDDELL
FT                   EFCREYGQTIFHPSGTAKMGPAGDPLAVVDERLRVYGTQGLRVVDCSIMPTLVSGNTNV
FT                   PIVMVAEKASDMILHDASGVDRGVATTPAAKVAA"
FT   gene            436696..438006
FT                   /locus_tag="Bphyt_4378"
FT   CDS_pept        436696..438006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4378"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1; KEGG: bxe:Bxe_B0699 major
FT                   facilitator superfamily (MFS)metabolite/H+ symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4378"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18755"
FT                   /db_xref="GOA:B2TF84"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF84"
FT                   /protein_id="ACD18755.1"
FT                   /translation="MAIDPRAIRRVAFASVIGATVEWYDFFLYGVVAGIVFNKLYFPAS
FT                   DPLVSTLLAYSTFAVGFVTRPLGGVIFGHFGDRIGRKSALILTLIIMGISTAGVAFVPT
FT                   YAQIGIWAPILLLSLRVLQGIGLGGEWGGAVLMAYEYAPPEKRGLYASLPQIGLSIGLC
FT                   LASGMVAALSRLLPETAFLSWGWRIAFGASLGLVLIGLYIRAKVMETPEFIALKRNRRE
FT                   AKIPFVDMITRYRGAVVLGMGARYIDGVFFNIFAVFSIGYLTQHVSMSRTDALLGVMIA
FT                   AGVMCFFIPLFGSMSDKLGRARVYFWGSLICGVSVFPAFWLIEMQPANTLLIWAAIVVP
FT                   FGIFYAMVYGPEAALFAELFDAEVRYTGISFVYQFSGIFASGLTPIIATILMRLNGGKP
FT                   WTVCAYVLFSALVSALSVRAIERRRAGAFESVVHARS"
FT   gene            complement(438126..438503)
FT                   /locus_tag="Bphyt_4379"
FT   CDS_pept        complement(438126..438503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4379"
FT                   /product="PilT protein domain protein"
FT                   /note="PFAM: PilT protein domain protein; KEGG:
FT                   reu:Reut_C6344 PilT protein, N-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4379"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18756"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR041705"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF85"
FT                   /protein_id="ACD18756.1"
FT                   /translation="MRVLLDTHIYLWAVTDDPKLSATARKIILDADEVFVSAASIWEAS
FT                   IKVGLGKLDADIDQLVAEIEESGFSELPVRAAHAAMVRNLPDIHRDPFDRILVAQAMAE
FT                   PLRLISADGHLSKYSELVLTV"
FT   gene            complement(438503..438733)
FT                   /locus_tag="Bphyt_4380"
FT   CDS_pept        complement(438503..438733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4380"
FT                   /product="prevent-host-death family protein"
FT                   /note="TIGRFAM: prevent-host-death family protein; PFAM:
FT                   protein of unknown function DUF172; KEGG: reu:Reut_C6345
FT                   prevent-host-death protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4380"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18757"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF86"
FT                   /protein_id="ACD18757.1"
FT                   /translation="MLTVNIHEAKTNFSRLVDAAAGGEEILIAKAGKPAARLVSITKPA
FT                   RRFGALKGAVRIADDFDAPLPDDVIAAFEGN"
FT   gene            complement(438866..439630)
FT                   /locus_tag="Bphyt_4381"
FT   CDS_pept        complement(438866..439630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4381"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="PFAM: regulatory protein IclR; Transcriptional
FT                   regulator IclR; KEGG: bxe:Bxe_B0700 transcriptional
FT                   regulator, IclR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4381"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18758"
FT                   /db_xref="GOA:B2TF87"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF87"
FT                   /protein_id="ACD18758.1"
FT                   /translation="MSTSNQSNAAAVRAFRVLETLAEAGSPLSMTELVNALGLPKQTVH
FT                   RILVQLMDAWLVTRGAGDRLYECSPRVRMLAVNVLMHAGPAAARHVLLEQLVAKIGETC
FT                   NLTMLSGNDVVYVDRVETEWPLRMHLQPGSHVPLHCSASGKLLLSFLPKDRRERVIETL
FT                   PLRGYSERTITDRDALRKELSTTRRRLLAINNQEHLQGLIAIAVPVMLDRNRACAAIAV
FT                   QAPVGRVTLDDLLAFVPDLRHAAEETAKTFQE"
FT   gene            439835..441280
FT                   /locus_tag="Bphyt_4382"
FT   CDS_pept        439835..441280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4382"
FT                   /product="Aldehyde Dehydrogenase"
FT                   /note="PFAM: Aldehyde Dehydrogenase_; KEGG: bxe:Bxe_B0701
FT                   succinate-semialdehyde dehydrogenase (NAD(P)+)"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4382"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18759"
FT                   /db_xref="GOA:B2TF88"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF88"
FT                   /protein_id="ACD18759.1"
FT                   /translation="MNVRATGAEISGTHADGEAERIVATLVAKARAAQRAFEQAGQQAL
FT                   DTAADAAAWAIMEPERNRQLAERAVHDTGLGNADDKFRKNYRKTLGLLRDLHEQKTTGV
FT                   IAEDKASGLVEIARAVGVVAAITPSTNPAATPANKIINALKCGNAVIVAPSPKGYSSCA
FT                   LLIEFIHAQFAKAGIDPDLVQMLPAPISKAATAALMRQCDLVVATGSQANVRMAYASGT
FT                   PAFGVGAGNVASIVTASADLHDAARKILRSKTFDNATSCSSENSIVIEEAVYQPMLAEL
FT                   TSCGGVLLDAAQKAKLQTAMWVNGKLSEQCTAKSAEVIARVAGLEEVAARHPAFLMVEE
FT                   SGAGSDYPFSGEKLAPVLTVYRAAGFDAAAEVVRSIYAYMGAGHSVGLHSSDAAQAVQL
FT                   GVTLPVARVIVNQAHCLATGGNFDNGLPFSLSMGCGTWGRNNFSGNLGFRHYLNTTRVA
FT                   YPIEERVPETDELLGDFFARYGR"
FT   gene            441277..442938
FT                   /locus_tag="Bphyt_4383"
FT   CDS_pept        441277..442938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4383"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   bxe:Bxe_B0702 putative acyl-CoA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4383"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18760"
FT                   /db_xref="GOA:B2TF89"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF89"
FT                   /protein_id="ACD18760.1"
FT                   /translation="MNTPVTLRALIDERAAQHPDKPFLLAALDDDETPVPDRRATVLTF
FT                   RELRDDCRALEARFREAGLQPGEVISVFMGNGIQTARLLLAAMYSGLVANPLNLLCQPS
FT                   QVRYIVDHSDTRMIFAASDTHAVIGAAVAELRAAGLTREIALIQTEPDDAEPPSLAKHE
FT                   PALVEAAAHGASGATAPAPALAKRSVAPRPVTSRATAYEPTADDVALLMYTSGTTGTPK
FT                   GVLLTHRNLVANARNISAEHRLASDDRVLASLPLYHINGLVVTLLAPLFHGGSAVMTSR
FT                   FSARTFWRDVALHACTWINVVPTIVAYLLNADEACTYDLSALKFCRSASAALPADHHRA
FT                   FEARFGIGVIETMGMTETAAPVFSNPYEMERRRVGSIGLPSGGEAKVIDREGRECAANE
FT                   CGELVLRGEQVMGGYYKRPEETAAAFTSDGWLRTGDLGYRDADGYFYINGRAKELIIKG
FT                   GENIAPREIDEALLRHPDVLDAAAVGVPDPAYGQDIVAFVVPRMSDGRGAPDPADLREH
FT                   CLRELGRYKTPKEFRFVDELPRGPSGKVQRLKLVPT"
FT   gene            443002..444384
FT                   /locus_tag="Bphyt_4384"
FT   CDS_pept        443002..444384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4384"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bxe:Bxe_B0703 major facilitator superfamily (MFS)
FT                   metabolite/H+ symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4384"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18761"
FT                   /db_xref="GOA:B2TF90"
FT                   /db_xref="InterPro:IPR000849"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF90"
FT                   /protein_id="ACD18761.1"
FT                   /translation="METRIRRVKTRHIILAVMCLMYFISYIDRVNIAVAGPLIRHEMGL
FT                   TTVQLGLVFSAFAYPYAAMQIIGGWLADKYGPKLVLTVLSLIWGVATLATGFAGSVTML
FT                   VVMRFALGIGEGGAFPTATRAFTYWMPVAERGFAQGITHSFARLGGAITPPLVLAVVAT
FT                   GGWRDAFILLGIASLAWTVLYLFVFTNSPEQNRRITPEETAEIGYRAGDCDRAKHAATP
FT                   WRKLVRRMWLVTFVDFCYGWLLWVYLTWLPSYLRESRGFDLKQLALFTALPLLAGVIGD
FT                   TLGGVVSDKLYKITGRLRFARCTVLVVGMGGSLVFLLPMVSATNPLTAVWFLSASFFFL
FT                   EITNPVLWTLPLDIAGKYAGTAGGMMNTGFGVAGMVSPVVFGYLIEKTGSYNVPFNISA
FT                   GLLAVGILAALFIDTSKTVEADEERERAAGVELGGMPSFSHAGAGVRLERHHLRRPLRW
FT                   RK"
FT   gene            444824..445156
FT                   /locus_tag="Bphyt_4385"
FT   CDS_pept        444824..445156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4385"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bmu:Bmul_6287 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4385"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18762"
FT                   /db_xref="InterPro:IPR025421"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF91"
FT                   /protein_id="ACD18762.1"
FT                   /translation="MKFRKVFVIGLLGAFLSPLALADVGHASPGHAPVKQDGSYGSVPQ
FT                   TTLPSSAAPVVKPAAQGKTRAEVRQELLQAYKDGLIPTTEADYPPSKRTIERNKALFAE
FT                   TERYLE"
FT   sig_peptide     444824..444892
FT                   /locus_tag="Bphyt_4385"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 23"
FT   gene            445245..445583
FT                   /locus_tag="Bphyt_4386"
FT   CDS_pept        445245..445583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4386"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B0467 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4386"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18763"
FT                   /db_xref="InterPro:IPR025421"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF92"
FT                   /protein_id="ACD18763.1"
FT                   /translation="MKSIISLALASAVFVTSAVQAQGLTRAEVKQQLIEAQANGLRYVT
FT                   ESSYPDVHPSFAHKVKAKAATPSAQSDEGGVPAGSHESGSAPHGLPMPEGNPHCVGPVS
FT                   FCNIYAGS"
FT   sig_peptide     445245..445310
FT                   /locus_tag="Bphyt_4386"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.991 at
FT                   residue 22"
FT   gene            445991..447550
FT                   /locus_tag="Bphyt_4387"
FT   CDS_pept        445991..447550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4387"
FT                   /product="sulphate transporter"
FT                   /note="PFAM: Xanthine/uracil/vitamin C permease; sulphate
FT                   transporter; KEGG: bxe:Bxe_A3224 sulphate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4387"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18764"
FT                   /db_xref="GOA:B2TF93"
FT                   /db_xref="InterPro:IPR001902"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF93"
FT                   /protein_id="ACD18764.1"
FT                   /translation="MNLREQFASFPRDMFAGTVVFLVALPLCLGIANASGVDPIAGLLS
FT                   GIIGGLVVALLSGSHLSVSGPAAGLVVIVVDGMTRLGSFSSFLIAVLLAGAMQFGFGLL
FT                   KAGRFAAYVPSSVIKGMLAAIGLLLIIKQAPLAAGLADGSASVTSAMSGTVVTPFGAMS
FT                   VAACAIALVSLAILASWETRAARRFAFVRHVPAPLAVVLFGIGLTLLLDFVAPAFAPPL
FT                   EHRVSLPSLASFAALDKVFNWPELTHLLKPDVWRLAMTIAIVASLETLLCLEAVEQIDP
FT                   KKRPVQPDRELKAQGIGNIVAGAIGGLPITSVIVRSSANVEAGAQSRWSAVVHGALLLV
FT                   SVFALTAVINLIPLASLAAILIFTGLKLAKPSMFADAARQGFARFAPFVVTIAAVLLTD
FT                   LLMGIVIGIVCSVAFAIHAHMRRPITMAQHDDHFLLCLRKDVSFLAKVSLKEHLKTIPD
FT                   RATVILDGSRADFIDPDARELIDEFVKNAPARGIQVECRQLEKVVEERVGLRGFGALLR
FT                   RQ"
FT   sig_peptide     445991..446095
FT                   /locus_tag="Bphyt_4387"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.846) with cleavage site probability 0.618 at
FT                   residue 35"
FT   gene            447563..448013
FT                   /pseudo
FT                   /locus_tag="Bphyt_4388"
FT   gene            448093..448773
FT                   /locus_tag="Bphyt_4389"
FT   CDS_pept        448093..448773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4389"
FT                   /product="two component heavy metal response
FT                   transcriptional regulator, winged helix family"
FT                   /note="TIGRFAM: heavy metal response regulator; PFAM:
FT                   response regulator receiver; transcriptional regulator
FT                   domain protein; KEGG: bxe:Bxe_B0708 two component heavy
FT                   metal response transcriptional regulator, winged helix
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4389"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18765"
FT                   /db_xref="GOA:B2TF94"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR006291"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF94"
FT                   /protein_id="ACD18765.1"
FT                   /translation="MRILLVEDEPKTGAYLRKGLSEAGYVVDWAQNGVTGQHQAETEDY
FT                   DLLILDVMLPGQDGWTLLQNLRRKRCTPVLFLTARDDVGDRVKGLELGADDYLAKPFDF
FT                   VELIARVRSILRRGKPREFTLLKVADLELDLTRRKATRQHDVILLTAKEFTLLWLLMRK
FT                   EGEILPRATIASQVWDMNFNSDTNVVDSAIRRLRSKIDDAYEPKLIHTVRGMGYVLENR
FT                   GAGN"
FT   gene            448782..450215
FT                   /locus_tag="Bphyt_4390"
FT   CDS_pept        448782..450215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4390"
FT                   /product="heavy metal sensor signal transduction histidine
FT                   kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="KEGG: bxe:Bxe_B0709 heavy metal sensor signal
FT                   transduction histidine kinases (STHK); TIGRFAM: heavy metal
FT                   sensor kinase; PFAM: ATP-binding region ATPase domain
FT                   protein; histidine kinase HAMP region domain protein;
FT                   histidine kinase A domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4390"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18766"
FT                   /db_xref="GOA:B2TF95"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR006290"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF95"
FT                   /protein_id="ACD18766.1"
FT                   /translation="MVPRTLRARLTALIIVSTSAILALSGLALYHVLRSCLESSSVEQM
FT                   SSTMAALHTHLSGIPTVHAIGGNAETVIDHLRGHPHMALAIYDTAGQRRLSTAGFKPYA
FT                   PIAAIVLNGAPLALTRAGSNLRYLLQRVALNGGIGPPVLVAIQYDGTGDEALLRVYACT
FT                   TVAIEVLGVLLAAVFAYGIALVGLLPLRRLVARAEAMSTSGLAQPLPELHASGELKELE
FT                   QAFNGMLTRLDESFTRLSQFSSNLAHDMRTPLTNLLAAAQVALSQRRSAEDYRDVIESS
FT                   VDEYRRLSHMIEDMLFLARSDQADAPPSLRLLDAVAEAERVAGYYETVAEDAQVEIKVT
FT                   GEGTVLADLLLFQRALSNLLSNALAQGPPGTTIIIDCKEEPDWTTLSVSDSGAGIEARH
FT                   LERIFERFYRVDPSRHGSASGTGLGLAIVKSIMTSHGGQCGCESRPHVRTCFWLRFPNH
FT                   DCSSHGMAARPGRDAVRKA"
FT   sig_peptide     448782..448859
FT                   /locus_tag="Bphyt_4390"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.902) with cleavage site probability 0.392 at
FT                   residue 26"
FT   gene            complement(450285..450557)
FT                   /locus_tag="Bphyt_4391"
FT   CDS_pept        complement(450285..450557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4391"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0710 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4391"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18767"
FT                   /db_xref="InterPro:IPR025421"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF96"
FT                   /protein_id="ACD18767.1"
FT                   /translation="MNAARLFTLSVAALTIFGTASQVAQAQGKSRAEVQQELVQAQHAG
FT                   LIPSSKTQYPPDARTVARNKQIHAIAWHGGETTPSLDQHDKLSAK"
FT   sig_peptide     complement(450477..450557)
FT                   /locus_tag="Bphyt_4391"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.957 at
FT                   residue 27"
FT   gene            450848..451132
FT                   /locus_tag="Bphyt_4392"
FT   CDS_pept        450848..451132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4392"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0711 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4392"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18768"
FT                   /db_xref="InterPro:IPR025421"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF97"
FT                   /protein_id="ACD18768.1"
FT                   /translation="MKSLIQAVVVAAVLAAPVAVFAQTNSPVTRAQVRAELIELEQAGY
FT                   NPGRGEDPNYPADIQAAEARVAARHAATGFGGSASGSSEAGRAPVSNSD"
FT   sig_peptide     450848..450916
FT                   /locus_tag="Bphyt_4392"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 23"
FT   gene            451472..451903
FT                   /locus_tag="Bphyt_4393"
FT   CDS_pept        451472..451903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4393"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   bxe:Bxe_B0713 response regulator receiver domain
FT                   protein(CheY)"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4393"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18769"
FT                   /db_xref="GOA:B2TF98"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF98"
FT                   /protein_id="ACD18769.1"
FT                   /translation="MPRTPATCQRWSAREIRVLHELPRVLVVDDNVGAAEALATYLSYE
FT                   GVEARAADGCEQALRCVRDWVPDVVVLDIMMPERDGYETASALRSYLPTQSLGIVAFTS
FT                   LDEDHVKETGKARHNFDGYCQKGTAPTALLALMRKLWRE"
FT   gene            complement(451943..452272)
FT                   /locus_tag="Bphyt_4394"
FT   CDS_pept        complement(451943..452272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4394"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: regulatory protein ArsR; KEGG: bxe:Bxe_B0714
FT                   transcriptional regulator, ArsR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4394"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18770"
FT                   /db_xref="GOA:B2TF99"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF99"
FT                   /protein_id="ACD18770.1"
FT                   /translation="MRTYNHPAAEDFALGRLFHALSDPVRLEIVRRLASVDEATCGELD
FT                   GGRPKSSVSHHFRILREAGLVRTRVAGTVHQNSLRRAELDARFPGLMEAILKQIVAETA
FT                   ESEPA"
FT   gene            452360..453457
FT                   /locus_tag="Bphyt_4395"
FT   CDS_pept        452360..453457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4395"
FT                   /product="NADH:flavin oxidoreductase/NADH oxidase"
FT                   /note="PFAM: NADH:flavin oxidoreductase/NADH oxidase; KEGG:
FT                   bxe:Bxe_B0715 NADH-flavin oxidoreductase / NADH oxidase
FT                   familyprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4395"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18771"
FT                   /db_xref="GOA:B2TFA0"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B2TFA0"
FT                   /protein_id="ACD18771.1"
FT                   /translation="MSALFQPYKLKDVSLRNRIAIPPMCQYTAEDGLINDWHRIHLAGL
FT                   ARGGAGLVIVEATAVSPEGRITPGCAGIWTDEQAQAFAPVVASIKAAGAVPGIQIGHAG
FT                   RKASANRPWEGDDHIADDDSRSWQTIAPSAIAFGGGLPKVPKAMTLDDIARVREDFVAA
FT                   AKRALDAGFEWLELHFAHGYLGQSFFSTHSNQRDDAYGGSLENRSRFLLETLAAVRKVW
FT                   PEHLPLTARFGVIEYDGRDEETLVESIELAKNFKREGLDMLSVSVGFSTPTAAIPWAPA
FT                   FLAPIAERVRREAGIPVSSAWGIDTPELADRSVKDGQLDLVMVGRAHLADPHWPYHAAK
FT                   KLGIERPSWTLPAPYAHWLERYKVA"
FT   gene            454309..455337
FT                   /locus_tag="Bphyt_4396"
FT   CDS_pept        454309..455337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4396"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="PFAM: regulatory protein MerR; KEGG:
FT                   bvi:Bcep1808_5897 putative transcriptional regulator, MerR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4396"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18772"
FT                   /db_xref="GOA:B2TFA1"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:B2TFA1"
FT                   /protein_id="ACD18772.1"
FT                   /translation="MTSSDEQRPAQQGYRSGEAARLAKMPVTTLRIWERRYGVVGPAKT
FT                   ASGQRLYTEDDVRRLTLIKLLVSRGHAIGAIARLDREQLQFLAARSGRESGGATDLPLV
FT                   ESVNLRLALVGGSLAQRFRASGVDLRPYGVNELITFADLSLAAAGGGTSGERGAPIDAL
FT                   LVSIDSLQEDIASQIIALGDAVRAKAIAVVYGFGTGPAAEILRVAGVRLYREPDSRTEF
FT                   RQMLGDLCERVRSQERIGDDAVWSRVRRRYDDRELEMIAGRSSTIACECPRHLAELVMK
FT                   LSAFERYSDACTSRSAQDAALHRYLGDVSNRACAMVEAALERVAREEGWFAGSQSPQAG
FT                   QA"
FT   gene            455365..455988
FT                   /locus_tag="Bphyt_4397"
FT   CDS_pept        455365..455988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4397"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: sigma-70 region 2 domain protein; sigma-70
FT                   region 4 domain protein; Sigma-70 region 4 type 2; KEGG:
FT                   bxe:Bxe_B0889 sigma-24 (FecI)"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4397"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18773"
FT                   /db_xref="GOA:B2TFA2"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:B2TFA2"
FT                   /protein_id="ACD18773.1"
FT                   /translation="MSHDASTDATIGASALDQKSAYLAALLERVSRREAGAFEALYRAS
FT                   APSLFGLAVRVTRTSESAEEVVQDGFIKIWRFAGSYDPGKASPSTWMSTIVKNQALDYL
FT                   RRNPYSGVYVDELDERNAAGDADVNFWQEFALDAERLSSYLGRLAPVQRQAIALAYFRG
FT                   QSQSEIAHTLDAPVGTVKSWISRGLESLRAMADARPAPHHGGLY"
FT   gene            456173..456850
FT                   /locus_tag="Bphyt_4398"
FT   CDS_pept        456173..456850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4398"
FT                   /product="bifunctional deaminase-reductase domain protein"
FT                   /note="PFAM: bifunctional deaminase-reductase domain
FT                   protein; KEGG: bxe:Bxe_B0716 putative pyrimidine reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4398"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18774"
FT                   /db_xref="GOA:B2TFA3"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:B2TFA3"
FT                   /protein_id="ACD18774.1"
FT                   /translation="MNPYIVAHMMSSLDGRSLTDGWHLDYASDLYEDTAATFEADGWIC
FT                   GRVTMQEIAHGADYPKGLAKGAVPRTDHFVERKADQYAISIDPQGRVAWKSNTALKSHV
FT                   IEVLTEQVADDYLAYLQSIGVSYVFGGKTELDLGKVVQTLARELGVKKLIVEGGSHVSG
FT                   AFVNAGLVDEVSVLILPLVDGRSEHPSSFEVAMEKWQAPAYLKLTSVEQKEHGAVWLRY
FT                   TKA"
FT   gene            complement(456949..457719)
FT                   /locus_tag="Bphyt_4399"
FT   CDS_pept        complement(456949..457719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4399"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0717 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4399"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18775"
FT                   /db_xref="InterPro:IPR025522"
FT                   /db_xref="UniProtKB/TrEMBL:B2TFA4"
FT                   /protein_id="ACD18775.1"
FT                   /translation="MLPTSMKSLRKNAARLACVTMVFCSALLTGCAGSSIKDASAASTP
FT                   VQVRPDNIYVYTFDANPDQVKLDGGMMQKVKTQLEGSSAAQKQAADAAEVREQVANEIA
FT                   HQLQSMGLRAIRSDITAPADQNVLLVQGSFNTIDSGNRRRRMLIGLGAGKSQVSSSVQI
FT                   LYKPAGGTPRLVQTFTANADSGKAPGMVETAGVGAAAGSIATSAAVGGGLHAVSETKRA
FT                   GVSADAKRLADAVAKQIGEIGVNGGWLSTQHIKG"
FT   sig_peptide     complement(457594..457719)
FT                   /locus_tag="Bphyt_4399"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.444 at
FT                   residue 42"
FT   gene            complement(458495..458953)
FT                   /locus_tag="Bphyt_4400"
FT   CDS_pept        complement(458495..458953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4400"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mmu:100044247 hypothetical protein
FT                   LOC100044247"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4400"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18776"
FT                   /db_xref="UniProtKB/TrEMBL:B2TFA5"
FT                   /protein_id="ACD18776.1"
FT                   /translation="MKKSILSAALSVVVTLAATAAFAQEAPPPAAPQSHGEPQHDDGPP
FT                   PHGRMGPMGPMGPGFAVINDLEQLRRLYAMSGHQGEIIAVYHDVLNKTQDPMLRHYVYD
FT                   SLAREQLKPANPDQAIVTLRTSLSEDLAAANKAPRGGPGGMPPPAEAQ"
FT   sig_peptide     complement(458882..458953)
FT                   /locus_tag="Bphyt_4400"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 24"
FT   gene            459304..459729
FT                   /locus_tag="Bphyt_4401"
FT   CDS_pept        459304..459729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4401"
FT                   /product="phasin family protein"
FT                   /note="TIGRFAM: phasin family protein; PFAM: Phasin family
FT                   protein; KEGG: bxe:Bxe_B0720 phasin"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4401"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18777"
FT                   /db_xref="InterPro:IPR010127"
FT                   /db_xref="InterPro:IPR018968"
FT                   /db_xref="UniProtKB/TrEMBL:B2TFA6"
FT                   /protein_id="ACD18777.1"
FT                   /translation="MDRPDAANPFGDFTKMLEQFKLPGFDVPAIMEARRKDMEALVQAN
FT                   QTAFQGMQSLAQKQADMLRSTLGELQSLTGQLSAGGTAPSGKAAELIQQSLHKSLADMQ
FT                   QLAQAAYQTQAESYAVIAKRVEENVQELKSLLQQQKK"
FT   gene            460311..460760
FT                   /locus_tag="Bphyt_4402"
FT   CDS_pept        460311..460760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4402"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0721 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4402"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18778"
FT                   /db_xref="InterPro:IPR021267"
FT                   /db_xref="UniProtKB/TrEMBL:B2TFA7"
FT                   /protein_id="ACD18778.1"
FT                   /translation="MLYSRIARAMLGASCALSLAAHATLGQNVSTVNGDQSRLRAVTHT
FT                   ATTQSAYSVHLMTLPSGTLVREYVARNGIVFGVAWEGPTLPDLKSMLGTSFDAYVAATT
FT                   TRRGTPLAVSNSDLVVYSGGHLRAFSGHAYLPQTVPAGVDAGVIQ"
FT   sig_peptide     460311..460382
FT                   /locus_tag="Bphyt_4402"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.932 at
FT                   residue 24"
FT   gene            460772..462049
FT                   /locus_tag="Bphyt_4403"
FT   CDS_pept        460772..462049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4403"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0722 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4403"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18779"
FT                   /db_xref="InterPro:IPR021847"
FT                   /db_xref="UniProtKB/TrEMBL:B2TFA8"
FT                   /protein_id="ACD18779.1"
FT                   /translation="MRLMSSFKTLLCAALLALLVGACGGGGGGSSGSGSAAGTNGSTSA
FT                   SPGPSVANTVPLSQTLAANAVRVTVDSGVSDVPNMPFVNLTICAPGTTQCQTIDHVLVD
FT                   TGSWGVRLFASQLPASMTLPQQKDTSGHLVAECMQFFDGYTWGPVKLADLQIAGEKAAS
FT                   LPIQVIDPNYATLPADCANFGAARNTPATLQANGILGIGVFKHDCGANCVQQALAGTYY
FT                   GCNGATCTSIPLAEELQVANPVPYFATDNNGSLLSLPAVSGGAQSVSGQLIFGIGTQTN
FT                   NALGGAQVIGVSPSNGTFTTVQNGITYPRSILDSGSTGLFFQTSALPVCASPNNSYYCP
FT                   GSTQQLSAMIQGVNGTTSAVNFSVGNATTIAQTYSGDSALPLLAGPAFVQSAIFDWGLP
FT                   FFYGRSVYAAVEQQPTPGGMGPYVAY"
FT   sig_peptide     460772..460882
FT                   /locus_tag="Bphyt_4403"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.863 at
FT                   residue 37"
FT   gene            complement(462135..463976)
FT                   /locus_tag="Bphyt_4404"
FT   CDS_pept        complement(462135..463976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4404"
FT                   /product="putative adhesin processing HmwC-like protein"
FT                   /note="KEGG: bxe:Bxe_B0723 putative adhesin processing
FT                   HmwC-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4404"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18780"
FT                   /db_xref="InterPro:IPR040542"
FT                   /db_xref="InterPro:IPR041109"
FT                   /db_xref="UniProtKB/TrEMBL:B2TFA9"
FT                   /protein_id="ACD18780.1"
FT                   /translation="MSTEFSLDRFESQIQSRDYDAAHEEFCTLLRTLSDKRGRLGAEHF
FT                   ARSTPNAPSDEKSRDTLQRIADGFTTLFSAPEYPLQAEKMNIMFWGRPWINMIFAVTSY
FT                   GSTDHIVRKLLETAEDNDEARAILTRKQLVLYTAGSQYDIDFTDLHRRDPVLATSLGVS
FT                   MVSAAVHISPAAHEKRERLLEWLPGALDKIEDLDELPTAAVCGAYMHCSYSTSPERHEI
FT                   KRSINRLVRKKLDALGLLGHEASVARTGIKGRKPVMLVVLEWFSGGHSIYRTHSRTMLA
FT                   ARQHFEVVAFGEAQNVDEAGRAIFDRFVEFEHPEYVGDCIRQIQAFAAREQPDVLYMPS
FT                   VGMFSHTIFLSNLRVAPLQIAGLGHPATMHAAHMDYVSVEDDFVGDPACFSEKMLRLPK
FT                   DGQPYVPSKLLTNVVPSVPERGDVVNIGVTASAMKINPHFLETCQAIVRTARVPVKFHF
FT                   MTCWNESIDLAYVRKSIYATLPESSVDVYGSLSYPEYLKILNTMDMFVSPFPFGNTNGI
FT                   VDSFTMGLPGVNLCGREVFEHIDSGLFERAGLPSWLTTYSTDEYVRAAARLAEQHDERE
FT                   ALRRRLIDGKAVERIFEGRPEAFGEGVLKLLNGLGEK"
FT   gene            complement(464317..465546)
FT                   /locus_tag="Bphyt_4405"
FT   CDS_pept        complement(464317..465546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4405"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0724 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4405"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18781"
FT                   /db_xref="InterPro:IPR011201"
FT                   /db_xref="InterPro:IPR031321"
FT                   /db_xref="UniProtKB/TrEMBL:B2TFB0"
FT                   /protein_id="ACD18781.1"
FT                   /translation="MKTFHCNHCSHLVFYENVRCERCESLLGYVPEVAEISAFEDAGEG
FT                   RWRSLHPGAEGALFRQCHNYAVENVCNWMIPADSPDQLCRACQLTLTIPNLSAPDNRLY
FT                   WYRLEMAKRRLLYTLAELGLDVKSRQVDPEHGLAFEFLEDGGDGSRVMTGHDNGLITLN
FT                   IAEADDAHREKVRTAMGEPYRTLLGHFRHETGHYYFSQLVENNPRWLEPFRKLFGDESV
FT                   DYGEALNAYYRDGAPAEWQASFISAYATMHPWEDWAETWAHYMLIVDVLDTSTSYGVAL
FT                   LPDDPSEPTLTDRTPVEDASFENLMKRWFPLTYALNSLNRSLGMPDGYPFTLAAPVVEK
FT                   LRFVHRVIQAAGDKSQPREAATPPGQAAVAPVQEAAAPQQQPVASEPPPLQPAPVAAQT
FT                   APAKRATRRR"
FT   gene            465882..469355
FT                   /locus_tag="Bphyt_4406"
FT   CDS_pept        465882..469355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4406"
FT                   /product="transglutaminase domain protein"
FT                   /note="PFAM: transglutaminase domain protein;
FT                   transglutaminase domain protein; KEGG: bxe:Bxe_B0725
FT                   transglutaminase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4406"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18782"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR013589"
FT                   /db_xref="InterPro:IPR018667"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:B2TFB1"
FT                   /protein_id="ACD18782.1"
FT                   /translation="MSIRVALHHVTHYRYDRLVSLSPQVVRLRPAPHCRTPILSYSMRV
FT                   EPAEHFINWQQDAFANYQARLVFPEKTREFKVTVDLVAEMAVYNPFDFFLEPSAEQFPF
FT                   EYSPGLALELAPYRVKRPMTPRFAEFVASIDRTPAATADFLVGLNQRLQREIRYLIRME
FT                   PGVQTPEETLVSAAGSCRDSGWLLVETLRQLGLAARFVSGYLLQLAPDVKSIDGPSGTE
FT                   VDFTDLHAWCEVYLPGAGWIGLDPTSGLLAGEGHIPVACTPEPGSAAPISGAVDESEVE
FT                   FEHTMSIERVLETPRVTKPFSEAVWADVLKMGAQVDRQLQDMDVRLTMGGEPTFVSVRD
FT                   RDAAEWNTDALGPTKRGYAVALMDKLRSRYGANGFLHIGQGKWYPGEQLPRWAMSLYWR
FT                   ADGEPCWHDPSLFADEREPGTYTAADAQRFLAHLANKLSLDTDCIQPGFEDVWYYLWRE
FT                   RRLPVNVDPFDARLDDELERVRLRRVFDAGLGGATGYVLPLARERDVPGEAPQWVSGRW
FT                   FFRDERMFLIPGDSPMGYRLPLDSLPWVSKTDYPYQHAHDPFAPPVPLRPAAQLRMQYD
FT                   GEQRSMSPADARRAAALSSSAADLLSGMPGSGVLAYARQPGDEAPPERGQSSKETIRTA
FT                   ICVEARDPKRAAGPKAETEAFGSGRTLLHVFMPPLTELDDYLDLLAAVEATAAELRMQV
FT                   VLEGYPPPRDARLKILQVTPDPGVIEVNIHPAANWDQLVDHTEYLYQSAAQSYLSSEKF
FT                   MTDGRHTGTGGGNHFVLGGATPADSPFLRRPDLLASLIAYWHNHPSLSYLFSGLFIGPT
FT                   SQAPRIDEARNDQVYELEVAFRELQRQIDMLGGRDSASLPAWMIDRSLRNILIDVTGNT
FT                   HRAEFCIDKLYSPDGPTGRLGLLELRGFEMPPHARMSLVQQLLLRALVARFWHTPYTQR
FT                   LTRWGTELHDRFLLGTFVKMDFDDVLGELNRAGFAFDSSWFAPHFEFRFPLVGETTVNG
FT                   VSLTIRNALEPWHVMGEEGSPGGTVRYVDSSVERLEVRALGLNDNRHVLTVNGVPVPLQ
FT                   PTGRVSEYVAGVRFRAWSQPSALHPTIGVDAPLTFDLVDTWAGRSVGGCQYHVAHPGGR
FT                   NYQTFPVNAYEAESRRRARFFASGHTPGPLTVDAPHRSLEFPFTLDLRYW"
FT   gene            469385..472021
FT                   /locus_tag="Bphyt_4407"
FT   CDS_pept        469385..472021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4407"
FT                   /product="protein of unknown function DUF404"
FT                   /note="PFAM: protein of unknown function DUF403; protein of
FT                   unknown function DUF404; protein of unknown function
FT                   DUF407; KEGG: bxe:Bxe_B0726 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4407"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18783"
FT                   /db_xref="InterPro:IPR007296"
FT                   /db_xref="InterPro:IPR025841"
FT                   /db_xref="UniProtKB/TrEMBL:B2TFB2"
FT                   /protein_id="ACD18783.1"
FT                   /translation="MAFQSTFPFETSAARADASSLLRLLPAHEGHWDELRDASGALREP
FT                   WRQFFERLGEDGIARLDDHLASVARQIRDNDISYNVYADNGEPRPWALDLLPFLISEEE
FT                   WAHIERGVTQRAHLLNAIVADIYGPQTLLERGQLPPALVFGHPGYLRSVKGYAPPGGQF
FT                   LQVVAVDLARTPDGDWTVMAHRTEAPSGLGYALENRLIVSTLFADPFRALRVSRLAPTY
FT                   SQLIATLVQAAQATMRHESDGADHSPHIALLTPGPFSETYFEHVFLARYLGVTLVEGKD
FT                   LTVRDDKLYLKTLAGLERVHVVLRRLDDAFCDPVELRADSSIGVPGLLQVMRAGNVIVS
FT                   NVPGSGFVESPALHGFLPGIAEVLLDEDLVLPSVATWWCGEEAAREHAFRRLDEAFIVP
FT                   TWPVAGRDAPPGVEQGRQRLSTWRERIEAMPDTYTIQQAQRFSCTPRYEDGTVGRRPSV
FT                   LRVYAIADVNGGWHVMPGGFTRMAAERQATVSMQYGGSSVDTWVLSSQPTSTFTLLPSP
FT                   MQPADLARKHRTVSSRAAENLFWAGRYGERAENNVRLLRLILGSLEGNDADAMFPTLVE
FT                   LALYCGLVQSGDMFAPHSPQAFERALVANLIESTGAASIGQNLTSQARSNGEVRGRLSN
FT                   DHWRTILAARNDFRDALQMLMPAPGYSNGSSSSQGNGNGRGERYERYDRVTLMSALEHL
FT                   SVQLSAISGAQGDRMTRDEAWRLLFVGRHIERVSAMTSFLRVVADKGQLSTPAGFDLLL
FT                   QLFDSTLTYRSLYPGRFEVPALLDLLVIEPTNPRGIYGVYERLRKKLDEIAVAAGSTRH
FT                   RPFAELMAPTDVLPTLESLCEVDENGTYANLIAVCDQIAGFVGAAGHEISARYFSHAST
FT                   VASQVWS"
FT   gene            472018..472908
FT                   /locus_tag="Bphyt_4408"
FT   CDS_pept        472018..472908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4408"
FT                   /product="transglutaminase domain protein"
FT                   /note="PFAM: transglutaminase domain protein;
FT                   transglutaminase domain protein; KEGG: bxe:Bxe_B0727
FT                   transglutaminase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4408"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18784"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR013589"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:B2TFB3"
FT                   /protein_id="ACD18784.1"
FT                   /translation="MKHTPTVLSVSHRTTYRYSTFVETAQHLATIRPIACSWQRVVSHS
FT                   EKIEPEPSYMNSRIDAFGNDVLYFALDAPHERLQLVSETTVALMPRWTDLDPEATPAWD
FT                   DVADALRFRVGGRFRPEAEFCFASPNIVPRPSLRDYALPSFPPGMPVAAGAIDLMHRIH
FT                   EDFAYKPSATMFDTPAERAFELKSGVCQDFAQVMIGCLRSLGLPARYVSGYLRNDPPPG
FT                   QPRLIGADASHAWVSVYCPGSGWIDLDPTNDVLADMDHVTLAIGRDYSDVSLLRGMILG
FT                   GGAHRVEVGVTVLAL"
FT   gene            473096..473845
FT                   /locus_tag="Bphyt_4409"
FT   CDS_pept        473096..473845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4409"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="PFAM: regulatory protein ArsR; regulatory protein
FT                   IclR; Transcriptional regulator IclR; KEGG: bxe:Bxe_B2051
FT                   transcriptional regulator, IclR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4409"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18785"
FT                   /db_xref="GOA:B2TFB4"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2TFB4"
FT                   /protein_id="ACD18785.1"
FT                   /translation="MNTEQGVTGAERVLLVLAALASHGKAMSVKELLAVTGLAQSTLYR
FT                   QIALLKRWGFVAENAGHYAPGPISLQLALGFDVNSLLVEASRSEMQRLARASQESIGLV
FT                   VAVKHQVMCLEMVDSQHSLRCSFEKGRAVALKAGASAKSLLAFMADKARTEVLDNLFND
FT                   DPAGRVAIEARLEQIRAQGYAVSDSEVDPGVWGVSAPIFHRSGRGAGSGASITLMAPST
FT                   RAVGRESQFIDGTLRTARAISERMQTD"
FT   gene            473921..474676
FT                   /locus_tag="Bphyt_4410"
FT   CDS_pept        473921..474676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4410"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="PFAM: extracellular solute-binding protein family 3;
FT                   SMART: ionotropic glutamate receptor; KEGG: bxe:Bxe_B2050
FT                   ABC polar amino acid family transporter, periplasmic ligand
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4410"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18786"
FT                   /db_xref="GOA:B2TFB5"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:B2TFB5"
FT                   /protein_id="ACD18786.1"
FT                   /translation="MKLQRLLSLACVTVAVTFAGFSGAASAQTPDVLNVATDATFPPME
FT                   YTENGARTGFDVDLMNALAKAMGKKVQWTDIDFKGLIPGLIAHRFDAAISGIYITDERA
FT                   KVVDFTDSYYAGGLVVLVKSNSPIKSVEELNGKKVSVQVGTKSVNFLRDNFPQINRVEV
FT                   EKNQEMFDLVGIGRADAAVTGKPAAYQLVKTRGGFRVLDKPLTTEAYGIAVRKDEPQLK
FT                   AAFNTALAKIKADGTYAAIVKKWFGATAQ"
FT   sig_peptide     473921..474004
FT                   /locus_tag="Bphyt_4410"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.992 at
FT                   residue 28"
FT   gene            474694..475362
FT                   /locus_tag="Bphyt_4411"
FT   CDS_pept        474694..475362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4411"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: bxe:Bxe_B2049 ABC
FT                   polar amino acid family transporter, inner membrane
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4411"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18787"
FT                   /db_xref="GOA:B2TFB6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B2TFB6"
FT                   /protein_id="ACD18787.1"
FT                   /translation="MELDFSPVIAGLPDILHGAVVTVEVTAASLALSCVLGLLIGIGRL
FT                   TPKRRIVYGFCTAYLTFFRGTPLLVQLFLLFFGLPQFGILLPAFVCGMLGLGLYSAAYV
FT                   SEIVRGAIQSVDRGQMEAARSIGMSSGQAMRAIILPQAIVRMIPPLGNEFIALIKNSAL
FT                   VSLLTIDDLMHEGQKIISVSYRSLEVYLAIALVYLVLTQATNYALHRVERHLRAGGMVQ
FT                   "
FT   gene            475359..476135
FT                   /locus_tag="Bphyt_4412"
FT   CDS_pept        475359..476135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4412"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: reh:H16_A0045 ABC-type transporter, ATPase component:
FT                   PAAT family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4412"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18788"
FT                   /db_xref="GOA:B2TFB7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:B2TFB7"
FT                   /protein_id="ACD18788.1"
FT                   /translation="MNTVTNLSEPIVSIRGLTKSFGSHTVLNGIDFDIQPQQVVVVIGP
FT                   SGSGKSTFLRCCNGLEQAEGGTIDICGHRLVDQGEMLKERSLNELRTEVGMVFQSFNLF
FT                   PHLSVLHNITVGPRMLRGASKAEAEAAALALLEKVGLAHKAHVMPASLSGGQKQRVAIA
FT                   RALAMQPRVMLFDEPTSALDPELVGEVLQVMKLLASEGMTMVVVTHEMGFAKEVADVVV
FT                   VMDGGVIVEAGPPAEIFSAPSQPRTRAFLQAVLSRA"
FT   gene            476132..477094
FT                   /locus_tag="Bphyt_4413"
FT   CDS_pept        476132..477094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4413"
FT                   /product="formiminoglutamase"
FT                   /note="TIGRFAM: formiminoglutamase; PFAM:
FT                   Arginase/agmatinase/formiminoglutamase; KEGG: bxe:Bxe_B2046
FT                   formiminoglutamase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4413"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18789"
FT                   /db_xref="GOA:B2TFB8"
FT                   /db_xref="InterPro:IPR005923"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR020855"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2TFB8"
FT                   /protein_id="ACD18789.1"
FT                   /translation="MRVPFDDKMWAGRSDDGEPGDTRRVFNQIVPFDGSLRAHGDTTVV
FT                   VGFGSDEGVRRNQGRTGAAHAPKELRRALAGLPAKNSMAMLADAGDVACDDGDLEGAQA
FT                   ELANVISEVLASGGRPLVFGGGHEVAWATYCGLVLHQHRREADESATPRKLLIINFDAH
FT                   FDLRQKRPANSGTPFDQIANDCAERRVPFNYVCFGISDLGNTASLFVHAQRLGVRYALD
FT                   VDMQETQLPLRLQELDLMLDEADDVYLTIDLDVLPAATAPGVSAPAALGVPLFVVEEMV
FT                   RRVRGSGKLRAADIAEYNPSLDQDRRTARAAARLAYRLL"
FT   gene            477266..477688
FT                   /locus_tag="Bphyt_4414"
FT   CDS_pept        477266..477688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4414"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; KEGG: bxe:Bxe_B0734
FT                   transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4414"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18790"
FT                   /db_xref="GOA:B2TFB9"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2TFB9"
FT                   /protein_id="ACD18790.1"
FT                   /translation="MNRPISYDECNCFALRQAARHVTQIYERHLGEVGLTAAQFTILAK
FT                   LARVPNLPMVDLADAMVMERTTLVRAMKPLQRDGLVAAEAAEHDGRTFLFSLTKKGETT
FT                   FDQAAIAWRAAQDEFEKKFGHARAKTLRAELFSITG"
FT   gene            477770..478192
FT                   /locus_tag="Bphyt_4415"
FT   CDS_pept        477770..478192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4415"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; protein of unknown
FT                   function UPF0074; KEGG: bxe:Bxe_B0735 transcriptional
FT                   regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4415"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18791"
FT                   /db_xref="GOA:B2TFC0"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2TFC0"
FT                   /protein_id="ACD18791.1"
FT                   /translation="MERFFDDDCFAIRQAARYVSQIYDRHLANVGLTITQFSLLGRLKR
FT                   TGPMTMKQLAETMRMERTTLVRTIQPLRRNGLVSSEALGADARALTIALTLAGEERLKA
FT                   GGEHWHAAQAEFEHRFGERRAAALRGELFAITRDSI"
FT   gene            478283..479383
FT                   /locus_tag="Bphyt_4416"
FT   CDS_pept        478283..479383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4416"
FT                   /product="secretion protein HlyD family protein"
FT                   /note="PFAM: secretion protein HlyD family protein; KEGG:
FT                   bxe:Bxe_B0736 MFS multidrug efflux pump, membrane fusion
FT                   protein, EmrA subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4416"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18792"
FT                   /db_xref="GOA:B2TFC1"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:B2TFC1"
FT                   /protein_id="ACD18792.1"
FT                   /translation="MSTTPSTIAPPSAAQTAKPARRIPWMLLAVITVLAVLALAASYWF
FT                   FVGRFVETTDDAYVGGDVTVMAPKVNGFVTDVLVHDNQFVHANDVLIRLDARDYDARLA
FT                   QATAEVQSAQASVTELQAKKSLQLATINEQAAEVRASGAELTRSAADQTRYRELVKDDA
FT                   VSNQVVERADADLTKAHAAVDRSSAALIAAQRQIAVLDAQIGDAEARIATAQAAQRVAA
FT                   LNVEYTTIRSPIDGYVGNRTARVGLLANTGVSLLTVVPSSGLWIDANFKEDQLKKMRVG
FT                   DSVDVDLDASSTPIHGVVESLAPATGATFSVLPAENATGNFTKIVQRVPVRVRLDVPKS
FT                   MQGVLRPGLSATVKVHLDSGDTPARG"
FT   sig_peptide     478283..478405
FT                   /locus_tag="Bphyt_4416"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.983) with cleavage site probability 0.978 at
FT                   residue 41"
FT   gene            479391..480962
FT                   /locus_tag="Bphyt_4417"
FT   CDS_pept        479391..480962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4417"
FT                   /product="drug resistance transporter, EmrB/QacA subfamily"
FT                   /note="TIGRFAM: drug resistance transporter, EmrB/QacA
FT                   subfamily; PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bxe:Bxe_B0737 major facilitator superfamily (MFS) multidrug
FT                   efflux pump, EmrB/QacA subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4417"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18793"
FT                   /db_xref="GOA:B2TFC2"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2TFC2"
FT                   /protein_id="ACD18793.1"
FT                   /translation="MTQVLANPADLPTRIKVLAFTLMCVGFFMATLDIQIVASSLKDIG
FT                   GGLSASQDELSWVQTSYLIAEILVIPMSGWLTRVFSTRWVFAFSALGFTVTSMLCGLAW
FT                   DINSMILFRGLQGALGAAMIPTVFTTAFVLFPGKQRLIASTTISALATLAPTIGPVIGG
FT                   WITSQWSWHWLFYLNLVPGLAVTLLVPKYVHFDNVDLSLLKKGDYLGILLMSGFLGCLE
FT                   YVLEEGPRKNWFGDHVILTCAWITAICGFLFLVHAFTAKEPIVDLRALAIRNFGIGSLL
FT                   SFITGIGIFCAVFLTPVFLSRVRGFDSLQIGVALLSVGCFQLVAMVVYSVVARFIDMRI
FT                   LLVFGLVLFGVGCYLYVPLTNQWGWHELLIPQALRGIGQQFCIPPIVTMALGSLPMSRL
FT                   RSASGLFNLMRNLGGAIGIAVSSTMLNDRLNLHYERLDEHLNVGRPVVESILQQQSAHF
FT                   AAVGGNVLNAANAGLGELHALLMREALVLTFSDTFFALSLCFLVGLFSVLFSRPFGNTA
FT                   PPPDAH"
FT   gene            480973..482406
FT                   /locus_tag="Bphyt_4418"
FT   CDS_pept        480973..482406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4418"
FT                   /product="RND efflux system, outer membrane lipoprotein,
FT                   NodT family"
FT                   /note="TIGRFAM: RND efflux system, outer membrane
FT                   lipoprotein, NodT family; PFAM: outer membrane efflux
FT                   protein; KEGG: bxe:Bxe_B0738 MFS multidrug efflux pump,
FT                   outer membrane lipoprotein, NodT family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4418"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18794"
FT                   /db_xref="GOA:B2TFC3"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:B2TFC3"
FT                   /protein_id="ACD18794.1"
FT                   /translation="MKPILVKVLASAALLTLAACAVQPETHADLPQTVKTVAPAAWNVD
FT                   APQDSVSANAWWDQFGDPVMHQLVESVLTGNLDVQAAVERVRQAQDLAKQNRAALLPEL
FT                   NASATASDSRQNTPPPLGYVRQAGVGLTASWTPDVFGGERLAVLAAQAQVSGRQSALNE
FT                   VRLALAANTAAAYIDLRWAQSQLQILSDNEQIRARALKLTQQRLHYGLSTQLDVARAQN
FT                   QLQDLQAQIPRVQSAVQHQLSLIAVYSGRTPESVDSLLLANARDIPVPAQSVPQMLPSE
FT                   ALLQRPDVRTAYATVEQRAAEVGVSKAQRYPQFRLNLADGLLASSYLGLPTLTDNLFSA
FT                   ALNATSPIFNAGRITANIDASESRMRESQLGLQQTMLQALKEIEDNRSDLVSGAVQVQR
FT                   LGGALDASNQALHLSSELYKGGAADFLDVLTAQEAYLRDAESLNQAKREHALSAVALYR
FT                   SLGGGWDVPDAVTAVSSSN"
FT   sig_peptide     480973..481038
FT                   /locus_tag="Bphyt_4418"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.764 at
FT                   residue 22"
FT   gene            482477..483664
FT                   /locus_tag="Bphyt_4419"
FT   CDS_pept        482477..483664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4419"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.9"
FT                   /note="KEGG: bxe:Bxe_B0739 thiolase; TIGRFAM: acetyl-CoA
FT                   acetyltransferase; PFAM: Thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4419"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18795"
FT                   /db_xref="GOA:B2TFC4"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:B2TFC4"
FT                   /protein_id="ACD18795.1"
FT                   /translation="MANQREVVICNPVRTPIGAFGGALKEVPATTLGAVAVRETLRRSR
FT                   LDAAELASVVMGNVIQAGNKMNAARQASIGGGVPVAVPALTVNRVCGSGAQAIASAAQE
FT                   ILLGLGDAAVAGGMENMDRAPYLLDGGRWGYRMGNAQIHDSLLRDGLNDAFSGEHSGWH
FT                   TEDLVAQFDITRETQDRWAARSQQRFSEAQARGDFDAELVGVEIAGRKGPQHFTRDEQP
FT                   RPDTTVETLAKLRPAFRPDGTITAGNAPGLNSGAAAMLVAERGFAEARGIAPLARLVSY
FT                   GVAAVEPGMFGLGPVPAVQMALARAGWQLHDVERFEINEAFAAVPIAVARKLGIADELI
FT                   NVRGGAIAHGHPIGATGAVLTTRLLHSMQRDGIKRGIVTLCIGGGQGIALALEML"
FT   gene            483861..485138
FT                   /locus_tag="Bphyt_4420"
FT   CDS_pept        483861..485138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4420"
FT                   /product="nucleoside transporter"
FT                   /note="TIGRFAM: nucleoside transporter; PFAM: Na+ dependent
FT                   nucleoside transporter; nucleoside recognition domain
FT                   protein; Na+ dependent nucleoside transporter domain
FT                   protein; KEGG: bxe:Bxe_B0740 concentrative nucleoside/H+
FT                   symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4420"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18796"
FT                   /db_xref="GOA:B2TFC5"
FT                   /db_xref="InterPro:IPR002668"
FT                   /db_xref="InterPro:IPR008276"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="InterPro:IPR011657"
FT                   /db_xref="InterPro:IPR018270"
FT                   /db_xref="UniProtKB/TrEMBL:B2TFC5"
FT                   /protein_id="ACD18796.1"
FT                   /translation="MALIVRNILGIAVLLLIAFIFSTNRRAIRLRTVISALLVQIGIGA
FT                   FILFVPFGKSILSGAASAVNHVLGYGNAGIEFLFGGLVQAKMFQVFGDGGFVFAVRVLP
FT                   AIIFVTALISVLYYLGVMRWIVIVLGTVFQKLLGVSKIESFSAVTTIFLGQSEMPAVVK
FT                   PFTAEMTGAELFAVMSSGMAAVAGSVLAGYAGLGVRIEYLLAASFMAVPGGLLFAKIIH
FT                   PSTEPSRVHLENLNFDEKRPANIIEAASSGATVGLKIAVMVGAMLIAFVGLIALLNGIV
FT                   GGVGGWFGHPQLSMQSVLGVIFAPLAYLIGVPWNEATIAGNFLGQKVILNEFVAYASLS
FT                   PYLKDAASVSAAGLAALDPRTIAILSFALCGFANFSSIAVLTGGFSAVAPARRAEVARY
FT                   GLRVVLAATLSNLMSATIAGMFITLN"
FT   sig_peptide     483861..483944
FT                   /locus_tag="Bphyt_4420"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.652) with cleavage site probability 0.634 at
FT                   residue 28"
FT   gene            485154..485543
FT                   /locus_tag="Bphyt_4421"
FT   CDS_pept        485154..485543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4421"
FT                   /product="cytidine deaminase"
FT                   /note="TIGRFAM: cytidine deaminase; PFAM: CMP/dCMP
FT                   deaminase zinc-binding; KEGG: bxe:Bxe_B0741 cytidine
FT                   deaminase, homotetrameric"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4421"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18797"
FT                   /db_xref="GOA:B2TFC6"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR006262"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:B2TFC6"
FT                   /protein_id="ACD18797.1"
FT                   /translation="MNMEQLLERAGVAREKAYAPYSKFKVGAALLTKDGQVFDGCNVEN
FT                   ASYGLCNCAERTAFFSAIAAGYQRDQFAALAVIGDTDGPIAPCGACRQVIIELGGPELP
FT                   IRLGNLHGATRDTTAREQLPDAFYL"
FT   gene            485540..486505
FT                   /locus_tag="Bphyt_4422"
FT   CDS_pept        485540..486505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4422"
FT                   /product="Inosine/uridine-preferring nucleoside hydrolase"
FT                   /note="PFAM: Inosine/uridine-preferring nucleoside
FT                   hydrolase; KEGG: bxe:Bxe_B0742 putative inosine-uridine
FT                   preferring nucleoside hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4422"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18798"
FT                   /db_xref="GOA:B2TFC7"
FT                   /db_xref="InterPro:IPR001910"
FT                   /db_xref="InterPro:IPR023186"
FT                   /db_xref="InterPro:IPR036452"
FT                   /db_xref="UniProtKB/TrEMBL:B2TFC7"
FT                   /protein_id="ACD18798.1"
FT                   /translation="MSRHKVIYDTDPGVDDAMALVFQALHPDIELLGLTSVFGNATIAT
FT                   TTRNARFLAGRFAAGVPVAQGAAAPLKRTAPEPLAWIHGDNGLGNIALDTTDEAPLDAR
FT                   PAHRFIIDTVRAHPGEVTLLAVGPLTNLALALADDPQIATLVKQVVIMGGAFGTDGVLG
FT                   NVTPAAEANILADPHAADIVFGAAWPVAIVGLDVTQPTIMSREYLASLRERGGAAGQFV
FT                   WEVSRHYEAFHEQSAQLAGIYVHDSSAVAYVLAPHLYTTRSGPVRVLTDGIAVGQTIQK
FT                   PSTMPVPAPAWDSRPDCKVCIGVDVPGMLALYERTICGTL"
FT   gene            486725..487660
FT                   /locus_tag="Bphyt_4423"
FT   CDS_pept        486725..487660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4423"
FT                   /product="2-dehydropantoate 2-reductase"
FT                   /EC_number="1.1.1.169"
FT                   /note="KEGG: bxe:Bxe_B0743 ketopantoate reductase
FT                   ApbA/PanE; TIGRFAM: 2-dehydropantoate 2-reductase; PFAM:
FT                   Ketopantoate reductase ApbA/PanE domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4423"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18799"
FT                   /db_xref="GOA:B2TFC8"
FT                   /db_xref="InterPro:IPR003710"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR013332"
FT                   /db_xref="InterPro:IPR013752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2TFC8"
FT                   /protein_id="ACD18799.1"
FT                   /translation="MRILVVGAGAVGGYFGGRLAAAGQDVTFLVRPGRAEKLKRDGLVI
FT                   SSVRGDLKLPDPQTILAGVSAEPFDLVLLSCKAFSLDDAIDSFAPLVGESTLILPMLNG
FT                   MRHMEVLNEKFGAARVLGGQCVIAATLNAEQHIVHLNDTHAITFGEQAGGASERVQAIA
FT                   EAMGDANFDAVISDNILLRMWEKWVFLATLAGGTCLMRGSVGDILAAPDGKRVIENLLG
FT                   ECRAVAEHNGFTMGPDFDARATQTLFTPSPLTASMLRDVENHSHTEADHILGDLISRGG
FT                   DAQKGEHGLSLLRIAYSHLKTYEARQARTS"
FT   sig_peptide     486725..486790
FT                   /locus_tag="Bphyt_4423"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.954) with cleavage site probability 0.307 at
FT                   residue 22"
FT   gene            487728..488027
FT                   /locus_tag="Bphyt_4424"
FT   CDS_pept        487728..488027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4424"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0744 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4424"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18800"
FT                   /db_xref="GOA:B2TFC9"
FT                   /db_xref="UniProtKB/TrEMBL:B2TFC9"
FT                   /protein_id="ACD18800.1"
FT                   /translation="MPTPIGSVPALSAASATIFSIGIVFLGYWGLYEPIQWRAADVFVF
FT                   VFALIGFGCLGLVPWVATSPVEPEGSDSRIRIARHLFLAGVAGIWLAVAMSVIF"
FT   gene            complement(488114..489160)
FT                   /locus_tag="Bphyt_4425"
FT   CDS_pept        complement(488114..489160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4425"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: bxe:Bxe_B0745 ABC polyamine/opine/phosphonate uptake
FT                   family transporter, periplasmic ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4425"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18801"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:B2TFD0"
FT                   /protein_id="ACD18801.1"
FT                   /translation="MKLFKTLAALAALCAFGAAAPAWSQTKTIYIGMNGGPMEKAYTSQ
FT                   VLPDFEKANNVKVVVVPGTSSDILAKLLANKANPQIHVVFLDDGVMARAISMGVCKKLD
FT                   DAPVLKELYPFARMKDDMGAGVQLGMTGIAYNKKLFAEKGWAPPTSWMDFADPKYKGKV
FT                   VFQSASSSTFGLHGFLAINRLMGGSEQNVEPGFTKWATTVGPNVVEYVPNSAKISEMVQ
FT                   TGEAGLFPLTPTAVGDLADKGIPVGYVNPKEGPVLLLVDLCVVNNNPDPQLAQKLAQFL
FT                   LSAPAQTKAAEAGRQIPTNRLAKMTPPMQQSLGNIDDLVHKVTVVDWDTINAHRAQWDT
FT                   RWNRQIER"
FT   sig_peptide     complement(489086..489160)
FT                   /locus_tag="Bphyt_4425"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 25"
FT   gene            complement(489193..490320)
FT                   /locus_tag="Bphyt_4426"
FT   CDS_pept        complement(489193..490320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4426"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   bxe:Bxe_B0746 putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4426"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18802"
FT                   /db_xref="GOA:B2TFD1"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B2TFD1"
FT                   /protein_id="ACD18802.1"
FT                   /translation="MSNTLHYDVAIAGGGLVGSSAALALAKRGLRVGLFERRYCGAQAS
FT                   GVNYGGVRCQGRPVEQMPLAIRARRIWDRLPELIGIDGEFTVSGHLRLARSESDLAALQ
FT                   TWADMARDFGLHAQLVSGAAFRQRYPWLGPAAVGGSLCATDGHANPRLVSPAFARAARA
FT                   AGADVREQTELTDIHHDGTRFQLRAGDLRVSADWLINSAGAWANTVAGYFGETAPMKPI
FT                   YPNMWVTEPLPLFITHNLGVYGGGIYARQVARGNCVIGGGRGHGDGEYGQPSTDTTRAV
FT                   MRDACALLPALREALLIRTWSGVEGETPDSNPIIGASRTVPRLLHAFGFSGGGFLLAPG
FT                   VGEVLADLVADGATVTPLDAFSIGRFAAVATSPVA"
FT   sig_peptide     complement(490246..490320)
FT                   /locus_tag="Bphyt_4426"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.967) with cleavage site probability 0.784 at
FT                   residue 25"
FT   gene            complement(490313..491746)
FT                   /locus_tag="Bphyt_4427"
FT   CDS_pept        complement(490313..491746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4427"
FT                   /product="BFD domain protein (2Fe-2S)-binding domain
FT                   protein"
FT                   /note="PFAM: BFD domain protein [2Fe-2S]-binding domain
FT                   protein; FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: bxe:Bxe_B0747 pyridine
FT                   nucleotide-disulphide oxidoreductase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4427"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18803"
FT                   /db_xref="GOA:B2TFD2"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR017224"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:B2TFD2"
FT                   /protein_id="ACD18803.1"
FT                   /translation="MSDERRIVIVGAGPAGVRAAETLVAAGVKPIVIDENARWGGQIYR
FT                   QPPANGGFERSKKTLYGFEAHKAEALHSTMAALLPHLDYRPDTLAWACEAGRLDTLHAG
FT                   RELRVPFSHLIIASGATDRVLPVPGWTLPGVYTLGAAQVALKAQGCAIGRRVVLAGTGP
FT                   LLYLVAYQYVKAGAQVVAVLDTSPFSQQIAAAPKLARLPGTFAKGLYYVGWLKTHGVRI
FT                   ERDVTLVGIRGVDGVQALEWRASREGSPTETIACDAVGVSFGLKPETQLADLAGCRFRF
FT                   DATNRCWLPEVDPAGRSSVRGLYLAGDGAGIAGADAAELAGRRAALALLDDLGIAHPRG
FT                   AGMPDAASIERSLKRIAVFREGIETAFAPPANCASQWPDDMTVCRCEEIDAGTLRRCIR
FT                   GGEANEINRLKALTRVGMGRCQGRMCGEAALTLLAEETGKPLDAVGRLRSQPPVKPIPL
FT                   APEMYADDLAEIPAEARDE"
FT   gene            complement(491743..492129)
FT                   /locus_tag="Bphyt_4428"
FT   CDS_pept        complement(491743..492129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4428"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bam:Bamb_5373 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4428"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18804"
FT                   /db_xref="GOA:B2TFD3"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR042204"
FT                   /db_xref="UniProtKB/TrEMBL:B2TFD3"
FT                   /protein_id="ACD18804.1"
FT                   /translation="MSSSDHALMPSTLPSTQNAASQFIRLAETRREPLHFFIDGQEVAA
FT                   LQGDTLLTAVLMQQRRVRESEFSGAPRAGFCLIGACQDCWMRTEDGKRVRACSTPVTEG
FT                   MRVLTRIAAVVTSAGAADENGEAR"
FT   gene            complement(492129..492923)
FT                   /locus_tag="Bphyt_4429"
FT   CDS_pept        complement(492129..492923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4429"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bxe:Bxe_B0748 ABC
FT                   polyamine/opine/phosphonate uptake family transporter,
FT                   inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4429"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18805"
FT                   /db_xref="GOA:B2TFD4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B2TFD4"
FT                   /protein_id="ACD18805.1"
FT                   /translation="MRKNGPIALIFHTLVIAFVLAPLVIVVLVAFTPDETLTLPTHGVS
FT                   LRWFRAILNYPDFIGAFFNSLKLAFASATLSLIVALPAALAIGRARFPGRSFLNGLLLS
FT                   PLVIPGLVLGIALLRFFALIGATGSFAWLVLAHMIIITPFVMRLVLASVSGLDRSIEHA
FT                   AHSLGADPWTTFRRITFPMILPGITGGWLLAFINSFDELTMSIFVTSPQTVTLPVRMYM
FT                   YATESIDPMMASVSALVIFITGGAMLLLDRVYGLNRILIGQH"
FT   sig_peptide     complement(492831..492923)
FT                   /locus_tag="Bphyt_4429"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.828) with cleavage site probability 0.801 at
FT                   residue 31"
FT   gene            complement(492963..493877)
FT                   /locus_tag="Bphyt_4430"
FT   CDS_pept        complement(492963..493877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4430"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bxe:Bxe_B0749 ABC
FT                   polyamine/opine/phosphonate uptake family transporter,
FT                   inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4430"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18806"
FT                   /db_xref="GOA:B2TFD5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B2TFD5"
FT                   /protein_id="ACD18806.1"
FT                   /translation="MASTLPAADNPDMKSGNVRRAPWHAFLPLWLMCAPAFLLFVALVL
FT                   VPLLMTLVLTFYRFDPASGPIAAFQFGNYAEVLSSSYYHTIFLRTFGIAFLVTLLCIVI
FT                   GTPEAYVLSRMRDPYRSMFLLVILAPLLVSVVVRAFGWSMLLNTNGLVNQAFGLVGLGP
FT                   YKLEYTTFAIVIALVHVMLPFMVIPVWTALQKLDPQTENAALSLMASPATTLRRIVLPQ
FT                   LTPGILSGSLMVFGLSASAFAIPGLLGGRRLKVAATAVYDEFLGSLNWPLGATIALLLL
FT                   VANLIVMLTYYRVLERKYTRSLG"
FT   gene            complement(493870..494961)
FT                   /locus_tag="Bphyt_4431"
FT   CDS_pept        complement(493870..494961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4431"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; TOBE domain protein;
FT                   Transport-associated OB domain protein; SMART: AAA ATPase;
FT                   KEGG: bxe:Bxe_B0750 ABC polyamine/opine/phosphonate uptake
FT                   family transporter, ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4431"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18807"
FT                   /db_xref="GOA:B2TFD6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2TFD6"
FT                   /protein_id="ACD18807.1"
FT                   /translation="MSFLTLTDVTKSFGDLQAVADVNLSVEKGEFVSLLGPSGCGKTTT
FT                   LQMIAGFVETTHGRITLDGRDITHMKPNKRGLGIVFQSYALFPHMSVADNVGFGLEMRN
FT                   IDKAERKERIREALSLVRLDTLAHRFPRELSGGQRQRVALARAIVIAPPVLLLDEPMSN
FT                   LDAKLREDMQFELRGIQRKIGTTTIMVTHDQSEALSISDRVVVMEAGRITQIDTPYEAY
FT                   ERPENRFVSQFIGKANMLPGTVVARDGDAIRIDLGHDLAETGHTAQLPARERVVGVGDA
FT                   VTLCIRPEKLRLCAPNAGRVPATVTSRFFLGSQWLYRLDSRLGEVLVCCQNEGTEPLPE
FT                   GATVGVDWNSEAIRFIQRDAHHG"
FT   gene            495265..496143
FT                   /locus_tag="Bphyt_4432"
FT   CDS_pept        495265..496143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4432"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="PFAM: regulatory protein IclR; Transcriptional
FT                   regulator IclR; KEGG: bxe:Bxe_B0751 transcriptional
FT                   regulator, IclR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4432"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18808"
FT                   /db_xref="GOA:B2TFE1"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2TFE1"
FT                   /protein_id="ACD18808.1"
FT                   /translation="MNPAAKRDTHPDTADTGSAPGPGMLERAFAVIRALSEAQPDGGRV
FT                   TRLAKAVGLTQGTVHRILHALIAEGIVEQDESSKLYRLSVDFFALAAQAGNPSGMRTLC
FT                   RPALLRLCASLGDTIFLLVKSSFDAVCLDICEGPFPIRSFTGDIGGRVALGVGQGSLAI
FT                   LAFLPEAEREEIIRFNVPRIRGYGVLDEVYLRTEIERVRQLGYAGRNSGVLDGMAGVAV
FT                   PILDRTGVAVAALSVGTLAARLGDDRLPMVVELLRRQADAIGPQTNPFDVALRRPMHGL
FT                   SRAMTTERITG"
FT   gene            complement(496195..497784)
FT                   /locus_tag="Bphyt_4433"
FT   CDS_pept        complement(496195..497784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4433"
FT                   /product="outer membrane porin"
FT                   /note="PFAM: outer membrane porin; KEGG: bxe:Bxe_B0752
FT                   outer membrane porin for cationic amino acids and peptides"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4433"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18809"
FT                   /db_xref="GOA:B2TFE2"
FT                   /db_xref="InterPro:IPR005318"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="UniProtKB/TrEMBL:B2TFE2"
FT                   /protein_id="ACD18809.1"
FT                   /translation="MKDTRSKNRSKKTGAATFFYCAFTLPALTLAANAYADDGVTEPTS
FT                   EASKTQTVAQTLSSPAQLAQTAQPTTTQQNNSSSKRRAEQGGQVRNDQPDTTNAIVNAE
FT                   ASQTVTPPAPPSSQAASKGFIADSHLNLQFRNYSDYFQAPNTIYRHAWVQGAQANFESG
FT                   YTQGLIGFGIDASLFGALKLDGGNGAGNMVHVGKDGGGSQQLAWAYPGMYDIKGRISET
FT                   VVKYGLQDVTNPFLEPHDNRALPPTFLGVSMVSNDLAHTELQAGSFTKVDARGHTNLTN
FT                   LTTSYGGTRIDRLTYVGGTWHYAKNGEMALYVDQADDVWRQYYGSVAQSFGDPTTIKWS
FT                   GLANIYSTHDTGASRQGHINSNAYSVSVSAQHGPHALLLGYQQVLGDQFFDYVNETNGI
FT                   YLTNSMDVDYNAPHEQSLQLRYTFDGKYAGVPGLKAMFWGQYGWGADASAGAAENASPS
FT                   APLHDLYWKNGEPVHGHHHEFGFIPSYTLQSGRFKDTKVTFIAMWHNSQYHYSDGNNME
FT                   YRLVVNVPVKVF"
FT   sig_peptide     complement(497674..497784)
FT                   /locus_tag="Bphyt_4433"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.887 at
FT                   residue 37"
FT   gene            complement(497961..498986)
FT                   /locus_tag="Bphyt_4434"
FT   CDS_pept        complement(497961..498986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4434"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="KEGG: bxe:Bxe_B0753 ABC oligopeptide/dipeptide
FT                   transporter, ATPase subunit; TIGRFAM:
FT                   oligopeptide/dipeptide ABC transporter, ATPase subunit;
FT                   PFAM: ABC transporter related; Oligopeptide/dipeptide ABC
FT                   transporter domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4434"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18810"
FT                   /db_xref="GOA:B2TFE3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2TFE3"
FT                   /protein_id="ACD18810.1"
FT                   /translation="MNTTSLANQDAATLLRVDNLKVQFGVPRGGFPWSGKATLRAVDGV
FT                   SFNVRRGETVGLVGESGCGKSTLARAIIGLAPVASGSVRWLGDETVLPGARRNTSRLRR
FT                   DVQMIFQDPLASLDPRMTIEQIVSEPLTTHGQDVARADVQRRVLTMLERVGLNAQHLRR
FT                   YPHEFSGGQCQRVGIARALIGEPQLVICDEPVSALDVSIQAQIVNLLRDLQRELSLSLL
FT                   FVAHDLAVVKAISHRVLVMYLGRVMEFGDKREVYGTPRHPYTRALLSAVPVPDPVVERA
FT                   RRHLLLRGEIASPLNPPSGCAFRTRCPDAIDACAREIPQPVTHGARATRVACIRVEDTV
FT                   R"
FT   gene            complement(498983..499981)
FT                   /locus_tag="Bphyt_4435"
FT   CDS_pept        complement(498983..499981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4435"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="KEGG: bxe:Bxe_B0754 ABC oligopeptide/dipeptide
FT                   transporter, ATPase subunit; TIGRFAM:
FT                   oligopeptide/dipeptide ABC transporter, ATPase subunit;
FT                   PFAM: ABC transporter related; Oligopeptide/dipeptide ABC
FT                   transporter domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4435"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18811"
FT                   /db_xref="GOA:B2TFD7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2TFD7"
FT                   /protein_id="ACD18811.1"
FT                   /translation="MPLLEVKDLSVRFTRREGAPVDAVQGVSFSLEAGRTLGIVGESGS
FT                   GKSQTVMALLGLLAGNGKVSGSATYRGENLLTMNEASLNKIRGDRIGMIFQDPMTSLNP
FT                   FLTIERQMTETLQLHRKMSRREARRRAIETLESVRIPDAARRIGMYPHEFSGGMRQRVM
FT                   IAMALLSEPEILIADEPTTALDVTVQAQIIELLRELNRERGTAIILITHDMGVVAGLCD
FT                   DVMVMYAGQTVEQASAAALFAAPTHPYTLGLLNALPRLTDDDDDRPLQTIPGNPPLPGE
FT                   VGAGCAFAPRCGYCTERCRESRPPLAASADHVDALRACHRPVGEILEAQHV"
FT   gene            complement(499983..500897)
FT                   /locus_tag="Bphyt_4436"
FT   CDS_pept        complement(499983..500897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4436"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bxe:Bxe_B0755 ABC
FT                   oligopeptide/dipeptide transporter, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4436"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18812"
FT                   /db_xref="GOA:B2TFD8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B2TFD8"
FT                   /protein_id="ACD18812.1"
FT                   /translation="MPRSIQSTAAALDPLAAIARAPRSRGPLATAAWRFVRNRAAFAGF
FT                   VVLMLIVIACVAGPWLLPNNPIDSDWSAISLPPTLQNMHWFGTDELGRDLLARTLQGGR
FT                   VSLEVGLLGTLVSGLIGVAYGATAGYLGGRVDAVMMRIVDMMYAIPYMLIAILMMTMFG
FT                   RAFYLVVLTISAFSWLDMARVVRGQTLSLRSREFIDAARAIGVSSGSIIARHIVPNLFG
FT                   VVVVYASVTVPNIVLTESVLSFLGLGVQEPMTSWGVLIQDGAQKLESMPWLLLCPAVML
FT                   CVTLYCVNFVGDGLRDAFDPKDR"
FT   gene            complement(500901..501839)
FT                   /locus_tag="Bphyt_4437"
FT   CDS_pept        complement(500901..501839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4437"
FT                   /product="Nickel-transporting ATPase"
FT                   /EC_number="3.6.3.24"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bxe:Bxe_B0756 ABC
FT                   oligopeptide/dipeptide transporter, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4437"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18813"
FT                   /db_xref="GOA:B2TFD9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B2TFD9"
FT                   /protein_id="ACD18813.1"
FT                   /translation="MLAYTLRRTLWAIPTILAVITACYLLLHLTPGGPFDTEKQLSAAV
FT                   LANLNAKYHLDEPLWLQYLHYLGSLLHGDLGPSFRYADWSVNDLVWKALPVSLGVGGVS
FT                   VPIALVIGVALGTVAAVRRDRFVDHFVMVLGNLGNVVPPFVLGPVLVWIFAILLKTSEG
FT                   HGWLPAGGWGEGEWRYRVLPIVLLTIINVAAIARVMRGSMIEVLSGNFIRTARAKGLPG
FT                   RTIVLRHAMKPALMPVVSLLGSICISSITAAVVTESVFALPGLGQLVVNGAINRDYTLV
FT                   LGLVVLTTAVAVLFNLLVDLAYAWLDPRIRY"
FT   gene            complement(501857..503473)
FT                   /locus_tag="Bphyt_4438"
FT   CDS_pept        complement(501857..503473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4438"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: bxe:Bxe_B0757 ABC oligopeptide/dipeptide transporter,
FT                   periplasmic ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4438"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18814"
FT                   /db_xref="GOA:B2TFE0"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:B2TFE0"
FT                   /protein_id="ACD18814.1"
FT                   /translation="MKTPFVYTTALAALVLTFAPSAFAVTVPPGVTLAASQEMTRQVPG
FT                   ETESLDPAHIESWTGNTIGLDLFEGLTRMDASGAIVPGVAESWSRSGPNTWVFKLRHDA
FT                   RWSNGQPVTASDFVYSWQRVLDPKTGSKYTVLVEFVKNAKAILAGKAPLSSLGVRAVDP
FT                   YTLEVTTEVPATFFPQLTAMATMTPVNRAVVTKFDGDWTRPGNFVGNGPYALTDWQPSN
FT                   RLVATKSPTYWNNGKVVITKVTYLPIENDETAMRMYQAGQFDYTYSIPSGVYSQVSKQF
FT                   GPELKTGLQIATYYYSLNNDDPAFKDKRVRQALAMVLDRDLLTKRLTADGEVPMYGLIA
FT                   KGTEGSGVFTPEWANWPMAKRVDYARNLLKTAGYSDAKPLTFTLTYNTNDLHKKVALFA
FT                   TSEWRTKLGVTAKLENVEYKVLLKQRHDGKVQASRDGWFVDYNDANSFFDLIRCNSVQN
FT                   DQHYCNPQVDKLIDEGNQQLDDAKRTALFTQAHDLAMNDYPVVSLFQYSADRLVKSYVG
FT                   GYKPTNYLDMRATQDMYLTKH"
FT   sig_peptide     complement(503399..503473)
FT                   /locus_tag="Bphyt_4438"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 25"
FT   gene            complement(503655..504227)
FT                   /locus_tag="Bphyt_4439"
FT   CDS_pept        complement(503655..504227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4439"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; protein of
FT                   unknown function DUF861 cupin_3; Cupin 2 conserved barrel
FT                   domain protein; KEGG: bxe:Bxe_B0758 transcriptional
FT                   regulator, XRE family with cupin sensor domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4439"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18815"
FT                   /db_xref="GOA:B2TE23"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE23"
FT                   /protein_id="ACD18815.1"
FT                   /translation="MVTTIQKSNPALEIGSKIRALRQRLKRTLDDTATAAGISKPFLSQ
FT                   VERGLASPSITSLAGIAHALGVTVQYFVDTPSEERCVSRGDQLKFFGFADSANLFARLT
FT                   NLTGGRQLEAILVRMPPGQKRSEVTTHAGEEFVYVIDGEVSLTLEGKTFVLHAGDSAHY
FT                   ESTVPHSWVNTARIESVVVWVGTPRLF"
FT   gene            505151..506692
FT                   /locus_tag="Bphyt_4440"
FT   CDS_pept        505151..506692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4440"
FT                   /product="amino acid/peptide transporter"
FT                   /EC_number="3.1.3.1"
FT                   /note="KEGG: bxe:Bxe_B0759 major facilitator superfamily
FT                   (MFS) peptide/H+symporter, POT family; TIGRFAM: amino
FT                   acid/peptide transporter; PFAM: TGF-beta receptor type I/II
FT                   extracellular region; major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4440"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18816"
FT                   /db_xref="GOA:B2TE24"
FT                   /db_xref="InterPro:IPR000109"
FT                   /db_xref="InterPro:IPR005279"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE24"
FT                   /protein_id="ACD18816.1"
FT                   /translation="MNSTTPAGARVSQTRSFSTVFLIEMWERFGYYGMAALLVLFMIDK
FT                   LQFTDSHATLTWGAFTALVYASPSIGGWIGDKILGARRTMIFGAGVLSVGYFMLALPND
FT                   QLAYMYASLGVIVVGNGLFKANAANLVRRIYEGDDARIDSAFTIYYMAVNIGSTVSMLA
FT                   TPWIKDHWGWHTAFAVCCAGMLLSMLNYFIMFRTLAHIGSAPDAEPVRWKRVGAVALGG
FT                   LALGAATMFVLQHKAIAVACVYTAGVAILAIFGYMLMKCERSERSGLVAALILTAQVIL
FT                   FFVFYVQMSTSLTLFALRNVDPRFILFGQTWFTWSAAQFQALNPIWIMLLSPLLALLYT
FT                   KLAKSGKDVPVAVKYAFGFAVVAAGFFVYAASGNYAVNGRVSSWFMVGGYGLYSLGELL
FT                   VSGLGLAMIARYVPARMSGFMMGAYFVATGVSQYLGSVVANFAQMPAGDMDPLESLPLY
FT                   TKLFTGLGWLAAVGALVAVLLLPLMRKLSREHQRCSDEARESARQTAALNGAVAE"
FT   gene            506911..508383
FT                   /locus_tag="Bphyt_4441"
FT   CDS_pept        506911..508383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4441"
FT                   /product="transcriptional regulator, GntR family with
FT                   aminotransferase domain"
FT                   /note="PFAM: regulatory protein GntR HTH; aminotransferase
FT                   class I and II; KEGG: bxe:Bxe_B0760 transcriptional
FT                   regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4441"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18817"
FT                   /db_xref="GOA:B2TE25"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE25"
FT                   /protein_id="ACD18817.1"
FT                   /translation="MEIHIAVEGHHDLSGQIYRQLRAGILEGRLAGGTRLPSTRELATQ
FT                   LGVSRKTTLDVFERLLSEGYLSARGGSGTFVADGLERLPVERSAHARAAESSRERARAK
FT                   AAARAQPLWDEMPESLPLPKPSVASPQDFVGGATDKTLFPFDIWRRCVNHALRAQARGP
FT                   GIYRDTAGEQELRLAISRYLAFNRAVSSNWEDVIVTQGAQHALDLLARISLRAGEVAAI
FT                   EDPAYLPAHACLKATGARVVPVPVDAEGLIVSKLPDKARLVYVTPSHQFPLGMPMSLER
FT                   RVELLEWAQKRGAVIIEDDYDCEYRFEGRPMEPLKSLDRAGLVAYVGTFSKTIFPELRV
FT                   GYVVPPASLYGPLIKARQIGDWHGCTLTQTALASFMLNGEFAKHLRRMHKTYAARRAML
FT                   LDHLHGGLAPWFEPIVPTAGIHMAARLKAPLTEEAVVSAAREASIGLYGLAPFYVRAKP
FT                   QPGLMFGYGNIAVEHIDAALTKLAGILPRLTQ"
FT   gene            508898..509350
FT                   /locus_tag="Bphyt_4442"
FT   CDS_pept        508898..509350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4442"
FT                   /product="histone family protein DNA-binding protein"
FT                   /note="PFAM: histone family protein DNA-binding protein;
FT                   KEGG: bxe:Bxe_B0762 Bph2"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4442"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18818"
FT                   /db_xref="GOA:B2TE26"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE26"
FT                   /protein_id="ACD18818.1"
FT                   /translation="MPTSAKKVAKKAAAPVPAKKVAAKKVPAKKAVAAKKVAVKASSAP
FT                   APIKDTFTKASLAAHVAERAAVEPKTAKAVLAALEDTILGAVHKKGAGEFTLSGLLKIV
FT                   VQAVPAKKKRFGKDPFSGEERWFPAKPASVRIKARPLKKLKDAAAG"
FT   gene            509755..511164
FT                   /locus_tag="Bphyt_4443"
FT   CDS_pept        509755..511164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4443"
FT                   /product="protein of unknown function DUF404"
FT                   /note="PFAM: protein of unknown function DUF404; protein of
FT                   unknown function DUF407; KEGG: bxe:Bxe_B0763 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4443"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18819"
FT                   /db_xref="InterPro:IPR016450"
FT                   /db_xref="InterPro:IPR025841"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE27"
FT                   /protein_id="ACD18819.1"
FT                   /translation="MRCYDEMRHHDDAVRPHYARFERWLVKQGNEAIARKRAEADLLFR
FT                   RVGITFAVNGDLSGTERLIPFDLIPRIIPRGEWQTLEAGLRQRVQALNLFIHDVYHDRN
FT                   IVRAGIVPAEQVYTNAQYRPEMQGVNVPLGVYAHIAGVDVVRAGDEGEFYVLEDNLRVP
FT                   SGVSYMLENRKMMMRLFPELFVQNRIAPVAHYPDLLLDTLRSVAPEGVDDPVVVVLTPG
FT                   MYNSAYFEHTFLAQQMGVELVEGKDLFVDDNYVFMRTTQGPKRVDVIYRRVDDDFLDPL
FT                   AFRNDSALGVPGLLTAYRAGRVALANAMGTGIADDKSIYPYVPEMIEFYLGEKPILNNV
FT                   PTFQCRKPDDLAYTLAHLPELVVKEVHGAGGYGMLVGPASTKAEIESFRERLIARPAGY
FT                   IAQPTLALSACPTFVEAGIAPRHIDLRPFVLSGKTVTMVAGGLTRVALQEGSLVVNSSQ
FT                   GGGTKDTWMVD"
FT   gene            511329..512279
FT                   /locus_tag="Bphyt_4444"
FT   CDS_pept        511329..512279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4444"
FT                   /product="protein of unknown function DUF403"
FT                   /note="PFAM: protein of unknown function DUF403; KEGG:
FT                   bxe:Bxe_B0764 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4444"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18820"
FT                   /db_xref="InterPro:IPR007296"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE28"
FT                   /protein_id="ACD18820.1"
FT                   /translation="MLSRTADHLFWMARYMERAENTARMLDINLKALLLPQTPDQEARA
FT                   QRSVLRISELETAFAQRHDEPTRENVLDFMVADATNPSSIHSCLQAARENARAVRGTLT
FT                   TEWWETINDTWLEFNERASSGQAASNPGALFEWVKFRSHLSRGVTIGTALQDDAFFFTQ
FT                   LGTFLERADNTARILDVRFADVEPNSRDAARQLEDFYYWTSILSSVSALEIYRKVYRDV
FT                   VTPARVVELMILNQQMPRSLLASLEGVCVNLAMLRTSGSNQCERFAGKLRAELVYSDIR
FT                   QIFEAGLHAYLTQFLARVFELGNLVARTYLMLPVA"
FT   gene            512292..513092
FT                   /locus_tag="Bphyt_4445"
FT   CDS_pept        512292..513092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4445"
FT                   /product="transglutaminase domain protein"
FT                   /note="PFAM: transglutaminase domain protein;
FT                   transglutaminase domain protein; KEGG: bxe:Bxe_B0765
FT                   transglutaminase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4445"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18821"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR013589"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE29"
FT                   /protein_id="ACD18821.1"
FT                   /translation="MYLTIRHDTSYRYEATVHYSIQQLRLTPASGASQVVRRWAIDAPG
FT                   KLDATFDAYGNVLHTLVINKPHSEIRLHVAGEVDTIPLIDGHLPDAVGPIPLEHFTCST
FT                   RLTEADAAVRELAESVPSLSSSANLIALAEQIVQRVKYNTGITEVTSTAAEALALGNGV
FT                   CQDHAHLMLACCRARGIPARYVSGYIEPGEVTHGASHAWVDVWVDGKGWISIDVTHAAF
FT                   ASELYCRLAVARDYEAAAPVRGRRIGGLEEQLKVSVTVSGQQSQ"
FT   gene            513266..514138
FT                   /locus_tag="Bphyt_4446"
FT   CDS_pept        513266..514138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4446"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0766 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4446"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18822"
FT                   /db_xref="InterPro:IPR016545"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE30"
FT                   /protein_id="ACD18822.1"
FT                   /translation="MTYCVAMSVDDGLVFLSDTRTNAGVDHISTARKMSVFEQPGERML
FT                   TLLGAGNLSLTQAVLHELSEPTDPSLPTLWNAPTMADAARVIGRAVRCVHQREAEALQE
FT                   FGVDFNCSFILGGQIAGNRPRLFMIYAAGNFIEASAVNPYFQIGEAKYGKPIIDRVLTP
FT                   STPLDEAAKCALISMDSTLRSNLSVGLPLDLLVYQKDTLHVTRFVSIDHDNAYFEMIHR
FT                   TWGERLRQVFGEIPDPDWQESPNVPLLQRERALVLHRAPVGADGIEHELDAKPAQTLAQ
FT                   AERGKAQRK"
FT   gene            complement(514363..515544)
FT                   /locus_tag="Bphyt_4447"
FT   CDS_pept        complement(514363..515544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4447"
FT                   /product="porin Gram-negative type"
FT                   /note="PFAM: porin Gram-negative type; KEGG: bxe:Bxe_B0768
FT                   outer membrane porin, OmpC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4447"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18823"
FT                   /db_xref="GOA:B2TE31"
FT                   /db_xref="InterPro:IPR001702"
FT                   /db_xref="InterPro:IPR002299"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE31"
FT                   /protein_id="ACD18823.1"
FT                   /translation="MKRIALSTLSLALLSATGVAHAQSSVTLYGLIDESIQYAHNTVDT
FT                   NGKNSNQVGLVGGNLQGPRFGLKGTEDLGGGLKAIFQLENGFDVNTGKLGQGGRMFGRQ
FT                   AYVGLTGDQWGTFTLGRQYDPLVDLVQPLTADNYFGSTFTTPGDVDNNDNSSRTNSAIK
FT                   YTSPVWSGFQFEGMYALGGVAGATGSGQSWSGAATYATGPFSVAAGYFRLDNGNTLASR
FT                   TSAGAVGWNGSTSDGTFDNQVNGAYAAAKSIGIASVAVQYVAGPFTANLRYSNAQYKPD
FT                   ANSGFGSTEKYNIGGAYLGYQATPAMLVGVGYIYTKASGDSSATYHQVSLGGDYNLSKR
FT                   TDVYLVGAYQHASGQQRTSGGGLVDAGAAIGSYGYNSASSSQELVSLGIRHKF"
FT   sig_peptide     complement(515476..515544)
FT                   /locus_tag="Bphyt_4447"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 23"
FT   gene            complement(515963..517294)
FT                   /locus_tag="Bphyt_4448"
FT   CDS_pept        complement(515963..517294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4448"
FT                   /product="ribonuclease BN"
FT                   /note="PFAM: ribonuclease BN; KEGG: bxe:Bxe_B0769
FT                   ribonuclease BN"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4448"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18824"
FT                   /db_xref="GOA:B2TE32"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE32"
FT                   /protein_id="ACD18824.1"
FT                   /translation="MDIDTLSAENLQQVARKQANWAIGAFKQFAENRCAAMAASIAFYA
FT                   AFSLAPTLVMVIAVAGWFFGAEAARGELFNHIHGLLGDQAAAGVQTIVENAHHSGSAGG
FT                   IAAVISLVTLVIGASATFSSLNSALNIVWPNTGPRSSSVIALVRVRLISFGLVLGVAFL
FT                   LIVSLVLDTVITFVGKWLWGDSPYIVIGNLLQLGVGLLVLAFAFAGLLKFLPDARVRWR
FT                   DAFVGGIVAAVLFSAGKKLFALYLAHAGMATSFGAAGSLAVLLMWLYFSAAVLLLGAEF
FT                   SAARGRMHDPRGGWGMQNDTPPGSRAKLASVLAASTVAADAVPHADAQANGRAASDDAT
FT                   RSPALRAAKAVALDGAAPPATFRARAENRPSARATALKVGRTVVLAEAQATRIAAVTLI
FT                   EASRKAVAADRYVRRHPWTSVLFAATAGLAAAMVTRRHTGNNER"
FT   gene            517568..518107
FT                   /locus_tag="Bphyt_4449"
FT   CDS_pept        517568..518107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4449"
FT                   /product="YbaK/prolyl-tRNA synthetase associated region"
FT                   /note="PFAM: YbaK/prolyl-tRNA synthetase associated region;
FT                   KEGG: bxe:Bxe_B0770 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4449"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18825"
FT                   /db_xref="GOA:B2TE33"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE33"
FT                   /protein_id="ACD18825.1"
FT                   /translation="MHSHELVQRLDVIAAEQLGAHLPAHVVEQLPAQGVTVFSVTDDAS
FT                   DTAAFSERYGFGLEDCANTIVIRYKKEGAEHYAAVVSLGSLRLDINGAVKAALGAQRLS
FT                   FAKREAAVEHSGMEFGGITAFGLPDDWRILVDAAVMERTQIVMGAGVRAAKLLLSPDVL
FT                   RQWPRCEVAALTLPAE"
FT   gene            518424..519983
FT                   /locus_tag="Bphyt_4450"
FT   CDS_pept        518424..519983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4450"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; Cache type 2
FT                   domain protein; KEGG: bxe:Bxe_B0771 methyl-accepting
FT                   chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4450"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18826"
FT                   /db_xref="GOA:B2TE34"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR033480"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE34"
FT                   /protein_id="ACD18826.1"
FT                   /translation="MERFRLKVRLWLALAVMCMGILAIGLWGAFKTRDTMIADRQAELK
FT                   SVVSVAYSVLDRYNGLVAAGSMPLADAQRTAMADLRAMRYDGAGGYLVIEDAHARVLMH
FT                   GVRADLEGKDMSGFTDPQGRHVFKDGSDLAQREGEGFIHLQFLKPGSNEMAPKINYVRL
FT                   YKPWDWTIVTGVFTDDIDAAFYTTLVQYVGAALLLCLVVSLVIGVILRSILRQLGGEPA
FT                   YAAQIAARIADGELDVIVDTKAGDDTSLLAAMQRMQQRLAHAITQIRGGATLISTVSNE
FT                   IAAGNADLSRRTEQQATALGETASSMEQITATVKQNADNAKQASQLAHNASETAARGGE
FT                   VVDQVVETMRGISQSSHRIGDIIGVIEGIAFQTNILALNAAVEAARAGEEGRGFAVVAG
FT                   EVRSLAQRSAAAAKEIKTLIEESAAQIEGGSQYVSRAGETMHEVVQAVRRVTDIMGEIS
FT                   AASVEQSSGIEQVNIAVASMDQTTQQNAALVEEASASADVLKAQTGQLSAAIAVFTLPE
FT                   TR"
FT   sig_peptide     518424..518510
FT                   /locus_tag="Bphyt_4450"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.956) with cleavage site probability 0.654 at
FT                   residue 29"
FT   gene            complement(520014..520460)
FT                   /locus_tag="Bphyt_4451"
FT   CDS_pept        complement(520014..520460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4451"
FT                   /product="response regulator receiver protein"
FT                   /note="KEGG: bxe:Bxe_C0361 response regulator receiver
FT                   domain protein(CheY)"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4451"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18827"
FT                   /db_xref="GOA:B2TE35"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE35"
FT                   /protein_id="ACD18827.1"
FT                   /translation="MTRRVSLDDETEFAIWKRRSTADSGPSHRILIGHRDKAIGESLVL
FT                   SLSLKGYEAIYAADLIKVQSFLKWWKPHAVLLDTRLDSVSSYEFARAARAERSNADVLI
FT                   LAMSNVWPLDPVSLLKDAGFDGHCRRPCSLWRVADILEHHFARQ"
FT   gene            complement(520622..522109)
FT                   /locus_tag="Bphyt_4452"
FT   CDS_pept        complement(520622..522109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4452"
FT                   /product="sulphate transporter"
FT                   /note="PFAM: Sulfate transporter/antisigma-factor
FT                   antagonist STAS; Xanthine/uracil/vitamin C permease;
FT                   sulphate transporter; KEGG: pfo:Pfl_3557 sulphate
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4452"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18828"
FT                   /db_xref="GOA:B2TE36"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE36"
FT                   /protein_id="ACD18828.1"
FT                   /translation="MNTARPSHGWLATLPGIKSNVLAGLTSSFALVPECIAFALVAHLN
FT                   PLMGLYGAFSICAITALFGGRPGMISGAAGSMAVVIVALVVQHGAQYLLATVILSGILM
FT                   VLFGALRLGKLIRMVPHPVMLGFVNGLAIIIAMAQLAHFRQSTPQGEQWLHGSALLLMC
FT                   GLVALTMAIVYLLPRLTRAAPPALVAIVGVGLFTQWLHVPTRTLGDMAHIAGGLPGLHM
FT                   PDVPLNLDTLHVVLPYAVLMAVVGLLETLLTFNLTDEITETRGQPNRECLALGAANIAS
FT                   GLFGGMGGCAMIGQTMINLNSGGRSRLSGIVSGVMILMYILFLSPLIERIPLAALVGVM
FT                   FVVAQQTFAWGSLRVLGKVPRNDALVIVAVTIITVFSDLAIAVLCGIVIAAFNFAWQHA
FT                   REIHAHVEDRAGDKTYAPRGTLFFASTTRFHELFDPVKDPARVTVDCRDLLLADHSALA
FT                   ALQGLVERYRKAGKELRMKNLSDRNKRLLSRAGIALA"
FT   gene            complement(522379..522969)
FT                   /locus_tag="Bphyt_4453"
FT   CDS_pept        complement(522379..522969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4453"
FT                   /product="putative lipoprotein"
FT                   /note="KEGG: bxe:Bxe_B0772 putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4453"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18829"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR007461"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE37"
FT                   /protein_id="ACD18829.1"
FT                   /translation="MRRRQFIMTTSAALATAGLGLAGCTTTSPSSSASPSANAGKRDSI
FT                   NAGVDSTLSRLYENVTGSRELVAKARGVLVFPNVISAGFWIGGQYGEGALRVGGRTAGY
FT                   YSTVAGSFGLQIGAQSKALIFLFMTQEALDKFTSSQGWAAGADATVALLKVGANGAVDT
FT                   STATSPVEAFVLTNGGLMAGVSLEGTKVSRLMI"
FT   sig_peptide     complement(522868..522969)
FT                   /locus_tag="Bphyt_4453"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.730 at
FT                   residue 34"
FT   gene            complement(523184..524572)
FT                   /locus_tag="Bphyt_4454"
FT   CDS_pept        complement(523184..524572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4454"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="PFAM: FAD linked oxidase domain protein;
FT                   Berberine/berberine domain protein; KEGG: bxe:Bxe_B0773
FT                   putative FAD/FMN-containing oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4454"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18830"
FT                   /db_xref="GOA:B2TE38"
FT                   /db_xref="InterPro:IPR006093"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR012951"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE38"
FT                   /protein_id="ACD18830.1"
FT                   /translation="MVNVSSSAVDELKTAMRGQVLLPGDAAFDEARSIWNAMIDRHPAI
FT                   ILRCAGVADIRQGVAFARDNGLPLAIRGGGHNIGGSALCNDGVVLDLSQMKSVQIDPTA
FT                   RRAYVEPGATLHDFDHEAQAFGLATPLGINSTTGVAGLTLGGGFGWLSRRYGMTVDNLV
FT                   SADVVTAEGELVHASADSHEDLFWAIRGGGGNFGVVTRFEFALHPVGPLVYGGLVVLPI
FT                   EQARDALLKYRAANATMPKELSVWAVLRLAPPLPFLPPEVHGKPVIVFAMCYTGAVESG
FT                   PSTVEFVRAFGTPLGEHLGPMPYVMWQQAFDPLLTPGARNYWKSHNLVDIPDGLIDALL
FT                   RSIDNLPSPQCEIFFGQIGKQTQSVPVEATAYSSRNTVYAMNVHGRWDDASDDARCVGW
FT                   ARAFFDAAAPFALGSVYVNFMTEEEGGRVADAYGPNYERLVAVKNRYDPRNLFRHNQNI
FT                   RPSA"
FT   gene            complement(524924..525685)
FT                   /locus_tag="Bphyt_4455"
FT   CDS_pept        complement(524924..525685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4455"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: ajs:Ajs_3977
FT                   3-ketoacyl-(acyl-carrier-protein) reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4455"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18831"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE39"
FT                   /protein_id="ACD18831.1"
FT                   /translation="MLLSEQWVLVTGGARGLGAAITRALVREGASVVVNYRNSETSALA
FT                   LKDEFGDRVLPLRADVTDAAAVVRLFDKAQTRTGQPIVSVVNNALADFQFDGDARPKID
FT                   SIAWARFQQQLDGSLKGALNTIQTAVTGMRSRGFGRIVNVGTNLFQNPVVPYHDYTAAK
FT                   AALLSLTRTAAHDLGPDGITVNMVSGGLLRTTDASAATPEFVFELIASSTPVRRVTTPE
FT                   EFADAVLFFLSPWSRAVTGQNLIVDGGLVKG"
FT   gene            525714..525911
FT                   /locus_tag="Bphyt_4456"
FT   CDS_pept        525714..525911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4456"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4456"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18832"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE40"
FT                   /protein_id="ACD18832.1"
FT                   /translation="MLVLSPETEFAPGPCDGAYSANEFRKGVAADPMTECFYSLDGFVR
FT                   CSGWQVIMAQVNSPGVAPSV"
FT   gene            526814..527866
FT                   /locus_tag="Bphyt_4457"
FT   CDS_pept        526814..527866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4457"
FT                   /product="putative membrane glycoprotein"
FT                   /note="KEGG: bxe:Bxe_B0776 putative membrane glycoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4457"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18833"
FT                   /db_xref="GOA:B2TE41"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE41"
FT                   /protein_id="ACD18833.1"
FT                   /translation="MAVVTAVVTAEPAQAAMAAAPAGMEVTAAMAVTVATAAVMVMAIM
FT                   GTTVIMVTTAMAVIMVTAVMAMAATVMETVATAMADMETAVMAMEAMATGTAVMVTVAT
FT                   ETVAMAMVAMAMAVMETAVMAMAVMAMAVTVMAVMVTVVTVMAVMVTVVTAMAVTATAA
FT                   TATAATETVAMVMVVTATAVTETAVMVMVVTAMAVTATAATETVAMVMVVTETAVMLMV
FT                   VMVMVVTAMAATETAATATAATAMAVMAMAVTATAATATAATETVAMVMVVTATAVTET
FT                   AAMAMAARAETVLVQAALATVAMERVAMEKAATAMAAMAETVLARAVPAMVVTATVATA
FT                   TAAREEAVPA"
FT   gene            527879..529039
FT                   /locus_tag="Bphyt_4458"
FT   CDS_pept        527879..529039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4458"
FT                   /product="putative membrane glycoprotein"
FT                   /note="KEGG: bxe:Bxe_B0776 putative membrane glycoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4458"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18834"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE42"
FT                   /protein_id="ACD18834.1"
FT                   /translation="MAVLAQGARGMAAAVVSATAARAAAVRAQVALATAVLAQVARATA
FT                   VTAAPVTAAREAAVRAQVALATAVQAQAVLAQAARATAVTAAPATAAREAAVRAQVALA
FT                   TAVLAQAARATAVTAAPVTAAREAAVRAQVAQATAVLAQVARVTAATVATEAPVRAQAQ
FT                   AARAMVATVGRATVARAAAVLAQAARATAATVVPAQAAPATVATVARAQAARAMAAAVA
FT                   PAQAAPATAATVVLAQVATATAVTAARAETAPAQAMEAKATVAASVAALAQAMEASAAA
FT                   SAQAMAAASAATVAATAAVAVATAAATTNEATLLHRTEAGRPASLPMPNGASERLPSAR
FT                   SHRQPRQTGRSETSSKSLVTPLPSPSPAPPEKPSLLRHDRPRAFLQ"
FT   sig_peptide     527879..527950
FT                   /locus_tag="Bphyt_4458"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.962) with cleavage site probability 0.661 at
FT                   residue 24"
FT   gene            complement(528954..529613)
FT                   /locus_tag="Bphyt_4459"
FT   CDS_pept        complement(528954..529613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4459"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: bxe:Bxe_B0777
FT                   putative phosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4459"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18835"
FT                   /db_xref="GOA:B2TE43"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR024173"
FT                   /db_xref="InterPro:IPR026336"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE43"
FT                   /protein_id="ACD18835.1"
FT                   /translation="MKPASLPVEIAGHPVVLSSLRAMFDPALRCLFVADAHFGKDAVFR
FT                   ARGIPVPIGSTADNLMRLDILIAEFEPAMLVFLGDLLHAREAHASETLDALHAWRARHA
FT                   RLRVVLVEGNHDRHAGALPATLEVEYVQEPWRVGPWALCHYPQKVEGAYALAGHVHPVY
FT                   RIATRNDSVRVPCFRFGTACGVLPAFGSFTGGTREDGRVAGEKVFLVVQERVMEVV"
FT   gene            complement(529610..532255)
FT                   /locus_tag="Bphyt_4460"
FT   CDS_pept        complement(529610..532255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4460"
FT                   /product="DEAD/H associated domain protein"
FT                   /note="PFAM: helicase domain protein; DEAD/DEAH box
FT                   helicase domain protein; DEAD/H associated domain protein;
FT                   SMART: DEAD-like helicases; KEGG: bxe:Bxe_B0778 putative
FT                   DEAD/DEAH box helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4460"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18836"
FT                   /db_xref="GOA:B2TE44"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR013701"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR017170"
FT                   /db_xref="InterPro:IPR026362"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE44"
FT                   /protein_id="ACD18836.1"
FT                   /translation="MTEPADSDETTIPAPSAASERRRAPRPRRIPRSREQQARLDAREP
FT                   AFEPQPFSIDENAAQRPFAEKLGEWFEARRWQPFEFQREVWQEIARGASGLLHATTGAG
FT                   KTWAVWFGALAAFAATPSARKRSTLRTQPEPLTVLWITPMRALAADTARALQSSAAELA
FT                   VPWSVGLRTGDTSSAERARQNRRMPSALVTTPESLSLILTRPDAHDVLAHVRLVIVDEW
FT                   HELLGNKRGTQTQLALARLAHWRPELQVWGLSATLGNLSFAGDVLLAPVKTPRVSVHGA
FT                   LPKALIVDTVIPETIERFPWGGHVGMRQVGAVAEAIGEAQTSLVFTNTRSQCEVWYQAL
FT                   LEARPEWAGLIALHHGSLDQEVREWVERGLKSGLLKVVVCTSSLDLGVDFLPVERVFQI
FT                   GSPKGVARLMQRAGRSGHAPGRPSRVTIVPTHALELVEAAAAREAVEKRQIEGRETPEK
FT                   PFDVLVQHLVTVAIGGGFDARELYGEIRSTYAYRQLTQAEFDWALGFVEGGGTALRAYP
FT                   DYHRVVRESDGMYHVPREDLVRRHRNNIGTIVANGTLNVAYLSGGRIGAIEESFISRLK
FT                   PGDIFTFGGRALELIRVQDMTAWVRRATSSRGAMPQWAGSRMPLSSELADATLTMLARA
FT                   ATGIYDEPEMRAVRPLLELQQKWSALPEPGVLVVELVKSREGHHFFCYPFAGRTAHIGL
FT                   GALLAWRVAREKPGTFSISMNDYGFELLSAQPFDWAAQLESGLLSPKELDHDILASLNS
FT                   SELSLRRFREIARVSGLVFQGHPGQQKSARQLQASSALFYEIFRNHDRGNLLLNQADDE
FT                   VLLQELDARRIRIALERMNASRVVVTRPKKPTPFAFPLIVGRLREKVSTEKLADRVERM
FT                   LAELEKAARV"
FT   gene            532472..533350
FT                   /locus_tag="Bphyt_4461"
FT   CDS_pept        532472..533350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4461"
FT                   /product="Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase"
FT                   /note="PFAM: Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase; KEGG: sma:SAV3194 hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4461"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18837"
FT                   /db_xref="GOA:B2TE48"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE48"
FT                   /protein_id="ACD18837.1"
FT                   /translation="MLNHIQALLPQTSLRIAAAQAQPISGDVTGNIARTVELTALAADA
FT                   GAKLVVFPEKFLTGYEPDLIAGDPAKYAFDAHDARLEPIRDICRQREIAVIVGAATRGE
FT                   RGLHISSLVFSRSGAQLDSYHKQYLYSSETRIYQPGTQGRMLELDGWRLALGVCYDSGF
FT                   AEHARHAAVNGAHAYLVSALFSVQTGYHQSRIWFPARAFDNTMYALLSNHVGTTGGWAT
FT                   CGASAIWSPSGDVIAQASREREEVITALLDPAVLADVRERETMLADFRERDEAVHAIRY
FT                   NEAHYPSGDSL"
FT   gene            533398..533748
FT                   /locus_tag="Bphyt_4462"
FT   CDS_pept        533398..533748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4462"
FT                   /product="peptidylprolyl isomerase FKBP-type"
FT                   /note="PFAM: peptidylprolyl isomerase FKBP-type; KEGG:
FT                   bxe:Bxe_B0780 putative FKBP-type peptidyl-prolyl
FT                   cis-transisomerase signal peptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4462"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18838"
FT                   /db_xref="GOA:B2TE49"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE49"
FT                   /protein_id="ACD18838.1"
FT                   /translation="MAAAPTTEKLPSGVVVEHLTQGTGAQPAAEDVVKVNYRGTLANGT
FT                   EFDSSAKHGGPATFPLNRVIPCWTQGVQKMKVGGKAKLTCPAATAYGDRGVGVIPPNSD
FT                   LTFEVELVGIVK"
FT   gene            533849..534310
FT                   /locus_tag="Bphyt_4463"
FT   CDS_pept        533849..534310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4463"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0781 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4463"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18839"
FT                   /db_xref="InterPro:IPR007438"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE50"
FT                   /protein_id="ACD18839.1"
FT                   /translation="MKRENNAVPVASIGFTGKTAEEFFDLLKNAQVRTVLDIRLSNTSQ
FT                   LAGFAKKQDLPFFLDKLCGAVYREMPELAPEPDLFKRYKANELTWDEFSAAYVELIARR
FT                   RVESNLDVDLFRSACLLCSEHLPHHCHRRLALEYLNSRWNSRLKITHLS"
FT   gene            complement(534358..534669)
FT                   /locus_tag="Bphyt_4464"
FT   CDS_pept        complement(534358..534669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4464"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0782 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4464"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18840"
FT                   /db_xref="GOA:B2TE51"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE51"
FT                   /protein_id="ACD18840.1"
FT                   /translation="MRKGMTGPHDSPVQTFGHYTLTQRTHPVKLDNWKEGASPERRKLI
FT                   RSKLHVLLATIGTLASVVGICVAINGGLEFNRTKVFIGVGITVVSTIVYISMLFAPSD"
FT   gene            534930..536003
FT                   /locus_tag="Bphyt_4465"
FT   CDS_pept        534930..536003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4465"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0783 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4465"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18841"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE52"
FT                   /protein_id="ACD18841.1"
FT                   /translation="MNIDFHYGVVYIAARVAGMTADNAITVAHACQYVDDATTAGILRF
FT                   KGGETFERFATAHKLFDYATTEDDKNRLVWTPFHFLPAAEGSTLHEKAVCRPDSAVARE
FT                   VVRRAILRRDTETGLHRLGVTLHTYVDTWAHQGFAGIESPWNRVHLLEAQDCTRKGWFA
FT                   KLRLASEHLIEHIEEDVLTVALPVGHGAALHYPDQPWAKWHYIDGRNEFVQRHNLPEFV
FT                   QAAEMACRAVRAYLAGRQDFENLPGMPDDVTDVLTDLLNTNRLEDDNDRLRHICRVVKA
FT                   GGIPGLKESIPDYVPKGPGSWKYLATGLKFDDDTGDKPEWTNAFEKSDYRLFHDAVKQH
FT                   RFVTTQEILPTHGLRIA"
FT   gene            complement(536031..536270)
FT                   /locus_tag="Bphyt_4466"
FT   CDS_pept        complement(536031..536270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4466"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bvi:Bcep1808_0035 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4466"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18842"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE53"
FT                   /protein_id="ACD18842.1"
FT                   /translation="MKAGYMRAALAAVALTSAAVGTANAAGCMKGAVVGGVAGHYAGHH
FT                   AVVGAVGGCLVGRHMAKKHAEEQQAAQRQQARVE"
FT   sig_peptide     complement(536193..536270)
FT                   /locus_tag="Bphyt_4466"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.966 at
FT                   residue 26"
FT   gene            complement(536327..536617)
FT                   /locus_tag="Bphyt_4467"
FT   CDS_pept        complement(536327..536617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4467"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bam:Bamb_0017 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4467"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18843"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE54"
FT                   /protein_id="ACD18843.1"
FT                   /translation="MNKKIIGAVFGLAVLAASSAASAHVDVAVGVGIPVGVVAPPPVYV
FT                   ERGPAPVPVVYGGYDDWRAREWRERREWREREWRREHWREHEWRERHWNGY"
FT   sig_peptide     complement(536546..536617)
FT                   /locus_tag="Bphyt_4467"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.933 at
FT                   residue 24"
FT   gene            537221..538072
FT                   /locus_tag="Bphyt_4468"
FT   CDS_pept        537221..538072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4468"
FT                   /product="histone family protein nucleoid-structuring
FT                   protein H-NS"
FT                   /note="PFAM: histone family protein nucleoid-structuring
FT                   protein H-NS; KEGG: bxe:Bxe_B0784 putative histone-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4468"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18844"
FT                   /db_xref="GOA:B2TE45"
FT                   /db_xref="InterPro:IPR001801"
FT                   /db_xref="InterPro:IPR027444"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE45"
FT                   /protein_id="ACD18844.1"
FT                   /translation="MPTLEQIQAKLKKLQAQADVLLARKAQVAVDQIRDLMLKHGLTTA
FT                   DIEAKAKARRAARGLNGGGKAKAVSSGKAVAKYRDHKTGATWTGHGRAPGWIASVKDRT
FT                   QFLIEGASELKSAAKAAVTHAKGSKGQPKGAQPPKYINPKTGATWSGRGPAPAWLASVK
FT                   DRSKFLIDSASAAVADAGHQAAKKAGKVKSAATGGVVSKKAAARKVVAKKAGAAKKTVA
FT                   KKATAATRQVAAKKGAVKPAAKKSAVAKAARKAPARKAAAKKAAATSAPATPAAAPASA
FT                   GA"
FT   gene            538095..538580
FT                   /locus_tag="Bphyt_4469"
FT   CDS_pept        538095..538580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4469"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0785 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4469"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18845"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE46"
FT                   /protein_id="ACD18845.1"
FT                   /translation="MTRTREKTQQEDQVVLLDSVPHPAEDAAEPFIVASDRRVILCYPI
FT                   AESDFESFGPFDPDDDPFCAVLFPDTVFHRLGPPGDGDLEIHPLASQGLTGYSVHEFRN
FT                   SSLASELAAVASTGPTLRHFVITFQASTFECVASDYTVVGVYGAGEIASREAFSLVR"
FT   gene            538727..539989
FT                   /locus_tag="Bphyt_4470"
FT   CDS_pept        538727..539989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4470"
FT                   /product="phospholipase D/Transphosphatidylase"
FT                   /note="PFAM: phospholipase D/Transphosphatidylase; KEGG:
FT                   bxe:Bxe_B0786 putative cardiolipin synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4470"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18846"
FT                   /db_xref="GOA:B2TE47"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR022924"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE47"
FT                   /protein_id="ACD18846.1"
FT                   /translation="MLTIPITAFVTLVIILVIANLSSGEKKIEHKIDRLYASDDPQFLR
FT                   SMGLLLGPPVISGNRFEMLLNGDHIFPSMLEGIRSARRTITFETFIYWSGEIGEQIAQA
FT                   LADKAREGIAVHVLLDWVGSSKMDKRYLDLLRDAGAEVIQYHKPHWTGLGRMNDRTHRK
FT                   LLVIDGHVGFTGGVGIAPEWTGHAQNEKHWRDTHFRVEGPVVGHMQAVFMDNWVKATGN
FT                   VLHGPNYFPDVEPMGEGLAHMFSSSPSGGSDDMQLMYLMAITAATHSIHLASAYFVPDK
FT                   LTINAIVEAAKRGVKVQIIMPGKRIDTHTVREASRACWGDLLRAGVEMYEYQPTMFHCK
FT                   LLVVDEYLVSVGSTNFDSRSFKLNDEANLNIYDRDFAKQQTAVFADDIKKSQQITLEAW
FT                   MHRPLMEKLIEKFVSLLDTQL"
FT   sig_peptide     538727..538798
FT                   /locus_tag="Bphyt_4470"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.651) with cleavage site probability 0.359 at
FT                   residue 24"
FT   gene            complement(540002..540955)
FT                   /locus_tag="Bphyt_4471"
FT   CDS_pept        complement(540002..540955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4471"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bch:Bcen2424_3546 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4471"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18847"
FT                   /db_xref="UniProtKB/TrEMBL:B2T7U5"
FT                   /protein_id="ACD18847.1"
FT                   /translation="MNAFSFACTACGKCCNSPPAMALPELFRHRDRFIGCLAIGRVPRR
FT                   RVGERLRVGRHEAVLDEADIAAFDSIANTLLYRTGDTFSIMTQGYDYPSLARCPALADD
FT                   GRCAIHLNGKPVTCEVVPLDPFVPDALQHLVLAGRNQSASYIGADCIQEGERADAPLLT
FT                   AEGEIKDANARDALARRRSALEREREVWGRAVFDSLRKDLFASPAALARIPPGGFLTIS
FT                   IVPVLLAVASTSARCRQLCLDYIDSQIALIGRNIEQALLRRRLEDRAVTQELRGFAHAY
FT                   QRAKALLGTTLPAMEVESSAPSSLSSIEAYLCGAHR"
FT   sig_peptide     complement(540887..540955)
FT                   /locus_tag="Bphyt_4471"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.827) with cleavage site probability 0.827 at
FT                   residue 23"
FT   gene            complement(540952..541746)
FT                   /locus_tag="Bphyt_4472"
FT   CDS_pept        complement(540952..541746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4472"
FT                   /product="NLPA lipoprotein"
FT                   /note="PFAM: NLPA lipoprotein; KEGG: bmu:Bmul_5128 NlpA
FT                   lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4472"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18848"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:B2T7U6"
FT                   /protein_id="ACD18848.1"
FT                   /translation="MKARRFATAVLLVAASMVQHVQAAAPQVIKVGVSAGAHAEIMDEV
FT                   RRVAASRGLTLDVVVFDQPERIDAALAAKQIDAASFEDEPRFEAQCKQHGFPLTSVATT
FT                   VTFPIALYSRKLTNLGQLQRGATIAIPNDREGTARALILLQNFTLLTFRDTAGLHATLA
FT                   DITSNRLNLQIRQVPRARLFDTLNSVAFAVIDSDDAARAGLYPARDSLGLEDARSPYAN
FT                   VLTVRDAERTQPWVAQLVAAYHSDDVAHFILTRYQDSVRRPW"
FT   sig_peptide     complement(541675..541746)
FT                   /locus_tag="Bphyt_4472"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.935 at
FT                   residue 24"
FT   gene            complement(541743..542828)
FT                   /locus_tag="Bphyt_4473"
FT   CDS_pept        complement(541743..542828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4473"
FT                   /product="protein of unknown function DUF323"
FT                   /note="PFAM: protein of unknown function DUF323; KEGG:
FT                   bmu:Bmul_5129 protein of unknown function DUF323"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4473"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18849"
FT                   /db_xref="GOA:B2T7U7"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR042095"
FT                   /db_xref="UniProtKB/TrEMBL:B2T7U7"
FT                   /protein_id="ACD18849.1"
FT                   /translation="MTVRSKLKSNTALYGVYAAIATVAFATAFTAATAASAVFSGGAKQ
FT                   RAFDELNTSRPLAALGSEQQCARYAGLPARWRDDPKAGMVHLHGGDFVFGSKLGYEDER
FT                   PAGDGKTRVAGFWIDQTDVTNAQFAAFVKATGYVSDSERQGGAVVFHTPTRDEMNARDL
FT                   AWWTWVKGAAWNHPTGPGSTLEGRLNQPVTMVTQADALAYARWLGRDLPTEAEWEYAGK
FT                   AGREGADLDTAPRDGHGKPSANYWQGVFPVLNTNEDGHIGLAPVGCYAANDFKLYDMIG
FT                   NAWEWTKDVYTGPHQSHTNGDTAEVAPLSRKHDTPMVIKGGSFLCSRDYCVRYRAASRE
FT                   QQEADLPASHIGFRTVLRDAS"
FT   sig_peptide     complement(542724..542828)
FT                   /locus_tag="Bphyt_4473"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.581 at
FT                   residue 35"
FT   gene            complement(542836..544782)
FT                   /locus_tag="Bphyt_4474"
FT   CDS_pept        complement(542836..544782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4474"
FT                   /product="sulfatase"
FT                   /note="PFAM: sulfatase; KEGG: bcm:Bcenmc03_3976 sulfatase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4474"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18850"
FT                   /db_xref="GOA:B2T7U8"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024607"
FT                   /db_xref="UniProtKB/TrEMBL:B2T7U8"
FT                   /protein_id="ACD18850.1"
FT                   /translation="MTTPRSQRPSLRLGMIGAAVASLVALASCGDDNLPGPTPTPVVAQ
FT                   KRPNILYIMADDLGYSDIHAFGGEINTPNLDALVQSGRILTNHHTGTVCAITRSMLISG
FT                   TDHHLVGEGTMGVPTDERKGLPGYEGYLNDRALSVAQLLKDGGYHTYMAGKWHIGSGIV
FT                   GSTTGGGQTPDQWGFEHSYALLGGAATNHFAHEPANSHNYTEDGKYVQPGQPGQPGGAG
FT                   GSPAVFYSTDFYTQRLISYIDSNKGDGKPFFAYAAYTSPHWPLQVPEPYLHNYAGKYDA
FT                   GYDAIRNARIARQKALGIIPNDFVPYGGASETLVATAATANNGTVNAKYVSAVHSAAQG
FT                   YTDYGPGTVNKTWASLSPAEKKAQARYMEIYAGMVENLDHNIGLLIQHLKDIGEYDNTF
FT                   IMFQSDNGAEGWPIDSGADPTATDTANAADPVYSALGTDNGKQNAQRLQYGLRWAEVSA
FT                   TPFRLTKGYSGEGGVSTPLIVHLPGQSTQKPTLRDFTHVTDNTATFLAVAQISPPTQAA
FT                   PPLINSLTGVDQNKGKVVYNNRYVYPVTGQSLLPLLNDQATSAVHSASFGDEAYGRGYL
FT                   RSADGRWKALWTEPPLGPVDGHWQLFDMSADRGETQDVSTQNPSVIDGLVQQWNNYMSS
FT                   VGGVEPLRPRGYY"
FT   sig_peptide     complement(544690..544782)
FT                   /locus_tag="Bphyt_4474"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.646 at
FT                   residue 31"
FT   gene            complement(544941..545489)
FT                   /locus_tag="Bphyt_4475"
FT   CDS_pept        complement(544941..545489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4475"
FT                   /product="conserved hypothetical signal peptide protein"
FT                   /note="KEGG: bxe:Bxe_B0787 conserved hypothetical signal
FT                   peptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4475"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18851"
FT                   /db_xref="UniProtKB/TrEMBL:B2T7U9"
FT                   /protein_id="ACD18851.1"
FT                   /translation="MKRSTPLRLASLLICFAVTAIHAHAEPARVNRGHDPFFQISKAIS
FT                   DCPVPLGPLETEKEWLDDSHYRIERGNSCWVEGRCRLSNAYLYDVEIAEAVQRRLTNIN
FT                   FATHWREQSTLWLTLQRRFIYVEGCVAPGFAKQSFLTELAKTADVERVIDDTVTNPHAA
FT                   QLPYKTLANPDKPVLDPGN"
FT   sig_peptide     complement(545412..545489)
FT                   /locus_tag="Bphyt_4475"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.797 at
FT                   residue 26"
FT   gene            complement(545599..546246)
FT                   /locus_tag="Bphyt_4476"
FT   CDS_pept        complement(545599..546246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4476"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: regulatory protein LuxR; response regulator
FT                   receiver; Sigma-70 region 4 type 2; KEGG: bxe:Bxe_B0788 two
FT                   component transcriptional regulator, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4476"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18852"
FT                   /db_xref="GOA:B2T7V0"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:B2T7V0"
FT                   /protein_id="ACD18852.1"
FT                   /translation="MNDASPAIARLILVDDHPLVRDGLRARLEAVRHLEVVGEAGNAQE
FT                   ALALAASAEPHLVLMDVGMNGMNGIALAGMFHERFPAIRVLMLSMHDNLEYVTQAVRAG
FT                   ASGYVLKDSPSTEIIQAIGAVLEGKQFFSAGLGARLIQASAMQSPVERLTPRERDILDA
FT                   LAEGLSSKQIAQRNDLSVRTVETHRLNLKRKLDIEGQAELIKFAVENRRTNR"
FT   gene            complement(546243..547658)
FT                   /locus_tag="Bphyt_4477"
FT   CDS_pept        complement(546243..547658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4477"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase dimerisation and phosphoacceptor region;
FT                   Cache type 2 domain protein; KEGG: bxe:Bxe_B0789
FT                   periplasmic sensor signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4477"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18853"
FT                   /db_xref="GOA:B2T7V1"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR017171"
FT                   /db_xref="InterPro:IPR033480"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B2T7V1"
FT                   /protein_id="ACD18853.1"
FT                   /translation="MKLKAKIVLLAIVPFLAAIASIEVGVQRQATALAETQHASTQAAY
FT                   MASKEIELKHYVELATTAIAPLYDAGQDNARDDATLRARALDVLQKMDFGKDGYFFVYD
FT                   MHGRSLMHPREPDLVGRDLWELRDPQGTLTIQQLLAAAARGGGYVRYLWHRPSTGKVAS
FT                   KLGYVVPLERWGWMIGTGIYLDDVDNTLAHIDERAAANIDRTMKWIDAIAVAGLAVIAL
FT                   CALVLNVTEYRSADAKLKRLAQQVVESQENERARLSRELHDGISQMMVSVKLLLESALA
FT                   RFERSEVRVPAAEAALTTSLTRLGDTLREVRRISHALRPSMLDDLGVAAALEQLSRELS
FT                   EQSGIEIGFTQIAHTHAAALPDAVNTVLFRIAQEALTNIVRHAQATNAALALEISNDGV
FT                   TLNIADNGRGFDVAHAFVGRRSGVGLRNMRERLEALGGTLSLSSQAGHTLVTARVPLGS
FT                   TEPTLPALQETSP"
FT   sig_peptide     complement(547596..547658)
FT                   /locus_tag="Bphyt_4477"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.980) with cleavage site probability 0.743 at
FT                   residue 21"
FT   gene            547915..548112
FT                   /locus_tag="Bphyt_4478"
FT   CDS_pept        547915..548112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4478"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0790 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4478"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18854"
FT                   /db_xref="GOA:B2T7V2"
FT                   /db_xref="InterPro:IPR021741"
FT                   /db_xref="UniProtKB/TrEMBL:B2T7V2"
FT                   /protein_id="ACD18854.1"
FT                   /translation="METSQPAGRSWLWLILLLPYIALLWLPFYNDTRPSFAGFPFFYWY
FT                   QFLWVPLTSLLIYAVYRGVK"
FT   gene            548109..549590
FT                   /locus_tag="Bphyt_4479"
FT   CDS_pept        548109..549590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4479"
FT                   /product="Na+/solute symporter"
FT                   /note="PFAM: Na+/solute symporter; KEGG: bxe:Bxe_B0791
FT                   Na+/monocarboxylate symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4479"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18855"
FT                   /db_xref="GOA:B2T7V3"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:B2T7V3"
FT                   /protein_id="ACD18855.1"
FT                   /translation="MSDVNPVNPVAMTVFIAFFVLVTVIGFFAARWKRGDLTQLHEWGL
FT                   GGRQFGTVISWFLVGGDFYTAYTVIAVPALVYSVGAYGFFALPYTIIVYPFVFAVMPKL
FT                   WKIAHAKNHITAADYVQGEYGGKWFPAAVAITGIVATMPYIALQLVGMQVVIKGLGVTG
FT                   EMPLIVAFVILALYTYASGLRAPAMIAFVKDIMIYIVVIAAVWLIPAKLGGYAHVFDAA
FT                   DTYFKAKGGATGIILKPTQFTAYASLALGSALAAFMYPHTMTAVLSSSSANTVRKNAIF
FT                   LPAYTLLLGLIALLGYMAIAAGVHVKSASDMVPALFNTLFPSWFVGFAAAAIAISALVP
FT                   AAIMSIGAANLFTRNLWRPLVSPNISPEGEASTAKIVSLVVKFGALLFIVFLPTQYAID
FT                   LQLLGGVWILQIFPAIVFSLYTRRLNTPGLFLGWLAGIVLGTGLAISQGLKPVFALHLG
FT                   DAVYPVYIGLIALTVNIVVSFVVSVLSPRRVVAAA"
FT   gene            complement(549665..550909)
FT                   /locus_tag="Bphyt_4480"
FT   CDS_pept        complement(549665..550909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4480"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   bxe:Bxe_B0799 D-amino-acid dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4480"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18856"
FT                   /db_xref="GOA:B2T7V4"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B2T7V4"
FT                   /protein_id="ACD18856.1"
FT                   /translation="MKFDTVVLGAGIVGVCTAVHLQKRGRQVALVDRKLPGNETSFGNA
FT                   GLIQREGVYPYAFPRGLGTLLRYARNQSPDVRYHADAIVKTAPFLWQYWRNSHPTRHAA
FT                   IAKSYATLIEHCVSEHRALAADAGASALLRPIGWIKVFRTAAARDAETRLAERWHREYE
FT                   VAFEALDAARLQQLEPDLDKTLLGGLRYPESDSVSDPNALVTAYARYFEALGGRFFIGD
FT                   ADTLRDGWQVDTQAGTISASSAVVALGPWSERASARLGYRLPLAVKRGYHMHYSAQGMA
FT                   RLNHPVLDAEGGYLLAPMARGIRLTTGAEIADLEAPKTPAQLAAVEPVARTLFPLGERL
FT                   DDEPWMGRRPCTADMLPIIGPAKKHPGLWFAFGHAHHGLTLGPVTGRLIAEMMTGEATL
FT                   VDPRPFSVERFARHG"
FT   gene            complement(550915..551205)
FT                   /pseudo
FT                   /locus_tag="Bphyt_4481"
FT   gene            551291..551608
FT                   /pseudo
FT                   /locus_tag="Bphyt_4482"
FT   gene            551715..552506
FT                   /locus_tag="Bphyt_4483"
FT   CDS_pept        551715..552506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4483"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0802 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4483"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18857"
FT                   /db_xref="InterPro:IPR021783"
FT                   /db_xref="UniProtKB/TrEMBL:B2T7V5"
FT                   /protein_id="ACD18857.1"
FT                   /translation="MLQAPQRTALSGPALIRLLARLADVDVPESRQSLSDRLSQWLGWT
FT                   DAIALSSVLNGNPPAGSAGTREFGSAEESEYVRARSSLAKTITGDSVFAADRRRGPARA
FT                   SAHASLQSAPAEPAADYAVFRQRYLSIQQSMEMAIGNLRGRLRGMLATRTPGMARLAVV
FT                   DAVMERALSERERNLLAAIPALLAGHFERLRAAEQAALVAAEASDQATDDTGSNIAGNA
FT                   AALAPGAWLNVFRKDMQSVLLAELDIRLQPVEGLLAALRAS"
FT   gene            552517..555135
FT                   /locus_tag="Bphyt_4484"
FT   CDS_pept        552517..555135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4484"
FT                   /product="protein of unknown function DUF802"
FT                   /note="PFAM: protein of unknown function DUF802; KEGG:
FT                   bpm:BURPS1710b_A0266 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4484"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18858"
FT                   /db_xref="GOA:B2T7V6"
FT                   /db_xref="InterPro:IPR008520"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:B2T7V6"
FT                   /protein_id="ACD18858.1"
FT                   /translation="MSRYRIDLVVFLAGLAAVCWIAAGYLGSNPLALAVTLLIGVCYLA
FT                   GSLELHRYNQATATLTQAVAGLSGPPPSLGTWLEPLHPSLRHAARLRVEGERVALPGPA
FT                   LTPYLVGLLVLLGMLGTLLGMVVTLRGTGMALESATDLQAIRASLAAPVKGLGFAFGTS
FT                   IAGVATSAMLGLLSALCRRERLQAAQMLDVKIATILRIYSQSHQREEAFRLLQRQSEVM
FT                   PTLVDRLQTMMSAIEQQSLALNERQIASQEAFHGRAEAAYTRLASSVEQSLKESVADST
FT                   RAAGAALQPVMQATMAGLARETAVLHDTVTHAVQRQLDGLSSGFETTTTTVADIWNKAL
FT                   AGHQRSSEELAQHLRASLDRFTDTFEQRSAGLLDGVSARLESTAGNVAQAWNEALARQE
FT                   SAGEKLAANNQQAFAAAAATFEQHAASLLRGVGQSHVDLQTELASKDEQRLAAWTETLG
FT                   AMAATLSKAWEQSGAQTASRQQEICETLAQTARDISAQTQAHASNTIAEIDRLVEAAAE
FT                   APKAAANLQAELASRDQQRLAAWTDTLAAMAATLSKEWAQSGAQTASRQQEICEALAQT
FT                   ARDISAQTQAHASNTIAEIDRLVQAAAEAPKAAANLQAELASRDQQRLAAWTEALGAMA
FT                   NTLSAEWEQAGARTASRQQEICETLAQTARDISAQTQAHASETIAEIGQLVQAASEAPK
FT                   AAAEVVAELRQKLSDSMVRDTAMLQERSRLLETLETLLDAVNHASTEQRTAVDALVATS
FT                   ADLLERVGTRFTDKLEHETGKLGSVAAQVTGSAVEVASLGEAFGTAVQVFGESNDKLVT
FT                   HLQRIETALDKSLARSDEQLAYYVAQAREVIDLSVMSQKQIVEDLQQLAGRRASAGVEA
FT                   A"
FT   sig_peptide     552517..552621
FT                   /locus_tag="Bphyt_4484"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.983) with cleavage site probability 0.811 at
FT                   residue 35"
FT   gene            555132..555779
FT                   /locus_tag="Bphyt_4485"
FT   CDS_pept        555132..555779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4485"
FT                   /product="OmpA/MotB domain protein"
FT                   /note="PFAM: OmpA/MotB domain protein; KEGG: bxe:Bxe_B0804
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4485"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18859"
FT                   /db_xref="GOA:B2T7V7"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:B2T7V7"
FT                   /protein_id="ACD18859.1"
FT                   /translation="MSEDIDGGVEQVAPIWPVFGDLMSVLLGAFVLILVGVIGVQLELS
FT                   SKLEQEVKQRQLETQRRKTLEQALAGPLAAGRVTLVNGRIGISGNVLFALNSDQLQPQG
FT                   RDLLKSLAGPLSAYLGANDEILMVSGFTDDQRLREGNRRFADNWELSAQRALTVTRALI
FT                   DDGVPASSLFAAAFGSGQPVSSNTDEQGRAKNRRVEIAPVPRPSTAAVKPRE"
FT   gene            555772..556425
FT                   /locus_tag="Bphyt_4486"
FT   CDS_pept        555772..556425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4486"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0805 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4486"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18860"
FT                   /db_xref="InterPro:IPR021549"
FT                   /db_xref="UniProtKB/TrEMBL:B2T7V8"
FT                   /protein_id="ACD18860.1"
FT                   /translation="MSDGGNSDPASGARATLDAWRERGDDRLDPVRFHFIDALERRAAG
FT                   HSGEARRILDERLSGLLDAYAGYIERAAAASANQTNAQAADEPTHATLKSLVDYIASQD
FT                   HVPAAIGLPRAASYPELPALDYFREVWSKVRAEKQMRQSLEQVPGNAGPLNSSSLVHRA
FT                   LSLMREVSPGYLKQFLSYVDALSWMEQINGGAAPAGKDAPRAGSTGKSARGKAR"
FT   gene            complement(556479..556799)
FT                   /locus_tag="Bphyt_4487"
FT   CDS_pept        complement(556479..556799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4487"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0806 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4487"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18861"
FT                   /db_xref="InterPro:IPR027392"
FT                   /db_xref="UniProtKB/TrEMBL:B2T7V9"
FT                   /protein_id="ACD18861.1"
FT                   /translation="MKCPVCKTTDLLMTERRSIEVDYCPDCRGVWLDRGELDKLIAQDT
FT                   ANSDTPPAPRSSHDSHDSHDRHDRHRQRDHSYDSHRGYDEHRSGYRTQKKKRSLFDVFD
FT                   FD"
FT   gene            complement(556893..557645)
FT                   /locus_tag="Bphyt_4488"
FT   CDS_pept        complement(556893..557645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4488"
FT                   /product="Integral membrane protein TerC"
FT                   /note="PFAM: Integral membrane protein TerC; KEGG:
FT                   bxe:Bxe_B0807 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4488"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18862"
FT                   /db_xref="GOA:B2T7W0"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2T7W0"
FT                   /protein_id="ACD18862.1"
FT                   /translation="MDTLLTLVADPAAWAALLTLVVMEIVLGIDNLIFISILSNKLPEA
FT                   QRARTQRIGIMLALVMRLGLLGTVAWIAQLTAPAITLFAHAFSWRDLILLGGGLFLVWK
FT                   ATREIHHHVTHAEEERSKAGSTVQLTVAAAIGQILVLDMVFSVDSIITAVGMTEHMPIM
FT                   FVAVISAVLAMLFAARPLSRFIDRNPTIVTLALSFLLVIGMTLIAEGFGSHVPKAYIYV
FT                   AMAFSAFVEAMNMLVRRAKSKRALNSGQ"
FT   gene            557767..558645
FT                   /locus_tag="Bphyt_4489"
FT   CDS_pept        557767..558645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4489"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bxe:Bxe_B0808 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4489"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18863"
FT                   /db_xref="GOA:B2T7W1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2T7W1"
FT                   /protein_id="ACD18863.1"
FT                   /translation="MLNYRHLYYFWIVVKEGGFARAAERLDMAVQTISAQVRELEKSIG
FT                   RQLLKPAGRGVTMTEAGETAFNRAEQIFQLGEALLDDMREAGGEGVARLAVGLSDGISK
FT                   LAAHALLAPVLGTPSLRLLCHEGEHAELMSELALHRLDLVLACQPEPHNADLRVLSQRL
FT                   AGSPVDWYGPTGIVRKSARAGFPQCLAEVPVLLPTRHAALRARLDRWFDAQGIRPHIVG
FT                   EFEDSALMAVFAARGLGVFPLAELGAEDLSLLRGLRWLGRADGVIEEIHAIRSRRGQHH
FT                   GLASQVVAGAR"
FT   gene            complement(558621..559082)
FT                   /locus_tag="Bphyt_4490"
FT   CDS_pept        complement(558621..559082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4490"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0809 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4490"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18864"
FT                   /db_xref="InterPro:IPR029024"
FT                   /db_xref="UniProtKB/TrEMBL:B2T7W2"
FT                   /protein_id="ACD18864.1"
FT                   /translation="MRTYPRNSPQAAARIVALALTSDGHVCSSEERVLQKLNIAGELGL
FT                   APAQFEQIVQTLCEDHSVAQLSFAPPVGRLDPAMLTTLIDEIDDPTLRRKVIRLCVAVT
FT                   VADDYLADGEIALLAAMLNAWGPDLTPAANRHGLPSRVLRGYQRAPATT"
FT   gene            complement(559379..559573)
FT                   /locus_tag="Bphyt_4491"
FT   CDS_pept        complement(559379..559573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4491"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4491"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18865"
FT                   /db_xref="UniProtKB/TrEMBL:B2TDX5"
FT                   /protein_id="ACD18865.1"
FT                   /translation="MKDLKIGELHRNEEMTSADMARVVGGKDKEPAGKPTHIDAINGVL
FT                   TFGDGSKWSMDLNGKLHPL"
FT   gene            complement(559951..560271)
FT                   /locus_tag="Bphyt_4492"
FT   CDS_pept        complement(559951..560271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4492"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0810 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4492"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18866"
FT                   /db_xref="InterPro:IPR025421"
FT                   /db_xref="UniProtKB/TrEMBL:B2TDX6"
FT                   /protein_id="ACD18866.1"
FT                   /translation="MKLTSLNRLMVRAAAGALVASAALLATASGAYAQTSAAPGTHQLT
FT                   RADVRHELEELEAAGYDPSRGDESDYPADIQEAERKVAAMHAAQQSALNNNQPAMQDAP
FT                   MH"
FT   sig_peptide     complement(560170..560271)
FT                   /locus_tag="Bphyt_4492"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.985 at
FT                   residue 34"
FT   gene            560457..560654
FT                   /locus_tag="Bphyt_4493"
FT   CDS_pept        560457..560654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4493"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A3098 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4493"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18867"
FT                   /db_xref="UniProtKB/TrEMBL:B2TDX7"
FT                   /protein_id="ACD18867.1"
FT                   /translation="MNIIDMARESGMAVVLDARIGREEYHSVCGSLSALEKFVDAIRQT
FT                   RVNHTTAIKPRQRPFTRGLK"
FT   gene            560651..561532
FT                   /locus_tag="Bphyt_4494"
FT   CDS_pept        560651..561532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4494"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0811 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4494"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18868"
FT                   /db_xref="GOA:B2TDX8"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:B2TDX8"
FT                   /protein_id="ACD18868.1"
FT                   /translation="MNRTRIATWKPLYPADMLRAAGRAPLVPFRRSLSMAGRAARESAV
FT                   HTLLRRCQLVSGVVLLVYLFLHLVNHALGIWSLDLAGRGLTLALRVWRSAPGTVLLYGA
FT                   SLLHFSLALRTIYGRRHWKMPLTEWVRLWAGLSLPLLLIRHVVSTRLASSLYGFEPNYE
FT                   RIVIALITSGTQGLQLALLAPGWVHGCLGLWLRMRHRAGARRAKPFLLGLLVGLPLLSA
FT                   AGFVRMKQAVLALCIGPLQTDPKLVAHQLSLDTWRHNILMLYLALLIGAFVAGQLRNWR
FT                   ERRRLRKATMTI"
FT   gene            complement(561635..563131)
FT                   /locus_tag="Bphyt_4495"
FT   CDS_pept        complement(561635..563131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4495"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; KEGG: bxe:Bxe_B0814 periplasmic
FT                   sensor signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4495"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18869"
FT                   /db_xref="GOA:B2TDX9"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B2TDX9"
FT                   /protein_id="ACD18869.1"
FT                   /translation="MNLTLTQRLSLVFSVLLLACCGASAFLQIRSSDLHEKEVIQSLSR
FT                   NLADHIAHGNSLMDANGLRPDAVRQLFGQLMRVNPSVEVYLLDNQGHIKGDDAPAGHVK
FT                   REQVNLAPIRQFIAGDSLPILGDDPRSVDGKKVFSAAPLQLSGQPPSGYIYVVLLGEEH
FT                   DALAARVAASSVLRTTLWSMALVALLGLLAGLTAFGLITRPLRRLTDAMRRFDAEGEPD
FT                   IQPSVPRSSPAGRRDEIAVLEATFAQMANRIGEQWRALTRQDQQRRELIANISHDLRTP
FT                   LTSLHGYLETLSLKSDTLGETERKRYLAIALAQSVKVGRLAQALFELARLEHGNVQPAL
FT                   EQFSLVDLVQDVFQKFELPAEARHIQLRATIPPRLPNVSADLGMIERVLTNLLDNAIRH
FT                   TPAEGSIEVDLAHKDGKVSVTISDTGPGIPPEQREGLFERPFSSGGAHRGGGLGLLIVQ
FT                   RMLQLNQSQIRLLDTAGTGTTFCFELPTAAIRSSAASILM"
FT   sig_peptide     complement(563054..563131)
FT                   /locus_tag="Bphyt_4495"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.715 at
FT                   residue 26"
FT   gene            complement(563128..563865)
FT                   /locus_tag="Bphyt_4496"
FT   CDS_pept        complement(563128..563865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4496"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: bxe:Bxe_B0815 two component
FT                   transcriptional regulator, winged helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4496"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18870"
FT                   /db_xref="GOA:B2TDY0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B2TDY0"
FT                   /protein_id="ACD18870.1"
FT                   /translation="MDNPKRILIVEDDIDIANVLSLHLRDERYEVVHSADGNEGLRLLE
FT                   QGGWDALILDLMLPGVDGLEICRRARAMTRYTPIIITSARSSEVHRILGLELGADDYLA
FT                   KPFSVLELVARVKALLRRVDALAKDSKIEAGSLRIAGLSIDPLTREAAVDGKPIELTPR
FT                   EFDLLYYFAQHPGKVFSRMDLLNAVWGYQHEGYEHTVNTHINRLRAKIEADPAQPERIL
FT                   TVWGRGYKLAVPGEPAGAPKDVS"
FT   gene            563937..566012
FT                   /locus_tag="Bphyt_4497"
FT   CDS_pept        563937..566012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4497"
FT                   /product="Redoxin domain protein"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; cytochrome c biogenesis protein
FT                   transmembrane region; Redoxin domain protein; KEGG:
FT                   bxe:Bxe_B0816 putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4497"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18871"
FT                   /db_xref="GOA:B2TDY5"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR041017"
FT                   /db_xref="UniProtKB/TrEMBL:B2TDY5"
FT                   /protein_id="ACD18871.1"
FT                   /translation="MAPLCKISGQRVITFNLTFREDFDTGGALGCGHFLQYQVLNELYA
FT                   GCRPSQRAHFNRPIRTFGTDMLLIVLAYLGGALTILSPCILPVLPFVFARADQPFVRSG
FT                   LPLLAGMALTFALVATLAAVGGGWVTQANQYGRWVAIALLAIFGLTLLFPRFADHLMRP
FT                   LVSAGNRLSNFAQTDGQQVRAGSSFLLGIATGLLWAPCAGPILGLVLTGAALRGASVGT
FT                   TLLLVAYAAGAATSLAVALLIGGKVFTAMKRSLGAGEWIRRGIGALMLCGVAAIALGFD
FT                   TGVLARVSTVATGGLEQKLVDKLSPNAAPGKAPVAGNAADASGGAMMSVNAASQSTAGA
FT                   DADSTAVNAAQGGAMMRTAVAAEAAPLPVEGVLPPLDGAVQWLNSPPLTTQDLRGKVVL
FT                   VDFWTYSCINCLRSLPYVKAWAQKYKDQGLVVIGVHAPEFAFERNIDNVKKATHDLGVD
FT                   YPVAIDNNYAIWRALNNQYWPAHYFVDAKGQIRYHHFGEGDYAGSEKVIQQLLTEAGHA
FT                   NASKVALGIANGGAQGVQAAADNADMQSPETYVGYQRAENFASPGGEVADKTHTYVAPS
FT                   QPGVNDWGLAGSWNVGAEHATLAASSGRIVYRFHARDLHLVLGPGKDGKPVRFRVSVDG
FT                   AAPGASHGTDVAADGSGTVTGQRLYQLVRQTGEVGDHTFSIEFLDPGVQAFAFTFG"
FT   gene            566062..566802
FT                   /locus_tag="Bphyt_4498"
FT   CDS_pept        566062..566802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4498"
FT                   /product="peptide methionine sulfoxide reductase"
FT                   /EC_number="1.8.4.11"
FT                   /note="TIGRFAM: peptide methionine sulfoxide reductase;
FT                   PFAM: Methionine sulfoxide reductase A; KEGG: bxe:Bxe_B0817
FT                   peptide methionine sulfoxide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4498"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18872"
FT                   /db_xref="GOA:B2TDY6"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/TrEMBL:B2TDY6"
FT                   /protein_id="ACD18872.1"
FT                   /translation="MRTISTRTASLRKRFSVTRIMGLVVVALGVVAAQHVAHSAEAATK
FT                   IPAPVQDEKAAATHSETAVFAGGCFWGVQGVFEHVRGVKQVASGYTGGAASTAQYEPVS
FT                   EGDTGHAESVQITYDPTQITYGRLLQIFFSVAHNPTELDYQGPDHGTQYRSAIFPVNAV
FT                   QRGIAQSYIAQLDSAHVFSAKVVTRVEDFKGFYPAESYHQNFLALHPDYPYIAINDLPK
FT                   VSDLKRMFPDLYRNDPVLFATASR"
FT   sig_peptide     566062..566181
FT                   /locus_tag="Bphyt_4498"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.791 at
FT                   residue 40"
FT   gene            complement(566957..567082)
FT                   /pseudo
FT                   /locus_tag="Bphyt_4499"
FT   gene            568495..570741
FT                   /locus_tag="Bphyt_4500"
FT   CDS_pept        568495..570741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4500"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0820 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4500"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18873"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:B2TDY7"
FT                   /protein_id="ACD18873.1"
FT                   /translation="MTRYLKLLGVASATVLASFAAESAQAQASTITVSGQQYKLCAQEN
FT                   GKCSFLGTGSVVFGAVPPTSPSVMLTAPRTFSNGVGCYVGAVSQSDPAYGYGKSCWVKA
FT                   VAATPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPSPTPGNATMSCS
FT                   TPTQTAGGTANGVISADTPTTDGLRVFQNNAPFKLAITTNAPSADTVVWSVADSNGAIK
FT                   TQGSFAVKAGVQTSTIPCTSTWSGYGALTATLRSNGGTLPRSGTRPVGIATFGVLPNLS
FT                   SVLGTVTYAHQDQHRFGMQGFNGNIAALHALGISWTIDDRQVSAMEPNGPNTYTPNVND
FT                   LDPFYKANPDQMRIVRLDGLPAWDSKTGQFNDSYYAPSNMPEFQTFMSKVGTDTSLIRA
FT                   ANYPNQQKNYYQVTWEPSLGWADSDANFVAMYKAAYEGIHSTDPNAVVMGTGNPFASNC
FT                   DTCTTGYLQKFGALGLWNYIDAVATHGYWNAGTYPAHPPELQDSDPSTANQANALDNQM
FT                   AQLRSVMQAGKPNMKLFFTEAGVSYDPGLNYGPNVPSQNQLFAHAAVGVRAHIIVLGGG
FT                   AQVTTLFYGPDYPGEVGYGSFFDLNDAQGAFGASNLSPKPEAMAFATMTRVLDGTNTLG
FT                   RIKSAPAGVFAYGFQQLGNGKVVTAAWTHSNAQWPASNGTYSQTYSTSYSLQVDNAGTS
FT                   GNVTKIDGYGNVSTVAYTNGQVALTLTEVPQYIVSNNATVAKANATVPLGYTGQ"
FT   sig_peptide     568495..568575
FT                   /locus_tag="Bphyt_4500"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.679 at
FT                   residue 27"
FT   gene            complement(570962..571450)
FT                   /locus_tag="Bphyt_4501"
FT   CDS_pept        complement(570962..571450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4501"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0821 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4501"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18874"
FT                   /db_xref="UniProtKB/TrEMBL:B2TDY8"
FT                   /protein_id="ACD18874.1"
FT                   /translation="MHFVGNGSNGDQPLDFSNSVGLAGSWNGGGKTLPVSFNLEGMSFA
FT                   DANTGHRYGMITNETDDAFEARAQGFYFAALKGDPKQAARFVHFPLRVNWSATHHEMID
FT                   SASQLAANWNRIFTPKYLAALRDVVPHDMPVIKSQYAMLGAGLAFFTDKGVEVLNAQR"
FT   gene            complement(571480..571704)
FT                   /locus_tag="Bphyt_4502"
FT   CDS_pept        complement(571480..571704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4502"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0821 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4502"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18875"
FT                   /db_xref="UniProtKB/TrEMBL:B2TDY9"
FT                   /protein_id="ACD18875.1"
FT                   /translation="MNTPRLRLHGLNRRRTIAMLAVVSGLSTGMNHAAIAQSESTSSVD
FT                   YSGTVGGAKVGMTLVLHGNAIGKGHYFYF"
FT   sig_peptide     complement(571603..571704)
FT                   /locus_tag="Bphyt_4502"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.497 at
FT                   residue 34"
FT   gene            571955..572629
FT                   /locus_tag="Bphyt_4503"
FT   CDS_pept        571955..572629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4503"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   3"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 3; HAD-superfamily hydrolase, subfamily IA, variant
FT                   1; PFAM: Haloacid dehalogenase domain protein hydrolase;
FT                   KEGG: bxe:Bxe_B0822 HAD-superfamily hydrolase, subfamily
FT                   IA, variant3"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4503"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18876"
FT                   /db_xref="GOA:B2TDZ0"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:B2TDZ0"
FT                   /protein_id="ACD18876.1"
FT                   /translation="MRIQTSFLFDLDGTLVDSVYQHVLAWKEALDSEGIPLSVWRIHRK
FT                   IGMSGGLFTNQLLRETHGEINADRVERLRQAHAAAYQRLRAQVCPLPGARALLDALTQA
FT                   GTPWAVATSGRMETAALNLEALGVDPAKAVVVTRDDVKYAKPDPDLFIAAAGRLGVPVE
FT                   HTVVVGDSIWDMLAARRCRALGVGLLSGGYGTEELERAGALRVYDDPADLLDHLDEVAS
FT                   RP"
FT   gene            572982..573944
FT                   /locus_tag="Bphyt_4504"
FT   CDS_pept        572982..573944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4504"
FT                   /product="response regulator receiver protein"
FT                   /note="KEGG: bxe:Bxe_B0823 response regulator receiver
FT                   domain protein(CheY)"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4504"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18877"
FT                   /db_xref="GOA:B2TDX4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B2TDX4"
FT                   /protein_id="ACD18877.1"
FT                   /translation="MNNFIRPPVFHPSTVVFVDDNDSYLDALRRFFPDSATNLFFTRPQ
FT                   TALAFIRQHARKNSLEFAPASACVSETGFERYMETAAERDILARGSRFAEVAAVVVDFD
FT                   MPGMNGVEFLSSISNLRCAKVLLTGVADETVAVKAFNAGIVDLYLRKTDTDSANRLAHF
FT                   LKDAKARHCSEGGWLALGENGLTYCDPRTRKVIDEVVAANGIVEYYWRPEQDAILMFDR
FT                   AGNPSVFVAWAENDWISQGEIVADEDGPADLLKQMAVREVMPIFWPNLAYRSGMTVRTL
FT                   TPRTIPGWDDVFYCWTPIDKADVGMDLLTFAQWRKDRTR"
FT   gene            573969..575411
FT                   /locus_tag="Bphyt_4505"
FT   CDS_pept        573969..575411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4505"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   KEGG: reu:Reut_B3506 ATP-binding region, ATPase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4505"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18878"
FT                   /db_xref="GOA:B2TDY1"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR031621"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B2TDY1"
FT                   /protein_id="ACD18878.1"
FT                   /translation="MYAIPTACVSAMFVVFGLYVLITQGATRLFTPFILMCVSTFAWQG
FT                   AWTLLFQTDNPHTADLLVRGGYLFILFLPTTFYHFVTEVAAQRREQPILLASYGLCFVL
FT                   AILLPGNEVVAGYQHFFFGYYPVAGPLHPLHVVQTVLLAGRSAQLLLAARQKAEGDARR
FT                   RLDLCLASLCLYSFAAMDYAVNYGFGFYPPGVLFIGLSLGLLAITIVRYHLIHPYAVAA
FT                   TIAHEISTPLATIGMHADEIASVWGHVFKGYRTAVTHGLYEDHDEVGQSERIGQLATAI
FT                   RREVSGTSAMVEMALASFTLDRLDRGDFSRHSVHQCVMSTLERYPFSGDERERVTVMPI
FT                   DLAMSFSGSDTVVVFVLFNLLKNALHAIRVGGDGAITISAVQDQDFCVLQFRDTGPGIA
FT                   PDVLPYIFDAFFTTKRHGSGAGMGLAFCRRATELLGGSIECSSIRGIHTTFTVRLPAPD
FT                   TPADRALRKTPAQHSPRWSQGQ"
FT   gene            complement(575487..576452)
FT                   /locus_tag="Bphyt_4506"
FT   CDS_pept        complement(575487..576452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4506"
FT                   /product="Alpha/beta hydrolase fold-3 domain protein"
FT                   /note="PFAM: Alpha/beta hydrolase fold-3 domain protein;
FT                   KEGG: bxe:Bxe_B0824 putative lipase (esterase)"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4506"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18879"
FT                   /db_xref="GOA:B2TDY2"
FT                   /db_xref="InterPro:IPR002168"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B2TDY2"
FT                   /protein_id="ACD18879.1"
FT                   /translation="MLEPEMAAFIERAAAIYRGHSTSLTPPEQRKIYDQYAAAVTPALP
FT                   DDVVTHDAEFHTGAGHSIALRLYRNHARHHDAARGAVLYFHGGGFVLGSLDSHQLVTAR
FT                   LAADTDLDVIAVDYRLAPEHPAPAAHDDCMEVTLAALAGRLPFELHAGAPLQLAGDSAG
FT                   ATLAASVAMRLRDDAVQGISGLVLVYPMLGTDPQLPARDSEALAPMLKLTDVHAFRDLY
FT                   WGPHPPYPAWTIPLDATRYDGLPPTLAIGVEHDPLRDDARVFAERINAAGGEARLMIGA
FT                   GLVHGCWRAIESSPGVQRLHEEVCRFLSAHATPGSSADNR"
FT   gene            complement(576445..576954)
FT                   /locus_tag="Bphyt_4507"
FT   CDS_pept        complement(576445..576954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4507"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0825 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4507"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18880"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B2TDY3"
FT                   /protein_id="ACD18880.1"
FT                   /translation="MPQPAALPCYRDTVRAEWVDYNGHLRDAFYMLIFSFATDALIDLI
FT                   GLPDVVRKERQRSIYTLEAHINYLHEIKEGAQVRVDMRVLGHDAKRLHLYLEMFAGDGG
FT                   KPLAAGEQMLLHVDTGGPRAAAFDPDVAAHVKALADAHAALPPAAFAGRVIGLPAKTKP
FT                   SGSGHA"
FT   gene            complement(577184..578149)
FT                   /locus_tag="Bphyt_4508"
FT   CDS_pept        complement(577184..578149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4508"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase NAD-binding"
FT                   /note="PFAM: 3-hydroxyacyl-CoA dehydrogenase domain
FT                   protein; 3-hydroxyacyl-CoA dehydrogenase NAD-binding; KEGG:
FT                   bxe:Bxe_B0826 3-hydroxybutyryl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4508"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18881"
FT                   /db_xref="GOA:B2TDY4"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR026578"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2TDY4"
FT                   /protein_id="ACD18881.1"
FT                   /translation="MAVIVDIKTFAAIGVGVIGSGWVARALAHGLDVIAWDPAPGAEKQ
FT                   LRENVANAWSALQRVGLAAGASPERLRFVDTIQACVGQADFIQESAPEREELKLSLHEQ
FT                   ISRAAKPDAIIASSTSGLLPSDFYARAVNPQRCIVGHPFNPVYLLPLVEVLGGESTAPE
FT                   TIDAALQVYRALSMRPLRVRKEVPGFIADRLLEALWREALHLVNEGVATTGEIDDAIRF
FT                   GAGIRWSFMGTFLTYTLAGGDAGMRHFMQQFGPALELPWTKLVAPKLTDELIDRVVDGT
FT                   AEQVGPRSIKQLERYRDDCITSVLTAIAEAKARHGMQPAE"
FT   gene            complement(578213..579142)
FT                   /locus_tag="Bphyt_4509"
FT   CDS_pept        complement(578213..579142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4509"
FT                   /product="protein of unknown function DUF849"
FT                   /note="PFAM: protein of unknown function DUF849; KEGG:
FT                   bxe:Bxe_B0827 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4509"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18882"
FT                   /db_xref="GOA:B2TGS1"
FT                   /db_xref="InterPro:IPR008567"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B2TGS1"
FT                   /protein_id="ACD18882.1"
FT                   /translation="MNHEVIVTCAVTGAGDTVGKHPAIPVTPKQIAEAAIEAAKAGATV
FT                   AHCHVRDPKTGRGSRDPQLYREVVDRIRSSGTDVIINLTAGMGGDLEIGPGEDPMRFGA
FT                   NTDLVGGLTRLAHVEELLPEICTLDCGTLNFGDGDYIYVSTPAQLRAGARRIQELGVKP
FT                   ELEIFDTGHLWFAKQLLKEGLLDAPPLFQICLGIPWGAPADTTTMKAMADNLPPGAQWA
FT                   GFGIGRMQMPMVAQAMLLGGHVRVGLEDNIWLDKGVPATNGTLVQRAVEIIERLGARAL
FT                   TPAEGRRKLGLPARGERQLERREAGQYA"
FT   gene            complement(579184..580149)
FT                   /locus_tag="Bphyt_4510"
FT   CDS_pept        complement(579184..580149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4510"
FT                   /product="choline ABC transporter, periplasmic binding
FT                   protein"
FT                   /note="TIGRFAM: choline ABC transporter, periplasmic
FT                   binding protein; PFAM: Substrate-binding region of ABC-type
FT                   glycine betaine transport system; KEGG: bxe:Bxe_B0828 ABC
FT                   glycine betaine transporter, periplasmic ligand binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4510"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18883"
FT                   /db_xref="GOA:B2TGS2"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="InterPro:IPR017783"
FT                   /db_xref="UniProtKB/TrEMBL:B2TGS2"
FT                   /protein_id="ACD18883.1"
FT                   /translation="MKLRIKALLAHLACLAAAVGAAVTALPAFAQDPAACRAVHFADIG
FT                   WTDITSTTALASTVFEGLGYQPVTTVASVPISFAGLKSKQLDVSLGYWWPVQEKAIAPF
FT                   VDSKSIQVLQPPNLTGAKATFAVPSYEYDAGLKTFADIAKHRDQLDGKIYGIEPGSSAN
FT                   AAIQKMIANNQFGLGGFKLIESSEAGMLVSVDRAIREKKWVVFLGWEPHPMNIQIDMKY
FT                   LTGSDGVFGPNDGEARVYTLTSPDFLTRCPNAGKLVSNLRFSTQLENVVMQSVMNKEKP
FT                   ADAAKAYLKKNPQVLDAWLAGVKTYDGKDGLPAVKAYLGL"
FT   sig_peptide     complement(580057..580149)
FT                   /locus_tag="Bphyt_4510"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 31"
FT   gene            580497..581522
FT                   /locus_tag="Bphyt_4511"
FT   CDS_pept        580497..581522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4511"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; ThiJ/PfpI domain protein; KEGG: bxe:Bxe_B0829
FT                   transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4511"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18884"
FT                   /db_xref="GOA:B2TGS3"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B2TGS3"
FT                   /protein_id="ACD18884.1"
FT                   /translation="MPEDMSFLLLPGFSAIGFMSAVEPLRVANRYRGDLYRWRILSLDG
FT                   APVAASNGISINADAAIGDVEAARTLFVVAGFEPLACYTRELGDCLKRLARAGATLGGI
FT                   DTGSFVLAEAGLLGGSDSVTVHWEALSAFRERYPSLDASQELFEIGARRITCAGGTASI
FT                   DMMLDLIGREHGAALASAVSEQFVVSRIRRRSDHQRMEVAARYGVHNRKLIQVIGVMEQ
FT                   HMEEPLTPDRLAQEIGVTRRQLERLFCASLKDTPTHFYQQLRLARARELLQQTDMSITS
FT                   ICVACGFESPSHFSRTYRARFGASPRSDRQGTGGRNAGELERSAGQDLVSAPQLSRLSQ
FT                   Q"
FT   gene            581632..581958
FT                   /locus_tag="Bphyt_4512"
FT   CDS_pept        581632..581958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4512"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0830 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4512"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18885"
FT                   /db_xref="InterPro:IPR025421"
FT                   /db_xref="UniProtKB/TrEMBL:B2TGS4"
FT                   /protein_id="ACD18885.1"
FT                   /translation="MKSLIEAVVIAALISAPLAAFAQSNQPVTRAQVRAELIQLEKAGY
FT                   NPGTANDEDYPSNIQAAEARVAAQKSAAQTSGYGSATNGSSQAGTRSDTTNSSYSAPVV
FT                   TYGR"
FT   sig_peptide     581632..581700
FT                   /locus_tag="Bphyt_4512"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.990 at
FT                   residue 23"
FT   gene            complement(582016..582417)
FT                   /locus_tag="Bphyt_4513"
FT   CDS_pept        complement(582016..582417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4513"
FT                   /product="transcriptional regulator, HxlR family"
FT                   /note="PFAM: helix-turn-helix HxlR type; KEGG:
FT                   gur:Gura_3513 transcriptional regulator, HxlR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4513"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18886"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2TGS5"
FT                   /protein_id="ACD18886.1"
FT                   /translation="MPRHGGSSPDAFSGACPSRLALARLGQKWTVLVMIALREKHLRFA
FT                   EIRRRLDGVSDKMLSQTLRAMERDGLVERCVDDRHPARVEYGLTVLARTALPIVTELKQ
FT                   WAERSIDSIEASNHAYDQKTGRSTCQAVS"
FT   gene            complement(582488..582913)
FT                   /locus_tag="Bphyt_4514"
FT   CDS_pept        complement(582488..582913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4514"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   bvi:Bcep1808_6067 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4514"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18887"
FT                   /db_xref="InterPro:IPR008318"
FT                   /db_xref="UniProtKB/TrEMBL:B2TGS6"
FT                   /protein_id="ACD18887.1"
FT                   /translation="MNASTRIRLITLAEHASDASNPSRQVVSLANDADPAEQKELIATA
FT                   ARVELHFPNFTDGRAYSQAYLLRRRLGFKGDLRATGDVLVDQLIQMERTGFSSAVLKDG
FT                   IDPEDAQRQLDRFPAFYQGDVIHDAPFVRSDVGSNDE"
FT   gene            complement(582910..584700)
FT                   /locus_tag="Bphyt_4515"
FT   CDS_pept        complement(582910..584700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4515"
FT                   /product="Sulfite reductase (ferredoxin)"
FT                   /EC_number="1.8.7.1"
FT                   /note="PFAM: nitrite/sulfite reductase hemoprotein
FT                   beta-component ferrodoxin domain protein; nitrite and
FT                   sulphite reductase 4Fe-4S region; KEGG: bxe:Bxe_B0922
FT                   putative nitrite/sulfite reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4515"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18888"
FT                   /db_xref="GOA:B2TGS7"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="UniProtKB/TrEMBL:B2TGS7"
FT                   /protein_id="ACD18888.1"
FT                   /translation="MYQYTEFDQSFVRSRAAQFRDQLERWQSGKLSEDDFRPLRLQNGW
FT                   YVQRHAPMLRVAIPYGELSSRQLRMLARIAREYDEPEAEVYRLASEAQRKLGTVRLPTN
FT                   YAHFTTRTNVQFNWIPLSKAADVMDLLASVDMHGIQTSGNCIRNISCDERAGVAPDEIA
FT                   DPRPFAEIMRQWTTLHPEFAFLPRKFKIAITGASEDRAATDWHDVGLRLLRNEAGELGF
FT                   RVTVGGGMGRTPVIGTVLREFLPWQHIMNYIEAVVRVYNQYGRRDNKYKARIKILVKAE
FT                   GQRYIDGVEEEFRQIVEHDGGPHTIPLAELERVSACFALPSRPSVDAPIDLEAIATSNA
FT                   VALETPQFERWLQRNVSPHRNQRLRIVTLSFKRLLQAPGDASAEQLDRVADLAERFSAG
FT                   EARVTHTQNVVLPWVHVNDLLPLWQAAREAGLASANVNLLTDMIACPGGDFCALANARS
FT                   IPVAEAITERYQDLDELNDIGDIDLHISGCINSCGHHHSGHIGILGVDKDGKEWYQVTL
FT                   GGSDGSHASGRAQAGKVIGPSFSAAEVPEVIDALLSAYLDIRAAVGGRRESFVETVRRA
FT                   GIEPFRTAADRVRTLMEKTA"
FT   gene            585029..585217
FT                   /locus_tag="Bphyt_4516"
FT   CDS_pept        585029..585217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4516"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0923 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4516"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18889"
FT                   /db_xref="GOA:B2TGS8"
FT                   /db_xref="InterPro:IPR021344"
FT                   /db_xref="UniProtKB/TrEMBL:B2TGS8"
FT                   /protein_id="ACD18889.1"
FT                   /translation="MDLLKMTRIVLWSFFGIRRGASHQADMAGVKLPLLPLVAVVLAAG
FT                   FGATLFALARLAVNVAH"
FT   gene            complement(585250..586665)
FT                   /locus_tag="Bphyt_4517"
FT   CDS_pept        complement(585250..586665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4517"
FT                   /product="transcriptional regulator, GntR family with
FT                   aminotransferase domain"
FT                   /note="PFAM: regulatory protein GntR HTH; aminotransferase
FT                   class I and II; KEGG: bxe:Bxe_B0924 transcriptional
FT                   regulator, GntR family with aminotransferase activity"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4517"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18890"
FT                   /db_xref="GOA:B2TGS9"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2TGS9"
FT                   /protein_id="ACD18890.1"
FT                   /translation="MKRFEMLANTMADEIRSGSRPVGSRMPSLRHLTTQHGVSQSTVFR
FT                   AYYLLEEWGLIRARERSGYYVAPGAALEHKPAPQPPAALESAKVEISDLVFSVLEAAKH
FT                   PNVVPFGSAFPSPQLFPLQRLARSLGHSSRLISPWSTVVDLPPGNEPLRRQISLRYMGM
FT                   GIAQPMEQLVVTNGALEALNLCLMAVTRPGDVVAIESPGFYAALQAIERLDLRAVEIPV
FT                   DPVSGIDLQALSDALDKHPIRACWFMTNYQNPTGAAMSQEKKKALVELLAERDVPLIED
FT                   DVYGELHHAATYPLPAIAFDTKGLVMHCSSFSKTLAPGYRIGWVAAGRFAEKVQRLKLM
FT                   TTLSASIPAQAAIADYLQHGGYDKHLRKLRGAFRNQLASMDTALRRYMPEDSHWTLPSG
FT                   GYFLWLRLPSHVDAMQLHRLALENGISIAPGPIFSARHEFRNHIRLNFGHPWSDNTESA
FT                   VQTLASLLEQASR"
FT   gene            complement(586887..588347)
FT                   /locus_tag="Bphyt_4518"
FT   CDS_pept        complement(586887..588347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4518"
FT                   /product="succinic semialdehyde dehydrogenase"
FT                   /note="TIGRFAM: succinic semialdehyde dehydrogenase; PFAM:
FT                   Aldehyde Dehydrogenase_; KEGG: bxe:Bxe_B0833 succinic
FT                   semialdehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4518"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18891"
FT                   /db_xref="GOA:B2TGT0"
FT                   /db_xref="InterPro:IPR010102"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:B2TGT0"
FT                   /protein_id="ACD18891.1"
FT                   /translation="MTTLSLKDPSLLKSHAYIAGEWQGADDGTTFEVKNPATGETIATV
FT                   PRMGTAETRRAIDTANAAWPAWRATTAKQRAVILRKWHDLMMENADDLAKILTTEQGKP
FT                   LAEAKGEIQYAASFLEWFAEEGKRVNGDTIPTPASDKRIVVTKEPIGVCAAITPWNFPA
FT                   AMITRKVGPALAAGCPIIVKPAEATPLSALALAVLAERAGVPRGVFNVVTGEPKAIGAE
FT                   MTGNPIVRKLSFTGSTPVGRLLMAQCAPTVKKVSLELGGNAPFIVFDDADLDAAVAGAI
FT                   ASKYRNSGQTCVCTNRFYVHDKVYDAFAEKLRVAVEQLKVGRGTEDGVTQGPLINDAAV
FT                   LKVESHIEDALAKGARIVTGGKRHALGHGFFEPTVLADVTPAMKVARDETFGPLAPLFR
FT                   FSSDEEVIRLANDTEFGLASYFYSRDIGRVWRVAEALEYGMVGINTGLISNEVAPFGGV
FT                   KQSGLGREGSHYGIDDYVVIKYLCVGGI"
FT   gene            complement(588358..589641)
FT                   /locus_tag="Bphyt_4519"
FT   CDS_pept        complement(588358..589641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4519"
FT                   /product="4-aminobutyrate aminotransferase"
FT                   /note="TIGRFAM: 4-aminobutyrate aminotransferase; PFAM:
FT                   aminotransferase class-III; KEGG: bxe:Bxe_B0834
FT                   4-aminobutyrate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4519"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18892"
FT                   /db_xref="GOA:B2TGT1"
FT                   /db_xref="InterPro:IPR004632"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B2TGT1"
FT                   /protein_id="ACD18892.1"
FT                   /translation="MKNAELKSRKDAATPRGVGVMCDFYAERAENAELWDVEGRRFIDF
FT                   AAGIAVCNTGHRHPKILAAIRDQLDHFTHTAYQIVPYASYVELAEKLNERAPGDHPKKT
FT                   AFFTTGAEAVENAIKIARAATGRPGVIAFTGGFHGRTLMGMALTGKVAPYKIGFGPFPS
FT                   DVFHAPFPNPLHGVTTADSLKAIEFLFKADIDPKRVAAIIFEPVQGEGGFYPAPAEFVR
FT                   ALRKLCNEHGILLIADEVQTGFARTGKLFAMHHYDVVPDLMTVAKSLAGGMPLSGVIGR
FT                   ADVMDAAAPGGLGGTYAGNPLAVAAAHAVLDIIDEEKLCERATLLGDRVKAKLIALQSD
FT                   VPQIADVRGPGGMVAVEFCKAGGTEPDAEFTKRVQTRALERGLLLLVCGVYSNVVRFLF
FT                   PLTIQDAVFDEAMAILEDVIKDSVTVAA"
FT   gene            589765..591270
FT                   /locus_tag="Bphyt_4520"
FT   CDS_pept        589765..591270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4520"
FT                   /product="transcriptional regulator, GntR family with
FT                   aminotransferase domain"
FT                   /note="PFAM: regulatory protein GntR HTH; aminotransferase
FT                   class I and II; KEGG: bxe:Bxe_B0835 transcriptional
FT                   regulator, GntR family, with aminotransferase activity"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4520"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18893"
FT                   /db_xref="GOA:B2TGT2"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2TGT2"
FT                   /protein_id="ACD18893.1"
FT                   /translation="MRASVLSDWLAQRLDRGNGQPIYRQLHRLLQQAILSRELPPGSKV
FT                   PSSRLLAQELGIGRNTVTQVYEQLVLEGYVSSATGRGTFVADSAPDEIVGVPDAEAPAA
FT                   RSEPAPQQARRALSTRGARLIAGAGVSKRQWGAFMPGVPDVTKFPARVWSRLHNKYWRR
FT                   LRPDLLTYAPGGGLASLRHALADYLRTSRSVRCTPEQIIITTGIHQSVDLAVRLLSDPG
FT                   DVIWTEDPCYWGVRSVLHVSGLESRPIAVDEEGINPSADDLAQPPKLMLVTPSHQYPLG
FT                   MVMSLARRRMLLEYARQNLCWIIEDDYDSEYRYGSRPLASLQGLDTSGQVIYVGSFGKT
FT                   LFPGLRIGYLVVPEALAESFATASAELYREGQLLQQAMLAEFIAEGHFTSHIRKMRTLY
FT                   GQRRQTLLDAAAQRYGDALPAVGGDAGLHLVMQLPDGTDDRRVAAAALERNIVVRPLSG
FT                   YYAQPALAPSGLLIGYACVPDEEIAPAFNTLADAIDATLPEFV"
FT   gene            complement(591281..592117)
FT                   /locus_tag="Bphyt_4521"
FT   CDS_pept        complement(591281..592117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4521"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: bxe:Bxe_B0836 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4521"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18894"
FT                   /db_xref="GOA:B2TGT3"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B2TGT3"
FT                   /protein_id="ACD18894.1"
FT                   /translation="METLVVLLVLLSALLHATWNAFLHLSEDRIWLLGMMAMPYIAVSA
FT                   VGVIVLPMPAPAAWPYIFASVVLEFGYLLALIRAYKSGDFGQIYPIARGLSPMLVFVGA
FT                   LVFAHEALKPLAAIGVALVSLGIVSLAFRRGMRFSGESVPFALLTGFFIATYSVVDGIG
FT                   ARLAGNGLSYIMWVYLIWNIPQFLLAWHWRGGAKGLFIGRAMVLKGIAAGLLALSAYCL
FT                   IIEAYRYLPIAMVSALREMSSIFAVLIGWLFMREKLTARRIVACALVTLGAVLIRV"
FT   sig_peptide     complement(592064..592117)
FT                   /locus_tag="Bphyt_4521"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.939) with cleavage site probability 0.856 at
FT                   residue 18"
FT   gene            complement(592397..593239)
FT                   /locus_tag="Bphyt_4522"
FT   CDS_pept        complement(592397..593239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4522"
FT                   /product="phosphonate ABC transporter, inner membrane
FT                   subunit"
FT                   /note="TIGRFAM: phosphonate ABC transporter, inner membrane
FT                   subunit; PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bxe:Bxe_B0837 ABC
FT                   phosphonate transporter, inner membrane subunit PhnE"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4522"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18895"
FT                   /db_xref="GOA:B2TGT4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005769"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B2TGT4"
FT                   /protein_id="ACD18895.1"
FT                   /translation="MNTADLITSPARASDVLDAQAARHPALAAGKRSWLSLAGWIAVLA
FT                   VLGGAWHGADMRPLDLLSDSGNMGQFAKDFFPPDFTEWRNYLHEMYVTLSVAVWGTALS
FT                   LVCAVPCGLMSAHNMAPMWIVQPMRRMMDACRAINEMVFAMLFIVAVGLGPFAGVLALW
FT                   VHTTGVLAKLFAEAVEAIDPRPAEGVRATGATSLDEIIYGVLPQVLPLWISYALYRFES
FT                   NVRSAMVVGMVGAGGIGVVLYEAIRSFNYAQTAAVMIMVIVVVTVIDLVSAWLRERVT"
FT   gene            complement(593236..594213)
FT                   /locus_tag="Bphyt_4523"
FT   CDS_pept        complement(593236..594213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4523"
FT                   /product="phosphonate ABC transporter, periplasmic
FT                   phosphonate binding protein"
FT                   /note="TIGRFAM: phosphonate ABC transporter, periplasmic
FT                   phosphonate-binding protein; phosphonate ABC transporter,
FT                   periplasmic phosphonate binding protein; KEGG:
FT                   bxe:Bxe_B0838 ABC phosphonates transporter, periplasmic
FT                   ligand binding protein PhnD"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4523"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18896"
FT                   /db_xref="GOA:B2TGT5"
FT                   /db_xref="InterPro:IPR005770"
FT                   /db_xref="InterPro:IPR017797"
FT                   /db_xref="UniProtKB/TrEMBL:B2TGT5"
FT                   /protein_id="ACD18896.1"
FT                   /translation="MKFLRSLITLAVGAATLATVAAAQAEDLNLGIISTDSSSVLKQRW
FT                   EPLIQDMNKQTGLNVKAFFATDYAGIIEGMRFNKVQVAYLGNASAIEAVDRSQGEVFAK
FT                   TVYANGDAGYKSVLITNVNSRFKTLDDVFKNTKDVTLGFGDPNSTSGTLIPGYYLFAQH
FT                   NTPVNTSFKTVLPSSHEANLLAVVNNKIDIATNNTEMLDSLKKQHPDKFAQVRVLWTSP
FT                   LIPSDPIVWRKDLPQATKDKLRNFFVNYAKTDAHEKAVMAGIFGYGGFAASSDAQLLPI
FT                   RQVALFQQKQKIESDAHLSDDDRKTQLAALDAKLSALNTAQSKQ"
FT   sig_peptide     complement(594136..594213)
FT                   /locus_tag="Bphyt_4523"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.905 at
FT                   residue 26"
FT   gene            complement(594255..595178)
FT                   /locus_tag="Bphyt_4524"
FT   CDS_pept        complement(594255..595178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4524"
FT                   /product="phosphonate ABC transporter, ATPase subunit"
FT                   /note="KEGG: bxe:Bxe_B0839 ABC phophonates transporter,
FT                   ATPase subunit PhnC; TIGRFAM: phosphonate ABC transporter,
FT                   ATPase subunit; PFAM: ABC transporter related; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4524"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18897"
FT                   /db_xref="GOA:B2TGT6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR012693"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2TGT6"
FT                   /protein_id="ACD18897.1"
FT                   /translation="MHQGVLMETIREAIRIERLSKTFSNGRKALDEIDLRVEPGEMVAL
FT                   IGASGSGKSTLLRHIAGFTASDAQPSQISILGRPIQQNGRIVREVRSIRRDIGFVFQQF
FT                   NLVNRLSVESNVLIGALARLPLWRRLSGRFPRAERALSMAALNEVGIGEHARERAANLS
FT                   GGQQQRAALARALVQRARIVLADEPIASLDPESSRRVMEMLRTLNVEHQLTVLVSLHQV
FT                   DIAMQYCPRTIALRRGKVVYDGPSAALTPVLLKKLYGDDARELLDAAPISAEDLDTKTV
FT                   NGSTPAQSTAPASTRYAFALNPAHSN"
FT   gene            595452..596486
FT                   /locus_tag="Bphyt_4525"
FT   CDS_pept        595452..596486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4525"
FT                   /product="zinc carboxypeptidase-related protein"
FT                   /note="KEGG: bxe:Bxe_B0840 zinc carboxypeptidase-related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4525"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18898"
FT                   /db_xref="GOA:B2TGT7"
FT                   /db_xref="InterPro:IPR000834"
FT                   /db_xref="UniProtKB/TrEMBL:B2TGT7"
FT                   /protein_id="ACD18898.1"
FT                   /translation="MQPLSFLPDSFAEYEDLRTILEQGSASFAIRTVCETTVRGRQFAV
FT                   QTASIGSTDPQAPAIGFFGGIHGLERIGSQLVLDYMRALLARLEWDELLVRQLQSIRLI
FT                   FMPIVNPGGMWAATRANPNGVDLMRNAPQNADERVPLLAGGQRVGAWLPWYRGRVGAPM
FT                   EPEASALLQVVETELATRPLSIALDCHSGYGWSDSIWFPYARTRKVMPHLPEMYVLKTM
FT                   FERAHPHHGYAFEPQSHQYLLHGDLWDFAYDRAPAPNVFLPMTLELGSWLWIKKNPRQL
FT                   FSRQGMFNPVKAHRTARVLRRHANLLDFLARAAFSSQRWLPQGNRREQLLQSAIDHWYK
FT                   PESV"
FT   gene            596483..597283
FT                   /locus_tag="Bphyt_4526"
FT   CDS_pept        596483..597283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4526"
FT                   /product="alpha/beta hydrolase fold"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: bxe:Bxe_B0841
FT                   putative hydrolase, alpha/beta fold family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4526"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18899"
FT                   /db_xref="GOA:B2TGT8"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B2TGT8"
FT                   /protein_id="ACD18899.1"
FT                   /translation="MSTWILLRGLTREVRHWGRLPGLLHGAVNESALHIGALGRLLLLD
FT                   LPGNGEFAHLRAPSTVADMVGFVRNAALQSGMPGPYCVLAMSLGGMVATDWAQRHPYEI
FT                   ERLVLINTSMRPFSQMQERLRPSAWSGLLGVAAHWRDAPRAEHGIHRLTCNNVQTLGDD
FT                   LDAWSRIRRSAPVSRGNALRQLWAAARFTAGAARPECPLLILSSRVDKLVDPVCSAKLA
FT                   AAWGALHCEHPWAGHDLPHDDPAWTSEQVRAWLAQEHAVPRAVL"
FT   gene            597453..602294
FT                   /locus_tag="Bphyt_4527"
FT   CDS_pept        597453..602294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4527"
FT                   /product="NAD-glutamate dehydrogenase"
FT                   /note="PFAM: NAD-glutamate dehydrogenase; KEGG:
FT                   bxe:Bxe_B0842 putative NAD-glutamate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4527"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18900"
FT                   /db_xref="GOA:B2TGT9"
FT                   /db_xref="InterPro:IPR007780"
FT                   /db_xref="InterPro:IPR028971"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2TGT9"
FT                   /protein_id="ACD18900.1"
FT                   /translation="MQAKNEEAVTHLLNDVVEFARGRLPEPTFKVVEPFLRHYYDFVDS
FT                   DDLQSRSIADLYGAALAHWQTAQRFTPGAERLRVYNPILEQHGWHSDHTVIEIVNDDMP
FT                   FLVDSVSMAVNRQGLALHSVVHPVFRIWRAPDGSIARVSQGAEEATDSRSHLTSFIHFE
FT                   VDRCGDAAKLDALRDEIAKVLRDVRAAVEDWPKIVELARVTIKGMKAGEGGPEGLEARA
FT                   FLEWMVADHFTFLGQRDYELVQHDIGYGLRAVPGSGLGILRDALRPAGAAEITPLPPAA
FT                   AEIISGSSPIFLTKANSRATVHRPGYLDYVGIKLTGADGKVTGERRFIGLYTSTAYFVS
FT                   AAEIPIVRRKCANIVRRAGFLPKGHLAKSLVTVLETYPRDELFQAEENQLYDIALGVLR
FT                   LQEHQRTRLFIRRDRFDRFVSCLVFVPRDKYNTDLRQRIANLLVDAFNGESVEFTPLLS
FT                   ESTLARIHFVVHAKPGGMPNVDTRELEARLVQVARRWQDDLADALLDAFGEEQGNRLLQ
FT                   HYGDSFPAGYRDDYPARTAVRDIELIEHVQGSERLAMNLYRPIESGPRAFRFKVYRAGL
FT                   PIALSRSLPMLEHLGVRVDEERPYLIEALGATPAWIHDFGLELADDAEFDIERVKDLFE
FT                   EAFEKVWTGAIESDDFNRLVLRAQLNAREVTILRAYAKYLRQVGSTFSDAYIERAVTGN
FT                   PAIARMLVELFIARFNPVLGETREARVDGWLHTIDSALDQVPNLDEDRILRQFLGVIKA
FT                   TKRTNYYRFDADGHPKPYLSFKFDPAQVPGLPEPKPMFEIWVYSPRVEGVHLRGGRVAR
FT                   GGLRWSDRREDFRTEVLGLMKAQMVKNVVIVPVGSKGGFVVKNPPPQTERDAWMREGIA
FT                   CYQTFLRGLLDVTDNLAGTTIVPPPDVVRHDPDDPYLVVAADKGTATFSDYANAISQEY
FT                   GFWLDDAFASGGSVGYDHKKMAITARGAWESVKRHFREMGVDTQTMDFTVVGVGDMSGD
FT                   VFGNGMLLSPHIKLVAAFDHRHIFLDPNPDPAVSLAERGRLFILDRSSWADYDPSLISA
FT                   GGGVFPRSAKTIPLSPAVQSVLGISAPALAPAELMRAILQAPVDLLYNGGIGTYVKASR
FT                   ESHLQVGDRANDAIRVNGSDLQCKVVAEGGNLGLTQLGRIEFAQRGGRINTDAIDNSAG
FT                   VDCSDHEVNIKILLGLVVSDGEMTEKQRNALLAEMTDEVGLLVLQDNYYQTQALSIAGR
FT                   YGVELLDAEARLMRYLERAGRLNRVIEFLPTDEEVAERQAAKQGLTTPERAVLLAYSKM
FT                   WLYDALLESPMPEDPLVSDMLVEYFPKPLRQRFSEPMQRHPLRREILATHLTNALVNRV
FT                   GCEFVHRLMEETDAQPGEIVRAIIMARDVFDLDDVWRSIDALDNRVADDIQARMFVEVA
FT                   RLVERSALWFLRQLQSGAVSDRDVAGLLARCRDAAQRLAPQWPALLPGADLEALSERQR
FT                   VFADAGVDSELAVRIAGGEISAALLDIAEVASTSGRSLELVAGVYFALGTLLNSSWISE
FT                   RAAALPVPTHWDMLARATAVADIARLKRALTTSALADADDASTPEALVEAWREKRTVQL
FT                   ERYAHLLADLRATGGASLSMLLVIVREMAALERA"
FT   gene            602492..603397
FT                   /locus_tag="Bphyt_4528"
FT   CDS_pept        602492..603397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4528"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /note="TIGRFAM: cation diffusion facilitator family
FT                   transporter; PFAM: cation efflux protein; KEGG:
FT                   bxe:Bxe_B0843 heavy metal/H+ antiporter, CDF family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4528"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18901"
FT                   /db_xref="GOA:B2TGU0"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR040177"
FT                   /db_xref="UniProtKB/TrEMBL:B2TGU0"
FT                   /protein_id="ACD18901.1"
FT                   /translation="MKEESPKAIFYALAANLGIAICKFAAAAFTGSGSMFAEAIHSTAD
FT                   CGNQLLLLFGLREARKPASPLHPMGGGREINFYSLLVALLLFFVGGAFSVYEGVHRLFV
FT                   REPLQYAYVALAVLGVSVVLEALSLWGAVKEIRKTHPDKSMWRWFRETRESELLVVAGE
FT                   DIAALAGLAMAFAAVLLTMMTGNPVYDALGSIGVGVLLMVIAWLVAREVKSMIVGESAS
FT                   PEVRRAIEAHLRGRTEIRSIINMITLQWGRHVVVAVQAEMIDYASGRAMVDAINVIEAD
FT                   LQATFPQVRWVFFEPEVPRV"
FT   gene            complement(603414..604394)
FT                   /locus_tag="Bphyt_4529"
FT   CDS_pept        complement(603414..604394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4529"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: bxe:Bxe_B0844
FT                   putative aldo/keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4529"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18902"
FT                   /db_xref="GOA:B2TGU1"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:B2TGU1"
FT                   /protein_id="ACD18902.1"
FT                   /translation="MDYVKLGRTGLDVSRLCLGCMSYGVPSRGTHPWSLDDEAARPFIK
FT                   QALDHGINFFDTANVYSDGTSEEIVGRALKDFAKRDEIVLATKVNSRMHPGPNGAGLSR
FT                   KAIMSEIDHSLRRLGTDYVDLYQIHRWDYGTPIEETMEALHDVVKAGKARYIGASSMYA
FT                   WQFAKALHVAEKNGWTRFVTMQNYVNLLYREEEREMLPLCESEGIGVIPWSPLARGRLT
FT                   RDWNTESARSETDEFGQTLYAQTEDADRRVVERVSQIAKERGVPRAQVALAWVLQKKPI
FT                   TAPIVGATKLHHLDDAVAALSLSLSADEIRQLEELYVPHAVTGFK"
FT   gene            604628..605701
FT                   /locus_tag="Bphyt_4530"
FT   CDS_pept        604628..605701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4530"
FT                   /product="purine nucleoside permease"
FT                   /note="PFAM: purine nucleoside permease; KEGG:
FT                   bxe:Bxe_B0845 concentrative nucleoside/H+ anitporter, CNT
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4530"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18903"
FT                   /db_xref="GOA:B2TGU2"
FT                   /db_xref="InterPro:IPR009486"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:B2TGU2"
FT                   /protein_id="ACD18903.1"
FT                   /translation="MLTRSLGAVCAITLAACAAFSSGPASADDNDGFSRGDGGSHGQPV
FT                   KVMIISMFGPEGQVWLDNLGPWREITVDGLSPDYPTVHCNKQDVCVMTTGMGHTNAAAS
FT                   IMALTFSPRFDLRHTYFMVAGIAGIDPQQGTVGSAAWAKYLVDFGIQWEIDGREIPPNW
FT                   NTGYLGINTTSPSDKPPLDYRTEVFQLNKRLANTAFALSRHVTLSDNAQAQAARAKYSY
FT                   PPANLPPTVIQCDTLAGDTWWSGTLLGQRARDWTKILTDGKGVYCTTQQEDNATYEALK
FT                   RAASVHKVDLDRVAVLRAGSDFDRPYDGQTSADNLLNYAAQGGFTIAIQNLFLSGNPLV
FT                   QDISTHWGEWRDGVPRR"
FT   sig_peptide     604628..604711
FT                   /locus_tag="Bphyt_4530"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 28"
FT   gene            complement(605924..606232)
FT                   /locus_tag="Bphyt_4531"
FT   CDS_pept        complement(605924..606232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4531"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0846 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4531"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18904"
FT                   /db_xref="InterPro:IPR025421"
FT                   /db_xref="UniProtKB/TrEMBL:B2TGU3"
FT                   /protein_id="ACD18904.1"
FT                   /translation="MKRNLLAGLALSLLVSAPVFAQSSSGGIGRAGSYNTQPAPTTTAK
FT                   SREEVKAELVAAYRDGSLPALNRTTYPNKGLIGQTQAERIARQEGTSGDVTRVANGQ"
FT   sig_peptide     complement(606167..606232)
FT                   /locus_tag="Bphyt_4531"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.994 at
FT                   residue 22"
FT   gene            complement(606467..607471)
FT                   /locus_tag="Bphyt_4532"
FT   CDS_pept        complement(606467..607471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4532"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bxe:Bxe_B0847 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4532"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18905"
FT                   /db_xref="GOA:B2TGU4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2TGU4"
FT                   /protein_id="ACD18905.1"
FT                   /translation="MDRLQAMQVFTRVVDTNSFTRAAETLDLPRASVTTIIQNLEAFLG
FT                   TRLMHRTTRRLSLTPDGAAYYERCVRILADVEETEASFQSGNKKPHGKLRIDMPGSIGR
FT                   LLVIPSLCEFHTRYPDIDLQLGLTDRPVDLLQEGVDCVVRVGALQDSSLVARRIGLFEG
FT                   VTCAAPDYIERAGMPTSLEDLENHKAVNYFSSRTGRTLDWAFLVDGKEIEVKMKSIVSV
FT                   NDADAYVTCGLEGFGLIQPALFMVLPHLRSGQLVEVLPELKPLPMPISAVYPHSRHLSP
FT                   KVRVFVDWIAELFDRCPLLSGRGSLDATCTKRTFEERESAPMLDTPVITEWVA"
FT   gene            607634..608518
FT                   /locus_tag="Bphyt_4533"
FT   CDS_pept        607634..608518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4533"
FT                   /product="Alpha/beta hydrolase fold-3 domain protein"
FT                   /note="PFAM: Alpha/beta hydrolase fold-3 domain protein;
FT                   KEGG: bxe:Bxe_B0848 putative carboxylesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4533"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18906"
FT                   /db_xref="GOA:B2TGU5"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B2TGU5"
FT                   /protein_id="ACD18906.1"
FT                   /translation="MRIARLDMEAFKPPYSFVPTGSSPAEADSTALEVSDVQIEGHAQD
FT                   ITLRLYRQEKKTSLPVLLYFHGGGFTKGSIDQADYASRYFAEHLPALVVSVGYSLAPQF
FT                   PFPAAPEDAHRAALWVQTRARAFGGNSKKVGVAGHDAGGQLANCLAFIARDRGDVRISA
FT                   QALFGPMLDPSLTRLGDEKRLGSDITAKECAACYRAYLPQASQRMHPYAAPLESSRLAG
FT                   LPATLIATAQNDVLHVEAEKYASSLIDAGVLTQVVRYPSVSHAALADHPPALQEAVRFF
FT                   QWRFDARASLKQK"
FT   gene            608553..609827
FT                   /locus_tag="Bphyt_4534"
FT   CDS_pept        608553..609827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4534"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   bxe:Bxe_B0849 RND efflux pump, membrane fusion protein,
FT                   CzcB subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4534"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18907"
FT                   /db_xref="GOA:B2TGU6"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:B2TGU6"
FT                   /protein_id="ACD18907.1"
FT                   /translation="MTILPLSRRRVAIAALAVIVVAGLGTFGAIRVDASSPAAPTIVPE
FT                   VDVATVVQKTITDWQSYSGRLEAVEKVDVRSQVPGTIVSVNFKDGALVKKGDTLFVIDP
FT                   RPYAAEVDRAEAQLAAAQARTGYTQSDWERAQRLIADNAIAKRDYDEKQNAAREASANL
FT                   KAAQAALETARINLGYTKIVAPVSGRVSRAEITVGNVISAGATAAPLTTLVSVSPIYAS
FT                   FDADEQTYLQYLSRAKDGSKVPVELGLADETGYSRSGVIESVDNRLDTSSGTIRVRARF
FT                   DNQDGALIPGLYARVKVGGSEPHPALLIDDAAVGTDQDKKFVLVVDQNNHVAYRSIDVG
FT                   GMQGNLRVVKGGLKATDRIVVNGIQRVRPGDAVRAHMVPMTTDGDPNSAPLAQKQTPAQ
FT                   PQSQAQSQAQTQAQTQTRTKADKNS"
FT   sig_peptide     608553..608657
FT                   /locus_tag="Bphyt_4534"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.993) with cleavage site probability 0.486 at
FT                   residue 35"
FT   gene            609884..613069
FT                   /locus_tag="Bphyt_4535"
FT   CDS_pept        609884..613069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4535"
FT                   /product="transporter, hydrophobe/amphiphile efflux-1
FT                   (HAE1) family"
FT                   /note="TIGRFAM: transporter, hydrophobe/amphiphile efflux-1
FT                   (HAE1) family; PFAM: acriflavin resistance protein; KEGG:
FT                   bxe:Bxe_B0850 hydrophobe/amphiphile efflux pump, RND
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4535"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18908"
FT                   /db_xref="GOA:B2TDZ1"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004764"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:B2TDZ1"
FT                   /protein_id="ACD18908.1"
FT                   /translation="MNISKFFIDRPIFAGVLSVLILLAGIISLFKLPISEYPEVVPPSV
FT                   VVHAQYPGANPKVIAEAVASPLEEQINGVENMLYMQSQANSDGNLTLTVTFKLGTNPDL
FT                   ATQLVQNRVNQALPRLPEDVQRLGVTTIKSSPTLTMVVHLISPNNRYDMTYLRNYALLN
FT                   VKDRLARIQGVGEVQLWGSGDYAMRVWLDPQKVSQRGLTATEVVNAIREQNIQVAAGVI
FT                   GASPSVPGTQLQLSVNARGRLRTEGEFGDIIVKTTPDGGVTYLKDIARIELAASEYGLR
FT                   SLLDNKPAVALAINQAPGANSLAISDQVRTAMKELAEDMPAGVEYKIVYDPTQFVRSSI
FT                   EAVVHTLLEAIALVVIVVIVFLQTWRASIIPLIAVPVSIVGTFSLLLAFGFSINALSLF
FT                   GMVLAIGIVVDDAIVVVENVERNIENGLSARDATYKAMQEVSGPIIAIALTLVAVFVPL
FT                   AFMTGLTGQFYKQFAMTIAISTVISAFNSLTLSPALSAMLLRSHGAKEDFLTRVMNRVL
FT                   GGFFRRFNKVFHRGSTEYGRGVTGVLRRKGAMLAVYAILLGATVLISRVVPGGFVPAQD
FT                   KEYLIAFAQLPNGASLDRTEKVIRDMSSIALKQPGVESAVAFPGLSVNGFTNSSSAGIV
FT                   FVTLKPFKDRGNKKLSAGAIAGALNQQYGAIKDSFVAVFPPPPVLGLGTLGGFKMQLED
FT                   HGALGYAELNKAAEAFVKKAAQTPELGPTFSSYQINVPQLNVDLDRVKAKQLGVPVTDV
FT                   FNTMQIYLGSLYVNDFNRFGRVYQVRVQADAPFRQRADDILQLKTRNAAGDMVPLSSLV
FT                   TVTPTFGPEMVVRYNGYTAADINGGPAPGFSSGQAQAAAERVAAEVLPHGVKLEWTDLT
FT                   YQQILAGNAGLWVFPISVLLVFLVLAALYESLTLPLAVILIVPMSVLSALTGVWLTGGD
FT                   NNIFTQIGLMVLVGLSAKNAILIVEFARELEHDGHTPLSAAIEASRLRLRPILMTSIAF
FT                   IMGVVPLVLSSGAGSEMRHAMGIAVFFGMLGVTLFGLMLTPVFYVVLRTLAGGTIHVAQ
FT                   KDSPHYGAPVTDA"
FT   gene            613083..614684
FT                   /locus_tag="Bphyt_4536"
FT   CDS_pept        613083..614684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4536"
FT                   /product="RND efflux system, outer membrane lipoprotein,
FT                   NodT family"
FT                   /note="TIGRFAM: RND efflux system, outer membrane
FT                   lipoprotein, NodT family; PFAM: outer membrane efflux
FT                   protein; KEGG: bxe:Bxe_B0851 RND efflux system, outer
FT                   membrane lipoprotein, NodT family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4536"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18909"
FT                   /db_xref="GOA:B2TDZ2"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:B2TDZ2"
FT                   /protein_id="ACD18909.1"
FT                   /translation="MKRFESLSGWGRAAASGLLVALLAACSLEPTYKRPDVDAPAAFKE
FT                   APAASATAGASAPSAASGVSAQDNGTWKQAQPADDAHRGEWWTIFGDPQLNALEEQASA
FT                   ANQDLKAAAARVQQARAVTQAAKSDWFPKLDAGFGPTRERASAASQFQPDSVGGTNGTI
FT                   WRAQTTASYEADLFGRVGSNVNASRSDEQQSEALFRSVQLSLQADVAQNYFQLRELDTD
FT                   QDLYRRTVALREDTLKLVERRFKEGDIGELDVSRARNELASARADAVGVARQRAASEHS
FT                   LAILLGKPPADFSFAEAPLVPVTVRVPPGLPSDLLERRPDISAAERAMQAANARVGLAK
FT                   SAFFPKLDITGGAGFESATLGDLFKWSSRAFILGPFAGTALTLPLFDGGRRKANLAQAR
FT                   SKYDEDVAQYRQQVLVAFREVEDNLSDLRLLDDQMREQNDAVQASQRAAHLSRTQYTEG
FT                   AVSYLDVIDGERQVLTSQLQASHLSGTQAVATVNLIRALGGGWGDVKAADTAVGAVAPA
FT                   SAPVTAAAAVQQVAKQ"
FT   sig_peptide     613083..613166
FT                   /locus_tag="Bphyt_4536"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.902) with cleavage site probability 0.669 at
FT                   residue 28"
FT   gene            615060..615899
FT                   /locus_tag="Bphyt_4537"
FT   CDS_pept        615060..615899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4537"
FT                   /product="NLPA lipoprotein"
FT                   /note="PFAM: NLPA lipoprotein; KEGG: bxe:Bxe_B0852 ABC
FT                   methionine transporter, periplasmic ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4537"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18910"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:B2TDZ3"
FT                   /protein_id="ACD18910.1"
FT                   /translation="MRIFLSTVQRFFHTPAVSLISAFGLALVLQATPASAADSPTLKIG
FT                   TATSPQIEALKIAAREAKEQGLDVKIIEFTDWNTPNAALANKDIDVNYFQHIPFLENAK
FT                   KQGGYNFVAIAPGTIMKIGLYSKKIKRFDELKDGATVAIANDPVNGGRGLLLLQRAGLI
FT                   KLKPGIDYRATTLDIIDNPKHLKIVQLEASQLARSLDDVDLAQGYPSFIKLAGTTDPNS
FT                   ALLFDGLENKNYAIQWVVRPESANDPRIRKFIAIYQHSPAVRAALDKAFGNLYAVAW"
FT   sig_peptide     615060..615170
FT                   /locus_tag="Bphyt_4537"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 37"
FT   gene            615943..617349
FT                   /locus_tag="Bphyt_4538"
FT   CDS_pept        615943..617349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4538"
FT                   /product="flavin-dependent oxidoreductase"
FT                   /note="KEGG: bvi:Bcep1808_3569 flavin-dependent
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4538"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18911"
FT                   /db_xref="GOA:B2TDZ4"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR016215"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:B2TDZ4"
FT                   /protein_id="ACD18911.1"
FT                   /translation="MAKKKILLNAFNMNAVGHINHGLWTHPRDRSAHYTDLDYWTSLAQ
FT                   TLERGKFDGIFLADIVGVYDVYQGGPETPLRESVQIPINDPSLIVPAMAHVTKHIGFGV
FT                   TSNLTYEPPYLFARRMSTLDHLTKGRVGWNIVTGYLDSAARGMGLAQQISHDDRYDRAD
FT                   DYMDVVYKLWEQSWEDDAVVRDRAARIFSHPDKVHRVKHDGPYYSIDAIHLSEPSPQRT
FT                   PVLYQAGSSSRGVDFAARHAECVFVGGQNKQLTRSIVDDIRARAVSFGRAPDDIKIFAG
FT                   ITVVVGETERLAQEKFEEYRRYASAEGGIAHFSSSTGIDFSQYELDEPISYVKTESMQS
FT                   AVEAISKKSVSGVWTKRKVLEQMTLGGRAKPVVGSPQQIADELVSWIEEAGVDGFNLTR
FT                   TVMPESFEDFVNLVVPELQNRGIYKEDYDPAPTLREKLFGGGRARLPDVHAGAQHRRRV
FT                   QAAAPVAADA"
FT   gene            617368..618528
FT                   /locus_tag="Bphyt_4539"
FT   CDS_pept        617368..618528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4539"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bxe:Bxe_B0853 ABC methionine transporter, ATPase
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4539"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18912"
FT                   /db_xref="GOA:B2TDZ5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017908"
FT                   /db_xref="InterPro:IPR018449"
FT                   /db_xref="InterPro:IPR026253"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041701"
FT                   /db_xref="UniProtKB/TrEMBL:B2TDZ5"
FT                   /protein_id="ACD18912.1"
FT                   /translation="MANLFDVPQFIEDAPSLAVNPDSHATATQPAVIFDNVGKVFADAR
FT                   GVSTAALANVTLNVARGEVFGIIGRSGAGKSTLLRLVNGLEKPSSGAVRVNGVSVGELD
FT                   ERGLVALRRRIGMVFQHFNLLSAKTVRENIALPLKIAGVPKAAIDKKVDALLELVGLSA
FT                   KRDAYPASLSGGQKQRVGIARALVTDPDILLCDEATSALDPETTQAILALLRDINQRLN
FT                   LTIVLITHEMQVIREVCDTVAVIERGEVVETGAVWRVFGDPQHDATRALLRTLVHDLPI
FT                   DLAKRIKPLNDIGQADAQILLDVRFTGVDAREPDLGGLASALSVDGGHVSFVHGGIDRI
FT                   QGHAQGRLVVSAQVRADDGSTVQKQIAALLDSARRYANHVEVLGYV"
FT   gene            618521..619177
FT                   /locus_tag="Bphyt_4540"
FT   CDS_pept        618521..619177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4540"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bxe:Bxe_B0854 ABC
FT                   methionine transporter, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4540"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18913"
FT                   /db_xref="GOA:B2TDZ6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B2TDZ6"
FT                   /protein_id="ACD18913.1"
FT                   /translation="MSELWLSELADAIRDTIVMVGVSAFVAALIGIPLALVLVTTTRGG
FT                   IFEKRAVNSTLGALVNAFRSTPFIILLVALLPLTRLLIGTTIGVWAAIVPLSIAAIPFF
FT                   ARVAEVSLREVDRGLIEAAQAMGAQRRHIIWHVLLPEALPGILGGFTITVVAMIGSSAM
FT                   AGAVGAGGLGDLAIRYGYQRFDTTVMVTVIVLLIAIVTAVQFVGDRFVRRLAQRA"
FT   gene            619333..620535
FT                   /locus_tag="Bphyt_4541"
FT   CDS_pept        619333..620535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4541"
FT                   /product="Acyl-CoA dehydrogenase type 2 domain"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase type 2 domain; KEGG: bxe:Bxe_B0855
FT                   putative monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4541"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18914"
FT                   /db_xref="GOA:B2TDZ7"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013107"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B2TDZ7"
FT                   /protein_id="ACD18914.1"
FT                   /translation="MNDPRHADALQTPQAFAESEVRDLAGLLDALRASAAQRDIDGGHA
FT                   AREKQWIADAGLLTLAVPREFGGLGARWPDIYETIRKIAQVDSALAHLLGFTCLQVVSV
FT                   NVWGNPEQRARYLSGTVEGRWWWGNAVNPLDTRLVASATDDGGYLLDGQKGFCSGTRGS
FT                   QMMTVSAHDPLTGKPVFGVVPTTREGITVHDDWNPIGQRQTDSGSVSFTRVKVEPNEVM
FT                   VRPDTPHASLRTLISQQVLTNLFVGIAQGALDEARAYVTQNGKAWIYSGVDKATDDPYL
FT                   IQRFGEMRLQAVSAEALATRAAWLLEDAWQQGPALTAETRAQVALATSEAKIVAHRAAL
FT                   DVSEKLFDACGARATHAPLALDRFWRNARVHTLHDPLDYRVRDVGRYALTGALPEVSLY
FT                   T"
FT   gene            620596..621924
FT                   /locus_tag="Bphyt_4542"
FT   CDS_pept        620596..621924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4542"
FT                   /product="Mn2+/Fe2+ transporter, NRAMP family"
FT                   /note="TIGRFAM: Mn2+/Fe2+ transporter, NRAMP family; PFAM:
FT                   natural resistance-associated macrophage protein; KEGG:
FT                   bxe:Bxe_B0856 manganese transport protein MntH"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4542"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18915"
FT                   /db_xref="GOA:B2TDZ8"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="UniProtKB/TrEMBL:B2TDZ8"
FT                   /protein_id="ACD18915.1"
FT                   /translation="MQFKLPTTATAPFCPSEVQGSVAVSPGAPFWKKILQFAGPGLLIS
FT                   IGYMDPGNWATDIEAGSRYGYSLLFVVMLSSLAAMALQCLSMRLGIATGRDLAALSRDR
FT                   YSPRVARFQWLLAELSIVACDLAEVLGGALAFHLLFKCSLTTGVLLTAFDTLIVLGLKG
FT                   KNFRDLEAIMLGLIATIGVGYIIELALVQPHWPSVAQGLIPSWQALSSREPMYLAIGIL
FT                   GATVMPHNLYLHSSIVQTRAVKRDPASIRSAIGMSRIDTIGSLVFALLINMAILILAAA
FT                   AFHATGHNQVTEIEDAYKLLAPIVGTGFAAVLFAVTLLASGQSSTFTGTVAGQVIMEGF
FT                   LKLKIPCWQRRFITRALALIPALIGVQMMGNGAVGKLLVASQVVLSLQLPFALYPLIRM
FT                   TSDRALMGEFANTLLTRFVSWTLFVVISAANLWLVVQTVGIAG"
FT   gene            complement(622063..622632)
FT                   /locus_tag="Bphyt_4543"
FT   CDS_pept        complement(622063..622632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4543"
FT                   /product="flagellar transcriptional activator FlhC"
FT                   /note="PFAM: flagellar transcriptional activator FlhC;
FT                   KEGG: bxe:Bxe_B0857 transcriptional activator FlhC"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4543"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18916"
FT                   /db_xref="GOA:B2TE01"
FT                   /db_xref="InterPro:IPR007944"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE01"
FT                   /protein_id="ACD18916.1"
FT                   /translation="MLKRSLTEDAQEVFRAIALIELGARMQVLESELTLSRDRMIRLYR
FT                   EVKGVSPPKGMLPFSADWYMTWLANIHASLFYNTYLFLKNEARCSHLDALTKGYRLYLE
FT                   HCQHSETEPVLDLTRAWTLVRFFDADILQLTKCCRCTGKFVAHKHDLQHNVVCGACQPP
FT                   SRAGKTKKAAAARQEALEAAQIAQAA"
FT   gene            complement(622647..622967)
FT                   /locus_tag="Bphyt_4544"
FT   CDS_pept        complement(622647..622967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4544"
FT                   /product="flagellar transcriptional activator"
FT                   /note="PFAM: flagellar transcriptional activator; KEGG:
FT                   bxe:Bxe_B0858 transcriptional activator FlhD"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4544"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18917"
FT                   /db_xref="GOA:B2TE02"
FT                   /db_xref="InterPro:IPR023559"
FT                   /db_xref="InterPro:IPR036194"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE02"
FT                   /protein_id="ACD18917.1"
FT                   /translation="MDRSSETLDSIREINLSYIMLAQRMLREDKPVGMFRLGLSSELAD
FT                   LLAGLSLAQIVKLAASDQLLCFFRFNDHSMLSALTQTTKHTAVAPTHAAILLAGQPAEQ
FT                   FA"
FT   gene            complement(623501..624724)
FT                   /locus_tag="Bphyt_4545"
FT   CDS_pept        complement(623501..624724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4545"
FT                   /product="protein of unknown function DUF395 YeeE/YedE"
FT                   /note="PFAM: protein of unknown function DUF395 YeeE/YedE;
FT                   KEGG: bmu:Bmul_3826 protein of unknown function DUF395
FT                   YeeE/YedE"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4545"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18918"
FT                   /db_xref="GOA:B2TE03"
FT                   /db_xref="InterPro:IPR007272"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE03"
FT                   /protein_id="ACD18918.1"
FT                   /translation="MSDLSTSLPRVPRRFDINPKPLGAALVLIALGAVYLAQTVSGRQA
FT                   ALYLVGALLGMSLYHAAFGFTSAWRVFIADGRGAGLRAQMLMLALGVLLFFPALQAGTL
FT                   FGHPVVGLVAPAGTSVLVGAFMFGIGMQLGGGCASGTLYTVGGGSTRMIVTLAAFVIGS
FT                   VVATAHMPFWTALPSLKPLSLVTVFGAGWAIALNLAVFAAIAALTVLIERRRHGQLVNE
FT                   PPRQPHTSPWLHGPWPLFVGAIALTLLNFATLALSGRPWGVTSAFALWGAKLFATLGID
FT                   VADWPYWAAHANANSLAAPVTHDVTSVMDIGIILGAMSAAALAGRYAPVWKVPARSLIA
FT                   AVVGGLMLGYGARLAYGCNIGAYFSGIVSGSLHGWLWLAAAFAGNVLGTRLRPAFGLEV
FT                   ERVRSTGC"
FT   sig_peptide     complement(624611..624724)
FT                   /locus_tag="Bphyt_4545"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.846) with cleavage site probability 0.697 at
FT                   residue 38"
FT   gene            complement(624895..625434)
FT                   /locus_tag="Bphyt_4546"
FT   CDS_pept        complement(624895..625434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4546"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   bxe:Bxe_B0859 putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4546"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18919"
FT                   /db_xref="GOA:B2TE04"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE04"
FT                   /protein_id="ACD18919.1"
FT                   /translation="MHLNDNAVLVRQLGPDDRHDYFQLRLRGLKAHPDSFGQSYEEALA
FT                   KGPSQHDALLKGSHAAQGDFLLGAYASAGSPLIGVVGLIRNPGDKQRHKAALIGMYVAP
FT                   EAAGRGVGRALLNELLARASRVEGLRQIQLHVGSRNEAARKLYESLGFRKFGCEVGALN
FT                   VGGVFHDADLMALFIQ"
FT   gene            complement(625508..626374)
FT                   /locus_tag="Bphyt_4547"
FT   CDS_pept        complement(625508..626374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4547"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   bxe:Bxe_B0860 transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4547"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18920"
FT                   /db_xref="GOA:B2TE05"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR041413"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE05"
FT                   /protein_id="ACD18920.1"
FT                   /translation="MNTLSLAQNVPSHASAASRTVGDLLREWRQRRRMSQLLLAAEADI
FT                   STRHLSFVESGRAVPSREMVMHLAERLDVPLRARNALLVAAGYAPLFRERPLSDPQLAA
FT                   AREAVELVLKGHEPYPALAIDRHWTIIAANNALMPLLTGASPELLKPPVNALRLSLHPE
FT                   GIAASIVNWHAWREHILARLQRQIDVSGDSTLSALRDELAAYPAPPDAEPAGHDNAGVN
FT                   QIAVPLRLRTPIGVLSFFSTTTVFGTPVDVTLSELAIEAFFPADQQTAAALREFGESQR
FT                   TEAARQP"
FT   gene            complement(626548..626850)
FT                   /locus_tag="Bphyt_4548"
FT   CDS_pept        complement(626548..626850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4548"
FT                   /product="putative transcriptional regulator"
FT                   /note="TIGRFAM: addiction module antidote protein; KEGG:
FT                   bxe:Bxe_B0861 predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4548"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18921"
FT                   /db_xref="GOA:B2TE06"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR014057"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE06"
FT                   /protein_id="ACD18921.1"
FT                   /translation="MSKIKTARFDASDYLDSEEAIAEYLNAALEDGDADVLLAAIADIA
FT                   KARGITKVAADAGLGRESLYKTLAPGSKPRMDTVLKLLRALGVKLNVVPEGVAAA"
FT   gene            complement(626847..627218)
FT                   /locus_tag="Bphyt_4549"
FT   CDS_pept        complement(626847..627218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4549"
FT                   /product="addiction module killer protein"
FT                   /note="TIGRFAM: addiction module killer protein; PFAM:
FT                   protein of unknown function DUF891; KEGG: bxe:Bxe_B0862
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4549"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18922"
FT                   /db_xref="InterPro:IPR009241"
FT                   /db_xref="InterPro:IPR014056"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE07"
FT                   /protein_id="ACD18922.1"
FT                   /translation="MVFTLARSYPQGYTAQQIGSPPVYEVNRTEQFDAWLATLADLRAR
FT                   AKILVRIRRAERGHFGDVKLLEDGVSEMRIDCGPGYRVYFAREGRMVYLLLCGGVKATQ
FT                   PADIKHAKAMWAAIRKELS"
FT   gene            627493..627861
FT                   /locus_tag="Bphyt_4550"
FT   CDS_pept        627493..627861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4550"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0863 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4550"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18923"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE08"
FT                   /protein_id="ACD18923.1"
FT                   /translation="MNAHTDLIDRYFDAWNETDGARRRELIAATWSADADYRDPLLAGA
FT                   GHAGIDAMIRAVHERFPHHTFRRTGQVDGFADRLRFSWELTTPAGDAIVKGSDFGVIDP
FT                   HGRLQAVTGFLDQVPDGV"
FT   gene            627889..628239
FT                   /locus_tag="Bphyt_4551"
FT   CDS_pept        627889..628239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4551"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0864 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4551"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18924"
FT                   /db_xref="GOA:B2TDZ9"
FT                   /db_xref="UniProtKB/TrEMBL:B2TDZ9"
FT                   /protein_id="ACD18924.1"
FT                   /translation="MHEPAAATAPQSAITLARLSGALDSLSSVVAGFALLAGARAFMFI
FT                   ALLGWREPVLSGAGLVLLAAVGWLRWQCGEAVTVPAMRRVRPTTRSSSATCSRLAPLST
FT                   NARDVACYNRPL"
FT   gene            628410..628874
FT                   /locus_tag="Bphyt_4552"
FT   CDS_pept        628410..628874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4552"
FT                   /product="RbsD or FucU transport"
FT                   /note="PFAM: RbsD or FucU transport; KEGG: bxe:Bxe_B0865
FT                   RbsD or FucU transport"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4552"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18925"
FT                   /db_xref="GOA:B2TE00"
FT                   /db_xref="InterPro:IPR007721"
FT                   /db_xref="InterPro:IPR023750"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE00"
FT                   /protein_id="ACD18925.1"
FT                   /translation="MLKNLDPLLNADILHALRAMGHGDELVICDANFPGDSVARESVLG
FT                   KVLRLDGVSAPRAIRAVLSVMPLDTFIEHPASRMEVVGEPHTMPAVQREAQVEINAAEG
FT                   RDVPFASIERFAFYERARKAYCVIATGEERGYGCFVFTKGVLLAPDAPQS"
FT   gene            629030..629437
FT                   /locus_tag="Bphyt_4553"
FT   CDS_pept        629030..629437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4553"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: bxe:Bxe_B0866 putative
FT                   glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4553"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18926"
FT                   /db_xref="GOA:B2TDX2"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B2TDX2"
FT                   /protein_id="ACD18926.1"
FT                   /translation="MTFSIDTLDHLVLNVADVEVSAAWYARMLGMRRAEFESRTGTRVA
FT                   MFYGNQKINLRPVTADTVAWFTGREPVPGSADLCFVTTTSPAEVKAHWLAQGVEIEAGP
FT                   VERDGARGKMTSVYCRDPDGNLIEVATYPQV"
FT   gene            629651..630082
FT                   /locus_tag="Bphyt_4554"
FT   CDS_pept        629651..630082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4554"
FT                   /product="DoxX family protein"
FT                   /note="PFAM: DoxX family protein; KEGG: bxe:Bxe_B0867
FT                   conserved hypothetical membrane protein YphA"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4554"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18927"
FT                   /db_xref="GOA:B2TDX3"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:B2TDX3"
FT                   /protein_id="ACD18927.1"
FT                   /translation="MSRPVDSSVILIARIALAVLFLWGGVMKLLGYAGFVGYLHSKGVP
FT                   FVQIAAPIATAVEALGGLLLIVGFKVRPLALIMAVYTVATAVLGHDFWNVTDAALQRDM
FT                   VIHFWKNIGIAGGFLLLFVTGAGRISIDGARAPRGGLGL"
FT   gene            630147..630419
FT                   /locus_tag="Bphyt_4555"
FT   CDS_pept        630147..630419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4555"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0868 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4555"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18928"
FT                   /db_xref="UniProtKB/TrEMBL:B2TD14"
FT                   /protein_id="ACD18928.1"
FT                   /translation="MIQSFEQIIGGKATQLCASLGEGPTPHRVIISLADSAKTLVVLDA
FT                   SGFISTIKAEIEEPEKLIADAIAKAQNEGLIERAIDTGTIQEASL"
FT   gene            complement(630539..632023)
FT                   /locus_tag="Bphyt_4556"
FT   CDS_pept        complement(630539..632023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4556"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bmu:Bmul_4907 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4556"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18929"
FT                   /db_xref="GOA:B2TD15"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2TD15"
FT                   /protein_id="ACD18929.1"
FT                   /translation="MYRMNSSNSPHSSALGRVLATVSVGFVVTQLDVTIVNIALPKIGA
FT                   DLHANVAGLQWVVDAYTLAFAVLMLSAGALGDRFGARRLYAGGIVLFALASLACGLALD
FT                   SAMLVAARAVQGVGAAAMLPNSLALLNQSYGHEPKLRARAVGLWTAAGAIAIAAGPVVG
FT                   GLLIAAFGWRSIFLVNLPICAAGFLATLLWVPRPEAATCRKPLSPATAASDTKPRGIDL
FT                   GGQCLAVVALTAFVAAVIEWRPLGLGHPLVAGGFVLALIAASAFVLVESRVAAPMLPLS
FT                   LFSKRSFSVAVLFGICVNLTYYGMVFVLSLYLQRVRGYTPLQAGLAFLPLTGGFLLSNV
FT                   ASGWVVGRFGVRVPMIAGAITAGLGYGLLHFVDAGTPLIGLLLPFLLIPSGMGLAVPAM
FT                   TTAVLASTDAPRAGTASAVLNTARQAGGAIGVAAFGALASGAAAAQIVAGMRASTAVSV
FT                   GLLAIGGVLSCFVHPQPQSPDAAHRHAGRERVGELR"
FT   gene            complement(632171..633472)
FT                   /locus_tag="Bphyt_4557"
FT   CDS_pept        complement(632171..633472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4557"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1; KEGG: bxe:Bxe_B0871 major
FT                   facilitator superfamily (MFS)metabolite/H+ symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4557"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18930"
FT                   /db_xref="GOA:B2TD16"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2TD16"
FT                   /protein_id="ACD18930.1"
FT                   /translation="MQATNLGGAQAVTPRPLGRSDYKTLGLAALGGALEFYDFIIFVFF
FT                   APAIGQLFFPAAMPDWLRQVQTFGIFAAGYLARPLGGIIMAHFGDLFGRKRMFTLSVLL
FT                   MSVPTLMMGLLPTYTSIGVLAPVLLLLFRVMQGAAVGGEVPGAWVFVSEHVPQRHIGYA
FT                   CGTLTAGLTAGILLGSLIASAVNRNFAPAEISAYAWRIPFLVGGVFGMFSVYLRRWLHE
FT                   TPVFAELKQRKAIAAEVPLKAVLRDHGRAVIVSMLLTWMLSAAIVVVILMTPTLLQKQF
FT                   HIAPATALLANCVATLCLTIGCVMAGSIAGRIGAGRTIFIGGVALAVTYYVMFQQLAVD
FT                   TSALVPLYAVAGLFVGVIGAIPFVMVKAFPPVVRFSGISFSYNVAYAVFGGLTPIAVSL
FT                   MMKSNPMAAPMYVGAICILGALTTLFIKDAPQKH"
FT   gene            633871..634611
FT                   /locus_tag="Bphyt_4558"
FT   CDS_pept        633871..634611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4558"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: bxe:Bxe_B0872 two component
FT                   transcriptional regulator, winged helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4558"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18931"
FT                   /db_xref="GOA:B2TD17"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B2TD17"
FT                   /protein_id="ACD18931.1"
FT                   /translation="MRIAILQRDLVMRQSIEKVLTSAGHSCSTYDDGLSMSRALARSTV
FT                   DLLVLDWQGLRLSGAEVLRAARAVGGDRLPVMFASADTAEENIVRAFVAGADDYVALPL
FT                   RAAEFRERVAALLRRAYPDRFSSASFDVGPYHFDTHRQLVMLRGQPVQLSGTQYRLASL
FT                   FFSNIGRVLSRDHIFAMVWGREFREFTRTIDSHVSRLRLLLEIEPQNEFRLQPVYKSGY
FT                   RLLHLRQGEAAVINAQIDAEKQAA"
FT   gene            complement(634632..635537)
FT                   /locus_tag="Bphyt_4559"
FT   CDS_pept        complement(634632..635537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4559"
FT                   /product="dihydrodipicolinate synthetase"
FT                   /note="PFAM: dihydrodipicolinate synthetase; KEGG:
FT                   bxe:Bxe_B0873 putative dihydrodipicolinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4559"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18932"
FT                   /db_xref="GOA:B2TD18"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B2TD18"
FT                   /protein_id="ACD18932.1"
FT                   /translation="MAHIWEGVLPAVTTKFNADFSIDRAWTGKNIEAQIDAGVDGIIVC
FT                   GSLGEASTLSLDEKLQVLDIAVEASRGRVPVLLTIAENSTLDACRQAEAGSRHGAAGYM
FT                   VLPGLRYLSDRRETLHHFRSVADASALPLMIYNNPLAYGVDMTPDMFAEIADEKKIVAI
FT                   KESCGDVRRVTDLINVVGDRFAILCGVDNLAMEAILMGAHGWVAGLVCAFPRETVAIYK
FT                   LLKAGRIEEARAIYRWFAPLLALDVSAKLVQNIKLAEAIVGLGTEPVRPPRLPLAGDER
FT                   KAVEALIRKSLETRPALPQI"
FT   gene            635819..636844
FT                   /locus_tag="Bphyt_4560"
FT   CDS_pept        635819..636844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4560"
FT                   /product="proline racemase"
FT                   /note="PFAM: proline racemase; KEGG: bxe:Bxe_B0874 putative
FT                   proline racemase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4560"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18933"
FT                   /db_xref="InterPro:IPR008794"
FT                   /db_xref="UniProtKB/TrEMBL:B2TD19"
FT                   /protein_id="ACD18933.1"
FT                   /translation="MTMPKSSQSTRKHTKTRTPAVSTMGIMKTLDIIDSHTGGEPTRLV
FT                   VSGGPDLGGGTLAQRLDVFRTQFDDWRAGIVTEPRGSDVVVGALLCEPDDPTCAAGVIF
FT                   FNNVGYLGMCGHGTIGLVVSLAHLGRIGAGRHRIETPVGIVEATLNDDGSVAVRNVPAY
FT                   RYRRSVQVDVPGHGVLTGDIGWGGNWFFLVADHGRVLEASRIGELTTFSGAIRDALIAQ
FT                   HITGADGALIDHIELFGPGSRDGLDSRSFVLCPGSAYDRSPCGTGTSAKVACLAADGKL
FT                   AEGAVWRQESIIGSVFEASYRHAGDGVHVIPTITGHAYITAEARLCFDERDPFAWGIPA
FT                   A"
FT   gene            636841..637968
FT                   /locus_tag="Bphyt_4561"
FT   CDS_pept        636841..637968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4561"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   bxe:Bxe_B0875 putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4561"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18934"
FT                   /db_xref="GOA:B2TD20"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B2TD20"
FT                   /protein_id="ACD18934.1"
FT                   /translation="MTADALIVGAGIVGAACAAELAALGMRVEVLDAQGIGGGATAAGM
FT                   GHIVVMNDSPAEFALSRYSRDLWLELAPQLRPRDAFARCGTLWVAADEEEWQAARATHA
FT                   AFEAQGIAAQLLDAPALRACEPALAASMAGGLRIEHDSIVYAPTVAEWLLTRSPSAANI
FT                   HLRLGAAVASVNAGGVTLTSGERIGAAHVIVANGVGAQQLVASLPLQPKKGHLLITDRY
FT                   PGLIRHQLLELGYIKSAHHAAGTSVAFNAQPRPTGQLLIGSSRQFDSTDPAVDLPVLAQ
FT                   MLQRAACYLPVLPTLHGIRAWTGFRAASPDGLPLIGPAGDFAPGVWLAVGHEGLGVTTS
FT                   LATAKLLAAQIVQSGTAIPLDPYLPVRFAQKVIHE"
FT   sig_peptide     636841..636897
FT                   /locus_tag="Bphyt_4561"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.963) with cleavage site probability 0.816 at
FT                   residue 19"
FT   gene            637961..639736
FT                   /locus_tag="Bphyt_4562"
FT   CDS_pept        637961..639736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4562"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /note="PFAM: ferredoxin; HI0933 family protein; BFD domain
FT                   protein [2Fe-2S]-binding domain protein; FAD-dependent
FT                   pyridine nucleotide-disulphide oxidoreductase; KEGG:
FT                   bxe:Bxe_B0877 FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4562"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18935"
FT                   /db_xref="GOA:B2TD21"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR017224"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="InterPro:IPR042204"
FT                   /db_xref="UniProtKB/TrEMBL:B2TD21"
FT                   /protein_id="ACD18935.1"
FT                   /translation="MNSVGVATPVSVTINGHRIDVDAGTTVAAALVLAGVRSTRMSVSG
FT                   QPRAALCGMGVCQECRVTIDGRAHALACQTLCREGQVVRTQDTAGAQLGCTWILWSRKP
FT                   VWTSRMKRWTLDDSALRSCRPRRRLGELGTNGRSPDETTPGYRCHGRRPGQVEPRSGHS
FT                   MKQHFDIVIVGAGPAGLNAASAAARAGATVALVDDNPRAGGQIWRQGPGHAPQAQLRSF
FT                   LTAIGEQNAITHWPSTRVVAPLSRRGLLLESTEFGGACVTYERLILATGARERLLPFAG
FT                   WTLPGVTGAGALQALIKGGMPVRGERIVIAGSGPLLIAALATARAAGARVAAVVEQASA
FT                   FYVARFGVSLLAAPAKLRQAVGMTRGFAGLRYWTGSVVEEAQGEGRVERVTVRCGREGR
FT                   RVTLDCDRVACGYGLVPNITLAQALGCAIGEAGEIVVDGKQRTSVESVFAAGECTGVGG
FT                   AELAGVEGEIAGLAASGAGADHAALDAHRARWRRFARRVDTAFALQDAARTPPADSTLL
FT                   CRCEDVSIGDVRAFNDWREAKLHTRCGMGACQGRICGTAASVYFGWQAAAPRPPFSPAQ
FT                   IGTLMALVAEPPPVE"
FT   gene            640131..640898
FT                   /locus_tag="Bphyt_4563"
FT   CDS_pept        640131..640898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4563"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; PAS fold-4 domain protein; KEGG: bxe:Bxe_B0878
FT                   transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4563"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18936"
FT                   /db_xref="GOA:B2TD22"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B2TD22"
FT                   /protein_id="ACD18936.1"
FT                   /translation="MNTLAHPLEPDDATLSGMLSHFRLLEPVFDAMPDVVFFVKDAEAR
FT                   YALVNRTLASRCGFKEKSALLGRTAEDVFPRRFGRIYTAQDKAIISVGNQMIDQLELHL
FT                   YPGRQPGWCLTCKQPLRDPAGKVVGLAGISRDLKADESSHPAYSRLAAVVQSIQENYVQ
FT                   PLNLKQLAAMANMSVAQLERYFHKVFHLTPRQVLLKTRLDAATALLVSHDKVTDVAALC
FT                   GYTDHSAFTRQFKATVGITPTEYRMLLHGTSRS"
FT   gene            640909..641238
FT                   /locus_tag="Bphyt_4564"
FT   CDS_pept        640909..641238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4564"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0879 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4564"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18937"
FT                   /db_xref="UniProtKB/TrEMBL:B2TD23"
FT                   /protein_id="ACD18937.1"
FT                   /translation="MARRKHHYYVYVIALDDKVWNEARFRRANPDYRFDKPCVYVGMTG
FT                   LDPDLRFDRHKAGIQANRYVRDYGLRLVPELYEVFNPMPYRGAQDMEVELAIGLREAGY
FT                   GVWQA"
FT   gene            complement(641360..641620)
FT                   /locus_tag="Bphyt_4565"
FT   CDS_pept        complement(641360..641620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4565"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0880 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4565"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18938"
FT                   /db_xref="UniProtKB/TrEMBL:B2TD24"
FT                   /protein_id="ACD18938.1"
FT                   /translation="MNQPDHNTNDTPAPAKRPTILRRLLSHHELATLLLLLHAPIDAFA
FT                   KPEIPQLHEAGLVETVSSDAGGSRIRLTPEGNAVLRGLGIK"
FT   gene            complement(641778..642110)
FT                   /locus_tag="Bphyt_4566"
FT   CDS_pept        complement(641778..642110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4566"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0881 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4566"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18939"
FT                   /db_xref="UniProtKB/TrEMBL:B2TD25"
FT                   /protein_id="ACD18939.1"
FT                   /translation="MKKFAVVLSIPLLLSACAYFQKNPDAGEPVTDTTTQRSVNDVVSC
FT                   LTQLATSHDAAFKSTAIPQGQMLDFGDSNIVKVRSDNGATTYRFYAGKRHVSNLWIESA
FT                   GKTCAP"
FT   sig_peptide     complement(642054..642110)
FT                   /locus_tag="Bphyt_4566"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.976) with cleavage site probability 0.464 at
FT                   residue 19"
FT   gene            complement(642301..644184)
FT                   /locus_tag="Bphyt_4567"
FT   CDS_pept        complement(642301..644184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4567"
FT                   /product="Xylose isomerase domain protein TIM barrel"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; Xylose isomerase domain protein TIM
FT                   barrel; KEGG: bxe:Bxe_B0882 4-hydroxyphenylpyruvate
FT                   dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4567"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18940"
FT                   /db_xref="GOA:B2TD26"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B2TD26"
FT                   /protein_id="ACD18940.1"
FT                   /translation="MQRSIATVSISGTLVEKLTAIQAAGFEGVEIFENDLLYFDGSPAD
FT                   VRRIAEDLGLKIMLFQPFRDFDGVSPERLERNLDRAKRKFDVMHELGTDRILVCSNVSP
FT                   DTIGDDALMTDQLGALARAAEAAGVIAGYEALAWGKHVKTYRHAWKLVNTVNHPNLGLV
FT                   LDSFHTLSLNDTPDAIADIPGGRIAFVQIADAPKLAMDVLEWSRHYRCFPGQGDFDLAN
FT                   FTAQVVKTGYSGPLSLEIFNDGFRAAPTTITAADGHRSLLFLEEQTRALLESTQQPVGD
FT                   LYRSPAAPAHVGYQFLEFAVDHSTRAQLVDWLGKLRFREAGRHRSKEVTLYQHGAASIV
FT                   LNAEPDSFANAFFQQHGLSLCASAFRVDDANQAFERAAGFGYAPFSGQIGPNERVLPAV
FT                   QAPDSSLNYFVDETPDQPTLFEADFVLTDINGPSEVGPLSRIDHVCLSVPANSLDTWVL
FT                   FLRTALGFQAEPGVLVPDPYGLVRSRALRSHDGSVRIVLNASVDHHTAVAEALHTYHGS
FT                   GLNHVAFSTSDIFSAIPEFVADGLPVLRIPRNYYEDLAARYALPDGTLEALRANNILYD
FT                   RDERGGEFFHAYTEQLDQRFFMEIVERRGGYDGYGAANAAVRLAAQAQRRK"
FT   gene            644503..644958
FT                   /locus_tag="Bphyt_4568"
FT   CDS_pept        644503..644958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4568"
FT                   /product="3-dehydroquinate dehydratase, type II"
FT                   /EC_number="4.2.1.10"
FT                   /note="KEGG: bxe:Bxe_B0883 3-dehydroquinate dehydratase;
FT                   TIGRFAM: 3-dehydroquinate dehydratase, type II; PFAM:
FT                   dehydroquinase class II"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4568"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18941"
FT                   /db_xref="GOA:B2TD27"
FT                   /db_xref="InterPro:IPR001874"
FT                   /db_xref="InterPro:IPR018509"
FT                   /db_xref="InterPro:IPR036441"
FT                   /db_xref="UniProtKB/TrEMBL:B2TD27"
FT                   /protein_id="ACD18941.1"
FT                   /translation="MSFASVLVLNGPNLNLLGTREPAIYGSETLDDVAKLCRDAAERLD
FT                   LSINFCQSNAEHQLIDWLHAARTKVDGIVINPAAYTHTSVAIADALTAIEKPVVEVHIS
FT                   NVHRREAFRHHSYVSAVADAIIIGCGTQGYVLALERMATILKNRAAK"
FT   gene            644955..645869
FT                   /locus_tag="Bphyt_4569"
FT   CDS_pept        644955..645869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4569"
FT                   /product="Shikimate dehydrogenase substrate binding domain
FT                   protein"
FT                   /note="PFAM: Shikimate/quinate 5-dehydrogenase; Shikimate
FT                   dehydrogenase substrate binding domain protein; KEGG:
FT                   bxe:Bxe_B0884 shikimate 5-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4569"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18942"
FT                   /db_xref="GOA:B2TD28"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2TD28"
FT                   /protein_id="ACD18942.1"
FT                   /translation="MNVQANTQPNAQTNAQTNSQATPHSYLVGLIGAGIGGSLTPAMHE
FT                   EEGSKLGLHYVYRRIDLEALKLDVAALPDLLMAAERMGFNGLNITYPCKQAVIPLLDEL
FT                   SDDARALGAVNTVLFKDGRRIGHNTDWSGFARAFQRGLPDVSLERVVQLGAGGAGAAVA
FT                   HAALNMGAKSLTLFDVDATRAASLADELQKRFPAAAVGAGSSLAESLAAANGLIHATPT
FT                   GMAKLPGLPLPVELLHRDLWVADIVYFPIRTALLQAAEALGCRTLSGGGMAVYQAVDAM
FT                   RIFTGLEPDAERVYTHFQSLLQR"
FT   gene            645919..647295
FT                   /locus_tag="Bphyt_4570"
FT   CDS_pept        645919..647295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4570"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bxe:Bxe_B0885 major facilitator superfamily
FT                   (MFS)metabolite/H+ symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4570"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18943"
FT                   /db_xref="GOA:B2TD29"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2TD29"
FT                   /protein_id="ACD18943.1"
FT                   /translation="MQQPIQSSSADAATPQGVTASTARRSKARYQILALLAVGTMINYL
FT                   DRTVLGIAAPQLTKELGINAALMGLLFSVFSWSYVASQIPGGLFLDRFGSKLTYFLSMT
FT                   LWSLCTLAQGLVHGIGALFAFRLGLGVSEAPCFPTNSRVVATWFPQSERAMATGTYTVG
FT                   EYIGLAFFSPFLFMLMGAFGWRSLFYVVGGVGIVFGGIWWMFYREPRDHPSANQAELDY
FT                   IEAGGGLTHRKKDADSAGGADAASAKSGGFEWRTIGRLLKHRQLTGICLGQFAGNSTLV
FT                   FFLTWFPTYLATERHMAWLKIGFFAIMPFIAASIGVMFGGFFSDWLLRRGKSPNVARKL
FT                   PIIAGLLLASTIILANYVESNVAVIAILSVAFFAQGMAALGWTLVSDIAPDGLLGVTGG
FT                   IFNFAANLAGIVTPLVVGFIVAATGSFVGALVFIGAIALIGALSYIFIVGDIKRIVLVD
FT                   "
FT   gene            complement(647366..648061)
FT                   /locus_tag="Bphyt_4571"
FT   CDS_pept        complement(647366..648061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4571"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: bxe:Bxe_B0886
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4571"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18944"
FT                   /db_xref="GOA:B2TD30"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041474"
FT                   /db_xref="UniProtKB/TrEMBL:B2TD30"
FT                   /protein_id="ACD18944.1"
FT                   /translation="MKKGSKAAEPDTNGIPSDSPRTDARRKYDPEQTKRNILDVATQEF
FT                   SAMGLTGARVDAIAERTNTTKRMLYYYFGSKEGLYQAVLEKVYGDIRALEQDLHVSELD
FT                   PIEGMRALVEFTFDYHDRQRDFVRLVTIENIHGAKYVEQVKTFKGRNVTVIHTIEDLLS
FT                   RGIAAGQFRSDIDPIDLHLLISSLCFHRVGNRHTFGTAFGRDPSHPRLRARHRAMIVDA
FT                   VLRFVRKDD"
FT   gene            complement(648156..649436)
FT                   /locus_tag="Bphyt_4572"
FT   CDS_pept        complement(648156..649436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4572"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   bxe:Bxe_B0887 putative FAD-binding oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4572"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18945"
FT                   /db_xref="GOA:B2TD31"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B2TD31"
FT                   /protein_id="ACD18945.1"
FT                   /translation="MQSFYEATVTRSSAYAPLAGRRAANVCVIGGGLAGLSTALGLAER
FT                   GVADVTVLEARQVGFGASGRNGGFVFGGYSLDCADLLKTLGAVRARELYTLTTDAVDLM
FT                   RKRIARYHIDCDATDAGVILANWFDEPARLESQRRLMRDSFGVEWEPVAAQQLASQLKT
FT                   RRYHSGLFERNAFHFHPLKYVLGVANAAAHAGVQIHEDSPVVRLERDGAGFVVHTQHGV
FT                   LDARHVVMAGGGYARRVYPRVERAVLPIATYVMATEPLGARLQDAIDTRAAIYDTRFAF
FT                   DYYRPLPDTRILWGGRISVRDREPEVIARLLRRDLLKVYPQLHGVRIDYAWGGLMSYAR
FT                   HKMPQIGRSADGVWYAVGFGGHGMAPTTVSGELLAAAIAGERPVPEAFASFGLTPAYGA
FT                   LGLAAAQLTYTAMQTRDALAARRRPAV"
FT   gene            complement(649568..650350)
FT                   /locus_tag="Bphyt_4573"
FT   CDS_pept        complement(649568..650350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4573"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0888 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4573"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18946"
FT                   /db_xref="GOA:B2TD32"
FT                   /db_xref="InterPro:IPR018764"
FT                   /db_xref="UniProtKB/TrEMBL:B2TD32"
FT                   /protein_id="ACD18946.1"
FT                   /translation="MNLHRYPQLVDLLAAEYVLGTLRGGARRRFERYADHDTTIRKAVE
FT                   QWQRRISPMAELAEPRMPPAAVWDAIERRLGLTATREAARPRTVVETPARPSRSIFENL
FT                   AFWRGWALGVTGLAAVAVVVAVRSLLPSATPPVTAPTVAQQPETAVSHVAVLNNKDAHP
FT                   VMLVAWDEAHSTMSVHPLGKVELPAGRAMELWGIPASGHPVSLGMLPDSANGKVTAGQQ
FT                   KPENYAALAVSIEAPGGSPDHNAPSGPVVFTGKLLPVS"
FT   gene            complement(650350..650919)
FT                   /locus_tag="Bphyt_4574"
FT   CDS_pept        complement(650350..650919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4574"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: sigma-70 region 2 domain protein; sigma-70
FT                   region 4 domain protein; Sigma-70 region 4 type 2; KEGG:
FT                   bxe:Bxe_B0889 sigma-24 (FecI)"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4574"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18947"
FT                   /db_xref="GOA:B2TD33"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:B2TD33"
FT                   /protein_id="ACD18947.1"
FT                   /translation="MTANPRELTPETLAELLERVAKQDGAALRELYDLAAPKLFGLALR
FT                   ILSRHEWAEEVLQDSFVNIWRFAGDYRRALSAPMTWMSAIVRNRALDHLRRVNTQETEW
FT                   SDALDDLVATGDPDPEALSAVSLQARLLAGCMQQLEPAQRQAVALAYLRDQSHSEIAEV
FT                   LSVPLGTIKSWIRRGLAKLKTCLGGE"
FT   gene            complement(651362..652294)
FT                   /locus_tag="Bphyt_4575"
FT   CDS_pept        complement(651362..652294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4575"
FT                   /product="dihydrodipicolinate synthetase"
FT                   /note="PFAM: dihydrodipicolinate synthetase; KEGG:
FT                   reh:H16_B0213 dihydrodipicolinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4575"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18948"
FT                   /db_xref="GOA:B2TD34"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B2TD34"
FT                   /protein_id="ACD18948.1"
FT                   /translation="MTQSSHPAAMRGVFPVAPTIFDDAGRLDLEGQKRCIDFMIDAGSN
FT                   GLCILANFSEQFALSDDERNTLMHVVLEHVAGRVPVIVTTTHFSSYQCAERSRSAQAAG
FT                   AAMVMVMPPYHGATIRIGERGIYEFYRTVSDAIGIPIMIQDAPVSGTPLSAPFLARMAR
FT                   EIDNVSYFKIEVPQAANKLRELIELGGDAIVGPWDGEEAITLMADLDAGATGSMTGGGY
FT                   ADGIRLIVDAYAAGDTEAAAAHYQQWLPLINYENRQGGLASCKALMKEGGVIRSDAVRH
FT                   PLPQMHPATREGLLKVARRLDPLVLRWGR"
FT   gene            652473..653456
FT                   /locus_tag="Bphyt_4576"
FT   CDS_pept        652473..653456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4576"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: reh:H16_B0214 transcriptional
FT                   regulator, LysR-family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4576"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18949"
FT                   /db_xref="GOA:B2TD35"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2TD35"
FT                   /protein_id="ACD18949.1"
FT                   /translation="MKDTLNVLLSKLRMKQLQLLIALDDLKSLHKAAGAMSMTQSAASK
FT                   ALQELESMLEAPLFERSKSGMIPNQLGHCVIRYARLMTTDLTALCQDVAEIRSGRGGRL
FT                   AIGAIMGAIPECVVPALNQLHAAQPGLSVEVVEDTSARMLRQLDDGRLDLVIGRATVAA
FT                   DPSKYHYRPLGDEPLSVVVGYGHPPLPKKEVKLRDLAGHRWVMYPSHMPLHALLEREMD
FT                   LAGLQMPDNPVSTASTFVTVALLQSSHDLVSLLPTAIAALFVRQKMLRLVPVKLKSPSQ
FT                   TFGIVTRKGGVLSPPAEQFIELLCAQPIEPAQGRLPEHPARKQKTA"
FT   gene            653652..656732
FT                   /locus_tag="Bphyt_4577"
FT   CDS_pept        653652..656732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4577"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0890 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4577"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18950"
FT                   /db_xref="GOA:B2TD36"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:B2TD36"
FT                   /protein_id="ACD18950.1"
FT                   /translation="MNRPLVRLPFRATGVASVRKWFKWALVAAFLLALALAARFCQNEI
FT                   ETSRLQAHYLSELTRDVGFSVADGPSHSIRFPEADKGPYDSRLGYALLPSIQQRLLQRG
FT                   FEITAQARDSERMLSLADNGLFLPYEEKDRAGLQLFDGTGAPLFAAQFPGRVYDDFDAI
FT                   PPLVVNSLLFIEDRYLLDPNQPNRNPAIDWGRFSRALADQGVRVFNHHQSQPGGSTLAT
FT                   QIEKFRHSAGGRTATPPEKLRQIASASVRAYLNGPQTMPARQQIVVHYLNSVPLAAQPG
FT                   IGEINGIGDGLAAWYGRDFNDVNRVLIAPSTEQNLPEQGIAFRQVLSLMIAQRAPSYFL
FT                   HHGYKELERLTDSYLRLLANGGIVSVPLRDAALSAVVDLQRAPVKTASADSFVSRKAVT
FT                   SMRSHLLAALNIPSFYELDRLDLQANGTLNNAVQQAVSDRLAAAATRDGAKAAGLVGFE
FT                   MLRASDDPSRIAYSFTLFERRDGANLVRVQTDSVNQPFDINSGARLNLGSTAKLRTVVT
FT                   YLQIVSDLHKRYAPLSTAELKAVKYDPNDQLTRWSLDYFAHTSDRSLQAMLDAAVERKY
FT                   SASPGETFYTGGGAQTFNNFESDDNSRILTVHRAFQHSVNLVFVRLMRDIVHYEMVQTT
FT                   GPSAQWLGDPEMRKMYLTRFADQESRVYMNRFYTKYHGKTPDQALSLLLLGVRKSPPKV
FT                   ATVLRSVAPDESNAWFNLKMRAALKNTPAASVLDDEDLANLYAKYAIDRFNLNDRGYIS
FT                   SVHPLELWTLNYLREHPDATLEQIQSASREVRLSTYSWLFKTRYHATQDRRIKRMVELR
FT                   AYDAIGKSWQALGYPFATLTPSYAAAIGASGDRPAALAQLIGVVANNGNKVPTESLTQL
FT                   DFAKDTPYETHFKRAAVAPEPQLSPEIASTVKVLLRDVVTGGTAKRLAQGMTFPDGQTL
FT                   EVYGKTGTGDQRFNVFAKGARLIESRKVNRSATFVFAMGDRFYGTLTAWVHEPYAAHYE
FT                   FTSALSVQLLKSLAPVLQPLLNETPVKTASVTKVAAQ"
FT   sig_peptide     653652..653783
FT                   /locus_tag="Bphyt_4577"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.875) with cleavage site probability 0.734 at
FT                   residue 44"
FT   gene            complement(656785..658011)
FT                   /locus_tag="Bphyt_4578"
FT   CDS_pept        complement(656785..658011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4578"
FT                   /product="ROK family protein"
FT                   /note="PFAM: ROK family protein; KEGG: bxe:Bxe_B0891 ROK"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4578"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18951"
FT                   /db_xref="GOA:B2TD37"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2TD37"
FT                   /protein_id="ACD18951.1"
FT                   /translation="METTGTRSPLKRTVGSNQVGMRQFNERIVLQAIRLHGPLPKADVG
FT                   RLTRLSMQTVSMIVERLIEDGLLEKQARVRGRIGQPSVPIALRAQGAYTIGIKVGRRSL
FT                   DVLAMDFAGHVVHRDVFDYAYPDPRTLFPALENKLARVNQTLGAKASQVVGVGVAAPLW
FT                   LGGWRDFLGAPPDALEAWNEIDLRSRIGTMTGLPVEFAKDTTAACAAELVMGQGRGIHN
FT                   FLYLFVGTFIGGGLVIDGRLHGGPHDNAGAVGSIPLREGGARKPARQLLHAASGFVLEK
FT                   LLTDAGAPAAAAHDHRALSPELWRHTEQWLDSACPAIATALTNAAALLDLDAIVIDGEL
FT                   DRQLLREIIRRTERVLDRFEWEGMVRPQLLEGAIGADARAMGGAILPLYAHFAPVHELF
FT                   LKPAAETVY"
FT   gene            complement(658042..658839)
FT                   /locus_tag="Bphyt_4579"
FT   CDS_pept        complement(658042..658839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4579"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bxe:Bxe_B0892 ABC sugar transporter, ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4579"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18952"
FT                   /db_xref="GOA:B2TD38"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2TD38"
FT                   /protein_id="ACD18952.1"
FT                   /translation="MSTPTSASSAMPVLQARGLIKRYGNVTALDGCDFEVMPGEIMAVI
FT                   GDNGAGKSSLIKALSGATVPDEGEILLDGKPVKFRSPLDARAQGIETVYQELAVAPAMS
FT                   IAENLFLARELLKPGWRGSIFKMIDKRRMLDEATAHMKDLQIGIRSMRQAVETLSGGQR
FT                   QGVAVARSAAFARHVVILDEPTAALGVKEGNMVLELIRRVRDRGLPVILISHNMPHVFE
FT                   IADRIHIQRLGRRAALVNRADIHMSEAVAIMTGAKEADVKAIA"
FT   gene            complement(658859..659845)
FT                   /locus_tag="Bphyt_4580"
FT   CDS_pept        complement(658859..659845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4580"
FT                   /product="Monosaccharide-transporting ATPase"
FT                   /EC_number="3.6.3.17"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   bxe:Bxe_B0893 ABC sugar transporter, inner membrane
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4580"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18953"
FT                   /db_xref="GOA:B2TD39"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B2TD39"
FT                   /protein_id="ACD18953.1"
FT                   /translation="MSTPSAPAGHSRSFAERMPSLAEVGPLIALVLACGFFISQSSRFL
FT                   SFQNLSLILQQTMVVAVIAIGQTLIVLTGGIDLSCGMVMAFGSIIMTKFAVTLGVPPVL
FT                   AILCGVGASALFGALNGVLITRIKLPAFIVTLGTLNIAFALTQIYSNAESVSNLPDAIM
FT                   FLGNTFKLGPADVTYGTVLTLLMYLATWFVLRDTVPGRHLYALGNNPEAARLMGLSSQK
FT                   ILLTVYSLAGAIYGIAALLSVSRTGVGDPQAGQTENLDSITAVVLGGTSLFGGRGSISG
FT                   TLLGALIVGVFRNGLTLIGVSSVYQVLITGMLVILAVAADKLSHRRG"
FT   gene            complement(659938..660942)
FT                   /locus_tag="Bphyt_4581"
FT   CDS_pept        complement(659938..660942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4581"
FT                   /product="Monosaccharide-transporting ATPase"
FT                   /EC_number="3.6.3.17"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; KEGG: bxe:Bxe_B0894 ABC sugar
FT                   transporter, periplasmic ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4581"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18954"
FT                   /db_xref="GOA:B2TD40"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B2TD40"
FT                   /protein_id="ACD18954.1"
FT                   /translation="MNLNSRRLPVARKIVSMCVAASAVWCASASQAADQPVVGLITKTD
FT                   TNPFFVKMKQGAEAAASKDGAKLITAAGKFDGDNASQVTAIENMMTAGAKAILITPSDT
FT                   KAIVPSIKKARAAGVMVVALDTPTDPQDATDALFATDNFKAGVLIGKYAKAALNGKPAK
FT                   IATLDLAPGVSVGVLRHNGFLEGFGVKEGDPSVVCSQDTRGDQAKGQTAMENCLQKSPD
FT                   INVVYTINEPAAAGAYRALKAAGKDKSVMIVSIDGGCEGVRNVKAGAIAATSQQYPLKM
FT                   ASLGVTAGVEYAKTGKKVSGYQDTGVTLITDKPMAGIDSKDTKFGLDNCWGNK"
FT   sig_peptide     complement(660844..660942)
FT                   /locus_tag="Bphyt_4581"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.995 at
FT                   residue 33"
FT   gene            complement(661389..662162)
FT                   /locus_tag="Bphyt_4582"
FT   CDS_pept        complement(661389..662162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4582"
FT                   /product="YcgR family protein"
FT                   /note="PFAM: type IV pilus assembly PilZ; YcgR family
FT                   protein; KEGG: bxe:Bxe_B0896 putative YcgR-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4582"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18955"
FT                   /db_xref="GOA:B2TD41"
FT                   /db_xref="InterPro:IPR009875"
FT                   /db_xref="InterPro:IPR009926"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR023787"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2TD41"
FT                   /protein_id="ACD18955.1"
FT                   /translation="MIADLSLDADVAEQTQQTLGADSNFAQRHPLQIAVCLRQLVAGQD
FT                   FVTVEFGGRQIVTQILDVDSRNARFVFDAGSVADDNDALPSARQLTFRSLPGGIRTEFT
FT                   TFDATPTQFDGLPAFEAPLPTVLHYVQRREFFRVQTPVLDPYIASGRYADGGSFRLELL
FT                   DLSLGGIALKTADERFGSLERGTVLRDVALQLGGFGMLRLDLEIVAPRQVSTAKGDRRF
FT                   VIGCKFVATPGPAERTLQRVVTQLETRRQALTPRR"
FT   gene            complement(662413..663444)
FT                   /locus_tag="Bphyt_4583"
FT   CDS_pept        complement(662413..663444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4583"
FT                   /product="transcriptional regulator, LacI family"
FT                   /EC_number="5.1.1.1"
FT                   /note="PFAM: regulatory protein LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; KEGG:
FT                   bvi:Bcep1808_3829 periplasmic binding protein/LacI
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4583"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18956"
FT                   /db_xref="GOA:B2TD42"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B2TD42"
FT                   /protein_id="ACD18956.1"
FT                   /translation="MPTLSEVARHAGVTPATVSNVLRNRGRVGATTRQRVLEAVEALGY
FT                   RPHLAARALAEGRAPTLALMVSSIANPFYPEFALAVERAARTSGHFVIICNTNEDPHTG
FT                   RAYLDQIAGTLSEGVLVTNANLDLADLHTTESRGTPVVLCMWERPNEPPGLPCVAVDFR
FT                   RAGELAGAHLLELGHRRIGAIVGSKASGIHAARYEGFVDALRAGGAPKGRVKHAADTIQ
FT                   GGYEAARALLESDPKLTAIFVTNDLPALGAMHAAADLGLNVPTDLSVIGITDIQLARES
FT                   RPALTTVAVPTVEVAGLAVSLLRELIESSYGQAGRPTTSVPMRIASPPELVVRASTGVP
FT                   RSR"
FT   gene            663638..664792
FT                   /locus_tag="Bphyt_4584"
FT   CDS_pept        663638..664792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4584"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; TOBE domain protein;
FT                   Transport-associated OB domain protein; SMART: AAA ATPase;
FT                   KEGG: bmu:Bmul_3198 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4584"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18957"
FT                   /db_xref="GOA:B2TD43"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005116"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040582"
FT                   /db_xref="UniProtKB/TrEMBL:B2TD43"
FT                   /protein_id="ACD18957.1"
FT                   /translation="MASISLRGVQKAYGEGAPVIRDVDLEIGENEFCVFLGPSGCGKST
FT                   LLRMIAGLEDLTDGDLSIGGKLMNDVPAAQRGVAMVFQSYALFPHMSVFENMAFGLKLA
FT                   KTPKDEVDRKVREAARILQLEALLERKPKALSGGQRQRVAIGRAIVREPGVFLFDEPLS
FT                   NLDATLRGQTRIEIARLHKQFAKASVVYVTHDQIEAMTLADKIVLLHAGKDTERYGSIA
FT                   QIGAPLELYHRPKSRFVAGFIGSPRMNFLPGRVASLDAQGVTITLDHTQETVRVPVNGA
FT                   GLQTSQAVTLGVRPEHLEFVDPSSVAPDDAVLTRTVSLVEQLGEHSYVHLDQPGGAALV
FT                   AKAPGNTRLAPGERASLRVPRAACHLFTEDGFAAASLESVEHYA"
FT   gene            664804..666786
FT                   /locus_tag="Bphyt_4585"
FT   CDS_pept        664804..666786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4585"
FT                   /product="Beta-galactosidase"
FT                   /EC_number="3.2.1.23"
FT                   /note="PFAM: Glycoside hydrolase family 42 domain protein;
FT                   Beta-galactosidase trimerisation domain protein; KEGG:
FT                   bam:Bamb_4931 beta-galactosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4585"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18958"
FT                   /db_xref="GOA:B2TD44"
FT                   /db_xref="InterPro:IPR003476"
FT                   /db_xref="InterPro:IPR013529"
FT                   /db_xref="InterPro:IPR013738"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B2TD44"
FT                   /protein_id="ACD18958.1"
FT                   /translation="MRLGVCYYPEHWPESMWQDDARRMKALGIEQVRIAEFAWSRIEPT
FT                   PGEYDWGWLDRSIDVLGAAGLQVVMCTPTATPPKWLIDRHPDILPVGADGRPRAFGSRR
FT                   HYDFSSPSYFAASQKICTAVAERYGKHPAVAYWQTDNEFGCHHTVVSYSPAAVGRFREW
FT                   LKARYQTIDALNRAWGTVFWSMEYRSFDEIDAPVATVTEAHPSHRLDYRRFASDEVARY
FT                   NRMQVEIIRAHSPGRPVAHNFMQLFTEFDHYKVAADLDVATWDSYPLGALEEQWFAPEV
FT                   KARWLRSGHPDFASFNHDVYRGMSKLPFWVMEQQPGPVNWALWNPAPLPGMVRLWSWEA
FT                   FAHGAGCVSYFRWRQAPFAQEQMHAGLNTPDNRLDVGGNEASQVAGEIRTVLAANADAD
FT                   AAVRSKVALVYDYEAKWLFEIHPQGADFHYPRFAFEYYSALRALGLDVDVVPVDAPLDG
FT                   YSLIVVPPLPVVPEAFAQRLASSGAQVVLGPRTGSKTKDLQIPANLPPGALTSVLPLRV
FT                   WRVESMRPNVTEAVRLADGESAGEADGFARHWRDFIDTDAAQSLDVRARFADGHPAYVQ
FT                   GGAFHYLASLFDDALTVRLFARIAQEAGLETMPLGDSVRVSRRGALTYVFNYGDETHTL
FT                   SGVADDALVFGSRAIEPQGVAVYRS"
FT   gene            666876..668129
FT                   /locus_tag="Bphyt_4586"
FT   CDS_pept        666876..668129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4586"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: bch:Bcen2424_5658 extracellular solute-binding
FT                   protein, family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4586"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18959"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:B2TD45"
FT                   /protein_id="ACD18959.1"
FT                   /translation="MKMKPRKILLALALAAAAVGTSAVSTAQAGTLTANIAFKGASQRA
FT                   VWQSVIDDFKKAHPGIDVKVSFVDEEAYKVQLPGWLTTVAPDIVNWHDGERMAYYAQRG
FT                   LFEDLSGDWAKNGWNEMYASTKEASSYKGKQYAAPTVYYSWGMFYRKDLFQKAGISGEP
FT                   KTWDQFLEDCKKLKAAGITPIAVAGRDSWTLAGWFDYLDLRLNGNAFHQKLMAGEIPYT
FT                   DPRVKKVYTTWKQLIDAGYFIDNSLSYDLDSVQPFLFQGKAAMMLMGTFITAGFPPNVK
FT                   PEMGYFQFPIIDAKVPTAEDGPVESLHIPSKAKNKADAHTFLAFVETPEIGAKLATGLG
FT                   SLSANSKSPEPEDPISRIGFQILANTKGGIAQFYDRDMTKEMADEGMKGMQQFISDPTK
FT                   LDDVLAQLEQTRRRIYKK"
FT   sig_peptide     666876..666965
FT                   /locus_tag="Bphyt_4586"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.822 at
FT                   residue 30"
FT   gene            668275..669252
FT                   /locus_tag="Bphyt_4587"
FT   CDS_pept        668275..669252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4587"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bcm:Bcenmc03_4576
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4587"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18960"
FT                   /db_xref="GOA:B2TD46"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B2TD46"
FT                   /protein_id="ACD18960.1"
FT                   /translation="MSHSVTRHTVSGPAEPGGPGLPTPGGAVRGGKPASSRRRGPSPTA
FT                   RRQRRAAFLFLAPACVMVAIYVVWPILSTIRLSFFNWDGMSEPSFVGLANYVELFHAQT
FT                   FYTALKNNLIWLLLFLLAPPMGLAVALYLNQAVAGIRIVKSLFFAPFVLSGVVVGLIFS
FT                   WFYDPTFGLLAVILGHGVPVLGDPRYATFGIVFAALWPQTAYCMILYLTGLTSLNAEQI
FT                   EAARMEGARGWSMLWHVILPQLRPTTFMAIVVTIIGALRSFDLISVMTGGGPFESSTVL
FT                   AYYMYDQAIKYYRIGYSAAVAVVLFAIMLVYIVYHLRRMLRAEQ"
FT   gene            669263..670114
FT                   /locus_tag="Bphyt_4588"
FT   CDS_pept        669263..670114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4588"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bvi:Bcep1808_3824
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4588"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18961"
FT                   /db_xref="GOA:B2TD47"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B2TD47"
FT                   /protein_id="ACD18961.1"
FT                   /translation="MFPIPIDKWKPATRRMYKLTLPVALLIWLLPMIAVLVTSVRSTEE
FT                   LSEGNYWGWPKHFAMFDNYREALTTSPMLHYFWNSVLITVPAVVGSIALAAMAGFALAI
FT                   YRFRGNSTLFATFVAGNFVPVQVLMIPVRDLSLQLGLFNTVSALILFHVSFQTGFCALF
FT                   LRNFIKQLPFELVEAARIEGANEWTVFFKIVLPLIRPALAALAILVFTFVWNDYFWALC
FT                   LTQGDDAAPITVGVAALKGQWTTAWNLVSAGSILAALPSVAMFFAMQKHFVAGLTFGAT
FT                   KG"
FT   sig_peptide     669263..669391
FT                   /locus_tag="Bphyt_4588"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.773) with cleavage site probability 0.291 at
FT                   residue 43"
FT   gene            670686..673034
FT                   /locus_tag="Bphyt_4589"
FT   CDS_pept        670686..673034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4589"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A3114 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4589"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18962"
FT                   /db_xref="UniProtKB/TrEMBL:B2TD48"
FT                   /protein_id="ACD18962.1"
FT                   /translation="MGSRPISAGFWRHLGRRAIPHSDRDKTLLGLQAAKALGNVAGFTI
FT                   DYARVPDKGASVRNFAYGARSHGAYSLVDSGAIQEIELTHFKPAPQSRYAQTSEPATGE
FT                   AHTQTPPPESTGSQTERQDKLPAHTQTQTGSSDKATQTSTSTRAGSSQTGTNGGDIAGN
FT                   RTTSSSSDEKGTQTHIQLVSEKTQAHSHGQDAETQTQRRETTDAENQAKPKVSHKGVLA
FT                   RVPRQEQSVQTHSSGPVDSSVQTEARVKNSKTQTGADVHDATVQTGSSSKTDTATQTVS
FT                   SRSSVGTRTATTSHNVQVQTAPSNARELIPQTSASLYDPRKRSPREGIQPTPRHHAGSQ
FT                   TVLPRTDQGSQANVKTQDRNTQSSLPTKEDQSSQTRVFSKDSEIQVTSPSRTRSTQTTQ
FT                   APHIGVPSFKPQRPAVPSTVKANGHWLVIDAFALASSGSNLKGDPSQMNRLTLASDSIS
FT                   SAGDVAATINLGGNEVLALTGKTLSLLGTAIGLAPSVAQLSSDIKTLIAHPENEQAKWN
FT                   VGNSAVQLFGGLLATAASFAFPPAALVPLLFPNFAEIGHAEDLRKQEAELRAQGRTAEA
FT                   DVVHGEYVKAALNATPIINWFSSFYTPAMRPAIERFELSHGNKPGSPPRGDLRPGERGD
FT                   PAVADYYGQAIQQRGQSLAAAATPYLKEVLKGTNADSITFVSRAPQMFGWPSTGQPMRM
FT                   FDRAIAITYSKKTGLCTFQFFGKDKDGVFRLPILNEGVATDDHQKNIVLMGNQLDPDKQ
FT                   KVKFDLEAYRNAPHGQMIVVDPNNYRLGA"
FT   gene            complement(673192..674417)
FT                   /pseudo
FT                   /locus_tag="Bphyt_4590"
FT   gene            674967..675467
FT                   /locus_tag="Bphyt_4591"
FT   CDS_pept        674967..675467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4591"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A1492 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4591"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18963"
FT                   /db_xref="UniProtKB/TrEMBL:B2TD49"
FT                   /protein_id="ACD18963.1"
FT                   /translation="MSTVNTVLSRVLQRLAAPSTMLSIGMLLAGAMLAVDASAASFKCT
FT                   SKSSVSEKIVCKEPTLSALDDRLTAAWQRAKEATLDTAALEAARTHQWLWRQHNCTDEA
FT                   CVKSWYDRRIAELDADYVQAKQARREAFDASLAGQNLAPSAADAVRKMKGEAVANATTA
FT                   SAQ"
FT   sig_peptide     674967..675086
FT                   /locus_tag="Bphyt_4591"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.732 at
FT                   residue 40"
FT   gene            complement(675513..676196)
FT                   /locus_tag="Bphyt_4592"
FT   CDS_pept        complement(675513..676196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4592"
FT                   /product="TonB family protein"
FT                   /note="TIGRFAM: TonB family protein; KEGG: bxe:Bxe_B0897
FT                   TonB protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4592"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18964"
FT                   /db_xref="GOA:B2TD50"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:B2TD50"
FT                   /protein_id="ACD18964.1"
FT                   /translation="MRLTISIDDSPTLRIVLAIVVALVVWIVFLYALGHWLDATTSQPA
FT                   PDKPLEMRVVELDPQAPVHREPAPTVKPQRPVEPRQHVAPRPAEARTPRQPTPDVQPTR
FT                   IPAPNESTASTESTARSPNSQEERQSTSQPTLPPGDTAARSIAQPLPELPDDLREQAYQ
FT                   TVATARFVIHVDGSVDVELLKPTQNPRLNQLLLEALRKWRFFPALQGGHPIESRQDVRV
FT                   HFNVS"
FT   gene            complement(676201..676599)
FT                   /locus_tag="Bphyt_4593"
FT   CDS_pept        complement(676201..676599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4593"
FT                   /product="Biopolymer transport protein ExbD/TolR"
FT                   /note="PFAM: Biopolymer transport protein ExbD/TolR; KEGG:
FT                   bxe:Bxe_B0898 biopolymer transport protein ExbD/TolR"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4593"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18965"
FT                   /db_xref="GOA:B2TD51"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:B2TD51"
FT                   /protein_id="ACD18965.1"
FT                   /translation="MKFKRSRAARRGRIEIIPMIDVMFFLLATFMLASLAMQRLDAVKL
FT                   TLPAGRAQQLAEHEPLTISVDSRNEIFVNHLPVRPDQIEPTIKRLLQPDANVVIAADDA
FT                   AGHGAVVQAMLAARRAGAARFLIAVRPK"
FT   sig_peptide     complement(676489..676599)
FT                   /locus_tag="Bphyt_4593"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.979) with cleavage site probability 0.831 at
FT                   residue 37"
FT   gene            complement(676596..677243)
FT                   /locus_tag="Bphyt_4594"
FT   CDS_pept        complement(676596..677243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4594"
FT                   /product="MotA/TolQ/ExbB proton channel"
FT                   /note="PFAM: MotA/TolQ/ExbB proton channel; KEGG:
FT                   bxe:Bxe_B0899 biopolymer transport protein, MotA/TolQ/ExbB
FT                   proton channel family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4594"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18966"
FT                   /db_xref="GOA:B2TD52"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="UniProtKB/TrEMBL:B2TD52"
FT                   /protein_id="ACD18966.1"
FT                   /translation="MQDWTNILAAVRVGGWVIYPLTVLAVVAVAIVLDRAYVFLRFGRL
FT                   PPGADDAHGIHMPASSTGMDNGLNHAPRQNVFKRMSTSWRPDASVPLWLREANAQSVAS
FT                   QIERDMSKGFWVLETIVTAAPLLGLLGTIVGMMHSFQLFGGTGLVDPAGVTGGVAQSLV
FT                   ATAIGLVVALFALFAFNYFSRRLERLMDELESFATARLGEIRLATSVAGAQS"
FT   gene            complement(677270..679615)
FT                   /locus_tag="Bphyt_4595"
FT   CDS_pept        complement(677270..679615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4595"
FT                   /product="TonB-dependent receptor"
FT                   /note="PFAM: TonB-dependent receptor; Cna B domain protein;
FT                   TonB-dependent receptor plug; KEGG: bxe:Bxe_B0900
FT                   TonB-dependent siderophore receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4595"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18967"
FT                   /db_xref="GOA:B2TD53"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:B2TD53"
FT                   /protein_id="ACD18967.1"
FT                   /translation="MTIRTRVSSAALLLFAMAAHAHAATDESSVTGAVTDAAGQPVNNA
FT                   TVIVQNASGAAVTEAKTNAEGRFAIAHVTPGTYAIVVTAPGFASGNSITTTSAGAESTV
FT                   SVSLAKSGTLDVQVNAKRLDRARNGLLPETGSSVYRFSQADIEALPAGQDTPLNQVLLQ
FT                   APGVASDSYGQLHVRGDHANLQYRINGIIIPEPISGFGQALDTRIIDQVNLLTGALPAQ
FT                   YGYRTAGVVDIRTKTGDAGNGGTIDVFGGSHQTLKTSADVFGTQGPFSYYFSGSLGVNN
FT                   LGIENPTASASALHDHTRQGDAFGYMSYIINPLTRVSLMFGTTSNQFEIPNTPGLPTNF
FT                   TLNGNNAFDSSQLDETQSELNNFAVLALQGTNGGALDYQVALFTRYTRTQFNPDPVGDL
FT                   LFNGVASQDFHSNSANGAQVDTTWRLNEKHTIRAGLFFQQEHAVFDDSVDVFAADSEGN
FT                   QLSDQPFNIHDSSSRTGYLYSAYVQDEWKITDKLTLNYGLRYDKMDEYVSASQLSPRIG
FT                   LVYALTPTTTFHAGYARYFTPPAFELVSGSTISRFNGTTNQSPSSQNDQVQPERSHYFD
FT                   LGVTQRLGSNVTVGIDAYYKKSTNLLDEGQFGSALIFTPFNYQYGRVYGLEFTANYKQD
FT                   NASAYLNFAYSRAQGKQIDSAQFNFEADELAYINDHWVYLDHDQRITASFGGTYDLGRT
FT                   TFTFDGLVGSGLRSGFANTDRLPVYAQINLGVIQHFNQPLVGKFDARLLVVNAFNRVYE
FT                   LRDGSGIGVGAPQYGPHFAVYAGITKHF"
FT   sig_peptide     complement(679544..679615)
FT                   /locus_tag="Bphyt_4595"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.725 at
FT                   residue 24"
FT   gene            complement(680177..680971)
FT                   /locus_tag="Bphyt_4596"
FT   CDS_pept        complement(680177..680971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4596"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bja:bll0272 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4596"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18968"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B2TD54"
FT                   /protein_id="ACD18968.1"
FT                   /translation="MKVLPLAAAALSLSAALFASTAAMAQDAQPQTAPVHNIVLVHGAW
FT                   VDGSGWKPVYDRLTKDGYHVTIVQEPLTSLDDDVAATKRVLDQQDGPTILVAHSYGGSV
FT                   ITEAGVHPKVVGLVYVAAHAPAVGEDESDLGKGMPSYTSKQPDAIMKTGDGYTYLNPAD
FT                   FAKDFAADLPLKQAQFESHSQILTAAKVFSAPMTVAAWTTKPSWGIVAADDKIINPDLE
FT                   RWYYARAHSHTTVIPGASHSVYESRPKEVTAVIEDAAKHVRS"
FT   sig_peptide     complement(680894..680971)
FT                   /locus_tag="Bphyt_4596"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 26"
FT   gene            complement(681088..681438)
FT                   /locus_tag="Bphyt_4597"
FT   CDS_pept        complement(681088..681438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4597"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0901 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4597"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18969"
FT                   /db_xref="InterPro:IPR025421"
FT                   /db_xref="UniProtKB/TrEMBL:B2TD55"
FT                   /protein_id="ACD18969.1"
FT                   /translation="MKKALVCFALALGTLAAPVVSFAQSNGPVTRAEVRADLVRLEQAG
FT                   YNPSLGNDADYPAAIQAAEAKVAAQTAPQTTQPSYGGVGQKGTSSSGMRKHASTDSSCV
FT                   GPVSFCNVFFGS"
FT   sig_peptide     complement(681367..681438)
FT                   /locus_tag="Bphyt_4597"
FT                   /note="Signal predi