(data stored in ACNUC17686 zone)

EMBL: CP001056

ID   CP001056; SV 1; circular; genomic DNA; STD; PRO; 3800327 BP.
XX
AC   CP001056;
XX
PR   Project:PRJNA28857;
XX
DT   08-MAY-2008 (Rel. 95, Created)
DT   24-MAR-2017 (Rel. 132, Last updated, Version 13)
XX
DE   Clostridium botulinum B str. Eklund 17B, complete genome.
XX
KW   .
XX
OS   Clostridium botulinum B str. Eklund 17B (NRP)
OC   Bacteria; Firmicutes; Clostridia; Clostridiales; Clostridiaceae;
OC   Clostridium.
XX
RN   [1]
RP   1-3800327
RA   Brinkac L.M., Brown J.L., Bruce D., Detter C., Munk C., Smith L.A.,
RA   Smith T.J., Sutton G., Brettin T.S.;
RT   ;
RL   Submitted (29-APR-2008) to the INSDC.
RL   Los Alamos National Laboratory, Los Alamos, NM, USA
XX
RN   [2]
RP   1-3800327
RG   US DOE Joint Genome Institute (JGI-PGF)
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Kyrpides N., Mavromatis K., Ivanova N.,
RA   Saunders E., Brettin T., Detter J.C., Han C., Larimer F., Land M.,
RA   Hauser L., Markowitz V., Cheng J.-F., Hugenholtz P., Woyke T., Wu D.,
RA   Gronow S., Klenk H.-P., Eisen J.A.;
RT   ;
RL   Submitted (01-JUN-2009) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive, Walnut Creek, CA
RL   94598-1698, USA
XX
RN   [3]
RC   Protein update by submitter
RP   1-3800327
RA   Shrivastava S., Brinkac L.M., Dodson R.J., Harkins D.M., Durkin A.S.,
RA   Sutton G.;
RT   ;
RL   Submitted (04-AUG-2009) to the INSDC.
RL   J. Craig Venter Institute, 9704 Medical Center Dr, Rockville, MD 20850, USA
XX
DR   MD5; b9e43e524832d99a50034d7fa56c6dcc.
DR   BioSample; SAMN02603538.
DR   EnsemblGenomes-Gn; CLL_A0008.
DR   EnsemblGenomes-Gn; CLL_A0010.
DR   EnsemblGenomes-Gn; CLL_A0011.
DR   EnsemblGenomes-Gn; CLL_A0012.
DR   EnsemblGenomes-Gn; CLL_A0013.
DR   EnsemblGenomes-Gn; CLL_A0019.
DR   EnsemblGenomes-Gn; CLL_A0020.
DR   EnsemblGenomes-Gn; CLL_A0021.
DR   EnsemblGenomes-Gn; CLL_A0022.
DR   EnsemblGenomes-Gn; CLL_A0030.
DR   EnsemblGenomes-Gn; CLL_A0162.
DR   EnsemblGenomes-Gn; CLL_A0163.
DR   EnsemblGenomes-Gn; CLL_A0164.
DR   EnsemblGenomes-Gn; CLL_A0165.
DR   EnsemblGenomes-Gn; CLL_A0166.
DR   EnsemblGenomes-Gn; CLL_A0167.
DR   EnsemblGenomes-Gn; CLL_A0168.
DR   EnsemblGenomes-Gn; CLL_A0179.
DR   EnsemblGenomes-Gn; CLL_A0180.
DR   EnsemblGenomes-Gn; CLL_A0181.
DR   EnsemblGenomes-Gn; CLL_A0186.
DR   EnsemblGenomes-Gn; CLL_A0187.
DR   EnsemblGenomes-Gn; CLL_A0188.
DR   EnsemblGenomes-Gn; CLL_A0190.
DR   EnsemblGenomes-Gn; CLL_A0191.
DR   EnsemblGenomes-Gn; CLL_A0192.
DR   EnsemblGenomes-Gn; CLL_A0193.
DR   EnsemblGenomes-Gn; CLL_A0223.
DR   EnsemblGenomes-Gn; CLL_A0420.
DR   EnsemblGenomes-Gn; CLL_A0421.
DR   EnsemblGenomes-Gn; CLL_A0422.
DR   EnsemblGenomes-Gn; CLL_A0423.
DR   EnsemblGenomes-Gn; CLL_A0424.
DR   EnsemblGenomes-Gn; CLL_A0425.
DR   EnsemblGenomes-Gn; CLL_A0426.
DR   EnsemblGenomes-Gn; CLL_A0427.
DR   EnsemblGenomes-Gn; CLL_A0428.
DR   EnsemblGenomes-Gn; CLL_A0429.
DR   EnsemblGenomes-Gn; CLL_A0430.
DR   EnsemblGenomes-Gn; CLL_A0431.
DR   EnsemblGenomes-Gn; CLL_A0432.
DR   EnsemblGenomes-Gn; CLL_A0433.
DR   EnsemblGenomes-Gn; CLL_A0434.
DR   EnsemblGenomes-Gn; CLL_A0435.
DR   EnsemblGenomes-Gn; CLL_A0436.
DR   EnsemblGenomes-Gn; CLL_A0438.
DR   EnsemblGenomes-Gn; CLL_A0439.
DR   EnsemblGenomes-Gn; CLL_A0441.
DR   EnsemblGenomes-Gn; CLL_A0442.
DR   EnsemblGenomes-Gn; CLL_A0508.
DR   EnsemblGenomes-Gn; CLL_A0509.
DR   EnsemblGenomes-Gn; CLL_A0510.
DR   EnsemblGenomes-Gn; CLL_A0511.
DR   EnsemblGenomes-Gn; CLL_A0512.
DR   EnsemblGenomes-Gn; CLL_A0513.
DR   EnsemblGenomes-Gn; CLL_A0514.
DR   EnsemblGenomes-Gn; CLL_A0534.
DR   EnsemblGenomes-Gn; CLL_A0542.
DR   EnsemblGenomes-Gn; CLL_A0690.
DR   EnsemblGenomes-Gn; CLL_A1082.
DR   EnsemblGenomes-Gn; CLL_A1767.
DR   EnsemblGenomes-Gn; CLL_A2048.
DR   EnsemblGenomes-Gn; CLL_A2049.
DR   EnsemblGenomes-Gn; CLL_A2050.
DR   EnsemblGenomes-Gn; CLL_A2051.
DR   EnsemblGenomes-Gn; CLL_A2596.
DR   EnsemblGenomes-Gn; CLL_A2795.
DR   EnsemblGenomes-Gn; CLL_A2943.
DR   EnsemblGenomes-Gn; CLL_A3382.
DR   EnsemblGenomes-Gn; CLL_A3383.
DR   EnsemblGenomes-Gn; CLL_A3406.
DR   EnsemblGenomes-Gn; CLL_A3407.
DR   EnsemblGenomes-Gn; CLL_A3408.
DR   EnsemblGenomes-Gn; CLL_A3409.
DR   EnsemblGenomes-Gn; CLL_A3411.
DR   EnsemblGenomes-Gn; CLL_A3418.
DR   EnsemblGenomes-Gn; CLL_A3419.
DR   EnsemblGenomes-Gn; CLL_A3421.
DR   EnsemblGenomes-Gn; CLL_A3451.
DR   EnsemblGenomes-Gn; CLL_A3466.
DR   EnsemblGenomes-Gn; CLL_A3481.
DR   EnsemblGenomes-Gn; CLL_A3482.
DR   EnsemblGenomes-Gn; CLL_A3484.
DR   EnsemblGenomes-Gn; CLL_A3485.
DR   EnsemblGenomes-Gn; CLL_A3486.
DR   EnsemblGenomes-Gn; CLL_A3488.
DR   EnsemblGenomes-Gn; CLL_A3490.
DR   EnsemblGenomes-Gn; CLL_A3491.
DR   EnsemblGenomes-Gn; CLL_A3493.
DR   EnsemblGenomes-Gn; CLL_A3495.
DR   EnsemblGenomes-Gn; CLL_A3496.
DR   EnsemblGenomes-Gn; CLL_A3498.
DR   EnsemblGenomes-Gn; CLL_A3499.
DR   EnsemblGenomes-Gn; CLL_A3500.
DR   EnsemblGenomes-Gn; CLL_A3502.
DR   EnsemblGenomes-Gn; CLL_A3507.
DR   EnsemblGenomes-Gn; CLL_A3508.
DR   EnsemblGenomes-Gn; CLL_A3512.
DR   EnsemblGenomes-Gn; CLL_A3513.
DR   EnsemblGenomes-Gn; CLL_A3514.
DR   EnsemblGenomes-Gn; CLL_A3516.
DR   EnsemblGenomes-Gn; CLL_A3561.
DR   EnsemblGenomes-Gn; CLL_A3562.
DR   EnsemblGenomes-Gn; CLL_A3563.
DR   EnsemblGenomes-Gn; CLL_A3564.
DR   EnsemblGenomes-Gn; CLL_A3565.
DR   EnsemblGenomes-Gn; CLL_A3566.
DR   EnsemblGenomes-Gn; CLL_A3567.
DR   EnsemblGenomes-Gn; CLL_A3568.
DR   EnsemblGenomes-Gn; CLL_A3569.
DR   EnsemblGenomes-Gn; CLL_A3570.
DR   EnsemblGenomes-Gn; CLL_A3571.
DR   EnsemblGenomes-Gn; CLL_A3605.
DR   EnsemblGenomes-Gn; CLL_A3606.
DR   EnsemblGenomes-Gn; CLL_A3607.
DR   EnsemblGenomes-Gn; CLL_A3608.
DR   EnsemblGenomes-Gn; EBG00001444091.
DR   EnsemblGenomes-Gn; EBG00001444092.
DR   EnsemblGenomes-Gn; EBG00001444093.
DR   EnsemblGenomes-Gn; EBG00001444094.
DR   EnsemblGenomes-Gn; EBG00001444095.
DR   EnsemblGenomes-Gn; EBG00001444096.
DR   EnsemblGenomes-Gn; EBG00001444097.
DR   EnsemblGenomes-Gn; EBG00001444098.
DR   EnsemblGenomes-Gn; EBG00001444099.
DR   EnsemblGenomes-Gn; EBG00001444100.
DR   EnsemblGenomes-Gn; EBG00001444101.
DR   EnsemblGenomes-Gn; EBG00001444102.
DR   EnsemblGenomes-Gn; EBG00001444103.
DR   EnsemblGenomes-Gn; EBG00001444104.
DR   EnsemblGenomes-Gn; EBG00001444105.
DR   EnsemblGenomes-Gn; EBG00001444106.
DR   EnsemblGenomes-Gn; EBG00001444107.
DR   EnsemblGenomes-Gn; EBG00001444108.
DR   EnsemblGenomes-Gn; EBG00001444109.
DR   EnsemblGenomes-Gn; EBG00001444110.
DR   EnsemblGenomes-Gn; EBG00001444111.
DR   EnsemblGenomes-Gn; EBG00001444112.
DR   EnsemblGenomes-Gn; EBG00001444113.
DR   EnsemblGenomes-Gn; EBG00001444114.
DR   EnsemblGenomes-Gn; EBG00001444115.
DR   EnsemblGenomes-Gn; EBG00001444116.
DR   EnsemblGenomes-Gn; EBG00001444117.
DR   EnsemblGenomes-Gn; EBG00001444118.
DR   EnsemblGenomes-Gn; EBG00001444119.
DR   EnsemblGenomes-Gn; EBG00001444120.
DR   EnsemblGenomes-Gn; EBG00001444121.
DR   EnsemblGenomes-Gn; EBG00001444122.
DR   EnsemblGenomes-Gn; EBG00001444123.
DR   EnsemblGenomes-Gn; EBG00001444124.
DR   EnsemblGenomes-Gn; EBG00001444125.
DR   EnsemblGenomes-Gn; EBG00001444126.
DR   EnsemblGenomes-Gn; EBG00001444127.
DR   EnsemblGenomes-Gn; EBG00001444128.
DR   EnsemblGenomes-Gn; EBG00001444129.
DR   EnsemblGenomes-Gn; EBG00001444130.
DR   EnsemblGenomes-Gn; EBG00001444131.
DR   EnsemblGenomes-Gn; EBG00001444132.
DR   EnsemblGenomes-Gn; EBG00001444133.
DR   EnsemblGenomes-Gn; EBG00001444134.
DR   EnsemblGenomes-Gn; EBG00001444135.
DR   EnsemblGenomes-Gn; EBG00001444136.
DR   EnsemblGenomes-Gn; EBG00001444137.
DR   EnsemblGenomes-Gn; EBG00001444138.
DR   EnsemblGenomes-Gn; EBG00001444139.
DR   EnsemblGenomes-Gn; EBG00001444140.
DR   EnsemblGenomes-Gn; EBG00001444141.
DR   EnsemblGenomes-Gn; EBG00001444142.
DR   EnsemblGenomes-Gn; EBG00001444143.
DR   EnsemblGenomes-Gn; EBG00001444144.
DR   EnsemblGenomes-Gn; EBG00001444145.
DR   EnsemblGenomes-Gn; EBG00001444146.
DR   EnsemblGenomes-Gn; EBG00001444147.
DR   EnsemblGenomes-Gn; EBG00001444148.
DR   EnsemblGenomes-Gn; EBG00001444149.
DR   EnsemblGenomes-Gn; EBG00001444150.
DR   EnsemblGenomes-Gn; EBG00001444151.
DR   EnsemblGenomes-Gn; EBG00001444152.
DR   EnsemblGenomes-Gn; EBG00001444153.
DR   EnsemblGenomes-Gn; EBG00001444154.
DR   EnsemblGenomes-Gn; EBG00001444155.
DR   EnsemblGenomes-Gn; EBG00001444156.
DR   EnsemblGenomes-Gn; EBG00001444157.
DR   EnsemblGenomes-Gn; EBG00001444158.
DR   EnsemblGenomes-Gn; EBG00001444159.
DR   EnsemblGenomes-Gn; EBG00001444160.
DR   EnsemblGenomes-Gn; EBG00001444161.
DR   EnsemblGenomes-Gn; EBG00001444162.
DR   EnsemblGenomes-Gn; EBG00001444163.
DR   EnsemblGenomes-Gn; EBG00001444164.
DR   EnsemblGenomes-Gn; EBG00001444165.
DR   EnsemblGenomes-Gn; EBG00001444166.
DR   EnsemblGenomes-Gn; EBG00001444167.
DR   EnsemblGenomes-Gn; EBG00001444168.
DR   EnsemblGenomes-Gn; EBG00001444169.
DR   EnsemblGenomes-Gn; EBG00001444170.
DR   EnsemblGenomes-Gn; EBG00001444171.
DR   EnsemblGenomes-Gn; EBG00001444172.
DR   EnsemblGenomes-Gn; EBG00001444173.
DR   EnsemblGenomes-Gn; EBG00001444174.
DR   EnsemblGenomes-Gn; EBG00001444175.
DR   EnsemblGenomes-Gn; EBG00001444176.
DR   EnsemblGenomes-Gn; EBG00001444177.
DR   EnsemblGenomes-Gn; EBG00001444178.
DR   EnsemblGenomes-Gn; EBG00001444179.
DR   EnsemblGenomes-Gn; EBG00001444180.
DR   EnsemblGenomes-Gn; EBG00001444181.
DR   EnsemblGenomes-Gn; EBG00001444182.
DR   EnsemblGenomes-Gn; EBG00001444183.
DR   EnsemblGenomes-Gn; EBG00001444184.
DR   EnsemblGenomes-Gn; EBG00001444185.
DR   EnsemblGenomes-Gn; EBG00001444186.
DR   EnsemblGenomes-Gn; EBG00001444187.
DR   EnsemblGenomes-Gn; EBG00001444188.
DR   EnsemblGenomes-Gn; EBG00001444189.
DR   EnsemblGenomes-Gn; EBG00001444190.
DR   EnsemblGenomes-Gn; EBG00001444191.
DR   EnsemblGenomes-Gn; EBG00001444192.
DR   EnsemblGenomes-Gn; EBG00001444193.
DR   EnsemblGenomes-Gn; EBG00001444194.
DR   EnsemblGenomes-Gn; EBG00001444195.
DR   EnsemblGenomes-Gn; EBG00001444196.
DR   EnsemblGenomes-Gn; EBG00001444197.
DR   EnsemblGenomes-Gn; EBG00001444198.
DR   EnsemblGenomes-Gn; EBG00001444199.
DR   EnsemblGenomes-Gn; EBG00001444200.
DR   EnsemblGenomes-Gn; EBG00001444201.
DR   EnsemblGenomes-Gn; EBG00001444202.
DR   EnsemblGenomes-Gn; EBG00001444203.
DR   EnsemblGenomes-Gn; EBG00001444204.
DR   EnsemblGenomes-Gn; EBG00001444205.
DR   EnsemblGenomes-Gn; EBG00001444206.
DR   EnsemblGenomes-Gn; EBG00001444207.
DR   EnsemblGenomes-Gn; EBG00001444208.
DR   EnsemblGenomes-Gn; EBG00001444209.
DR   EnsemblGenomes-Gn; EBG00001444210.
DR   EnsemblGenomes-Gn; EBG00001444211.
DR   EnsemblGenomes-Gn; EBG00001444212.
DR   EnsemblGenomes-Gn; EBG00001444213.
DR   EnsemblGenomes-Gn; EBG00001444214.
DR   EnsemblGenomes-Gn; EBG00001444215.
DR   EnsemblGenomes-Gn; EBG00001444216.
DR   EnsemblGenomes-Gn; EBG00001444217.
DR   EnsemblGenomes-Gn; EBG00001444218.
DR   EnsemblGenomes-Gn; EBG00001444219.
DR   EnsemblGenomes-Gn; EBG00001444220.
DR   EnsemblGenomes-Gn; EBG00001444221.
DR   EnsemblGenomes-Gn; EBG00001444222.
DR   EnsemblGenomes-Gn; EBG00001444223.
DR   EnsemblGenomes-Gn; EBG00001444224.
DR   EnsemblGenomes-Gn; EBG00001444225.
DR   EnsemblGenomes-Gn; EBG00001444226.
DR   EnsemblGenomes-Gn; EBG00001444227.
DR   EnsemblGenomes-Gn; EBG00001444228.
DR   EnsemblGenomes-Gn; EBG00001444229.
DR   EnsemblGenomes-Gn; EBG00001444230.
DR   EnsemblGenomes-Gn; EBG00001444231.
DR   EnsemblGenomes-Gn; EBG00001444232.
DR   EnsemblGenomes-Gn; EBG00001444233.
DR   EnsemblGenomes-Gn; EBG00001444234.
DR   EnsemblGenomes-Gn; EBG00001444235.
DR   EnsemblGenomes-Gn; EBG00001444236.
DR   EnsemblGenomes-Gn; EBG00001444237.
DR   EnsemblGenomes-Gn; EBG00001444238.
DR   EnsemblGenomes-Gn; EBG00001444239.
DR   EnsemblGenomes-Gn; EBG00001444240.
DR   EnsemblGenomes-Gn; EBG00001444241.
DR   EnsemblGenomes-Gn; EBG00001444242.
DR   EnsemblGenomes-Gn; EBG00001444243.
DR   EnsemblGenomes-Gn; EBG00001444244.
DR   EnsemblGenomes-Gn; EBG00001444245.
DR   EnsemblGenomes-Gn; EBG00001444246.
DR   EnsemblGenomes-Gn; EBG00001444247.
DR   EnsemblGenomes-Gn; EBG00001444248.
DR   EnsemblGenomes-Tr; CLL_A0008-1.
DR   EnsemblGenomes-Tr; CLL_A0010-1.
DR   EnsemblGenomes-Tr; CLL_A0011-1.
DR   EnsemblGenomes-Tr; CLL_A0012-1.
DR   EnsemblGenomes-Tr; CLL_A0013-1.
DR   EnsemblGenomes-Tr; CLL_A0019-1.
DR   EnsemblGenomes-Tr; CLL_A0020-1.
DR   EnsemblGenomes-Tr; CLL_A0021-1.
DR   EnsemblGenomes-Tr; CLL_A0022-1.
DR   EnsemblGenomes-Tr; CLL_A0030-1.
DR   EnsemblGenomes-Tr; CLL_A0162-1.
DR   EnsemblGenomes-Tr; CLL_A0163-1.
DR   EnsemblGenomes-Tr; CLL_A0164-1.
DR   EnsemblGenomes-Tr; CLL_A0165-1.
DR   EnsemblGenomes-Tr; CLL_A0166-1.
DR   EnsemblGenomes-Tr; CLL_A0167-1.
DR   EnsemblGenomes-Tr; CLL_A0168-1.
DR   EnsemblGenomes-Tr; CLL_A0179-1.
DR   EnsemblGenomes-Tr; CLL_A0180-1.
DR   EnsemblGenomes-Tr; CLL_A0181-1.
DR   EnsemblGenomes-Tr; CLL_A0186-1.
DR   EnsemblGenomes-Tr; CLL_A0187-1.
DR   EnsemblGenomes-Tr; CLL_A0188-1.
DR   EnsemblGenomes-Tr; CLL_A0190-1.
DR   EnsemblGenomes-Tr; CLL_A0191-1.
DR   EnsemblGenomes-Tr; CLL_A0192-1.
DR   EnsemblGenomes-Tr; CLL_A0193-1.
DR   EnsemblGenomes-Tr; CLL_A0223-1.
DR   EnsemblGenomes-Tr; CLL_A0420-1.
DR   EnsemblGenomes-Tr; CLL_A0421-1.
DR   EnsemblGenomes-Tr; CLL_A0422-1.
DR   EnsemblGenomes-Tr; CLL_A0423-1.
DR   EnsemblGenomes-Tr; CLL_A0424-1.
DR   EnsemblGenomes-Tr; CLL_A0425-1.
DR   EnsemblGenomes-Tr; CLL_A0426-1.
DR   EnsemblGenomes-Tr; CLL_A0427-1.
DR   EnsemblGenomes-Tr; CLL_A0428-1.
DR   EnsemblGenomes-Tr; CLL_A0429-1.
DR   EnsemblGenomes-Tr; CLL_A0430-1.
DR   EnsemblGenomes-Tr; CLL_A0431-1.
DR   EnsemblGenomes-Tr; CLL_A0432-1.
DR   EnsemblGenomes-Tr; CLL_A0433-1.
DR   EnsemblGenomes-Tr; CLL_A0434-1.
DR   EnsemblGenomes-Tr; CLL_A0435-1.
DR   EnsemblGenomes-Tr; CLL_A0436-1.
DR   EnsemblGenomes-Tr; CLL_A0438-1.
DR   EnsemblGenomes-Tr; CLL_A0439-1.
DR   EnsemblGenomes-Tr; CLL_A0441-1.
DR   EnsemblGenomes-Tr; CLL_A0442-1.
DR   EnsemblGenomes-Tr; CLL_A0508-1.
DR   EnsemblGenomes-Tr; CLL_A0509-1.
DR   EnsemblGenomes-Tr; CLL_A0510-1.
DR   EnsemblGenomes-Tr; CLL_A0511-1.
DR   EnsemblGenomes-Tr; CLL_A0512-1.
DR   EnsemblGenomes-Tr; CLL_A0513-1.
DR   EnsemblGenomes-Tr; CLL_A0514-1.
DR   EnsemblGenomes-Tr; CLL_A0534-1.
DR   EnsemblGenomes-Tr; CLL_A0542-1.
DR   EnsemblGenomes-Tr; CLL_A0690-1.
DR   EnsemblGenomes-Tr; CLL_A1082-1.
DR   EnsemblGenomes-Tr; CLL_A1767-1.
DR   EnsemblGenomes-Tr; CLL_A2048-1.
DR   EnsemblGenomes-Tr; CLL_A2049-1.
DR   EnsemblGenomes-Tr; CLL_A2050-1.
DR   EnsemblGenomes-Tr; CLL_A2051-1.
DR   EnsemblGenomes-Tr; CLL_A2596-1.
DR   EnsemblGenomes-Tr; CLL_A2795-1.
DR   EnsemblGenomes-Tr; CLL_A2943-1.
DR   EnsemblGenomes-Tr; CLL_A3382-1.
DR   EnsemblGenomes-Tr; CLL_A3383-1.
DR   EnsemblGenomes-Tr; CLL_A3406-1.
DR   EnsemblGenomes-Tr; CLL_A3407-1.
DR   EnsemblGenomes-Tr; CLL_A3408-1.
DR   EnsemblGenomes-Tr; CLL_A3409-1.
DR   EnsemblGenomes-Tr; CLL_A3411-1.
DR   EnsemblGenomes-Tr; CLL_A3418-1.
DR   EnsemblGenomes-Tr; CLL_A3419-1.
DR   EnsemblGenomes-Tr; CLL_A3421-1.
DR   EnsemblGenomes-Tr; CLL_A3451-1.
DR   EnsemblGenomes-Tr; CLL_A3466-1.
DR   EnsemblGenomes-Tr; CLL_A3481-1.
DR   EnsemblGenomes-Tr; CLL_A3482-1.
DR   EnsemblGenomes-Tr; CLL_A3484-1.
DR   EnsemblGenomes-Tr; CLL_A3485-1.
DR   EnsemblGenomes-Tr; CLL_A3486-1.
DR   EnsemblGenomes-Tr; CLL_A3488-1.
DR   EnsemblGenomes-Tr; CLL_A3490-1.
DR   EnsemblGenomes-Tr; CLL_A3491-1.
DR   EnsemblGenomes-Tr; CLL_A3493-1.
DR   EnsemblGenomes-Tr; CLL_A3495-1.
DR   EnsemblGenomes-Tr; CLL_A3496-1.
DR   EnsemblGenomes-Tr; CLL_A3498-1.
DR   EnsemblGenomes-Tr; CLL_A3499-1.
DR   EnsemblGenomes-Tr; CLL_A3500-1.
DR   EnsemblGenomes-Tr; CLL_A3502-1.
DR   EnsemblGenomes-Tr; CLL_A3507-1.
DR   EnsemblGenomes-Tr; CLL_A3508-1.
DR   EnsemblGenomes-Tr; CLL_A3512-1.
DR   EnsemblGenomes-Tr; CLL_A3513-1.
DR   EnsemblGenomes-Tr; CLL_A3514-1.
DR   EnsemblGenomes-Tr; CLL_A3516-1.
DR   EnsemblGenomes-Tr; CLL_A3561-1.
DR   EnsemblGenomes-Tr; CLL_A3562-1.
DR   EnsemblGenomes-Tr; CLL_A3563-1.
DR   EnsemblGenomes-Tr; CLL_A3564-1.
DR   EnsemblGenomes-Tr; CLL_A3565-1.
DR   EnsemblGenomes-Tr; CLL_A3566-1.
DR   EnsemblGenomes-Tr; CLL_A3567-1.
DR   EnsemblGenomes-Tr; CLL_A3568-1.
DR   EnsemblGenomes-Tr; CLL_A3569-1.
DR   EnsemblGenomes-Tr; CLL_A3570-1.
DR   EnsemblGenomes-Tr; CLL_A3571-1.
DR   EnsemblGenomes-Tr; CLL_A3605-1.
DR   EnsemblGenomes-Tr; CLL_A3606-1.
DR   EnsemblGenomes-Tr; CLL_A3607-1.
DR   EnsemblGenomes-Tr; CLL_A3608-1.
DR   EnsemblGenomes-Tr; EBT00001821765.
DR   EnsemblGenomes-Tr; EBT00001821766.
DR   EnsemblGenomes-Tr; EBT00001821767.
DR   EnsemblGenomes-Tr; EBT00001821768.
DR   EnsemblGenomes-Tr; EBT00001821769.
DR   EnsemblGenomes-Tr; EBT00001821770.
DR   EnsemblGenomes-Tr; EBT00001821771.
DR   EnsemblGenomes-Tr; EBT00001821772.
DR   EnsemblGenomes-Tr; EBT00001821773.
DR   EnsemblGenomes-Tr; EBT00001821774.
DR   EnsemblGenomes-Tr; EBT00001821775.
DR   EnsemblGenomes-Tr; EBT00001821776.
DR   EnsemblGenomes-Tr; EBT00001821777.
DR   EnsemblGenomes-Tr; EBT00001821778.
DR   EnsemblGenomes-Tr; EBT00001821779.
DR   EnsemblGenomes-Tr; EBT00001821780.
DR   EnsemblGenomes-Tr; EBT00001821781.
DR   EnsemblGenomes-Tr; EBT00001821782.
DR   EnsemblGenomes-Tr; EBT00001821783.
DR   EnsemblGenomes-Tr; EBT00001821784.
DR   EnsemblGenomes-Tr; EBT00001821785.
DR   EnsemblGenomes-Tr; EBT00001821786.
DR   EnsemblGenomes-Tr; EBT00001821787.
DR   EnsemblGenomes-Tr; EBT00001821788.
DR   EnsemblGenomes-Tr; EBT00001821789.
DR   EnsemblGenomes-Tr; EBT00001821790.
DR   EnsemblGenomes-Tr; EBT00001821791.
DR   EnsemblGenomes-Tr; EBT00001821792.
DR   EnsemblGenomes-Tr; EBT00001821793.
DR   EnsemblGenomes-Tr; EBT00001821794.
DR   EnsemblGenomes-Tr; EBT00001821795.
DR   EnsemblGenomes-Tr; EBT00001821796.
DR   EnsemblGenomes-Tr; EBT00001821797.
DR   EnsemblGenomes-Tr; EBT00001821798.
DR   EnsemblGenomes-Tr; EBT00001821799.
DR   EnsemblGenomes-Tr; EBT00001821800.
DR   EnsemblGenomes-Tr; EBT00001821801.
DR   EnsemblGenomes-Tr; EBT00001821802.
DR   EnsemblGenomes-Tr; EBT00001821803.
DR   EnsemblGenomes-Tr; EBT00001821804.
DR   EnsemblGenomes-Tr; EBT00001821805.
DR   EnsemblGenomes-Tr; EBT00001821806.
DR   EnsemblGenomes-Tr; EBT00001821807.
DR   EnsemblGenomes-Tr; EBT00001821808.
DR   EnsemblGenomes-Tr; EBT00001821809.
DR   EnsemblGenomes-Tr; EBT00001821810.
DR   EnsemblGenomes-Tr; EBT00001821811.
DR   EnsemblGenomes-Tr; EBT00001821812.
DR   EnsemblGenomes-Tr; EBT00001821813.
DR   EnsemblGenomes-Tr; EBT00001821814.
DR   EnsemblGenomes-Tr; EBT00001821815.
DR   EnsemblGenomes-Tr; EBT00001821816.
DR   EnsemblGenomes-Tr; EBT00001821817.
DR   EnsemblGenomes-Tr; EBT00001821818.
DR   EnsemblGenomes-Tr; EBT00001821819.
DR   EnsemblGenomes-Tr; EBT00001821820.
DR   EnsemblGenomes-Tr; EBT00001821821.
DR   EnsemblGenomes-Tr; EBT00001821822.
DR   EnsemblGenomes-Tr; EBT00001821823.
DR   EnsemblGenomes-Tr; EBT00001821824.
DR   EnsemblGenomes-Tr; EBT00001821825.
DR   EnsemblGenomes-Tr; EBT00001821826.
DR   EnsemblGenomes-Tr; EBT00001821827.
DR   EnsemblGenomes-Tr; EBT00001821828.
DR   EnsemblGenomes-Tr; EBT00001821829.
DR   EnsemblGenomes-Tr; EBT00001821830.
DR   EnsemblGenomes-Tr; EBT00001821831.
DR   EnsemblGenomes-Tr; EBT00001821832.
DR   EnsemblGenomes-Tr; EBT00001821833.
DR   EnsemblGenomes-Tr; EBT00001821834.
DR   EnsemblGenomes-Tr; EBT00001821835.
DR   EnsemblGenomes-Tr; EBT00001821836.
DR   EnsemblGenomes-Tr; EBT00001821837.
DR   EnsemblGenomes-Tr; EBT00001821838.
DR   EnsemblGenomes-Tr; EBT00001821839.
DR   EnsemblGenomes-Tr; EBT00001821840.
DR   EnsemblGenomes-Tr; EBT00001821841.
DR   EnsemblGenomes-Tr; EBT00001821842.
DR   EnsemblGenomes-Tr; EBT00001821843.
DR   EnsemblGenomes-Tr; EBT00001821844.
DR   EnsemblGenomes-Tr; EBT00001821845.
DR   EnsemblGenomes-Tr; EBT00001821846.
DR   EnsemblGenomes-Tr; EBT00001821847.
DR   EnsemblGenomes-Tr; EBT00001821848.
DR   EnsemblGenomes-Tr; EBT00001821849.
DR   EnsemblGenomes-Tr; EBT00001821850.
DR   EnsemblGenomes-Tr; EBT00001821851.
DR   EnsemblGenomes-Tr; EBT00001821852.
DR   EnsemblGenomes-Tr; EBT00001821853.
DR   EnsemblGenomes-Tr; EBT00001821854.
DR   EnsemblGenomes-Tr; EBT00001821855.
DR   EnsemblGenomes-Tr; EBT00001821856.
DR   EnsemblGenomes-Tr; EBT00001821857.
DR   EnsemblGenomes-Tr; EBT00001821858.
DR   EnsemblGenomes-Tr; EBT00001821859.
DR   EnsemblGenomes-Tr; EBT00001821860.
DR   EnsemblGenomes-Tr; EBT00001821861.
DR   EnsemblGenomes-Tr; EBT00001821862.
DR   EnsemblGenomes-Tr; EBT00001821863.
DR   EnsemblGenomes-Tr; EBT00001821864.
DR   EnsemblGenomes-Tr; EBT00001821865.
DR   EnsemblGenomes-Tr; EBT00001821866.
DR   EnsemblGenomes-Tr; EBT00001821867.
DR   EnsemblGenomes-Tr; EBT00001821868.
DR   EnsemblGenomes-Tr; EBT00001821869.
DR   EnsemblGenomes-Tr; EBT00001821870.
DR   EnsemblGenomes-Tr; EBT00001821871.
DR   EnsemblGenomes-Tr; EBT00001821872.
DR   EnsemblGenomes-Tr; EBT00001821873.
DR   EnsemblGenomes-Tr; EBT00001821874.
DR   EnsemblGenomes-Tr; EBT00001821875.
DR   EnsemblGenomes-Tr; EBT00001821876.
DR   EnsemblGenomes-Tr; EBT00001821877.
DR   EnsemblGenomes-Tr; EBT00001821878.
DR   EnsemblGenomes-Tr; EBT00001821879.
DR   EnsemblGenomes-Tr; EBT00001821880.
DR   EnsemblGenomes-Tr; EBT00001821881.
DR   EnsemblGenomes-Tr; EBT00001821882.
DR   EnsemblGenomes-Tr; EBT00001821883.
DR   EnsemblGenomes-Tr; EBT00001821884.
DR   EnsemblGenomes-Tr; EBT00001821885.
DR   EnsemblGenomes-Tr; EBT00001821886.
DR   EnsemblGenomes-Tr; EBT00001821887.
DR   EnsemblGenomes-Tr; EBT00001821888.
DR   EnsemblGenomes-Tr; EBT00001821889.
DR   EnsemblGenomes-Tr; EBT00001821890.
DR   EnsemblGenomes-Tr; EBT00001821891.
DR   EnsemblGenomes-Tr; EBT00001821892.
DR   EnsemblGenomes-Tr; EBT00001821893.
DR   EnsemblGenomes-Tr; EBT00001821894.
DR   EnsemblGenomes-Tr; EBT00001821895.
DR   EnsemblGenomes-Tr; EBT00001821896.
DR   EnsemblGenomes-Tr; EBT00001821897.
DR   EnsemblGenomes-Tr; EBT00001821898.
DR   EnsemblGenomes-Tr; EBT00001821899.
DR   EnsemblGenomes-Tr; EBT00001821900.
DR   EnsemblGenomes-Tr; EBT00001821901.
DR   EnsemblGenomes-Tr; EBT00001821902.
DR   EnsemblGenomes-Tr; EBT00001821903.
DR   EnsemblGenomes-Tr; EBT00001821904.
DR   EnsemblGenomes-Tr; EBT00001821905.
DR   EnsemblGenomes-Tr; EBT00001821906.
DR   EnsemblGenomes-Tr; EBT00001821907.
DR   EnsemblGenomes-Tr; EBT00001821908.
DR   EnsemblGenomes-Tr; EBT00001821909.
DR   EnsemblGenomes-Tr; EBT00001821910.
DR   EnsemblGenomes-Tr; EBT00001821911.
DR   EnsemblGenomes-Tr; EBT00001821912.
DR   EnsemblGenomes-Tr; EBT00001821913.
DR   EnsemblGenomes-Tr; EBT00001821914.
DR   EnsemblGenomes-Tr; EBT00001821915.
DR   EnsemblGenomes-Tr; EBT00001821916.
DR   EnsemblGenomes-Tr; EBT00001821917.
DR   EnsemblGenomes-Tr; EBT00001821918.
DR   EnsemblGenomes-Tr; EBT00001821919.
DR   EnsemblGenomes-Tr; EBT00001821920.
DR   EnsemblGenomes-Tr; EBT00001821921.
DR   EnsemblGenomes-Tr; EBT00001821922.
DR   EuropePMC; PMC2764570; 19804621.
DR   EuropePMC; PMC3067269; 21183631.
DR   EuropePMC; PMC4031146; 24853378.
DR   EuropePMC; PMC4778365; 26939550.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00002; 5_8S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00167; Purine.
DR   RFAM; RF00168; Lysine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00234; glmS.
DR   RFAM; RF00380; ykoK.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00522; PreQ1.
DR   RFAM; RF00557; L10_leader.
DR   RFAM; RF00558; L20_leader.
DR   RFAM; RF01051; c-di-GMP-I.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01316; CRISPR-DR3.
DR   RFAM; RF01764; yjdF.
DR   RFAM; RF01786; c-di-GMP-II.
DR   RFAM; RF01831; THF.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP001056.
DR   SILVA-SSU; CP001056.
XX
CC   The authors wish to acknowledge the Intelligence Technology
CC   Innovation Center for funding the sequencing and the NIH/NIAID for
CC   funding the annotation at the Pathema Bioinformatics Resource
CC   Center.
CC   For more information about this strain contact Theresa Smith,
CC   Integrated Toxicology, United States Army Medical Institute of
CC   Infectious Diseases, theresa.smith@amedd.army.mil.
CC   The NIAID funded Bioinformatics Resource Center PathoSystems
CC   Resource Integration Center (PATRIC; http://patricbrc.vbi.vt.edu/)
CC   is responsible for annotation updates of this record.
CC   The authors would like to gratefully acknowledge Dr. Ron Walters
CC   for sponsoring this genome sequencing and assembly project.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3800327
FT                   /organism="Clostridium botulinum B str. Eklund 17B (NRP)"
FT                   /strain="Eklund 17B"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:935198"
FT   gene            175..1545
FT                   /gene="dnaA"
FT                   /locus_tag="CLL_A0001"
FT   CDS_pept        175..1545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="CLL_A0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="identified by match to protein family HMM PF00308;
FT                   match to protein family HMM PF08299; match to protein
FT                   family HMM TIGR00362"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0001"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25095"
FT                   /db_xref="GOA:B2THB4"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2THB4"
FT                   /protein_id="ACD25095.1"
FT                   /translation="MDADLNKLWEKTLNIVKSEMSEVSFNTWIKSCEPISISDTSIKIS
FT                   VPNSFTKDILDKRYKSLVANSIEAVCSKLYEIKFIIESDLNNEDELNNSDNSDKNRDKN
FT                   SRRNIVVNDEMSSTLNPKYTFNSFVIGNSNRFAHAASLAVAEAPAKAYNPLFIYGGVGL
FT                   GKTHLMHAIGHYILQNNTKAKVVYVSSEKFTNELINAIKDDKNEEFRKKYRNVDVLLID
FT                   DIQFIAGKERTQEEFFHTFNELHDANKQIILSSDRPPKEIPTLEDRLRSRFEWGLIADI
FT                   QVPDFETRMAILKKKADVENLKVANEVMGYIATKIKSNIRELEGALIRIIAYSSLTNRE
FT                   VTVDLASEALKDIISKKQGKHVTIPSIQEIVANYFNLKIDDLKSQRRTRNVAYPRQIAM
FT                   YLSRKLTDMSLPKIGEEFGGRDHTTVIHAYEKISENLKSDESLQHTVSDITKKVSQN"
FT   gene            1806..2906
FT                   /gene="dnaN"
FT                   /locus_tag="CLL_A0002"
FT   CDS_pept        1806..2906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="CLL_A0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="identified by match to protein family HMM PF00712;
FT                   match to protein family HMM PF02767; match to protein
FT                   family HMM PF02768; match to protein family HMM TIGR00663"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22381"
FT                   /db_xref="GOA:B2THB5"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:B2THB5"
FT                   /protein_id="ACD22381.1"
FT                   /translation="MIFICEKHKLLDGISIVQKAITGKSTMKVLDGIYINATNDGLRLI
FT                   GSDMDLSIQTLVNADVLDKGEIVIDAKIFGEIIRKLPNSDIKIETVKEDVIQITCEKSV
FT                   FNVVCMNAEEFPSLPNINEDLKVEVNESILKNMIKGTSFSIAQDEARPILQGILFQVKD
FT                   RNLNLVALDGYRLAIRSEFLDNDINLEVVIPGKTLVEVSKILEDHDKNVDITFTNNHIL
FT                   FNLENTKIISRLLDGKFVNYTSLLPQEHKLLVTVKKEEFQNGIERASLMAKDGNNNLIN
FT                   LDLKEETLIITSNSQLGKVREEVSINLQGDEIEIAFNSRYLLDVLKNMESDEVILEMTS
FT                   GVSPCVIKEKDGENSQYLVLPVRQMR"
FT   gene            2945..3151
FT                   /gene="yaaA"
FT                   /locus_tag="CLL_A0003"
FT   CDS_pept        2945..3151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaA"
FT                   /locus_tag="CLL_A0003"
FT                   /product="S4 domain protein YaaA"
FT                   /note="identified by match to protein family HMM PF01479;
FT                   match to protein family HMM TIGR02988"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23566"
FT                   /db_xref="GOA:B2THB6"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:B2THB6"
FT                   /protein_id="ACD23566.1"
FT                   /translation="MNKIKINTEIIKLDAFLKWSGIASLGSEAKIYIQEGLIKVNGEIC
FT                   LQRGKKLKAGDIIEFEDEKFEIV"
FT   gene            3223..4308
FT                   /locus_tag="CLL_A0004"
FT   CDS_pept        3223..4308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0004"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="identified by match to protein family HMM PF02463;
FT                   match to protein family HMM TIGR00611"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0004"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22044"
FT                   /db_xref="GOA:B2THB7"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2THB7"
FT                   /protein_id="ACD22044.1"
FT                   /translation="MYIKAIMLANYRNYNNLELNLSEGVNVFIGDNAQGKTNVLESIYY
FT                   CAFAKSHRTSRDKDLINWKENEAYISLLVGKKRLDKRIDIKILRDGKKAIKVNSIKINK
FT                   IGELFGTFNVVMFSPEDLKIIKESPGIRRKFLDMELCQISKKYYFNLVQYNKILNERNV
FT                   ILRSRDFNKDILEVYDLQLVECADYIVKERLEYIDKINYYGKFIHNEITSGKEDIVFKY
FT                   DSGIKFKDDFKYAFLEKLKNNLLRDREQGITSIGPHRDDFNVLINNIDVKKFGSQGQQR
FT                   TAVLTMKFSSLKIIKEITKEYPILLLDDVLSELDINRKRYVLSTLNDIQTIITCTGIND
FT                   LEDYLDDKSKVFKVCNGEIVN"
FT   gene            4323..4583
FT                   /locus_tag="CLL_A0005"
FT   CDS_pept        4323..4583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0005"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0005"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22448"
FT                   /db_xref="InterPro:IPR007169"
FT                   /db_xref="UniProtKB/TrEMBL:B2THB8"
FT                   /protein_id="ACD22448.1"
FT                   /translation="MFLHLGENVVVPIKDIIGIFDLDNTMYSSDTIQFLRLAEEDGFVE
FT                   RITNEKPKSFVIAEVNKMSKIYLSPISSATLTKRTDIEYNS"
FT   gene            4619..6526
FT                   /gene="gyrB"
FT                   /locus_tag="CLL_A0006"
FT   CDS_pept        4619..6526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="CLL_A0006"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="identified by match to protein family HMM PF00204;
FT                   match to protein family HMM PF00986; match to protein
FT                   family HMM PF01751; match to protein family HMM PF02518;
FT                   match to protein family HMM TIGR01059"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0006"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23426"
FT                   /db_xref="GOA:B2THB9"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B2THB9"
FT                   /protein_id="ACD23426.1"
FT                   /translation="MEQNNQKYDENQIQVLEGLEAVRKRPGMYIGSTSARGLHHLVYEI
FT                   VDNSIDEALAGYCKNIEVKINKDNSITSSDDGRGMPVGMHPKMHKSAVEVIMTILHAGG
FT                   KFGGGGYKVSGGLHGVGASVVNALSEQCIVTVKREGHIWKQEYSKGKVLYDLKQIGNTE
FT                   ESGTTIYFKPDAEIFDEVLFDFDTLSQRLRELAFLNKGINIKLIDSRNDREENYYYEGG
FT                   IKSFVSYLNRNKTPLHPEPIYVEGIKDKVTVELGLQYNDGYTENLFSFANNIDTIEGGT
FT                   HLVGFKTALTRAFNDYAKRFGFIKENDKNFSGDDIREGLTAVISVKIEDPQFEGQTKTK
FT                   LGNSEVKGIVDSIVSEYIGIFLEENPGISKIIIDKALMAARAREAARKARELTRKSVLE
FT                   RTTLPGKLADCSSKDPRECEIYIVEGDSAGGSAKQGRDRKFQAILPLRGKIMNVEKQRL
FT                   DKILNSETIRSMVTAFGGGIGKDFDIEKIRYNRIIIMTDADVDGAHIRTLLLTFFYRYM
FT                   RELVEQGHVYIAQPPLFRVGKGKKEVYAYSDSELDQVLLDMGGKDTSVDIQRYKGLGEM
FT                   NATQLWDTTMDPAKRILLKAEIEDAMAADEIFTILMGEKVEPRREFIEQNAKNVVNLDI
FT                   "
FT   gene            6549..9098
FT                   /gene="gyrA"
FT                   /locus_tag="CLL_A0007"
FT   CDS_pept        6549..9098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrA"
FT                   /locus_tag="CLL_A0007"
FT                   /product="DNA gyrase, A subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="identified by match to protein family HMM PF00521;
FT                   match to protein family HMM PF03989; match to protein
FT                   family HMM TIGR01063"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0007"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23928"
FT                   /db_xref="GOA:B2THC0"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:B2THC0"
FT                   /protein_id="ACD23928.1"
FT                   /translation="MEFNEGKIISVDIKNEMKKCYIDYAMSVIVGRALPDVRDGLKPVH
FT                   RRILYSMQILGLSPEKGYRKCARIVGDVLGKYHPHGDTSVYDALVRMAQDFSMRYMLVD
FT                   GHGNFGSVDGDGAAAMRYTEAKMNKIAVEMLRDINKNTVDFMPNFDGEEEEPTVLPSRF
FT                   PNLLVNGSSGIAVGMATNIPPHNLGEVIDGTIMLIDNPESSVLELMTKIKGPDFPTGAT
FT                   IMGHAGIRSAYETGRGKIVIRAKSNIEEENGRHKIIFTEIPYQVNKARLIENIAELVKD
FT                   KKITGISDLRDESDRDGMRIVIELKKDANPNIILNLLYKHTKLQDSFGVIMLALVNNET
FT                   KVLNLKEVLVHYVDFQKEVITRRTTFELNKAEARAHILEGLKIALDNIDRVISIIRNSS
FT                   TSEIAKNTLMDEFALSEKQSQAILEMKLRRLTGLERDKIDDEYNELLKQMEYLRSILAS
FT                   EEKLLEVIKNELLEIKAKYGDERRTSIEQDMNEINIEDLIQEEDVVITLTKSGYIKRIS
FT                   ADVYSAQRRGGRGIQAMSTKEDDFVDHVMITSTHSDVLFFTNRGRVYKLRAYEIPDAGR
FT                   QAKGTNIINLIAIEPDEKIQTVLTVTDKRRDGYLFMGTKQGIVKKTHLNEFRNLRKNGL
FT                   IAINLRENDELLKVKITYGDANVMFVTQNGYALRFNEKDVRHMGRTASGVKAITLKGDD
FT                   IAVCMDIAVDEEELLVISENGFGKRTPVNEYKVQHRGGVGLITYKISEKTGKLVGATIC
FT                   KLDDELMLINTNGVAIRINVSDISKTSRSAMGVTLMRTNEEEKIVAIAKILKGDDEDLE
FT                   QNELESSQEDDLVNLDDSLDELVERAEDDIENDIDIE"
FT   gene            9618..11122
FT                   /gene="rrsA"
FT                   /locus_tag="CLL_A0008"
FT   rRNA            9618..11122
FT                   /gene="rrsA"
FT                   /locus_tag="CLL_A0008"
FT                   /product="16S ribosomal RNA"
FT   gene            11352..14261
FT                   /gene="rrlA"
FT                   /locus_tag="CLL_A0010"
FT   rRNA            11352..14261
FT                   /gene="rrlA"
FT                   /locus_tag="CLL_A0010"
FT                   /product="23S ribosomal RNA"
FT   gene            14321..14437
FT                   /gene="rrfA"
FT                   /locus_tag="CLL_A0011"
FT   rRNA            14321..14437
FT                   /gene="rrfA"
FT                   /locus_tag="CLL_A0011"
FT                   /product="5S ribosomal RNA"
FT   gene            14441..14517
FT                   /locus_tag="CLL_A0012"
FT   tRNA            14441..14517
FT                   /locus_tag="CLL_A0012"
FT                   /product="tRNA-Met"
FT   gene            14521..14598
FT                   /locus_tag="CLL_A0013"
FT   tRNA            14521..14598
FT                   /locus_tag="CLL_A0013"
FT                   /product="tRNA-Ala"
FT   gene            14679..15182
FT                   /locus_tag="CLL_A0014"
FT   CDS_pept        14679..15182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0014"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0014"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24483"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="UniProtKB/TrEMBL:B2THC1"
FT                   /protein_id="ACD24483.1"
FT                   /translation="MLYRIKQFMLGILSYFKNDNIDFINKYLNKKEKDLFMKLSKPDRL
FT                   HSFKVCKEAILMGKDYDTVDEFKIAKCALLHDIGKIEISLNVIEKGVVVIINKVTKGNF
FT                   LKYNKYSRMTKYYNHPAIGKRLLESISFEDEEILYCIENHHKNLDIIEENLYLKILNIC
FT                   DNRN"
FT   gene            15223..15735
FT                   /locus_tag="CLL_A0015"
FT   CDS_pept        15223..15735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0015"
FT                   /product="transcriptional regulator, biotin repressor
FT                   family"
FT                   /note="identified by similarity to PDB:1J5Y_A; match to
FT                   protein family HMM PF02829; match to protein family HMM
FT                   PF08279"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0015"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23490"
FT                   /db_xref="GOA:B2THC2"
FT                   /db_xref="InterPro:IPR004173"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR026043"
FT                   /db_xref="InterPro:IPR035922"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2THC2"
FT                   /protein_id="ACD23490.1"
FT                   /translation="MNSIERRENILKSLIQSKIPLKGLEIAKKYGVTRQIIVRDIAILR
FT                   AKGNNIIATPDGYIINKELNKIKAIIAVNHKEEELIYEMSIVIKYGGTIEDVIVEHSLY
FT                   GEIRGLLMIKNYNELNKFAEKYKKQEGRLLSVLTNGVHIHTISADTQEDINSIINELKE
FT                   NGFIVSD"
FT   gene            15749..17140
FT                   /locus_tag="CLL_A0016"
FT   CDS_pept        15749..17140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0016"
FT                   /product="FAD-dependent oxidoreductase"
FT                   /note="identified by match to protein family HMM PF01266;
FT                   match to protein family HMM PF04324"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0016"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23402"
FT                   /db_xref="GOA:B2THC3"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:B2THC3"
FT                   /protein_id="ACD23402.1"
FT                   /translation="MDYDVLILGGGIVGCAVAYQLSKYNINIALIEKDYDVADDISFIN
FT                   TAVIYDGSETSNDMMAKLEGIGRKLIEEHCKKFNVSYEKTGALRITSNNNQNYKLDVMY
FT                   NRAKKRNIEGVHLIENDKELLHKIEPNLNIDVSKAFYSENVAVISPYDLAISYAEVAAD
FT                   NGVNFKLEEEVIDIQSLMSGFKVTTNKNKFTCKVVVNTIPDEISFNHIEEEYDYKNMNY
FT                   IMFENKSENKLKTILIDDIDDTTFVINNPKLQNGNLIGIKSNHILSLEEGIDMSASIFP
FT                   EAKKDFVSNMFAEVYNKDIMIIDDCKLNNGYIKITGTHYGKITIAPAIALKIKNTLKDN
FT                   LNIIRKKDYIDKRREVYRFNNLSSEERNEVISLDKRYGNIVCVCNNISEGEIIDSIRRP
FT                   LGARTVEGVKRRTGIGRGNCNGAYCDIKIIKILAREMDKNILEIVEDSKNSNIVSSRIK
FT                   EFKEI"
FT   gene            17159..17395
FT                   /locus_tag="CLL_A0017"
FT   CDS_pept        17159..17395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0017"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF07892"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0017"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24963"
FT                   /db_xref="InterPro:IPR012460"
FT                   /db_xref="InterPro:IPR036593"
FT                   /db_xref="UniProtKB/TrEMBL:B2THC4"
FT                   /protein_id="ACD24963.1"
FT                   /translation="MSSKDIFTSLVRVKGSPNHKVVSVKSNNPIEKELWREFSKVLSRI
FT                   YVSAPINIGDIICKNIMNTGIDIVCTKKIDNNI"
FT   misc_feature    17472..17685
FT                   /note="T-box leader"
FT   gene            17710..18987
FT                   /gene="serS"
FT                   /locus_tag="CLL_A0018"
FT   CDS_pept        17710..18987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serS"
FT                   /locus_tag="CLL_A0018"
FT                   /product="serine--tRNA ligase"
FT                   /EC_number="6.1.1.11"
FT                   /note="identified by match to protein family HMM PF00587;
FT                   match to protein family HMM PF02403; match to protein
FT                   family HMM TIGR00414"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0018"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24107"
FT                   /db_xref="GOA:B2THC5"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2THC5"
FT                   /protein_id="ACD24107.1"
FT                   /translation="MLDLKRIRNNPEEIKKLLSNRGEDFDVAVIDEIVTLDEERRKILV
FT                   EVESLKSKRNQVSAEIPKLKKAGEDVTEIMNDMRKLGEEIKNFDTRVNEINERIEYIML
FT                   RIPNIPNPEVPDGETDEDNVEIKKWGEPTKFNFEPKAHWDLGTDLNILDFERGGKVAGS
FT                   RFTVYKGLGARLERSIINYFLDKHTTENGYTEILPPYMVNRDSMTGTGQLPKFEEDAFK
FT                   VENNGYFLIPTAEVPVTNMYRNEVLSGDILPIKHAAYSACFRAEAGSAGRDTRGLVRQH
FT                   QFNKVELVKFCKPEDSYAELDKLVEDAESVLQGLGLPYRIVRICKGDLGFTAALKYDIE
FT                   VWMPSYNRYVEISSCSNFEDFQARRANIKYRETPKDKPKFIHTLNGSGVAIGRTVAAVL
FT                   ENYQKEDGTVEIPEAIKRFMNVDFIK"
FT   gene            19213..19305
FT                   /locus_tag="CLL_A0019"
FT   tRNA            19213..19305
FT                   /locus_tag="CLL_A0019"
FT                   /product="tRNA-Ser"
FT   gene            19339..19431
FT                   /locus_tag="CLL_A0020"
FT   tRNA            19339..19431
FT                   /locus_tag="CLL_A0020"
FT                   /product="tRNA-Ser"
FT   gene            19718..19810
FT                   /locus_tag="CLL_A0021"
FT   tRNA            19718..19810
FT                   /locus_tag="CLL_A0021"
FT                   /product="tRNA-Ser"
FT   gene            19844..19936
FT                   /locus_tag="CLL_A0022"
FT   tRNA            19844..19936
FT                   /locus_tag="CLL_A0022"
FT                   /product="tRNA-Ser"
FT   gene            20244..20762
FT                   /locus_tag="CLL_A0023"
FT   CDS_pept        20244..20762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0023"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0023"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23831"
FT                   /db_xref="GOA:B2THC6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B2THC6"
FT                   /protein_id="ACD23831.1"
FT                   /translation="MLKGEKVYLRLMQVSDIKRLYDLSNDYEVKKYNDKMLDIDEKIHI
FT                   DEDSSNVSIYERKAVSIINKKNVLVGFMTYKPNDYCNNVYSIGITIGKKYWNRGYGQDS
FT                   IKTLIKYLFDDLNAKKIQLEVAAENIRAIKCYKKCGFVEEKIRKAIYYIDGKYMDIIIM
FT                   GILKKEMAL"
FT   gene            20791..24249
FT                   /gene="addB"
FT                   /locus_tag="CLL_A0024"
FT   CDS_pept        20791..24249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="addB"
FT                   /locus_tag="CLL_A0024"
FT                   /product="ATP-dependent nuclease subunit B"
FT                   /note="identified by match to protein family HMM TIGR02773"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0024"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22230"
FT                   /db_xref="GOA:B2THC7"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR014140"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2THC7"
FT                   /protein_id="ACD22230.1"
FT                   /translation="MSIRFIYGRAGSGKSLFCINQIKKLIDSDKEKKIILLVPEQYTFT
FT                   TENKVLNHIGERAALNTHVLSFRTMCQKVFEECGGRVKQIIKDTGKHMLINKVLNEKID
FT                   DLSYFKKMSREQGFNNIISELITEFKKYNIDIDALRDLTDKIDDNELVEKIRELSLIYE
FT                   EFNVKMHSSYIDTDDELTLLAKKLLANNIYANSEIWIDEFTTFTPQQLEIIRIISKTSV
FT                   VNITLCMDKIENSDAEDITNVFSSIENTENRILKLMEENNIGYLNPINLNSKLPYRFKN
FT                   SEELAHIEKYCITYPFKSYKGKNKDVRLYKANNTYDEIEKVAQDIIRLVRDRNYRFRDI
FT                   SVVCRNIEDYNKIISVIFNDYEIPFFMDKKIKLLNNPLIILITSAFEVLLKNWSYESVF
FT                   KYLKSGLTGFNTYDIDRLENFVLEHGIKSYKWNEEEIKKLKNISIENGATEEELTIFNV
FT                   MEEVRNSLISFHKLIEGKHNVRDICKALYEFLLSIKAFERIDEWIIKFEELKLEDKVKE
FT                   YKQVESIVIDMLDQAVEVMGSDVVDTFEFFKILNSGFENEEIGVIPVALDQVNVGDIAR
FT                   IKGREVKALYIVGINDGILPAAHKDEGILSDRDRIELKEFGVVLAADGRSKAFEEQFVV
FT                   YTALTIASEYLMLSYPMADFEGKSLRPSIIISRIKKILPNLVEESSLYDLSKGNDHFNK
FT                   VISPIPTFNELIFALRRELEDEEIDEEYWGEVYNWFKENEDFKWKIENIFKGLRYSNTG
FT                   EKVSRNKLLSLYKNDLGKLSFSVSRLEKYAECPFSYFIQYGLKAKNRKVYEFTPPDLGS
FT                   FVHDILDSFTNKVKKEKIAWSDLDMIKCKNIVSELIDTKLKEDSGSILNSTNKYKYFSK
FT                   RFKRVISKSVSVISEQMRRGEFEVFNNEFSFGSYNDGEAIVLELPSNEKVYLNGRIDRI
FT                   DTLDLEGSTYLRIVDYKTGNKHFDLNEFYYGLQMQLLVYLDALLKNSEYILKKQALPGA
FT                   VLYFRVDDPIIKTKGDITTEELEKEVLSNLKMNGLILKDAKVVKAMDRGIETDGYSLVI
FT                   PAALKKDGDFKAGSEVVTEEQFNLLREYVNKKMIDLCEDMLCGDIKIQPTKDSDGSHCE
FT                   FCDFSSICQFDSSIEDNKYKIIMKKSKDEIWNNIRDELNDDKKEN"
FT   gene            24275..28006
FT                   /gene="addA"
FT                   /locus_tag="CLL_A0025"
FT   CDS_pept        24275..28006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="addA"
FT                   /locus_tag="CLL_A0025"
FT                   /product="ATP-dependent nuclease subunit A"
FT                   /EC_number="3.6.1.-"
FT                   /note="identified by similarity to SP:P23478; match to
FT                   protein family HMM PF00580; match to protein family HMM
FT                   TIGR02785"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0025"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24582"
FT                   /db_xref="GOA:B2THC8"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR014152"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2THC8"
FT                   /protein_id="ACD24582.1"
FT                   /translation="MSGTKWTEEQLSAITTRDCNLLVAAAAGSGKTAVLVERIIKIITN
FT                   EENPIDIDKLLVVTFTSAAAAEMRERIANAISKKLDETPTSKNLQKQLTLLNRSNIMTI
FT                   HSFCLGVIKNNFHKIDLDPSFRICDQTEGILLKMEIIDELFDDKYDEENQEFIKFIEAF
FT                   SSYKSDNALKELVLSLYNFTMAGPWPKKWLKDASRDFDIKTLQELDETKWVNVLKESIK
FT                   IELDGYIKMMQKAVKLINETDGLEPYFEGFSSELDLIVNAYNNVESSLNDLYNSLNLIT
FT                   FNRLKTIKKNTVSDENIQNLVKQIRDQVKKKISALIEGTFIASPDKMLDNIIKSYPYIN
FT                   QLTELTSEFIDRFTAKKKEKNILDFNDLEHLCLKILIEENEENQIVPSTIAQKFKDYFE
FT                   EVLVDEYQDSNNVQEAIIELVSRKNSDNPNVFMVGDVKQSIYKFRQAKPELFIDKYNSY
FT                   SLDKGINRKIQLYKNFRSREEIINGVNYIFKSVMSKTVGELEYTDVEALNLGANYPEKK
FT                   NDDDIIGGPIEVHILDRSDNKEENDEFKLQAEEEIGDVNLEARIIVKRINELISKKEGN
FT                   KFKVLDKDTGEYRDLKYKDIVILLRATKNWSEVLLDELGLAGIPVYADTGSGYFESIEI
FT                   RTIMSLLKVIDNPMQDVPMLSLLISPIIGLSAEELSDIRLIDKEKYFYENIIKISKEKL
FT                   ISVELQEKCEYILSSIDKWRRKSIYMPIDEFIWYLYMDTAYYGYVGAMPNGVLRQANLK
FT                   ILFQRARQFSDTSFKGLFNFINFINKLTKSSGDMGSAKILGENEDVIRIMSIHKSKGLE
FT                   FPVVFLAGCGKNFNLMDLNNKILYHEELGLGPEYINLENRTSITTLPKEAIKKRMKLET
FT                   LSEEMRVLYVAFTRAKEKLIITGAVRNAEKSIEKWINSAVLDKDVVLPYEISKGKSYLD
FT                   WIGMALCKHKDGEILRKKLGFSSEMCKDDLSMWKISIWNKYELDMYDELDENQEEEDVK
FT                   ISILDKDVNKEIKSEVYRRLGYEYEFKESTKLTSNISVSDLKKRNIEDDIDTLKMFDLE
FT                   EEDNKNKDIITPKFLQEEKGISAAERGTAIHFAMKKIDFSKVGTLKEIKEQLNKLYDEE
FT                   LILQEEYNSINPYKILSFFKSSLGKKMLYVYNEGGKVYREVPFYTEISSLEIDESLPQK
FT                   YANEKIRLQGIIDCFFKCDDEIILLDYKTDYVENEEEFKDKYKNQLSYYSEAIFKMTGK
FT                   KVDKKYLYSFYLEKEILI"
FT   gene            complement(28288..29439)
FT                   /locus_tag="CLL_A0026"
FT   CDS_pept        complement(28288..29439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0026"
FT                   /product="ErfK/YbiS/YcfS/YnhG family protein"
FT                   /note="identified by match to protein family HMM PF03734"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23775"
FT                   /db_xref="GOA:B2THC9"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:B2THC9"
FT                   /protein_id="ACD23775.1"
FT                   /translation="MKINKNIHINKFTVYILLFTLITLTTLFNGYQYKKLVNNFKIDFD
FT                   SNKFSQANNILLTQENFNPFKNLMLKRDLKKYFSNNITTLKQDLETSKLNEEEILIKAN
FT                   EINRYGFNSNEVIELVNSVSSLQDSINNYSNGIEHFNNNEYYEAITNFSNLSPLDLNYN
FT                   ESLIYLRESKSKIKDELFSKCDELCSNDYYSQALNQISNVPSVLNDDEDIKTKIAEIKS
FT                   SKQQYLDKTAESKTVSDYYINNISSQNINTLNLVSNTPYLIFIDINSQKTYIYKGKSNK
FT                   WDLDKTFSCSTGIDSEPTPCGAFSIKEKGEWFFSEKFKQGGKYWTQIDGDILFHSVPYA
FT                   QDKTTVVDTTLNKKSSHGCIRLALSDAKWIYDNIPRDTKIIIK"
FT   gene            29595..30404
FT                   /locus_tag="CLL_A0027"
FT   CDS_pept        29595..30404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0027"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0027"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23390"
FT                   /db_xref="GOA:B2THD0"
FT                   /db_xref="InterPro:IPR009574"
FT                   /db_xref="UniProtKB/TrEMBL:B2THD0"
FT                   /protein_id="ACD23390.1"
FT                   /translation="MNKTDNFFKKFINCIYNLKALITYPKYGIWKAILYVLLMSIILGG
FT                   IRGITIGYKIDRELSNLSTMLQEDKYKFNIVDGVLHTENSPLKIEETSSLIYIDENKSL
FT                   NEIDDLRDITVHNDNNILFLKDGVSLEAGMYKQQAHYKELIGDSKLDNSILFGELSYVL
FT                   KIIVAIVILYTILFTFINTLINCLFVTAFASFSLIIMKVFMKYSILYSLSLYACTLPFI
FT                   FQIILQSIFPNINLDTMFIVGTLVYVIFILKYIKDGMTKTKLNKDGM"
FT   gene            complement(30462..31631)
FT                   /locus_tag="CLL_A0028"
FT   CDS_pept        complement(30462..31631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0028"
FT                   /product="sodium:dicarboxylate symporter family protein"
FT                   /note="identified by match to protein family HMM PF00375"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0028"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24914"
FT                   /db_xref="GOA:B2THD1"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:B2THD1"
FT                   /protein_id="ACD24914.1"
FT                   /translation="MKNLSLIKRIFTFLILGIILGLTCRSLNIIFPIRILATFSALFGS
FT                   FLSFVIPLIIIAFIVPGIASLGKNSGKVLIGTTILAYISTIISGIAAYFIGISFLPKLI
FT                   KAATLVATETIKAEPYFTIDIPPMLNIMSALIFAFIFGIGLSKITNSSLLRGFQEFSSI
FT                   VSMIISKVLIPLVPLYIAAIFSKLSLSGEIFTTIKSFATIYLILFILQFAYLLCQYSIA
FT                   GGLKKENPFKLLKNMIPAYLTAVGTQSSAATIPVTLSCTKENNVSEEVADLVVPLCATI
FT                   HLAGDTITLVLTSIGVMLMRGETPTLITMMPFILMLGVTMVAAPGVPGGGVMAALGLLE
FT                   SMLGFGNIEKPIMIALHAAQDSFGTATNITGDGALSLIIDYFVNKNKSK"
FT   gene            31969..32865
FT                   /locus_tag="CLL_A0029"
FT   CDS_pept        31969..32865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0029"
FT                   /product="sensory box histidine kinase"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0029"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24341"
FT                   /db_xref="GOA:B2THD2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B2THD2"
FT                   /protein_id="ACD24341.1"
FT                   /translation="MSVAKKIINDFIDDDMELNKLELSKLTKEELIDKYIDVNNHKNLQ
FT                   ENLLLNVSHDLRSPLNVILSILQFYESGYITGSDNMSKYMTSIKRNSYRMLKLIDNLID
FT                   TTRLDKNYYKIERRNLDIVKLIENTISSIDKYAKQKNISLIFDTNVEKCIMAIDPEAID
FT                   RIIMNLLSNAIKFSYNNGNVYINLWKRNNQLNISVKDEGMGIPLKEQKKIFNRFMQSSN
FT                   HKKIEQSGSGIGLALVESLTKAHNGKVLLNSEEDRGSEFIIKLPIIKLSENNEDNHIIN
FT                   AKTNIEMLEIEFSDIYL"
FT   gene            32995..33071
FT                   /locus_tag="CLL_A0030"
FT   tRNA            32995..33071
FT                   /locus_tag="CLL_A0030"
FT                   /product="tRNA-Arg"
FT   gene            complement(33191..34345)
FT                   /locus_tag="CLL_A0031"
FT   CDS_pept        complement(33191..34345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0031"
FT                   /product="site-specific recombinase, phage integrase
FT                   family"
FT                   /note="identified by match to protein family HMM PF00589"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0031"
FT                   /db_xref="EnsemblGenomes-Tr:ACD21844"
FT                   /db_xref="GOA:B2THD3"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR028259"
FT                   /db_xref="UniProtKB/TrEMBL:B2THD3"
FT                   /protein_id="ACD21844.1"
FT                   /translation="MASYEQLTKYNWKATVSLGYENGKQVKTRKQGFKTKKDAEIWVTD
FT                   TLGKKHKGYIALTNSNILFKDYINKWFNEYKVLNVSINTKNDYIYRINAHVVPMIGNYK
FT                   LSELSTSIIQDFYNKLISEKGMKPVSAKKVYDIVNGCLKYAKKSKLIYDLPTDIEKQKL
FT                   VKPEIEFWTKKEIDFFLDKINDLYLYSPVFLDVLTGLRVGELCGLRWCDVNLESGYIEV
FT                   NSQVIQDRINKELIFSSILKTSTSHRNISIPPVLIDFLKAMKEDNNALENDFVILSREG
FT                   LMCNPRNLSMNFTKTVAKYKKSIDDIEKENKEVPKDYMQLKQISFHGLRHTHATLLIFN
FT                   GENIKVVSDRLGHRDISITLNTYTHIMDDMKSNTATLLNNLFKK"
FT   gene            complement(34346..34930)
FT                   /locus_tag="CLL_A0032"
FT   CDS_pept        complement(34346..34930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0032"
FT                   /product="adenine-specific DNA methyltransferase"
FT                   /note="identified by match to protein family HMM PF01381"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0032"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23218"
FT                   /db_xref="GOA:B2THD4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B2THD4"
FT                   /protein_id="ACD23218.1"
FT                   /translation="MVGEKVAKFRKILGISQRELGRRTGLSGQMISKIENNLTNPSLET
FT                   LGKIASVLNVNLNNLLDMVKTPDCLIVNDTSLDINYLLDNIRELIMTNKDNNKLIYESF
FT                   DSLVTCFMVLFLPFAENPKEHKNQNVTLLNELMFEINQLIESDGLISPYNYPDDYLENS
FT                   GKTIHKIYTILEKIRLLKFSSRKYRNNMEGE"
FT   gene            35125..35451
FT                   /locus_tag="CLL_A0033"
FT   CDS_pept        35125..35451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0033"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0033"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23508"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:B2THD5"
FT                   /protein_id="ACD23508.1"
FT                   /translation="MPNKKIKEEIAMSKRELLKLFQVSQEVGLPLSTIQKHVREGKLKA
FT                   KKNGREYLVTRIDLNSYLGIESNEDALKKDLEIANLKNKVKTYEYQLKNIKNMINNLDN
FT                   IIEM"
FT   gene            35747..37507
FT                   /locus_tag="CLL_A0034"
FT   CDS_pept        35747..37507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0034"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0034"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24644"
FT                   /db_xref="InterPro:IPR014015"
FT                   /db_xref="UniProtKB/TrEMBL:B2THD6"
FT                   /protein_id="ACD24644.1"
FT                   /translation="MKKIKFELQETELCFIALSYMFSNIKVREEYRNLLLDNKIEFPTN
FT                   ELDIISSIIINYSDSEKMIENFNVAKELFEINKYSEITQYSLDSKSEMFFKKFRDRIIE
FT                   NTDKIESIPLISYEDNKKAFMSYIGGNFKALINSFNESKFVKWNGKAWIMLTEEEGKIE
FT                   YNNFIKQCNFELEKNINNLEKDDFYKLSKKINSWDNKNRVSEALDKLRRDNAYIINLKY
FT                   HNKNENILCSKNGLIIDLNKGEIKKSCRNDLILNTSKYNLMDKKDSIKFVKDKLKLYKK
FT                   VLGNERLEFILDLISYKMLGKNLQLAIFMIGAGATGKSTFKNIVKDLFEENAVNIPYTY
FT                   FTTKHKGNDDVSRDDLLVSLDNKSFGLSSEGDTTDIINQAKFKNILSNSSEKARATRGK
FT                   LIDVDLQKLDLLIDTNDIPQFTNYDDAVNRRLLFIKFINKIPIESRNTNFYKEEIKENF
FT                   DYLFSYFIYRAMNLINKTLIVPNIIKDDTMQNIKELDSLLKFSNEVIAPIEDFFVSCEE
FT                   VEKAYIKMCEEENLVNIIPGDLIGTAKGYSYLLNKLREKPGYENIERIRKSDGSKNRKC
FT                   YVINGLTFQK"
FT   gene            37765..38001
FT                   /locus_tag="CLL_A0035"
FT   CDS_pept        37765..38001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0035"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0035"
FT                   /db_xref="EnsemblGenomes-Tr:ACD21867"
FT                   /db_xref="UniProtKB/TrEMBL:B2THD7"
FT                   /protein_id="ACD21867.1"
FT                   /translation="MLINLEDVKKQRDIKNGLDDEHIKIFRMISDLLVKIEDKNHREKI
FT                   ISNIYDSTKFFERRLYSKKEVQKGRECKIISIN"
FT   gene            38124..38354
FT                   /locus_tag="CLL_A0036"
FT   CDS_pept        38124..38354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0036"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0036"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22236"
FT                   /db_xref="InterPro:IPR035255"
FT                   /db_xref="UniProtKB/TrEMBL:B2THD8"
FT                   /protein_id="ACD22236.1"
FT                   /translation="MSKRTGILGYNYNNERYSILNAMDLWEDSGLHCGEVLEVFIDGKW
FT                   IADRIEIGKGEWYLIYSKLHGEQLEGLRIRF"
FT   gene            38370..38522
FT                   /locus_tag="CLL_A0037"
FT   CDS_pept        38370..38522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0037"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0037"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23003"
FT                   /db_xref="UniProtKB/TrEMBL:B2THD9"
FT                   /protein_id="ACD23003.1"
FT                   /translation="MIKIRMIYKSKEDKKKMIQILMKAGAIIKKESKPYKLKGSKEERV
FT                   YLDIE"
FT   gene            38712..39938
FT                   /locus_tag="CLL_A0038"
FT   CDS_pept        38712..39938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0038"
FT                   /product="phage portal protein"
FT                   /note="identified by match to protein family HMM PF04860"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0038"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23518"
FT                   /db_xref="InterPro:IPR006944"
FT                   /db_xref="UniProtKB/TrEMBL:B2THE0"
FT                   /protein_id="ACD23518.1"
FT                   /translation="MNFISRLLKKNKSPTITEHVEVMNGSPAIFTPFSGNAYESDIYRA
FT                   AVDAIARNAAKLKIIHVVTIAGQRKDGDNSLNRILQVRPNPYMTAYDLIYKLVTHYYLY
FT                   NNAFAYLQKDDKGNLTGIYPLSPLNMEYLTDSTGTLYCRFLFMGGKQFTVPFTEVFTMR
FT                   RFFNSNDLLGDTNTAILPALDLAHTQSEGMENSIKASGNIRGILKYNQALSPENLKKEK
FT                   EAFISDYLSISNNGGIAALDSKMDYVPLDVKLAVIDEKQLEAVKKKIYEYLGISENIVN
FT                   STYSENEWAAFYESVIEPLGLQFSLELTEKVLTPREQAFGNSILLEANRLQFASNTTKT
FT                   NILKELMPLGLFTVNQAMEILNLPSVEGGDRRVQTLNVVSTDIIDKYQMSKARVKDDEG
FT                   NKKLTDSEQ"
FT   gene            39901..40458
FT                   /locus_tag="CLL_A0039"
FT   CDS_pept        39901..40458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0039"
FT                   /product="phage prohead protease, HK97 family"
FT                   /note="identified by match to protein family HMM PF04586;
FT                   match to protein family HMM TIGR01543"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0039"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22249"
FT                   /db_xref="GOA:B2THE1"
FT                   /db_xref="InterPro:IPR006433"
FT                   /db_xref="UniProtKB/TrEMBL:B2THE1"
FT                   /protein_id="ACD22249.1"
FT                   /translation="MKEIRNSQIQSNSDLELIGTPIVYDEPTIINDPLGNYTEIIKRGA
FT                   LDTADLSDIRLLYNHDTSKIPLARVPKTMGFNVDDKGLHMRATLPNTEEAKAVHTAVCR
FT                   GDLTGMSFAFKVPKDGSFYDSKTNTRTITKIEKVYECSVVPYPAYQNTSIEARNQITEV
FT                   QKLESQKDQAKIKINQILKGSI"
FT   gene            40460..41686
FT                   /locus_tag="CLL_A0040"
FT   CDS_pept        40460..41686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0040"
FT                   /product="phage major capsid protein, HK97 family"
FT                   /note="identified by match to protein family HMM PF05065;
FT                   match to protein family HMM TIGR01554"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0040"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23048"
FT                   /db_xref="InterPro:IPR024455"
FT                   /db_xref="UniProtKB/TrEMBL:B2THE2"
FT                   /protein_id="ACD23048.1"
FT                   /translation="MKFKTISEAFNYYRNHNTGDIEKRAAEIGNLINTDPNVDMESLNI
FT                   ELEGLKQAKTNIEERSQQQEQFNPVAGMNFNNNSTEVPKGDIFASNEYRSAFFKNMLGQ
FT                   RLTDMEQRTFKRAMEIVDTEKRADAFSTTTSAAAVLPTQTLNEVISKARTMGGLISSCR
FT                   NFNIPTNLSVPIGTPSTKAAWHVEGAAVETKEPAISSVSFAAYEIIKVMSLSAAAKKMS
FT                   IQAFESYVTEELTNCVMETIADSLVNGTGSAQGTGILTGITWNISNSFTFAKAGVPVYT
FT                   DFTKMVAMLKRGYGAGAKFAMNNSTLYNLVYSLVDLNGRPIFIADPKNEEIGYILGKPV
FT                   VIDDNIADDVVLLGNFNYMGYNIPQGIIIETSRDSSFKSGLIDYRALAIADTKPLVDET
FT                   FVKLSRASS"
FT   gene            41862..42122
FT                   /locus_tag="CLL_A0041"
FT   CDS_pept        41862..42122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0041"
FT                   /product="putative DNA packaging protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0041"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24262"
FT                   /db_xref="InterPro:IPR021146"
FT                   /db_xref="UniProtKB/TrEMBL:B2THE3"
FT                   /protein_id="ACD24262.1"
FT                   /translation="MIITLEEAKNLLRVDFEEDNGLIQTLINTIPQYLENKTGRPWDTD
FT                   VINPLVKTLAGFLLKSWYDGSTPQLEKTIENIIATLTPMAR"
FT   gene            42127..42669
FT                   /locus_tag="CLL_A0042"
FT   CDS_pept        42127..42669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0042"
FT                   /product="site-specific recombinase, phage integrase
FT                   family"
FT                   /note="identified by match to protein family HMM PF00589"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0042"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25073"
FT                   /db_xref="GOA:B2THE4"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:B2THE4"
FT                   /protein_id="ACD25073.1"
FT                   /translation="MVKPIKNKEVVRNIIEALKKENERNAIMFALGVYCGLRISDILNL
FT                   RVKNVKKKWNIRIKQQKTGKYIEIVLNRELKKMIDDYTENMDDDYYLIKSRKGQNKAIS
FT                   ETQAYRIMQEIACEFKLKNIGCHSTRKTFAYWLYMDNKKDIGLVQKALGHGSSATSLTY
FT                   IDMDKEALNKAIKKIKY"
FT   gene            42839..43150
FT                   /locus_tag="CLL_A0043"
FT   CDS_pept        42839..43150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0043"
FT                   /product="prophage LambdaBa04, Gp54"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0043"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24498"
FT                   /db_xref="GOA:B2THE5"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:B2THE5"
FT                   /protein_id="ACD24498.1"
FT                   /translation="MAKEGIKFFYDTKEWKKCRKAFIETKHYICERCGGVGKLVHHKKH
FT                   ITPSNVNDMNITLNWDNLQVLCLDCHNVVHGNGGATVKGVSFNQNGDLIYSPPHHKEI"
FT   gene            43250..43594
FT                   /locus_tag="CLL_A0044"
FT   CDS_pept        43250..43594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0044"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22059"
FT                   /db_xref="UniProtKB/TrEMBL:B2THE6"
FT                   /protein_id="ACD22059.1"
FT                   /translation="MFEKNKDISTEMKQLKRILKSIPKDRQPIAQNIYNELLFIQRTLD
FT                   KLKKDVDEEGTTTLFKQGQQEFLRENPALKGYNTTIKNYSSLYRQLIDLLPPLEPVQEV
FT                   DPLLDFIKAQ"
FT   gene            43594..45234
FT                   /locus_tag="CLL_A0045"
FT   CDS_pept        43594..45234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0045"
FT                   /product="putative phage terminase, large subunit"
FT                   /note="identified by match to protein family HMM PF03354"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0045"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22776"
FT                   /db_xref="InterPro:IPR005021"
FT                   /db_xref="UniProtKB/TrEMBL:B2THE7"
FT                   /protein_id="ACD22776.1"
FT                   /translation="MNYIIEYFEAIKSGECIVSKRVYKQYERLVSDIDNSDKYIFDESR
FT                   ALKPIKFIEQFCKHSKGEWAGKPVILELFQKAYISALFGFINKDTGLRRYKESMFYVAR
FT                   KNGKSTMLSGIAAYMLVADGEAGAEIYSCATKKDQAKLVFDETLNMIKQSPYLTKHIKK
FT                   RKTDLYFPLTMSKFQPLGKNSDTLDGLNAQCVIIDELHGVKDRNLYEVMKQSQSARRQP
FT                   LLLMITTAGTIRECIFDDMYEYACNIVDGNFEDDTFLPILYELDKKEEWLDPRAWSKAN
FT                   PALGTIKKIDDLERKVEKAKNSPKDLSGVLTKDFNIRDTISSAWLTFDDINNDETFDIA
FT                   DFKNCYAIGGADLSITTDLTAATLLLIDKVTHKRYIHQMYWLPSDNFEQRVKLEKIPYD
FT                   IWLKRDLIRLCNGNSINYSDITAWFLEMLNNYGITPLWIYYDSYSAKYWVDEMEQNGFK
FT                   MVRCIQGARTLSLPMQQLGADLQAKKINYNNSPILKWCLTNTGVQEDRNGNIVPIKNQA
FT                   AKQRIDGMASMLDSYVGLYEHYEEFIRAL"
FT   gene            45277..45594
FT                   /locus_tag="CLL_A0046"
FT   CDS_pept        45277..45594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0046"
FT                   /product="putative phage head-tail adaptor"
FT                   /note="identified by match to protein family HMM TIGR01563"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0046"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23984"
FT                   /db_xref="InterPro:IPR008767"
FT                   /db_xref="InterPro:IPR038666"
FT                   /db_xref="UniProtKB/TrEMBL:B2THE8"
FT                   /protein_id="ACD23984.1"
FT                   /translation="MRKDKKITILEYVNGVDEDNLPLEEYVPVKGAENIWAYYRHLSGK
FT                   EFYAAATTNSKVDVIFQINWRQGIDTTMKVLYNNKEYYITQIDDFEGKKTDLKIYAYKI
FT                   N"
FT   gene            45612..46313
FT                   /locus_tag="CLL_A0047"
FT   CDS_pept        45612..46313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0047"
FT                   /product="RNA polymerase sigma-F factor"
FT                   /note="identified by match to protein family HMM PF04542;
FT                   match to protein family HMM PF04545; match to protein
FT                   family HMM TIGR02937"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0047"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24853"
FT                   /db_xref="GOA:B2THE9"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B2THE9"
FT                   /protein_id="ACD24853.1"
FT                   /translation="MSNEELVELYQEGDKQALNKLIENNKKLVFKIVNKFYINATNSID
FT                   IEDLEQEGYMGLIMAAKKYNSNMDYHASFSTYSFYWIYQKINSFIKQKNTNDETSLNIP
FT                   LNEGEEKEKVDLIEYIDNGYENIEEKLYLEQLRSDLENLMEHNTTLRERSILKLHYGWD
FT                   CRECTMTYIAGMLEISQQRVRQIEKSTLRKLRRTKWIKCEYEKYYGSIKKNYINIEKKI
FT                   DFTNKYFKGVI"
FT   gene            46314..46652
FT                   /locus_tag="CLL_A0048"
FT   CDS_pept        46314..46652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0048"
FT                   /product="sigma-70, region 4 family"
FT                   /note="identified by match to protein family HMM PF04545;
FT                   match to protein family HMM PF08281"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0048"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22504"
FT                   /db_xref="GOA:B2THF0"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B2THF0"
FT                   /protein_id="ACD22504.1"
FT                   /translation="MEKDKIIESTKKLLENISVMKKRLENEVCEIMEEEKKRISSVLKV
FT                   LDSLNEEEQCLVAYKYFENKTHSEIAERLHVGINTVTRKLKKLYLTIGRLLYGFEDEFL
FT                   KELIEPIG"
FT   gene            47083..48222
FT                   /locus_tag="CLL_A0049"
FT   CDS_pept        47083..48222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0049"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0049"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22578"
FT                   /db_xref="GOA:B2THF1"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="InterPro:IPR015093"
FT                   /db_xref="UniProtKB/TrEMBL:B2THF1"
FT                   /protein_id="ACD22578.1"
FT                   /translation="MKEDILINLLDEHNEGNLLATDKFRPYKVIYLKNKENSEVYEKLM
FT                   KYHKEIFPSIHIESYVISEGGINEINNLLNKLDIEKTIINVTGGKRINSLILLNQALMK
FT                   KFNTVYVDILNKRIYELGNDIKNKSEEFKDIYLDDILKITGADILLDSSKISRYSDVTN
FT                   ITKKIYENLELWYKYKQRLYDNHLFIHDYSQGNKVIVNESDLYGDDERRILNSCLSYLE
FT                   KIDAIKYKRNKNNIEVYFQKDYLKGFIFKSGTWLEVLTNIVVREIEEIDDVKSGVMFVW
FT                   NNNQSKVKNEFDVLAVKDDVLICISCKDSAKYDENALNELDVYSKRLGGKNAKKILVAT
FT                   QEPCKKCIKERAEMMGISLIILDKDMEKFKNELKKVINK"
FT   gene            complement(48363..49253)
FT                   /gene="psd"
FT                   /locus_tag="CLL_A0050"
FT   CDS_pept        complement(48363..49253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psd"
FT                   /locus_tag="CLL_A0050"
FT                   /product="phosphatidylserine decarboxylase"
FT                   /EC_number="4.1.1.65"
FT                   /note="identified by match to protein family HMM PF02666;
FT                   match to protein family HMM TIGR00163"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0050"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22074"
FT                   /db_xref="GOA:B2THF2"
FT                   /db_xref="InterPro:IPR003817"
FT                   /db_xref="InterPro:IPR033177"
FT                   /db_xref="InterPro:IPR033179"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2THF2"
FT                   /protein_id="ACD22074.1"
FT                   /translation="MIKVYNRITNEYEEENVAGKKFIKWTYETPVGKSITELIAKRKIF
FT                   SKFYGKFCDTKCSAKKIPDFVRDFNIDMNIAEKNISEFNSFNDFFVRNLTSTSRPIDYN
FT                   EDIFISPGDGRITVYDNIDLDNIVQVKGLTYSLRELIKNDEISERYKDGICIILRLCPT
FT                   DYHRFHFVDSGIPCETHKIKGHYYSVNPIALNSIPKLFCENKREWCIFKSENFGDVLTV
FT                   EVGATCVGSIIQTYEPNKKAKKGDEKGYFKFGGSTTILFLEKDKVKIDDDILEQSKQGY
FT                   ECKVLLGETIGTKVL"
FT   gene            49414..49989
FT                   /locus_tag="CLL_A0051"
FT   CDS_pept        49414..49989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0051"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="identified by match to protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0051"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23383"
FT                   /db_xref="GOA:B2THF3"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:B2THF3"
FT                   /protein_id="ACD23383.1"
FT                   /translation="MNKTKKLIFNSSIEVFSKSGYRGATMDEIATTAGLAKGTLYYNFN
FT                   SKEEIFNFIVDNGLKLLNDEIAAVNELNDDAIEKLKQICKIQLTFLYEHNSFFRVVMSQ
FT                   LWGNEERQFILREKVKGHIKEIEKYIQMGIEDGCIRKGDSEVMAYEFFGTLCSSAIYEL
FT                   INIENVSLEDTINKTLEFIFNGLINKEA"
FT   gene            50301..52031
FT                   /locus_tag="CLL_A0052"
FT   CDS_pept        50301..52031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0052"
FT                   /product="hydrogenase-1"
FT                   /note="identified by match to protein family HMM PF00037;
FT                   match to protein family HMM PF00111; match to protein
FT                   family HMM PF02256; match to protein family HMM PF02906;
FT                   match to protein family HMM TIGR02512"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0052"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22263"
FT                   /db_xref="GOA:B2THF4"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR003149"
FT                   /db_xref="InterPro:IPR004108"
FT                   /db_xref="InterPro:IPR009016"
FT                   /db_xref="InterPro:IPR013352"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019574"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036991"
FT                   /db_xref="UniProtKB/TrEMBL:B2THF4"
FT                   /protein_id="ACD22263.1"
FT                   /translation="MAYILINEKEVSVKEEGRTILEVALENNIEIPTLCYLNDCSNTGK
FT                   CGVCAIEIEGQEELALSCETLVQDKMVIRTDSEKVQEAIKLRVAEMLDKHEFKCGPCKR
FT                   REDCEFLKLVIKTKARANKPFIVKDKSQYVDDRSKSIVIDRSKCVLCGRCEAACSEKTA
FT                   TNSIKIIDDNGDKKVATIEGKCFDDTNCLLCGQCIAACPVDALSEKSHTERVQNALEDP
FT                   SKHVIVAMAPSVRAAMGEAFKMGYGVDVTGKIYTALRMLGFNKIFDINFGADMTIMEEA
FT                   TELISRVNKGGPFPMFTSCCPSWVREVENYFPEFIDNLSSAKSPQQIFGAASKTYYPEI
FT                   EGLDPKDVFTVTIMPCTSKKFEADREEMENNGLRNIDAVITTRELAKMIKTAKINFATL
FT                   EDSEADPSMGEYTGAGAIFGATGGVMEAALRSAKDFIENKSLEEIEYEQVRGLDGIKEA
FT                   TVTLGGQEYNIAVINGAANVFDFVKSGRMEEKQYHFIEVMSCPGGCVNGGGQPHVNSKD
FT                   RSKIDIRTVRASVLYNQDKGLVKRKSHENVSLLKMYETYMGKPGKGLAHELLHIKYNKK
FT                   "
FT   gene            52291..53079
FT                   /locus_tag="CLL_A0053"
FT   CDS_pept        52291..53079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0053"
FT                   /product="HAD-superfamily hydrolase"
FT                   /note="identified by match to protein family HMM PF05116;
FT                   match to protein family HMM PF08282; match to protein
FT                   family HMM TIGR01484"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0053"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23047"
FT                   /db_xref="GOA:B2THF5"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B2THF5"
FT                   /protein_id="ACD23047.1"
FT                   /translation="MKLLASDLDGTLVVGNELKNYKDLTSINKLKEHGHKLIVSTGRSY
FT                   DLVIPLMEKYDIEYDYLLLCNGSLIMNRAHEMVFDEWVSNEISNKIINDYYNDETLVYV
FT                   DNYKNSIFIDNPNFDKSQIGDMMDLFTKKINIQEAVSSKDDYKIISLSPVDKDQIKAEK
FT                   IKDEIIKKYGEHVEAYRNQFFVDVVPKGCSKGNALKRILEVEDISKDNLYVVGDSFNDV
FT                   SMFNTTHNSYTFNDSEEKVKEYANHEVDYVYEVIEELLYK"
FT   gene            complement(53133..54728)
FT                   /locus_tag="CLL_A0054"
FT   CDS_pept        complement(53133..54728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0054"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0054"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22268"
FT                   /db_xref="GOA:B2THF6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:B2THF6"
FT                   /protein_id="ACD22268.1"
FT                   /translation="MITVSNVSLRFGGRKLFEDVNLKFTAGNCYGVIGANGAGKSTFLK
FT                   ILSGEVEPNTGDVIIAPNTRMSVLTQDHYKYDDCQVLETVIMGNERLYQIMKEKDELYA
FT                   KPDFSDEDGIKASELEGEFAELNGWEAESEASSLLQGLGIGTDYHFKNVSELTGGEKVK
FT                   VLLAQALFGNPGILILDEPTNGLDLKAVNWLEDFLGNFDGTVIVVSHDRHFLNSVCTQM
FT                   ADVDFGKIKIYVGNYDFWYESSQLALQMSKDQNKKKEEKIKELQDFVARFSANASKSKQ
FT                   ATSRKKLLDKITLDDIQPSSRKYPFVGFTPEREVGNDILTVKDLSKTVDGVKLLDNINF
FT                   MVNKGDKIALIGNEIAVTALFKILAGEMEPDSGEYKWGITITNSYFPTDNSQYFDGCNL
FT                   SLVDWLRQYSEEKSESYIRGFLGRMLFSGEEALKEANVLSGGEKVRCMLSRMMLSNGNV
FT                   LMLDQPTNHLDLESITAVNNGLKNYNSNIIFASHDHQFVQTIANRIIDIKDDGSIVDRT
FT                   MTFDEYLEFAATSK"
FT   gene            55218..56531
FT                   /locus_tag="CLL_A0055"
FT   CDS_pept        55218..56531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0055"
FT                   /product="sodium:neurotransmitter symporter family protein"
FT                   /note="identified by match to protein family HMM PF00209"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0055"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24545"
FT                   /db_xref="GOA:B2THF7"
FT                   /db_xref="InterPro:IPR000175"
FT                   /db_xref="InterPro:IPR037272"
FT                   /db_xref="UniProtKB/TrEMBL:B2THF7"
FT                   /protein_id="ACD24545.1"
FT                   /translation="MAKRENFKSRTGFILSCIGAAVGLGNIWMFPYRLGQNGGAAFLIP
FT                   YFIFVLLLGSTGLITEFAFGRKFKGGSATGIITTFAEKNKKGGKLVALIPVIGLAGVFM
FT                   FYNIVVGWIMKYFSMSITGELFSVDVHSFFEGFSGTSQTIVWNFIAIALTLVIVYAGVT
FT                   KGIEKINTIIMPALFVIFILLAIRSLTLPGAMEGVKYLLNPKWEFLLKPNTWIMALGQA
FT                   FFTVSLNGCGMVVYGSYMKDDFDIPRSALSTAILDTIAALLASFVIMPSVFAFNLDPMA
FT                   GPPLLFITMPTIFKAMPGGRLIAIVFFLSLIFAAVSSSINMLEGPVEALISQTKLNRKK
FT                   ASIIIAIIGFILSIPLNLSMASFDNFTNFITIIVSPLAALIVFLVFYYVGDSKKALLEI
FT                   NKGSSRELGINFIYLAKYVFVIITVVVIILGAIYGGIG"
FT   gene            complement(56664..57311)
FT                   /locus_tag="CLL_A0056"
FT   CDS_pept        complement(56664..57311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0056"
FT                   /product="channel protein, hemolysin III family"
FT                   /note="identified by match to protein family HMM PF03006;
FT                   match to protein family HMM TIGR01065"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23833"
FT                   /db_xref="GOA:B2THF8"
FT                   /db_xref="InterPro:IPR004254"
FT                   /db_xref="InterPro:IPR005744"
FT                   /db_xref="UniProtKB/TrEMBL:B2THF8"
FT                   /protein_id="ACD23833.1"
FT                   /translation="MNKYLREPVNGLTHLIGAILSLVGLVLMIIKVNISQGSLIEYVSI
FT                   ILFGISMILLYSASATYHSVIADSKIIKHLKKVDHSMIFVLIAGSYAPFCLIALQNSIG
FT                   NKLFIAVATSALVGIIFKICWVTCPKWLSSVIYITIGWFAIFAIYPLSIALSPIGVSLL
FT                   VLGGLMYTIGGVIYALKKDKIKIGVFGSHEIFHVFIMLGTLFHFICVFNYII"
FT   gene            57530..58111
FT                   /locus_tag="CLL_A0057"
FT   CDS_pept        57530..58111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0057"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF08876"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0057"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22599"
FT                   /db_xref="InterPro:IPR014975"
FT                   /db_xref="UniProtKB/TrEMBL:B2THF9"
FT                   /protein_id="ACD22599.1"
FT                   /translation="MTKDILNIMENLNLDKKINLEDIPEIDLYMDQVIQLFENKLSVLK
FT                   RKEEDKVLTKTMINNYAKAKLLMSIKNKKYSKEHLILMSLIYDLKGALSINDIKLTLDN
FT                   IVKKYENNEEYDLRALYKTYLDMNSQDVNEFKEYMNDKEENVKNLLSENNINGDFEEKF
FT                   LLVGSMISMSNMYRRMGETLIDEYFMGDEK"
FT   gene            58112..59812
FT                   /locus_tag="CLL_A0058"
FT   CDS_pept        58112..59812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0058"
FT                   /product="isopentenyl-diphosphate delta-isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0058"
FT                   /db_xref="EnsemblGenomes-Tr:ACD21852"
FT                   /db_xref="GOA:B2THG0"
FT                   /db_xref="InterPro:IPR019195"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2THG0"
FT                   /protein_id="ACD21852.1"
FT                   /translation="MKNFNDLRRDLINIDGKGYKSYKQLEGNYEFNDYILSIDHVQGDP
FT                   FATPSRVRIIMDKKVSNIPEDLVNNNYKKIAVQDYLTRTFYKNIYSYSSKIFGSGKSGL
FT                   ISISKCTQEILDRTSIVISDKKMEARIEVGFPARGRSVLAKELEKILFDFLPKIVESSL
FT                   IYKNIDKNKLMNQVKLVEDQQFIRNELRNNDLIGFIANGSILPRESGVSTKPLKDGIPF
FT                   KSPENLEVKFNLPNNGEIVGMGIKKGITIIVGGGYHGKSTLLNALELGIYNHIEGDGRE
FT                   FVITDNTALKVRAEDGRVINKDDISLFINNLPNKKDTTKFYSENASGSTSQAANIIEGI
FT                   ESGTKVFLIDEDTSATNFMIRDDIMQMLVSKDKEPITPFIEVARDLYNQKEISTIIVVG
FT                   SSGDYFDIADNVIQMDCYNIKNVTEQAKNLSNGKILSKIKERNLHIKINLNRVIKKGSI
FT                   EKGYKGVKIKTLGIDGLIINKENIDLRAVEQIVDNEQINTIGEIMKWAEDNVIDGKKTL
FT                   IEVTDEIMNYIEKNGIISISNIKGGHGRLSMPRRQEIMATFNRFRSLKI"
FT   gene            59901..60419
FT                   /locus_tag="CLL_A0059"
FT   CDS_pept        59901..60419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0059"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0059"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24431"
FT                   /db_xref="InterPro:IPR032256"
FT                   /db_xref="UniProtKB/TrEMBL:B2THG1"
FT                   /protein_id="ACD24431.1"
FT                   /translation="MRGLKNNILILLIFTISILVVGCSEQKVNDTKSENECVVEENFIE
FT                   SIKLPETMKSPEDVIRDSFKYKNSHQLKNLLICYTTRYKDINFRLDNLESCKLDSLELI
FT                   TDSRIYKSYFTSGVEIKRENVRKYTVKYNVQYKDQSKEPIDSGDYETIYTLIRENNLGE
FT                   WKIDGIGES"
FT   gene            complement(60692..62047)
FT                   /locus_tag="CLL_A0060"
FT   CDS_pept        complement(60692..62047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0060"
FT                   /product="membrane protein"
FT                   /note="identified by match to protein family HMM PF07670"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0060"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23428"
FT                   /db_xref="GOA:B2THG2"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="UniProtKB/TrEMBL:B2THG2"
FT                   /protein_id="ACD23428.1"
FT                   /translation="MNKNTEVNINLNMSSLLKFIVPSLIGILLFMTPIMINGQFTIPIA
FT                   FLSNLVVDTLESVLPLIALILISISAIGSILIKIFKTENKVLNSLFNISYSWLSARIIG
FT                   MIIVIMTYFKVGPEFIWSDSTGGMILFSLLPLLTAVFLFAGLFLPLLLNHGLLEFVGAL
FT                   FTKVMRPLFKLPGRSSIDCITSWLGDGTIGILLTSKQYEEGFYTKKEASVIGTSFSAVS
FT                   ITFSLMVITQVGLSHMFVPFYLTVTFAGIVAAIVLPRVRPLSKKPDTYIDGRELEKNVD
FT                   LIPNGYTPFTWGLKNAIDKAEDNFSFHSFVEDGLKNVIDMWMGVLPVVMSMGGIALMIA
FT                   EYTHIFTMLGLPFIPLLKLLQVPEAVAASKTLVVGFADMFIPSVLATSIQNEMTRFIIA
FT                   CTSVTQLIYMSEVGGLLLGSKIPVSFKELVIIFLERTIITLPIIVLIANLLF"
FT   gene            62297..63991
FT                   /locus_tag="CLL_A0061"
FT   CDS_pept        62297..63991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0061"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="identified by match to protein family HMM PF00015;
FT                   match to protein family HMM PF00672"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0061"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22435"
FT                   /db_xref="GOA:B2THG3"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="UniProtKB/TrEMBL:B2THG3"
FT                   /protein_id="ACD22435.1"
FT                   /translation="MYKRIKKKFKNFSIRRKVRTSFSIILVFTLVFMIMSLMSLQFVSN
FT                   KITKLYNEPFKAVDITWNMKTEFLKMQRDMYQALIEQKEDKIKTNISSVEDQLKLLEED
FT                   IISLRKIYTDDNNLINKFENNMDEVKDEREEIYSLLLNNKDLEAYTLITGKYDEGIQNA
FT                   RENLIEIGETTNNNALTFVQEAEKTRNLIFILAAIILILMIGSIIMISRIIQSSLLEGI
FT                   NHVKKVSEDLSEGNLNIDNSYVSDDEMGEMSRDLNETIENLSGYINDISRVIENIANEN
FT                   LNVETLIEYKGNFKPIKDSLDNIIGSFNSIFKNIHQASDLVASSSEEIASTTQSLSDGA
FT                   VEQSNAVEDLFFKFNEVLIKINKNTESTKKADEVFENTRRMVLDGNKKMEELMISMNRI
FT                   DEMSNEIEAIISTIEDIASQTNLLALNAAIEAARAGDAGKGFAVVAEEVKLLAEQSSKE
FT                   VKHTNQIIQNSMKFIKNSNVLAKETLDALEDIVKNVDHTSELVKQIANSSEYESEALGD
FT                   MSVKVDKISEVIQMNSATAEETAAATQELASQAELLEQEISKFRLKN"
FT   gene            64352..65161
FT                   /gene="proB"
FT                   /locus_tag="CLL_A0062"
FT   CDS_pept        64352..65161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proB"
FT                   /locus_tag="CLL_A0062"
FT                   /product="glutamate 5-kinase"
FT                   /EC_number="2.7.2.11"
FT                   /note="identified by match to protein family HMM PF00696;
FT                   match to protein family HMM TIGR01027"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0062"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24954"
FT                   /db_xref="GOA:B2THG4"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR005715"
FT                   /db_xref="InterPro:IPR011529"
FT                   /db_xref="InterPro:IPR019797"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041739"
FT                   /db_xref="UniProtKB/TrEMBL:B2THG4"
FT                   /protein_id="ACD24954.1"
FT                   /translation="MGFRKNLINANRIVVKVGTSTLTYDNGNINLRRIERLTRVLSDIV
FT                   NSGKEVVLVTSGAIGVGVSKLKLKEKPQNIREKQAVASVGQCELMHIYSKFFGEYSHVV
FT                   GQVLLTRDVVEDDHIRENVCNTFEKLIENKIIPIVNENDTVSIDEIENIVKFGDNDNLS
FT                   AIVATLVKADLLIILSDIDGFYDSDPRSNKDAKLLKVVEEITPELESCAGGAGSNLGTG
FT                   GMVTKLAAAKKAVSSSVDMILANGSDPSVILNVLDGEDVGTLFLGKK"
FT   gene            65176..66420
FT                   /gene="proA"
FT                   /locus_tag="CLL_A0063"
FT   CDS_pept        65176..66420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proA"
FT                   /locus_tag="CLL_A0063"
FT                   /product="glutamate-5-semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.41"
FT                   /note="identified by match to protein family HMM PF00171;
FT                   match to protein family HMM TIGR00407"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0063"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23938"
FT                   /db_xref="GOA:B2THG5"
FT                   /db_xref="InterPro:IPR000965"
FT                   /db_xref="InterPro:IPR012134"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR020593"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2THG5"
FT                   /protein_id="ACD23938.1"
FT                   /translation="MKELILKGERAKEASYVLMNATTSEKNDALIKMGQKLLENKEYII
FT                   AENKKDLENAMLKGTSKAMLDRLYLDEKRLEDMADGLNQLVNLNDPIGEVITMWKRPNG
FT                   LQIGKQRVPMGVIGIIYEARPNVTCDAAGLCLKAGNAVILRGGSEAINSNKAIVKALCE
FT                   GIKESGLPEYSLQLIENTSREIANEMMRLNEYIDVLIPRGGAGLIQAVVKNATVPVIET
FT                   GVGNCHVYVDEEADFKMAEDIIINAKTSRPAVCNAEEKLLVNEKIAEEFLPKIISALRE
FT                   KNVEVRGDSSVMKIVDDVKEATDEDWGKEYLDFIIGIKIVNNIDEAIKHINKYGSGHSE
FT                   AIITNNYQNSQKFLQRVDAAAVYVNASTRFTDGCEFGFGAEIGISTQKLHARGPMGLNE
FT                   LTTTKYIIYGNGQIR"
FT   gene            66522..66962
FT                   /locus_tag="CLL_A0064"
FT   CDS_pept        66522..66962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0064"
FT                   /product="acetyltransferase"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0064"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22960"
FT                   /db_xref="GOA:B2THG6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR039143"
FT                   /db_xref="UniProtKB/TrEMBL:B2THG6"
FT                   /protein_id="ACD22960.1"
FT                   /translation="MDWKIKKFNELTLDELYEICKARYEVFGCEQRIYQENDFDDIDKR
FT                   VYHLFLMDSNKIAAYARLIPSGITYNESSIGRVLVLKEYRRKGIAFELMKKSVDFLKNE
FT                   LNEETIVVSSQLYVKKLYESVGFKIISDIYDEVDIPHVKMKM"
FT   gene            67148..67654
FT                   /locus_tag="CLL_A0065"
FT   CDS_pept        67148..67654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0065"
FT                   /product="bacterial membrane flanked domain protein"
FT                   /note="identified by match to protein family HMM PF03703"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0065"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22004"
FT                   /db_xref="GOA:B2THG7"
FT                   /db_xref="InterPro:IPR005182"
FT                   /db_xref="UniProtKB/TrEMBL:B2THG7"
FT                   /protein_id="ACD22004.1"
FT                   /translation="MGNKLHKNAIKSWMISNIIGTVLFLVISLIVFYIMKSKFEIQWVV
FT                   RNANYILFGIGIIVLLSIIDVIVSPVIQYKTWVYELTSDKIDFTQGIFTKKRTIVPIIK
FT                   IEHIKINRGPINSRLGLANIEIFTAGGSHEIPNIEIKVAEEIGEYLNNKIKEKVEEFNE
FT                   KNRSL"
FT   gene            67845..69062
FT                   /locus_tag="CLL_A0066"
FT   CDS_pept        67845..69062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0066"
FT                   /product="bacterial membrane flanked domain protein"
FT                   /note="identified by match to protein family HMM PF03703"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0066"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24485"
FT                   /db_xref="GOA:B2THG8"
FT                   /db_xref="InterPro:IPR005182"
FT                   /db_xref="UniProtKB/TrEMBL:B2THG8"
FT                   /protein_id="ACD24485.1"
FT                   /translation="MFVYVKGMIEKTKEQIPLKQITTVDLKTTILDRILGSVTLKLNSG
FT                   NATLNEAEFELVVKKEYALLIQKAVSGQDVDNEETYNNSRELQVGYKDIAIYALTKNKF
FT                   GWIMILFVIGNKFSRLFDDSIVNNVETYFWSLKDYLLYGSMFDLILKLVFVFAFVYIFS
FT                   TAISIGIEISKYGNFKITRNEDLFNIRYGIIDLKEYSISLEKIQGLKLKQNLLQQLLNV
FT                   YRIEGIVIGDNEINSLLFPSLKGSDKDKFIDEFLPEYNITKEIDKAPKKSIFRFIFKRF
FT                   IVSIVVSLILILLTKQFLPKLYMISYFKVLLLLILGFSQIILGYINYLNNGIAIEENNI
FT                   LLTNGGRTKNTYIIRKFKVQSLQVKQSIFQKYRDICTYKIDIATSSFGETIEIKNMDIN
FT                   KYENIL"
FT   gene            69289..70059
FT                   /locus_tag="CLL_A0067"
FT   CDS_pept        69289..70059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0067"
FT                   /product="short chain dehydrogenase"
FT                   /note="identified by match to protein family HMM PF00106"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACD21938"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2THG9"
FT                   /protein_id="ACD21938.1"
FT                   /translation="MKKYTLITGGTEGIGLELAKLFAKDKYNLVIVARNTDKLLQVKKL
FT                   IESEYKVNVETISVDLSIHSSSKKIFEFVDKKNISVDYLINNAGIGSFGFFHKGECGFE
FT                   ENLININIISLTNLTKYFLEKMIEKNHGGIMNVASTAAFIGGPKMAMYYSSKAYVLSLT
FT                   EALHEEVKDLGIRVSCVCPGPVKTSFQSKAGIKKSEKAKKYLMDAEKVAKIAYEGFFKG
FT                   KAIIIPGHKNKLLVWGTKLLPRSISRKIILKNKA"
FT   gene            70216..71028
FT                   /locus_tag="CLL_A0068"
FT   CDS_pept        70216..71028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0068"
FT                   /product="HAD superfamily hydrolase"
FT                   /note="identified by match to protein family HMM PF05116;
FT                   match to protein family HMM PF08282; match to protein
FT                   family HMM TIGR00099; match to protein family HMM
FT                   TIGR01484"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0068"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24508"
FT                   /db_xref="GOA:B2THH0"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B2THH0"
FT                   /protein_id="ACD24508.1"
FT                   /translation="MEKFFYGCLLISDMDGTLLDSDGKLSYENKKAIDYFISKGGNFTL
FT                   ATGRIVASAGRFLNDINVTLPVILYNGAKIYDYKNNKIIYEEFIEDYRKNTITLVKKDN
FT                   PTLGIEVYSEEKVYIYSSCKYTDRFSKLGYEVIYNLPTEAWNKKWTKVIIVGEEDEIDS
FT                   LEENFIRNYGDGNIIRSGARYLEIVPNNTSKGKAIEKLMDVYNIKSQNLITIGDNMNDI
FT                   EMIKLADYGFCVRSGAERLINNSKFIAPSNDENAIDYVIKWINKNIIR"
FT   gene            71127..72584
FT                   /locus_tag="CLL_A0069"
FT   CDS_pept        71127..72584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0069"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /note="identified by match to protein family HMM PF00015"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0069"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22100"
FT                   /db_xref="GOA:B2THH1"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR025991"
FT                   /db_xref="UniProtKB/TrEMBL:B2THH1"
FT                   /protein_id="ACD22100.1"
FT                   /translation="MFNNRNRVISEVVNNISRLKLPKENIKIDKAVLDKVKTIHMRLNT
FT                   GKDKFQDITRLVLNSVIQMSNLDLTLKDKEEKIENVTGEIVELMKSVSNTSEILSSTSE
FT                   EVTAAHTDMTQSISHLSLNSTNLLESIKKSENELLEIKVFSDTAISHSIGMKDDMSNLI
FT                   HVIENVQNVINAISDISEQTNLLALNASIEAARAGESGRGFAVVAEEIRKLADETKTLT
FT                   NNMSDFIDAIESASNKSNSSVDNTVDSLGKLNQNLDSVVKASKDNRERVNNINESITSI
FT                   AANSEEINTSMDEVATSMRKFDEDIEKLGEDTVALKDISHTLGSVIAPISLMEEDLDNA
FT                   SKIIGTLVNDEYYMITNSLFIETINKAIVAHKNWLQTLNKMVIDREITALQINEHKCGF
FT                   GHFYYSMKPKNEKVLAIWNDIDEKHKVFHSYGKDIISRLKSNVNDNSVKEIYVKAEQLS
FT                   VDLINDFKKVINFAEELDSSNSNVYNN"
FT   gene            72952..74001
FT                   /gene="carA"
FT                   /locus_tag="CLL_A0070"
FT   CDS_pept        72952..74001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="carA"
FT                   /locus_tag="CLL_A0070"
FT                   /product="carbamoyl-phosphate synthase, small subunit"
FT                   /EC_number="6.3.5.5"
FT                   /note="identified by match to protein family HMM PF00117;
FT                   match to protein family HMM PF00988; match to protein
FT                   family HMM TIGR01368"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0070"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22700"
FT                   /db_xref="GOA:B2THH2"
FT                   /db_xref="InterPro:IPR002474"
FT                   /db_xref="InterPro:IPR006274"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR035686"
FT                   /db_xref="InterPro:IPR036480"
FT                   /db_xref="UniProtKB/TrEMBL:B2THH2"
FT                   /protein_id="ACD22700.1"
FT                   /translation="MKAKLILENGMVFEGKAFGYLKESIGEVVFTTGMTGYQEVLTDPS
FT                   YYGQIVTMTYPLIGNYGINLEDMESDSIKVRGFIVREKCNLPSNFRCELELEDFLKQGK
FT                   IIGLGDIDTRALTKVLRNSGTMRGIIALEDLDDKTIKEKVKSFSNKEAVKNVTTKEKYV
FT                   VNGNGKHIAIMDFGIKQNIITNFKKRGCKLTVFPATASAEEILSVNPDLVFLSNGPGDP
FT                   EDLDFVIGNVKKLVGKKPIVGICLGHQLLALTLGGKTTKLKFGHRGCNHPVKDLEENIV
FT                   HITSQNHGYVVETLPEDVEVTHVNINDGTVEGLKHKTLPIYSVQFHPEASAGPKDSEYI
FT                   FDKFLKYAL"
FT   gene            74016..77225
FT                   /gene="carB"
FT                   /locus_tag="CLL_A0071"
FT   CDS_pept        74016..77225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="carB"
FT                   /locus_tag="CLL_A0071"
FT                   /product="carbamoyl-phosphate synthase, large subunit"
FT                   /EC_number="6.3.5.5"
FT                   /note="identified by match to protein family HMM PF00289;
FT                   match to protein family HMM PF01071; match to protein
FT                   family HMM PF02142; match to protein family HMM PF02655;
FT                   match to protein family HMM PF02786; match to protein
FT                   family HMM PF02787; match to protein family HMM TIGR01369"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0071"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24094"
FT                   /db_xref="GOA:B2THH3"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005480"
FT                   /db_xref="InterPro:IPR005483"
FT                   /db_xref="InterPro:IPR006275"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR033937"
FT                   /db_xref="InterPro:IPR036897"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2THH3"
FT                   /protein_id="ACD24094.1"
FT                   /translation="MPLNKDIKKVLVVGSGPIVIGQAAEFDYSGTQACEALKSEGIEVV
FT                   LINSNPATIMTDKEVADKVYLEPLTLEFIEKVIVKERPDSLLAGMGGQTGLNLAVELHD
FT                   SGILEKYDVKVIGTSIESIKEGEDRELFRDMMNRIGEPVIKSEIVTDLQSGIDFANKIG
FT                   YPVIVRPAYTLGGSGGGIADDEEELRIILESGLQLSTIGQVLLEKSVKGWKEIEYEVMR
FT                   DSYGNCITVCNMENIDPVGIHTGDSIVVAPSQTLSDKEYQMLRTASINIINSVGIEGGC
FT                   NVQFSLNPNTFEYAVIEINPRVSRSSALASKATGYPIAKLAAKIALGYGLDEIKNAVTQ
FT                   KTYACFEPTLDYVVVKIPKWPFDKFFGADRQLGTKMMATGEIMAIGANFEQAFLKGIRS
FT                   LEIGKYSLDHKKFKEHSMSELKDLVMKPDDERIFALAEMLRRDYMIERINKITGIDKFF
FT                   LEKIKWIVEEEQRLKLSKIEDLDKEWLQNLKKKGFSDKAIADMLKVSPEDIYRLRDIWS
FT                   IKPSYKMVDTCGGEFEALSPYYYSTYEQYDEVEVSNRRKVIVIGSGPIRIGQGIEFDYA
FT                   SVHCVKALKKLDIETIIVNNNPETVSTDFDISDKLYFEPLTEEDVLNIIEKENPYGVIL
FT                   QFGGQTAIKLANFLKEKNIKTLGTTADQIDMAEDREKFDELLERLDISRPKGKGIWSVE
FT                   EGLEEAERLGFPVLVRPSYVIGGQGMEITHDEEELIFYLTNAFVKDKKNPILIDKYLMG
FT                   REIEVDAISDGENILIPGIMEHLERAGVHSGDSVTMYPSQNVCDEIKGKILEYTKKLAL
FT                   AIGIKGMINIQFIEFEGNLYVIEVNPRASRTVPYISKVSKVPIVDIATQVMMGAKLNDL
FT                   GYGVDIYKEPELVSVKVPVFSTQKLPNVEVCLGPEMRSTGEVLGVGRNLKEALYKGFVG
FT                   ANMYPSKEKGKILATINKHNKAEFLPIAKDLAKVGYKFIATTGTCKLLREEGIDAEEVR
FT                   KIDEEKPNILDIVKNREVDLVVNTPTKGNDSKRDGFLIRRAAVERNLGVITALDTLRAI
FT                   ADVELEEFDKNKDLEVFDITK"
FT   gene            complement(77269..78378)
FT                   /locus_tag="CLL_A0072"
FT   CDS_pept        complement(77269..78378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0072"
FT                   /product="HDIG domain/HD domain protein"
FT                   /note="identified by match to protein family HMM PF01966"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0072"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24634"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:B2THH4"
FT                   /protein_id="ACD24634.1"
FT                   /translation="MRLIPIECVKKDTILGKTIYDSEGRILLKKGVKLTQLLIQKIKHL
FT                   SILSIYIIDEYSDYEIEDIIKPELRQKAIKILKETFNDIQRISSLHSFEKFSIENYSKH
FT                   ELKYFENISTISEELLDNILSNKNLLISLVDIKSMDNYTYQHSVNVAVLSLVLGISLKL
FT                   PKRKLIQLCSGALLHDIGKTFIDKDIILKPGKLTPEEFDIIKTHPEKGYYFLGDLYSIN
FT                   SNSKSIILQHHERVDGLGYPYGLSGDKINYMAKIVSIADVYDALTSDRPYKRAMCPGDA
FT                   LEYIMSNSGTFFDYEMVKVFSRVIIPFPNGTIVCLSNGDIGIVEETFPNYPLRPQIKIL
FT                   KSDNKEIVGSRINLLTELSIVISGIKYEA"
FT   gene            complement(78671..80563)
FT                   /locus_tag="CLL_A0073"
FT   CDS_pept        complement(78671..80563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0073"
FT                   /product="glutamate--ammonia ligase"
FT                   /note="identified by match to protein family HMM PF00120"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0073"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23301"
FT                   /db_xref="GOA:B2THT2"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="UniProtKB/TrEMBL:B2THT2"
FT                   /protein_id="ACD23301.1"
FT                   /translation="MNNLLYVIKKENHNAKDLNAILNENSQIKFVSFVGIDLSGNDTDE
FT                   KIPVKLFLENIDSYLNGIAVQTDGSSVVLPGIATLNNAKVDMITDLDSKWFVDYNFNFT
FT                   DPETSKPVGTLRIPCFLYHDNKPVDSRHILKASASTVKETLSNLFKNKPELLNVYDITP
FT                   DDIDDIIVTSATELEFWVKTPNENAEVEELSTSQVLHEHYWTRTKGSVRTALEETLLLM
FT                   EKYDFEPEMGHKEVGGVRAKLNSSGNFDHVMEQIEIDWKYSDVLQAADNELFVRILTQE
FT                   TFRRNGLEVTFMAKPIEEVAGSGMHVHLSISLKLKNGKRINIFNGPKNHFLSVIGYGAI
FT                   MGVLKNYEVMNPFISSTNNSLRRLKPGFEAPVCIVTSLGKSPENPSRNRSILVGLIRDL
FT                   DSPLATRFELRSPNPHTNTYIAMAVSFMSMLDGILYAVNKTEDELLAELSKKSGEDADY
FT                   LEKERAYRSEEDVFEDFSEEERNKFFGIAPATIYENLSQLEKYPEKVEILKKNNVMTSD
FT                   IINSFKLATLQRWTTEIIHRIINNYINEIRSFAPLHSLDKALDLDISNWMKINDLRMYI
FT                   MKDTYTTKGLFTRIKIAFINKDYETASELYIELEDKMKLLRSLYSSYKKNLLDI"
FT   gene            80881..81657
FT                   /gene="murI"
FT                   /locus_tag="CLL_A0074"
FT   CDS_pept        80881..81657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murI"
FT                   /locus_tag="CLL_A0074"
FT                   /product="glutamate racemase"
FT                   /EC_number="5.1.1.3"
FT                   /note="identified by match to protein family HMM PF01177;
FT                   match to protein family HMM TIGR00067"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0074"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24274"
FT                   /db_xref="GOA:B2THT3"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004391"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="InterPro:IPR018187"
FT                   /db_xref="InterPro:IPR033134"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2THT3"
FT                   /protein_id="ACD24274.1"
FT                   /translation="MDKKNRPIGFFDSGVGGLSVMKEAIRLMPNENYIYFGDSKNAPYG
FT                   VKTVEEVRTLTFNAVESLLEKNVKAIVVACNTATSAAIDLVRSKYENIPIIGIEPALKL
FT                   ATKYNRKGNIIIMATPMTLKENKFKSLMEKYGENYDIVSLPCAKLVEFIEHGILSGEEL
FT                   EEYLKEKFKPYKNNDIGVVVLGCTHYPFIKETLYKVIDKDIPIIDGGLGTSQELRRRLE
FT                   EKNLLNTEEKQGSITIINSNGSEKMIELSKKLIEIS"
FT   gene            81796..82320
FT                   /locus_tag="CLL_A0075"
FT   CDS_pept        81796..82320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0075"
FT                   /product="peptidyl-prolyl cis-trans isomerase"
FT                   /EC_number="5.2.1.8"
FT                   /note="identified by match to protein family HMM PF00160"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0075"
FT                   /db_xref="EnsemblGenomes-Tr:ACD21771"
FT                   /db_xref="GOA:B2THT4"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:B2THT4"
FT                   /protein_id="ACD21771.1"
FT                   /translation="MANPIVTIKMKDGGTIKAELYPEIAPNTVKNFIDLINRGFYDGLI
FT                   FHRVIPGFMIQGGCPEGTGMGGPGYGIKGEFTSNGFKNELKHSKGVLSMARAMHPDSAG
FT                   SQFFLMVANAPHLDGQYASFGKVIEGIEVADKIVATKTDRQDRPYEDQVIEKMTVDTQG
FT                   ETYGEPEIIEE"
FT   gene            82501..82869
FT                   /locus_tag="CLL_A0076"
FT   CDS_pept        82501..82869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0076"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0076"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22768"
FT                   /db_xref="InterPro:IPR016621"
FT                   /db_xref="UniProtKB/TrEMBL:B2THT5"
FT                   /protein_id="ACD22768.1"
FT                   /translation="MIPNIKCILAYGLEDSEINKIKQRYGKVIKINKDMGNVKIKDLIS
FT                   GLEQVEEPEDMLEEKMIIFNKFVEGELKGAIKYIRGFTSDGVLAVTTPVSCNWSFKYLL
FT                   EHLIEEREWHKAGQKGRE"
FT   gene            82871..83539
FT                   /locus_tag="CLL_A0077"
FT   CDS_pept        82871..83539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0077"
FT                   /product="DNA-binding protein"
FT                   /note="identified by match to protein family HMM PF01381"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0077"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22993"
FT                   /db_xref="GOA:B2THT6"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:B2THT6"
FT                   /protein_id="ACD22993.1"
FT                   /translation="MSRVGEKIKQAREKNGLSAKVLGKKLGVAEKYINDIELGRKVANE
FT                   AFIERVSKFLKTDLNDINMVVTDEELMKEKEAFKKIVNTKAEKSEVWTDAFASVIKNVP
FT                   IYNYSLSNTKGTRELTVHSNKVEGYPQDKVLYLQIENDDMSGFRILKGDLAFAHMVKEF
FT                   SNNGIFLIDHKGERKIRQIRSLGNSKVLLISNGGSLITETTEIKEINIIAKLERIEIKL
FT                   "
FT   gene            83639..85483
FT                   /locus_tag="CLL_A0078"
FT   CDS_pept        83639..85483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0078"
FT                   /product="CspB"
FT                   /note="identified by match to protein family HMM PF00082"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0078"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23448"
FT                   /db_xref="GOA:B2THT7"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR017310"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR034045"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="InterPro:IPR041365"
FT                   /db_xref="UniProtKB/TrEMBL:B2THT7"
FT                   /protein_id="ACD23448.1"
FT                   /translation="MIKIETIESNNISSKLDAAIGLLANVPQDILNRINEKFFSGDLGN
FT                   TIEVTILYRDTPQILTELAKELEGEFQDLGFNFGIMNLPLKSLPKLATSNSIQYIELPK
FT                   SLYEADSEGNRATCVPQAVSTYNLSGKGVLVGFIDSGIAYTHPAFMDSEGNTRIEYIYD
FT                   LSLEKKVYDKDIINKAIKSNDPYSIVPVLDNTGHGTHVAGIACAGGKINDVYKGAAPEA
FT                   SIAMVKAARGSWILSSQIMQGIKFLIDKSKERNMPLVINMSLSTNNGAHNGSSLLEQYI
FT                   STVSNLERATIVIAAGNEGDAAHHTGGELDETQTKTFNVASDENTVVINLYKSILPDVS
FT                   LNIISPTGQSSGNINVQEGYFHGGIGRDRYDIYVAGPKPFELNSEVKIIISSIGSSYLI
FT                   TGVWKIQITVRNNYKGSFSMWLPISEGLNPQTKFLEPINYNTLGIPATVDNVIAVGSYN
FT                   SLTNTLSSFSGRGQQTQGNIIRPDLVAPGVGILGPIPNGGYDSKTGTSMAAPQVSGICA
FT                   LIMQFGIVNGNDPYLFGQRLKYYLVRGANRARTDIEYPNPLWGYGTACAYDSIYDIENT
FT                   LNQILARNYKLRDIDQYINSEKNNEFYVDKLFIRLPNK"
FT   gene            85553..86884
FT                   /locus_tag="CLL_A0079"
FT   CDS_pept        85553..86884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0079"
FT                   /product="spore cortex-lytic enzyme SleC"
FT                   /note="identified by match to protein family HMM PF01471"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24798"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/TrEMBL:B2THT8"
FT                   /protein_id="ACD24798.1"
FT                   /translation="MADKGSLKIQCFSGNDYIPVDNAKISVRESSLNENKPSTIELITN
FT                   SIGLTEKIDLDAPPIEYSLDENNNEVPYSVYDILVERDGFETLIINGCQIFPEEIAYQR
FT                   CNLIERKSTTRQKEVINIQPNTLNGNFPPKIPEEDEKELPPPSSGVVLAQPVVPEYIIV
FT                   HQGGPNDPSAPNYTVPFKEYIKNVASCEIYSTWSSNAIRANIFCIISFTLNRIYTEWYR
FT                   GKGKNFDITSSTAYDHAFNYGRNFYDSISVVVDEIFSTYIRRVGRKQPLLTQYCDGKDV
FT                   QCPEWLSQWGSQSLGAQGKPPYEILKYYYGNDIELVTAEKVEGSPKSYPDYDLTVGSVG
FT                   EPVKTIQNQLNRISKNYPLIPKVAEDGVFGQTTAESVKVFQGIFNLPQTGVVDYATWYK
FT                   ISDVYVGVTRIAELRGESSDQKIFVPPMTIQQANREIPSFNYFV"
FT   gene            complement(86925..87830)
FT                   /locus_tag="CLL_A0080"
FT   CDS_pept        complement(86925..87830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0080"
FT                   /product="radical SAM domain protein"
FT                   /note="identified by match to protein family HMM PF04055"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0080"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23999"
FT                   /db_xref="GOA:B2THT9"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR016431"
FT                   /db_xref="InterPro:IPR040085"
FT                   /db_xref="UniProtKB/TrEMBL:B2THT9"
FT                   /protein_id="ACD23999.1"
FT                   /translation="MKYSNMLEECTLCYRECKVNRLNNELGFCRASKNVKVARASLHLW
FT                   EEPPISSGKGSGTVFFSHCNLNCVFCQNHDISQEFKGMDISIKRLADIFLELQEKGANN
FT                   INLVTPTHYVPQIIEALEISKSKGLNIPILYNTNTYDSLETIKSLDGYIDVYLPDFKYF
FT                   NDKYSIKYSKASDYSINAIKIIDEMVRQTGEVNFDSESHITKGVIVRHLLLPGLLFDSK
FT                   KVVDLLFNRYGDNIYISLMNQYIPMFKACDYPEINKPLNPKHYDSLIDYAVNIGLKNGF
FT                   IQDQGTNTTDFIPSFNGEGI"
FT   gene            complement(87980..89038)
FT                   /locus_tag="CLL_A0081"
FT   CDS_pept        complement(87980..89038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0081"
FT                   /product="transporter"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0081"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23285"
FT                   /db_xref="GOA:B2THU0"
FT                   /db_xref="InterPro:IPR038728"
FT                   /db_xref="UniProtKB/TrEMBL:B2THU0"
FT                   /protein_id="ACD23285.1"
FT                   /translation="MKKSFVNIFQVAVVFIGTIVGAGLASGKEITEFFTSFGLKSFFGI
FT                   IVCGIFYIVIGCIIAKISIHYELNSYSDLINVISPNYLGKFTGFITTLYLISSASIILA
FT                   GSGALINQFFGIPKLVGSIIMICIAIFFLLRDTDGLIAVNSFIVPSLICTITLITILYF
FT                   VFSRDAVSLESMRQFKPIKSGLAISTILYAGYNTLCCTGVLVPLSNQMKKPKTMFIGIT
FT                   LGAIGLTLLCLAINLMLTVNQPYIYKFEIPLLLVANRFGCIIQAILLVIIWLEMFSTEV
FT                   SDVYSISKTLEQTFNIDFKKGIFIILAIALPISQIGFSNLITKLYPAFGVLSLVFILQS
FT                   VIFYFKHRKELK"
FT   gene            89173..90243
FT                   /locus_tag="CLL_A0082"
FT   CDS_pept        89173..90243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0082"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0082"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22547"
FT                   /db_xref="UniProtKB/TrEMBL:B2THU1"
FT                   /protein_id="ACD22547.1"
FT                   /translation="MKKIILIIMSMMMVFISMGCSNKISNNENIDLYDSKKAIETAQKY
FT                   LMEIQNENFEEAKKFCTKDFASASKINDLGKSKIQVFKINKSVDGGDKVSIIFDVLRGE
FT                   DYSPNNNLDKYNIDVIKENDEYKINNLSAAEEVEAYEKENELRLQTSGAGESKLILKLS
FT                   DMPKQVYNKGDNPLEQVDIPIDKFSSCGLSYSGDKVAYSTTNGKDSFIGILYIKDDKVV
FT                   TTIGSNQDDTQNKSDNRSNAIEKVQTDKVMNFGILNNCQIERIVFSASEDNLIVSYKNS
FT                   NEGMGLKIFDIESGKESSLNIKSKFPTDKYNVRVMYVNEDEIMVRVTLLEGVLEEKEDL
FT                   TGIYSININKATIEKK"
FT   gene            90336..91274
FT                   /locus_tag="CLL_A0083"
FT   CDS_pept        90336..91274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0083"
FT                   /product="radical SAM protein, family"
FT                   /note="identified by match to protein family HMM PF04055;
FT                   match to protein family HMM TIGR01212"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0083"
FT                   /db_xref="EnsemblGenomes-Tr:ACD21747"
FT                   /db_xref="GOA:B2THU2"
FT                   /db_xref="InterPro:IPR005911"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR032432"
FT                   /db_xref="InterPro:IPR039661"
FT                   /db_xref="UniProtKB/TrEMBL:B2THU2"
FT                   /protein_id="ACD21747.1"
FT                   /translation="MNNSWNGKRYHSLNYFLREKFGEKVFKISLDGGFSCPNRDGKVSK
FT                   GGCVFCSARGSGDYAGSRNFSITGQFNNVKTMMANKWKSGKYIAYFQAYTNTYAPVDEL
FT                   RQKYEEAINQEGVVALSIATRPDCLEDDVLDLIEELSKKLYVWVELGLQTINDDVAKKI
FT                   NRGYDLKVFDNAMTRLKERNIDVVVHSILGLPGESQDDMLKTIDYIAHSGAQGIKLHLL
FT                   HLMKDTKMVELYENGELQFLSQEDYIKLICRAVSMLPKEMVVHRLTGDAPRDLLIGPMW
FT                   SLKKWEVLNAIDKTLEDNDIYQGKNFDMGDI"
FT   gene            91275..91991
FT                   /locus_tag="CLL_A0084"
FT   CDS_pept        91275..91991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0084"
FT                   /product="putative 2-phosphosulfolactate phosphatase"
FT                   /note="identified by similarity to SP:Q58540; match to
FT                   protein family HMM PF04029"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0084"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24349"
FT                   /db_xref="GOA:B2THU3"
FT                   /db_xref="InterPro:IPR005238"
FT                   /db_xref="InterPro:IPR036702"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2THU3"
FT                   /protein_id="ACD24349.1"
FT                   /translation="MKVDVVISADYISDDIVKDKVVVVIDMFRATSVITTAINNGCQKI
FT                   IPYLTVEETLEEAKKYDNNEVILGGERRAVKIEGFDLSNSPLEYTEEVVKNKTVLMTTT
FT                   NGTRALTKCLLGKKIIIAAMINAEAVAKKLLEFNDDIVIVNAGTNGEFSMDDYICGGYI
FT                   INTMLKEKSNIELTDIAKTSNMIYESNKDIINYVKEARHYSVMRSLKLDNDIEYCIKKS
FT                   IIDVVPIYDGDKIIKL"
FT   gene            complement(92015..93205)
FT                   /locus_tag="CLL_A0085"
FT   CDS_pept        complement(92015..93205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0085"
FT                   /product="putative RNA methylase"
FT                   /note="identified by match to protein family HMM PF01170;
FT                   match to protein family HMM PF02475"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0085"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23153"
FT                   /db_xref="GOA:B2THU4"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR019614"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR041532"
FT                   /db_xref="UniProtKB/TrEMBL:B2THU4"
FT                   /protein_id="ACD23153.1"
FT                   /translation="MASKFYLHKGRSGKAEQGRPWVYTDEINEYDGEYENGDIVEVYNH
FT                   KGYFIGKGYINDKSKITIRIMSRDINENIDEEFFKSRFKTAFEYRRSIIDDSSCRMIFG
FT                   EADFLPGLTVDKFEDYYVIQISTLGMDQYKDLIVKVLVNEYNAKGVYERSDIATREIEG
FT                   LEQTRGFLTEPFDTNVEIVENGVKYIVDLANGQKTGFFLDQKENRAAIHRICKDKDVLD
FT                   CFTHTGSFALNAGIAGAKSVLGIDVSQHAIDCANKNAELNNLQDTVKFECHNAFDVLPA
FT                   WSREEKKFDVVILDPPAFTKSRNTINAAKRGYKEINLRGLKLVKHGGYFITCSCSHYMN
FT                   EELLKKTILEACQDANKLIRQVEFRTQSCDHPILWNSDESYYLKFFIFQVFDKTKL"
FT   gene            complement(93643..93852)
FT                   /locus_tag="CLL_A0086"
FT   CDS_pept        complement(93643..93852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0086"
FT                   /product="conserved domain protein"
FT                   /note="identified by match to protein family HMM PF04324"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0086"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22187"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:B2THU5"
FT                   /protein_id="ACD22187.1"
FT                   /translation="MDNNLNKDILDKITKTCTCKSITRAKIKEAIVNGASTYEEVQKAT
FT                   GAGSGCCKGKKCSEKINDLIKELN"
FT   gene            94170..94853
FT                   /locus_tag="CLL_A0087"
FT   CDS_pept        94170..94853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0087"
FT                   /product="DNA-binding response regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00486"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0087"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24365"
FT                   /db_xref="GOA:B2THU6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B2THU6"
FT                   /protein_id="ACD24365.1"
FT                   /translation="MISILLIEDNIEISRNIVEYFGNEFNIKAVYDGSDAIQYLDTYSY
FT                   DIVILDLMLPEVDGMSVLSYMSKKTLNTGVIILTAKEELGDKLKAFNLGANDYLTKPFF
FT                   MEELKARIIAILKSMGKIKKSNILEFKNMQIDMKVKKVYINNEELELNEKLYKLLEYLV
FT                   INKGVLLFKEQIFDNICGYNSDAATEIIEVYISRLRKQLSKYDYDKYLVTKRGMGYLLD
FT                   ESIGD"
FT   gene            94859..96130
FT                   /locus_tag="CLL_A0088"
FT   CDS_pept        94859..96130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0088"
FT                   /product="sensor histidine kinase"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0088"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23821"
FT                   /db_xref="GOA:B2THU7"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B2THU7"
FT                   /protein_id="ACD23821.1"
FT                   /translation="MKKDIFLSTKRRITAISIGIVLLCLIIFALITQAFYKSKLLDNVD
FT                   RQLIDQKKIFLGEEIIRTDRDEKEKHYNFDMIPDGKPMKIPPNLILISYNNDIFESMSN
FT                   TLYFSEDNLPTLPKESNEKIVNFQYNDYNFRGITVTNGEQKIQVIANIDVEVHSINRLR
FT                   NSIFFSLVILIIISSALAAYLASKVIKPVKKAYEKQIYFVQDASHEMRTPVAVIKGKVE
FT                   LLAHSPDDTIDDHFEHISNMMSEIRGLEKLNNDLLLLSKEDLELGLNITSFSLDDFIDE
FT                   ISEFYIDLAEIRHRDFQVIKPKNEIIVSWEKDKIKRAIIILLENAFKYTNEGGSVKLIV
FT                   EDLTKSIKVTVKDDGIGIKEEDQKRIFDRFYRSKEVRGKNISGTGIGLSLLKSITKNFG
FT                   IKLKVNSKYGEGSEFILVIPKIIK"
FT   gene            96428..97114
FT                   /locus_tag="CLL_A0089"
FT   CDS_pept        96428..97114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0089"
FT                   /product="VTC domain superfamily"
FT                   /note="identified by match to protein family HMM PF09359"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22447"
FT                   /db_xref="InterPro:IPR018966"
FT                   /db_xref="UniProtKB/TrEMBL:B2THU8"
FT                   /protein_id="ACD22447.1"
FT                   /translation="MGEKKFRHELKHYINFSDYLAIKSRIRSIMHIDKNANKDNEYKIR
FT                   SLYFDNAYDKVLMEKVIGLSKRDKFRIRFYNDNHEFIRLEKKSKIRGLCLKDSTRISKE
FT                   ECEKIINGKIEFLKDSNDKLFIDLYAQMKGQLLRPKTIVDYTREAYIYPIGNVRITFDK
FT                   SVRTGVQSKNLFNDDLPTIETIDNKHIVLEVKFDEFLPQVIQDIIQVNERRPTSISKYE
FT                   AARIYG"
FT   gene            97149..97838
FT                   /locus_tag="CLL_A0090"
FT   CDS_pept        97149..97838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0090"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0090"
FT                   /db_xref="EnsemblGenomes-Tr:ACD21909"
FT                   /db_xref="GOA:B2THU9"
FT                   /db_xref="InterPro:IPR032531"
FT                   /db_xref="UniProtKB/TrEMBL:B2THU9"
FT                   /protein_id="ACD21909.1"
FT                   /translation="MTQTTTNFSDIFKSSFAEKLTQVSFLDMFIALALAFVIGLFIMQV
FT                   YKKTFKGVMYSESFAISLLALSLITTLIILAVTSNVVLSLGMVGALSIVRFRSAIKEPI
FT                   DIAFLFWSISVGIVIGAGLIPLAVLGSIFIGIVMVLFINKKTSNNPYILVINCEDDDSE
FT                   NTALKVLSKNVDKYNVKSKTISPMNGIEMTVEIGLKKKSTDFVNSISKLNGISNVVLVS
FT                   YNGDYMS"
FT   gene            97955..100084
FT                   /locus_tag="CLL_A0091"
FT   CDS_pept        97955..100084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0091"
FT                   /product="CotH protein"
FT                   /note="identified by match to protein family HMM PF08757"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0091"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24047"
FT                   /db_xref="GOA:B2THV0"
FT                   /db_xref="InterPro:IPR014867"
FT                   /db_xref="UniProtKB/TrEMBL:B2THV0"
FT                   /protein_id="ACD24047.1"
FT                   /translation="MIKEKHKWYISITSMILAVIFIFSLVVNNETSSIAQKKLSTVLDK
FT                   ESITNIDIDIDDSDWNWLIENALNEEFHSCNITINGEIFYNVGIRPKGNTSLTSVASDD
FT                   TTDRYSFKIKFDKYVDGQTYHGLESIVLNNIIQDSTYMKEYITYDLYESLGVATPEMSY
FT                   SNITVNNENWGLYLAIEVIDERYLENNFGSNEGNLYKPETMGVNNGGGNQGGNPPNGGE
FT                   RPTGLPPGIENNQGNMTMPSQGGQETQQNISDENISNTQQDLGNVSEMKMPTGQEKINA
FT                   TAEKNTSQDDNMSNKEITKLNETTNNEMPQMGGNKMGGRAVEGADFVYIDDNVSSYSIV
FT                   RESAVLKRTTDADFEKVINMFKNLNEGTNLEEVLDVEEVLKYFAVNTFVINLDSYSGAM
FT                   YHNYYLYEKDGKCQMLPWDLNLSFGGFGARGGNGGNQGNASSESSVINFPIDNPVSGDL
FT                   SSMPLIGKLLEVDEYKEMYHSYLKQIADEYFNNGYYENLVNKIDNLISSYVENDPTAFC
FT                   TYDEYKNSIPEMIKFGEDRTKSVLAQLNGEQPSTTYGTIESTVNMTALGDMGGGKGMQG
FT                   NKTNNATQNTEQKVSTEITNKDNVENTQVTNENLNKEVPNVINQDNTNANSSNQDRIKQ
FT                   NQSNDITKTNENTKTEQNINNESNNSQNNMHKQDFQHVDNSEQNKSYLLILGGLVVLSG
FT                   LSLLFVSKFKRKKLK"
FT   gene            100377..102356
FT                   /locus_tag="CLL_A0092"
FT   CDS_pept        100377..102356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0092"
FT                   /product="5'-nucleotidase family protein"
FT                   /note="identified by match to protein family HMM PF00149;
FT                   match to protein family HMM PF02872"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0092"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23070"
FT                   /db_xref="GOA:B2THV1"
FT                   /db_xref="InterPro:IPR006146"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR008334"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR036907"
FT                   /db_xref="UniProtKB/TrEMBL:B2THV1"
FT                   /protein_id="ACD23070.1"
FT                   /translation="MFRRSKNKKFLSSIVASMMVFTLFTPMTANADTKNGSVNLQILTT
FT                   TDTHGRFLPYDYAVNAQDNSGSLAQISTAVKELKAKNPNTILVDAGDSLQDNSQALFIN
FT                   DSSNPMIEAMNKIGYDTFTLGNHEFNYGMPTLKNIIKQVKGKVLCGNVYDTDGKTRIAA
FT                   PYTIVEKGGVKVGIIGMVTPNITKWDSINLKGYKVTNPVEETKAAIEELKKKNVDTIIA
FT                   VDHIGETQEYGTEGSSAIEILEQCPEITAFVAAHFHVKIINDYYYDHKIYSLNPKDNKV
FT                   TTVTKDGTIGQSTVADYDKAKANGTVIVEASKWAKAIGQININLTKDSKGKYVVADKSK
FT                   DITTGFYEMAPKNGTPVKPDEEIVKSLESYNKRAIDDANTLIGELKGGNLTPANEVKGI
FT                   DQAKVEPTPMLSLINEVQMYYGEKVANHKIDVSSAAVFKDGQNIAEGPIKKCDTANIYK
FT                   FDNTLYALKITGSQLKKYMEWSFAYYNKYNPGDLTVSFNPNTPGYNFDMFAGVKYNVDI
FT                   SKDAGNRIVNLTKMDGSKINDSDELYLTVNNYRGATQLLTPGVIFKEGEQLPTLVGKSE
FT                   ETAGLGEGRIRDLIGQYIKEVKGGTITPKCDNNWSIIGNNWDKEQRKTAIKCINNETVT
FT                   LDGVAEEQTSSNSKSITWDDVKGK"
FT   misc_feature    102878..103129
FT                   /note="T-box leader"
FT   gene            103159..106287
FT                   /gene="ileS"
FT                   /locus_tag="CLL_A0093"
FT   CDS_pept        103159..106287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ileS"
FT                   /locus_tag="CLL_A0093"
FT                   /product="isoleucine--tRNA ligase"
FT                   /EC_number="6.1.1.5"
FT                   /note="identified by match to protein family HMM PF00133;
FT                   match to protein family HMM PF08264; match to protein
FT                   family HMM PF09334; match to protein family HMM TIGR00392"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0093"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22269"
FT                   /db_xref="GOA:B2THV2"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002301"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023586"
FT                   /db_xref="InterPro:IPR033709"
FT                   /db_xref="UniProtKB/TrEMBL:B2THV2"
FT                   /protein_id="ACD22269.1"
FT                   /translation="MKGENRMYKKVDSSKGFVNMEHDIATLWNEKDIIKKSFDSNQDGE
FT                   YFTFYDGPPTANGKPHVGHILTRVMKDIIPRYKVMKGYKVIRKAGWDTHGLPVELEIEK
FT                   KLGISGKEQIEEYGVEKFVKECKESVFTYVSMWEKMTEQIGYWVDMEHPYVTYHNPYIE
FT                   SVWWALKQMWDKELLYEGHKVMPYCPRCGTALSSHEVAQGYKDVKDLTAIAKFKVQGEE
FT                   NKFILAWTTTPWTLPSNLALCINKAYTYIEAKVEEEVYVLAKDLADKVLGEDYEIIREF
FT                   KGTELLGIKYEQLMPFGKVEGKAFEVIHGDYVTLTDGTGIVHIAPAYGEDDSLVAKANG
FT                   IAFINLVDKEGKFVEEVTPWAGKFVKKCDDSICKWLEENNKLFKTARHLHSYPHCWRCD
FT                   TPLLYYPKESWFVRMTSLRDKLLENNNKINWCPDNIRTGRFGKFLENVIDWGISRDRYW
FT                   GTPLPIWECECGHKECIGSIAELKEKGINVPEDIELHKPYIDNVHLKCAHCGKEMKRTK
FT                   EVIDCWFDSGSMPFAQLHYPFENKELFEQNYPAQFISEAVDQTRGWFYTLLAISTAVFD
FT                   RNPFENCIVLGHVLDKKGLKMSKSKGNVVDPFEVLSSQGADATRWHFYTASAPWLPTRF
FT                   STDDVGESQRKFLSTLWNVYSFYVLYAEIDSFNPLEYTDFKSENVMDKWIMSKLNTLIK
FT                   TVDEKLNSYDITAAALSIEEFTDELSNWYVRRNRSRYWTETINDDKIGAYVTLYRVLVT
FT                   LSKVAAPFVPFITEEIYQNLVVNLDNTAEESIHLTSWPQVEESAINKELEKEMDLAYTI
FT                   VKLGRSARNGANIKNRQPLSEILVSVASLPEYYGDIITNELNIKEIKFGADLSEHVNFE
FT                   LKPNLPVLGRAYGKLIPGIRKEIAARNQMELAQKIKGGNVEIINVDGTEIELNSESILV
FT                   TMQGLEGYAFAGEGEFGVVLDTHITDELREEGHVREVISKIQNMRKDNGFEVADKIKLY
FT                   VANNELLLGIIKKFSETIKKETLTCDIIYNEICDYTQTIINGENLDMTVEVVK"
FT   gene            106394..107392
FT                   /locus_tag="CLL_A0094"
FT   CDS_pept        106394..107392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0094"
FT                   /product="catabolite control protein A"
FT                   /note="identified by match to protein family HMM PF00356;
FT                   match to protein family HMM PF00532"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0094"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24784"
FT                   /db_xref="GOA:B2THV3"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B2THV3"
FT                   /protein_id="ACD24784.1"
FT                   /translation="MAASIKDVAREAGVSIATVSRVLNDIDVVNEDTKKKVLDAIKLLG
FT                   YRPNIIARSLKTQKTKTIGILLPDVSNQLYPEIVRGAEDVSNIYDYNVILCNSDLDIEK
FT                   EKEYLRVLKEKMVDGVLYMSSSLQEEILELINELNLKTVLVETKDKESRLPSVTIDNIK
FT                   GSYDSTKYLIDKGLKNIAFIGTEKNHMNAWGDRYIGYEKALKEQGIALDQDLVYLDTVK
FT                   VKTGYEGIDHFIEKNKKFDGIVCASDEIAMGTINRLREKGYEVPKDVSVIGFNDNYAAS
FT                   IFYPKITTISQPTYDMGSVAMRMLIKILNDKELETAHYVLEHELVERDSTI"
FT   gene            107674..108099
FT                   /locus_tag="CLL_A0095"
FT   CDS_pept        107674..108099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0095"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0095"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22939"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B2THV4"
FT                   /protein_id="ACD22939.1"
FT                   /translation="MRKKALVCFLIIIVIILAVVSINKMNSKTKEEQFSYKLEYVKSLN
FT                   DIDKSLPTVIFFKGLINEKESLEYEIMLKDLKDEINFNLVHVSLDYITNEEQENLINEY
FT                   KIIEVPTIVLKDKNQIDIATYHHITYEKLKELISNLT"
FT   gene            108224..109603
FT                   /locus_tag="CLL_A0096"
FT   CDS_pept        108224..109603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0096"
FT                   /product="mate efflux family protein"
FT                   /note="identified by match to protein family HMM PF01554;
FT                   match to protein family HMM TIGR00797"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACD21947"
FT                   /db_xref="GOA:B2THV5"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:B2THV5"
FT                   /protein_id="ACD21947.1"
FT                   /translation="MNNQKRLGEVGIRKLLLEFSIPAIVGMLVNTLYNIIDRVYIGNIP
FT                   EIGNLAITGVGITLPLMTIILAFGMLVGIGTATRISIKLGEHDKESAERHLGNAFTLII
FT                   IISILLTAIGLIFMRPLLSMFGASVNTIGYAIDYIRIIFMGTIFNMLSFGLNHSIRSDG
FT                   SPKVAMLSMLIGALTNIILDPIFIFVLGLGVKGGAIATVISQMVSTTWILYYFTKGKSV
FT                   LKIKRKYLKLNKEIVTSIFLIGMSPFSMQVAQCAVQVISNNSLQRYGGDAAIGAMTIIN
FT                   SLVMIFLMPIFGLNQGMQPIVGYNFGAKKYDRAKKTLKYTAIAATTIVTIGFIVVETIP
FT                   ELLISIFNRDPELLRIGVSGMRIFLVMLPLIGAQIVTTNYFQSIGKVKVSMFLSLLRQV
FT                   IILIPLLILIPKFMGLTGVWVAGATSDFLSALITLVVFLRYNNKLKKDTIKQSSTQILE
FT                   A"
FT   gene            complement(109655..109840)
FT                   /locus_tag="CLL_A0097"
FT   CDS_pept        complement(109655..109840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0097"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0097"
FT                   /db_xref="EnsemblGenomes-Tr:ACD21722"
FT                   /db_xref="UniProtKB/TrEMBL:B2THV6"
FT                   /protein_id="ACD21722.1"
FT                   /translation="MKEENLKIAQQDIENALKTVQDMEKSLSENADSKEQIKEKFILLS
FT                   ETVQNLENILKNEGIL"
FT   gene            109950..110525
FT                   /gene="spmA"
FT                   /locus_tag="CLL_A0098"
FT   CDS_pept        109950..110525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spmA"
FT                   /locus_tag="CLL_A0098"
FT                   /product="spore maturation protein A"
FT                   /note="identified by similarity to SP:P35157; match to
FT                   protein family HMM PF07670"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0098"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24648"
FT                   /db_xref="GOA:B2THV7"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="UniProtKB/TrEMBL:B2THV7"
FT                   /protein_id="ACD24648.1"
FT                   /translation="MINYIWFAMIFFGILVGLISGNGDIISKSIVNASGSTVTFIIELT
FT                   GIMCFWCGVMKVAEKSGLTEKISKLLKPVLKLIFKDAAKDEKALGAIVMNLTANMMGLS
FT                   NAATPFGIKAMEEMDRLNGKKESASNDMVLFLVLNAACIQIVPSTIISIRAACNSVNPG
FT                   VIIIPALISTATAATVGIICAKILQKYF"
FT   gene            110541..111068
FT                   /gene="spmB"
FT                   /locus_tag="CLL_A0099"
FT   CDS_pept        110541..111068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spmB"
FT                   /locus_tag="CLL_A0099"
FT                   /product="spore maturation protein B"
FT                   /note="identified by similarity to SP:P35158; match to
FT                   protein family HMM PF07670"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0099"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24180"
FT                   /db_xref="GOA:B2THV8"
FT                   /db_xref="UniProtKB/TrEMBL:B2THV8"
FT                   /protein_id="ACD24180.1"
FT                   /translation="MLNYLSKSIIPIIFLLIISYGMIEGRKVYEWFIEGAKEGLNVCLR
FT                   IFPALLAMIIAVQIFKESNLLGVLNNLIAPIGNLIGLPKEIIPLILIKPLSGSGAIGVF
FT                   TDIIKSFGADTKIGLISSVVMGTTETIFYTITVYFGAVKVKKIRHTLWAAIFADLTAII
FT                   MAVFMVNLFLIK"
FT   gene            111172..111504
FT                   /locus_tag="CLL_A0100"
FT   CDS_pept        111172..111504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0100"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0100"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22699"
FT                   /db_xref="InterPro:IPR008769"
FT                   /db_xref="UniProtKB/TrEMBL:B2THV9"
FT                   /protein_id="ACD22699.1"
FT                   /translation="MIKEARNLFIAMVGATTMTYEKANEVVNTLVEKGKVTIEEGKELS
FT                   EELKREIKEKKDTVKFMANEKINEIKPLTKDDIYGILQEFNFISKEEFNELKDRISDIE
FT                   EKLKDK"
FT   gene            111690..113300
FT                   /locus_tag="CLL_A0101"
FT   CDS_pept        111690..113300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0101"
FT                   /product="ABC1 family protein kinase"
FT                   /note="identified by match to protein family HMM PF03109"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0101"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23039"
FT                   /db_xref="GOA:B2THW0"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:B2THW0"
FT                   /protein_id="ACD23039.1"
FT                   /translation="MAKQSSERFKKIIKVFASYGFGYIFDSKQVEYKKSPANLRNAFEE
FT                   LGPTFIKLGQILSTRPDILPKEYIDELVKLQDSAPQEDFEVMKSVLEGSLNISLEEYFE
FT                   YVNISSIASASIAQVYEGILKDGRNVVIKIQRPDIYESMHLDIAILMRIFKFTKSKNTL
FT                   PIDPIEALQEIKITADEELDFILEGKNIEKFRLNNKNVLPIYAPYVVKELLSDKVIVLE
FT                   KIDGFKINDLQRIKDEGYNNKDIAKKLALSYCKQVFKDGFFHGDPHPGNLLIDCGKICF
FT                   IDFGIVGQLNDGTKKTLNSIMLAIATKDKEKLIEYILSVSIKKGKVNRMHLYDGVSYMF
FT                   DTYLATSIKNIKISVLLQEIFYLTKESNLQLPRELVSLIRGVVILEGVIAEIDPELEII
FT                   DVVVSFIKAKNKDIIFDFLTSEELIVSLYSFGRDGIRIPSKVSELLTKMSLGEAKLQLI
FT                   VQDKNYIFQELNKMVNRMITGLLISSLIIGSSLVITKNVGPKYNGVSLIGVVGYSISTI
FT                   FALILLINMIKYWRFNIKK"
FT   misc_binding    113421..113595
FT                   /bound_moiety="lysine"
FT                   /note="Lysine riboswitch; Rfam score 128.92"
FT                   /inference="nucleotide motif:RFAM:RF00168"
FT   gene            113901..115619
FT                   /locus_tag="CLL_A0102"
FT   CDS_pept        113901..115619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0102"
FT                   /product="Na+/H+ antiporter family protein"
FT                   /note="identified by match to protein family HMM PF03553"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0102"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22272"
FT                   /db_xref="GOA:B2THW1"
FT                   /db_xref="InterPro:IPR018461"
FT                   /db_xref="UniProtKB/TrEMBL:B2THW1"
FT                   /protein_id="ACD22272.1"
FT                   /translation="MKKINRYHVFLLTFMMFFMTSTVAFAEEIDPSVMNSGKFGWFTIL
FT                   PPLVAIVLAFITKDVVISLFIGILSGSFLLNLSSGNPFYALIQAFLDFVQRALNSLADP
FT                   WNAGIVLQVMAIGGVISLVSRMGGARAIAEALAKKAKSPISAQIITWLLGIFVFFDDYA
FT                   NSLIVGPIMKPVADKMKISRERLAFIIDATAAPVAGIAIISTWIGLELGLIRDGFASIG
FT                   QEVDAFGIFLSTIPYRFYNILILVFVVVSSLMLREFGPMRKAEIRARKGVSSNKEIALD
FT                   KEMEDEIKVKEGVKLSIWNAIIPIGALIISALASFYYSGYTTIMGGENQALISIMSNSP
FT                   ASFEAIREAFSASDAAVALFQSALFASIVAIVMSVCKKIFTLSEAIENWIHGMKGLIIT
FT                   GVILILAWSLGSVIKDLGTAVFLVSKLSSTVPSFLLPSIIFILGAVISFATGTAYGTMG
FT                   ILMPLAIPLSYSISPEMGYVVMSASAVLTGAIFGDHCSPISDTTIMSSMGAGCDHIDHV
FT                   RTQLPYSLSVAGITIVFGYIPVGLGLPVWLVLPISIIAIVGLVYFVGKPIENCEE"
FT   gene            115847..117631
FT                   /locus_tag="CLL_A0103"
FT   CDS_pept        115847..117631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0103"
FT                   /product="Xaa-Pro aminopeptidase 1"
FT                   /EC_number="3.4.11.9"
FT                   /note="identified by match to protein family HMM PF00557;
FT                   match to protein family HMM PF01321"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0103"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23858"
FT                   /db_xref="GOA:B2THW2"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR032416"
FT                   /db_xref="InterPro:IPR033740"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:B2THW2"
FT                   /protein_id="ACD23858.1"
FT                   /translation="MNYMRTFEKIEKLREIMKKENIDYYVVPSGDFHQSEYVAEHFKSR
FT                   AYITGFTGSAGTALIGREKGILWTDGRYFIQAEQQLKDSGIELYKMRIPGWPTLHEWLM
FT                   ENMKSGETVSFDGRLFSANEYKEFKKIKDKKDINIVMDKDLIEEIWNDKPELPKEKAFL
FT                   HDIKYCGKSAKEKIEEVRVEMKKMGAESYIISSLDDIAWLYNIRGNDVKDTPVVLAYAV
FT                   VNEEKATLYIDKNKLSNEDQIKLNNEGIKIDEYNNIFEDVKDIKNSVILDPNKVSGYIY
FT                   TLINENVEVIEALNITTKLKAIKNSIEIENLKRCQIKDGVAMVRFLKWLKESVGKENIT
FT                   EVTVADKLLELRSKGDLFVEESFGTIAGYKDHAAMMHYSATDESAYELKPEGILLVDSG
FT                   GQYLDGTTDITRSFILGKLTDEEKKDFTLVLKSHINLMKAKFLKGTTGSNLDVLARTIL
FT                   WDEGMDYKCGTGHGVGFFLSVHEGPQSIRPVPNTVVLEPGMILTNEPGVYKEGKHGIRT
FT                   ENVMLVTNDIETDEGGEFYKFEVMSYCPIDIEGIDKSLLTEAERKWLDVYHTETYAKLS
FT                   PYLNDEEKNFLKNATREI"
FT   gene            complement(117705..117833)
FT                   /locus_tag="CLL_A0104"
FT   CDS_pept        complement(117705..117833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0104"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0104"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24632"
FT                   /db_xref="GOA:B2THW3"
FT                   /db_xref="UniProtKB/TrEMBL:B2THW3"
FT                   /protein_id="ACD24632.1"
FT                   /translation="MVNHHSGPGSYIYAIMRCIDTTIGITIAVVINKFVHPPKEKI"
FT   gene            117841..118092
FT                   /locus_tag="CLL_A0105"
FT   CDS_pept        117841..118092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0105"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0105"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22252"
FT                   /db_xref="UniProtKB/TrEMBL:B2THW4"
FT                   /protein_id="ACD22252.1"
FT                   /translation="MNTIQQIITDADLFNKVHKYIEKIIPIPVMIGVILYKSGKVMLKN
FT                   ITKSPINPPKKVPISLFLPIVKEFETVSFMQTTEAIHA"
FT   gene            118299..119702
FT                   /locus_tag="CLL_A0106"
FT   CDS_pept        118299..119702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0106"
FT                   /product="sigma54 dependent transcriptional regulator, Fis
FT                   family"
FT                   /note="identified by match to protein family HMM PF00158;
FT                   match to protein family HMM PF02954; match to protein
FT                   family HMM PF07728"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0106"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23084"
FT                   /db_xref="GOA:B2THW5"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030828"
FT                   /db_xref="UniProtKB/TrEMBL:B2THW5"
FT                   /protein_id="ACD23084.1"
FT                   /translation="MRIVREIKINSNKYLKFEAIVSIIRNFFALEEIYNVKILLDIKEK
FT                   GEIPATIILGYILLNISEVKDLTLIIDGSNDLELVYKNVEVLLASYINEDNISSNINIY
FT                   NTYGMVINNKLNNNKVIVQNKPDKAFNKFIGRSNKILDILNLATKSAKSSATVLIRGES
FT                   GTGKELIAEGIHNASERKKGPFIRVNCAAIPENLIESELFGHEKGSFTGAIRRKLGKFE
FT                   LANNGTIFLDEIGEMDKNTQAKILRVLQYKEFQRVGGEDTIKVDVRVIAATHRNLEEMV
FT                   KSGAFREDLYYRLNVIPVMIPSLKDRSEDIPLLVNHFINKFQKSGEYKQFSKDAMNIFM
FT                   SYPWKGNVRELENVIERILALNEGDVITIKEIPLYIKEEMQKENKSNIKIFTENNFIGN
FT                   SKNEVLNIIQDLDEVLPMKTYEKMIIEKALRKYGSFNAAGKILGLNHKTIAAKAKEFGI
FT                   EKTVNWKRK"
FT   gene            119829..120752
FT                   /locus_tag="CLL_A0107"
FT   CDS_pept        119829..120752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0107"
FT                   /product="alpha/beta hydrolase family protein"
FT                   /note="identified by match to protein family HMM PF00561"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0107"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24275"
FT                   /db_xref="GOA:B2THW6"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B2THW6"
FT                   /protein_id="ACD24275.1"
FT                   /translation="MGIKELNFEMKREDGVNVFVRKFLKENASLKGAVIVCHGLGEHAG
FT                   RYKQFNEVLAENGFTVYAHDQRGHGKTAVRDDVVHLESGGFSKTVDDMEALYKIVKAEN
FT                   ENLPIFIFAHSMGTVITRKFIQKYSNNELKGVILCGPVYFLDRVKELCDESKKSMIKNG
FT                   SDHVNMNLIGLAFGNFNERFEPKRTDFDWLTRDNKEVDKYINDPLCGKPQTVGYYYEFA
FT                   SKFNVYDDEEINKIRKDLSVIFITGGDDPTSDYGEGIKVASEKYKKAGINDINLKIYPK
FT                   ARHELLNEFNKEEVINDVINWINNRI"
FT   gene            121218..121922
FT                   /gene="glpF"
FT                   /locus_tag="CLL_A0108"
FT   CDS_pept        121218..121922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpF"
FT                   /locus_tag="CLL_A0108"
FT                   /product="glycerol uptake facilitator protein"
FT                   /note="identified by similarity to SP:P18156; match to
FT                   protein family HMM PF00230"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0108"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23585"
FT                   /db_xref="GOA:B2THW7"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR022357"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="UniProtKB/TrEMBL:B2THW7"
FT                   /protein_id="ACD23585.1"
FT                   /translation="MSIFMAELIGSMLLILLGDGVVANVVLKDSKGTGAGWIVITTGWA
FT                   LAVAIPALMFGGYSGAHFNPALTVALAAIGTIPWSVVPQYFAGEFLGAFLGAILVFIMY
FT                   YDQFKATDDKDGKLAVFCTAPVIRNTGINFMGELIGTFMLVFGILGLGAVQMAPGLNTL
FT                   CVGGLIFVIGLSLGGPTGYAINPCRDLSPRIAHAILPIPDKRDADWGYAWIPVVAPIVG
FT                   GLIGAFLWQAIV"
FT   gene            122016..123014
FT                   /gene="dhaK"
FT                   /locus_tag="CLL_A0109"
FT   CDS_pept        122016..123014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dhaK"
FT                   /locus_tag="CLL_A0109"
FT                   /product="dihydroxyacetone kinase, DhaK subunit"
FT                   /EC_number="2.7.1.-"
FT                   /note="identified by match to protein family HMM PF02733;
FT                   match to protein family HMM TIGR02363"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0109"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24321"
FT                   /db_xref="GOA:B2THW8"
FT                   /db_xref="InterPro:IPR004006"
FT                   /db_xref="InterPro:IPR012736"
FT                   /db_xref="UniProtKB/TrEMBL:B2THW8"
FT                   /protein_id="ACD24321.1"
FT                   /translation="MKKLINNPDNVLSDMLEGIVAAHPEYLKKLDNANVLVRSEKAENK
FT                   VAIVSGGGSGHEPAHGGYVGFGMLDGAVCGEVFTSPTPDQVYEAIKATDNGKGVLLVIK
FT                   NYTGDVMNFEMAKEMAEMEGIKVEQVVVNDDVAVENSLYTAGRRGIAGTVFVHKLSGAK
FT                   AEAGGNLEEVKGVAEKVIENVRSMGMSLSSCIVPAAGKANFTLGEDEIEIGMGIHGEPG
FT                   THREKISNADQVAEHLLSKILDDIEISSGDEVAVMINGLGSTPYMELYIVNKKINQLLK
FT                   DKGISIHKTFVGEFMTSLEMAGCSVSVLKLDSELKELLDAKANTPGFKVVK"
FT   gene            123105..123743
FT                   /gene="dhaL"
FT                   /locus_tag="CLL_A0110"
FT   CDS_pept        123105..123743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dhaL"
FT                   /locus_tag="CLL_A0110"
FT                   /product="dihydroxyacetone kinase, L subunit"
FT                   /EC_number="2.7.1.-"
FT                   /note="identified by similarity to SP:P76014; match to
FT                   protein family HMM PF02734; match to protein family HMM
FT                   TIGR02365"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0110"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22131"
FT                   /db_xref="GOA:B2THW9"
FT                   /db_xref="InterPro:IPR004007"
FT                   /db_xref="InterPro:IPR012737"
FT                   /db_xref="InterPro:IPR036117"
FT                   /db_xref="UniProtKB/TrEMBL:B2THW9"
FT                   /protein_id="ACD22131.1"
FT                   /translation="MVTVKQVKDILIKVEKVIEENKLYLSELDAAIGDGDHGLNMNKGF
FT                   KAVIEKIKDLPEDDLGNILKNSGMALVSNVGGASGPLYGTAFMKAAMVVNKKSEMDIND
FT                   FVKVLEEALGGIKMRGKGQEGEKTMIDTLSPAIEAGNKSIEENKSVKEVLLEIKEAAKN
FT                   GMEHTKDIVATKGRASYVGERSIGHIDAGATSMYLILNTIVEELTKEGN"
FT   gene            123746..124135
FT                   /locus_tag="CLL_A0111"
FT   CDS_pept        123746..124135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0111"
FT                   /product="dihydroxyacetone kinase, phosphotransfer subunit"
FT                   /note="identified by match to protein family HMM PF03610;
FT                   match to protein family HMM TIGR02364"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0111"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22873"
FT                   /db_xref="GOA:B2THX0"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR012844"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="InterPro:IPR039643"
FT                   /db_xref="UniProtKB/TrEMBL:B2THX0"
FT                   /protein_id="ACD22873.1"
FT                   /translation="MVGIVIVSHSNFIAKGVREVALEMAPEVLIVDAGGTSDGRIGTDI
FT                   SKITSAIESVYSDSGVLVLFDLGSAFMNTEMAIEFLDDNIRGKVEIIDAPLVEGAITAA
FT                   VEASMDKSLAEIKEVLKPMSLNKIY"
FT   misc_feature    124250..124513
FT                   /note="T-box leader"
FT   gene            124646..126583
FT                   /gene="metG"
FT                   /locus_tag="CLL_A0112"
FT   CDS_pept        124646..126583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metG"
FT                   /locus_tag="CLL_A0112"
FT                   /product="methionine--tRNA ligase"
FT                   /EC_number="6.1.1.10"
FT                   /note="identified by match to protein family HMM PF01588;
FT                   match to protein family HMM PF09334; match to protein
FT                   family HMM TIGR00398; match to protein family HMM
FT                   TIGR00399"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0112"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24054"
FT                   /db_xref="GOA:B2THX1"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004495"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023457"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="InterPro:IPR041872"
FT                   /db_xref="UniProtKB/TrEMBL:B2THX1"
FT                   /protein_id="ACD24054.1"
FT                   /translation="MCKDCKKPYYITTPIYYPSTKLHIGNTYTTVAADALARFKRLTGY
FT                   EVMFLTGTDEHGQKIQRIAEEKGITPIEHVDEIVAGIKDLWSMMNVSYDKFIRTTDDYH
FT                   VKAVQDIFKKLHDQGDIYKSSYEGWYCTPCESFWTDTQLVNGNCPDCGRPVEKSKEEAY
FT                   FFKMSKYADRLIKYIEENPNFIQPESRKNEMLNNFLRPGLQDLCVSRTSFDWGVPVTFD
FT                   ESHVVYVWIDALSNYITALGYGQDNKELYDKFWPADVHLIGKDILRFHTIYWPIMLMAL
FT                   DLPLPKQVFGHGWLLVDGGKMSKSKGNVVDPVVLVNEFGVDPVRYYLLREIPFGADGLF
FT                   NNEIFIKKINSDLCNDLGNLLSRSVAMIEKYFDGEIQPQAESGEFDEELINLALAAPNK
FT                   VQEAIDELNIPLALEHVFELIGRANKYIDETTPWILAKDESKKARLGTVLYNLIESLRF
FT                   ASVMISSFLPDTAKKINEQINTDEISWESLKSFNGIKAGNKVAKGENLFPRIDVEKKLE
FT                   ELEALKAAQAPVKREITPIKEEITIDDFEKVDLRVVKVLACEPIKGAKKLLKLKVDLGS
FT                   EERQVVSGIAKYYKPEELIGKNVVLVANLKPVKLRGELSQGMILCAAPDDDSELKVVDP
FT                   GEILSGSIVR"
FT   gene            126780..127577
FT                   /locus_tag="CLL_A0113"
FT   CDS_pept        126780..127577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0113"
FT                   /product="hydrolase, TatD family"
FT                   /note="identified by match to protein family HMM PF01026;
FT                   match to protein family HMM TIGR00010"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0113"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23053"
FT                   /db_xref="GOA:B2THX2"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR015991"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B2THX2"
FT                   /protein_id="ACD23053.1"
FT                   /translation="MKGYAVMEKTFKIIDSHAHYDDESFENDRKEVLQEIKKNGVIGVL
FT                   NCAASYNSLKTTYELTKEYDFIYGALGIHPENANEFTDNTLDEIKGYIKSNEKIVAIGE
FT                   IGLDYYWDENPSKEIQKEVFRKHMELAKELKLPVIIHDRDAHQDTLQIIKEFPDVTGVV
FT                   HCFSGSVEFAKDCIKLGYYIGFTGVVTFKNAKKVVEVAKEIPLDRMLVETDCPYMAPEP
FT                   NRGKRNKSDYIEYIIEKLAHIREIDSYELNMIFNENFYSLIKK"
FT   gene            127860..128906
FT                   /locus_tag="CLL_A0114"
FT   CDS_pept        127860..128906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0114"
FT                   /product="3D/G5 domain protein"
FT                   /note="identified by match to protein family HMM PF03990;
FT                   match to protein family HMM PF06725; match to protein
FT                   family HMM PF07501"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0114"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24230"
FT                   /db_xref="GOA:B2THX3"
FT                   /db_xref="InterPro:IPR007137"
FT                   /db_xref="InterPro:IPR010611"
FT                   /db_xref="InterPro:IPR011098"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:B2THX3"
FT                   /protein_id="ACD24230.1"
FT                   /translation="MIEKLKDYFKKSFSNGPKAKIIITTIAMAIVITATLMSVRKTLTI
FT                   SIDGKEENFVTYKWTVKDVLQDNGIELAEKDKIEPSLDSRVSEKELITIKKAIPVNIAF
FT                   SDKVVTLETAENTIGDMLQTESDVLKEQGVEFEEGTDEVLPSLDAEIEQNLDVKIVKVE
FT                   TKDIVEKEKINFDTLVQKDSSLDSSVQQVKSEGTNGEKQITYKVIYKDGQEVSKEVKST
FT                   KVIAEPVNKIVVKGTGNVYASRGSGNITYKKKLSVVATAYSGHSTTATGRRPVRNANGL
FT                   STIAVDPSVIPLGSKVYVEGYGYAIAADTGGAIKGNIIDLYLDSSNECINWGRRPVNLF
FT                   VVAYPGEW"
FT   gene            129024..129581
FT                   /locus_tag="CLL_A0115"
FT   CDS_pept        129024..129581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0115"
FT                   /product="primase homolog"
FT                   /note="identified by match to protein family HMM PF01751;
FT                   match to protein family HMM TIGR00334"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0115"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24987"
FT                   /db_xref="GOA:B2THX4"
FT                   /db_xref="InterPro:IPR004466"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR025156"
FT                   /db_xref="InterPro:IPR034141"
FT                   /db_xref="UniProtKB/TrEMBL:B2THX4"
FT                   /protein_id="ACD24987.1"
FT                   /translation="MIKEVIVVEGRDDVDAVKKALDAEIIAVGGFGINAKVIDRIKEAQ
FT                   KRKGVIVLTDPDFAGEKIRRIISKRVEGIKHAYISKEDGLKDGDIGVENACPEVILNAL
FT                   ETAKITLEEKRNFFTMQDMFYFKLTNDSTSKVRRSMLGKILGIGYCNTTQMVSRLNNYG
FT                   ITKEEFTDAIEKIEKQLEVGIK"
FT   gene            129582..130433
FT                   /gene="ksgA"
FT                   /locus_tag="CLL_A0116"
FT   CDS_pept        129582..130433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ksgA"
FT                   /locus_tag="CLL_A0116"
FT                   /product="dimethyladenosine transferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="identified by match to protein family HMM PF00398;
FT                   match to protein family HMM TIGR00755"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22910"
FT                   /db_xref="GOA:B2THX5"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B2THX5"
FT                   /protein_id="ACD22910.1"
FT                   /translation="MDLMDIKTKELVKKYNFRFSKSLGQNFLLDESVLNDIVDGAEVNE
FT                   NDFIIEIGPGVGTLTAKLLQKAKMVTCIELDNDLIPILQQELGEYDKFELIHNDALKVD
FT                   FNEIMKNEEHVKLVANLPYYVTTPIIVKLLKENHKFESLTIMIQKEVAERINAEPNCKE
FT                   YGALSVLVQYYCNTKIVRKVSPESFMPRPKVDSIVIRLDRLSNPRVKVQDEKLLFDIVR
FT                   AGFNMRRKTLWNATKVVGLSKEDLQKAFDSCNIDPKRRAETLSIEEFAALADSIHNIRK
FT                   NN"
FT   gene            130701..132131
FT                   /locus_tag="CLL_A0117"
FT   CDS_pept        130701..132131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0117"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0117"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23436"
FT                   /db_xref="UniProtKB/TrEMBL:B2THX6"
FT                   /protein_id="ACD23436.1"
FT                   /translation="MVVAHNKLYRNFIILQQDEKINLESTEKALSGYAKVEAKGDKCKI
FT                   SFYAQNLKQEEDYSVVLICCKKDMKQLIDLGSLKINDVGKGDTSKEYYINNIAGLGISY
FT                   EKINGAAICKANSGEVIFMMYGFINGEEPKENWKKLKVAKEDNTNDTESKSSTKTELTE
FT                   KKMQEKSDDNAKKENIKKENVSKSDNLNIDMDLDCEKESNRNKDKKCKDKCEDKCEDKC
FT                   EDKCKDTCDDKCEKKCEDKCEKKCKDKCEVEVEKEEHKKEYKKEKKSEEEKTKKDKCDF
FT                   SGSEKCKKIIDELNDESYCTKTVNHKRIEENTRIDGADFEQYEKDIEKLKMESSKNLNI
FT                   KGKIGEYFEKIAQGFEEYHDGIDGVKNCKWYNVPINRIDDLFNISDYNKYTLVYYPMLN
FT                   YYPYISKTKHFLLGYKCDSAGELTHIVYAIPGSKDLSEQPYEGKTGYVTWTHNDTRSSG
FT                   YWLMFYDFQNSTVVVPMK"
FT   gene            132142..132711
FT                   /locus_tag="CLL_A0118"
FT   CDS_pept        132142..132711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0118"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:ABG86907.1"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0118"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24509"
FT                   /db_xref="UniProtKB/TrEMBL:B2THX7"
FT                   /protein_id="ACD24509.1"
FT                   /translation="MNRKQVLILSILLSLMVVLGITQSFFKETFTEVALVENGINEFKD
FT                   YNFDEGRYIFSLPSEWNVSEKESQGQYISYKADFKDKDNKITGYLEVINTQIDLGNFAE
FT                   SDLKNLPLSYKNEQIMPFKLEETSGVLSQYKTKVKRGYTFENSCYYLSSDDGKVIKVLF
FT                   NVKEDDYKENVKTVFNTIISKINIRS"
FT   gene            132809..133567
FT                   /gene="lgt"
FT                   /locus_tag="CLL_A0119"
FT   CDS_pept        132809..133567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lgt"
FT                   /locus_tag="CLL_A0119"
FT                   /product="prolipoprotein diacylglyceryl transferase"
FT                   /EC_number="2.4.99.-"
FT                   /note="identified by match to protein family HMM PF01790;
FT                   match to protein family HMM TIGR00544"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0119"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22431"
FT                   /db_xref="GOA:B2THX8"
FT                   /db_xref="InterPro:IPR001640"
FT                   /db_xref="UniProtKB/TrEMBL:B2THX8"
FT                   /protein_id="ACD22431.1"
FT                   /translation="MRIILFKAFGLEIKSYGLMIAIGILVAASLLLKKGKEKGYEEDSL
FT                   LNLIILTVIGGVVGGKLLFIITEFKSILEDPSILLNFGYGFVVYGALILGALTIYLYCK
FT                   KKKWKVLEILDLVAPVLAIAQGFGRIGCFLAGCCYGKETNIPIGVEFPINSLAPAGIHV
FT                   HPTQIYSSIFDFLLGFFLLYYSKKEKKSGKIVSMYLIIYSIGRFMVEFFRNDPRGNVGL
FT                   LSTSQFIAVFTLILGLVIFNFHNFFKGAKK"
FT   gene            133617..134402
FT                   /locus_tag="CLL_A0120"
FT   CDS_pept        133617..134402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0120"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0120"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23396"
FT                   /db_xref="UniProtKB/TrEMBL:B2THX9"
FT                   /protein_id="ACD23396.1"
FT                   /translation="MFILVGCSAYDKMAVTLGIKNNNFEYIKQSKVDKIVIQSARDTGF
FT                   MFIITEPNAINDMYKLLSNGNKVSEHSSLDPDYYFEIHMGDDIKKYNYIVGADERGKGN
FT                   FFNDEESFSISNRLDDTIIQNLSFIRKPRNFQYVYYQTILSALEAEKLNLDESNKVGID
FT                   ISGDIDCLKYILSTDLQQFEKNITKVIPNAEIIKNNSSEFDTIIKVKNRGYNSTIFKTM
FT                   ITIDNKKDKVFNTYYISAEYNFRNWDIDMGEVNKMPNEW"
FT   gene            134417..135259
FT                   /locus_tag="CLL_A0121"
FT   CDS_pept        134417..135259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0121"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to SP:P53381"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0121"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23991"
FT                   /db_xref="GOA:B2THY0"
FT                   /db_xref="InterPro:IPR000808"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="UniProtKB/TrEMBL:B2THY0"
FT                   /protein_id="ACD23991.1"
FT                   /translation="MGSCDNCPSKDSCGSKGQGCENSIPKMIPTYGKIKNVIGIISGKG
FT                   GVGKSTVTGIMATTLAKKGYKVGVLDADITGPSMPRFFGINEKRGKIIPLENDMVKFEP
FT                   VITDSGIKVISMNLLTAVEEDPVIWRGPVITGVLKQMFMETNWEELDYLLIDMPPGTGD
FT                   IALTVMQEFPITEVIIVSTPQDMVSMIVKKLVIMAQKIGIKIRGVVENMAYIKCPDCDK
FT                   KIRVFSTKSSDEHAEYLGLPLIGELPINVELTEALEKGKAEAYVIDNDLYSLIFEALY"
FT   gene            135326..135514
FT                   /locus_tag="CLL_A0122"
FT   CDS_pept        135326..135514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0122"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0122"
FT                   /db_xref="EnsemblGenomes-Tr:ACD21964"
FT                   /db_xref="GOA:B2THY1"
FT                   /db_xref="InterPro:IPR001080"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:B2THY1"
FT                   /protein_id="ACD21964.1"
FT                   /translation="MKANVDKDTCIGCGLCPSICPECFDMQDDGKAGVIVPEVPSSCQD
FT                   SAKEAETSCPVNAISVE"
FT   gene            complement(135666..136343)
FT                   /locus_tag="CLL_A0123"
FT   CDS_pept        complement(135666..136343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0123"
FT                   /product="probable proton-coupled thiamine transporter
FT                   YuaJ"
FT                   /note="identified by match to protein family HMM PF09515;
FT                   match to protein family HMM TIGR02357"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0123"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22366"
FT                   /db_xref="GOA:B2THY2"
FT                   /db_xref="InterPro:IPR012651"
FT                   /db_xref="UniProtKB/TrEMBL:B2THY2"
FT                   /protein_id="ACD22366.1"
FT                   /translation="MSIFNDWAEQISKLYTHLPENVQTIISNPLSIITLLGCIAILVVL
FT                   VKAKKIKFTPQLIARIGIALALATILKILRIYHFPQGGSITFGSMVPILLIAFMYGPQV
FT                   GFLTGFLYGMITLLMDPYILHPVQVLFDYPLPFLCLGIAGFFPNKKYLGVILAVLGRFI
FT                   CHFISGIAFFGSFAPEGMSPALYSLSINAPIIGLEGLICLVIIAALPMTRLISVVSNNR
FT                   VTT"
FT   misc_binding    complement(136470..136573)
FT                   /bound_moiety="thiamine/thiamin pyrophosphate"
FT                   /note="TPP riboswitch (THI element); Rfam score 70.01"
FT                   /inference="nucleotide motif:RFAM:RF00059"
FT   gene            complement(136598..136804)
FT                   /locus_tag="CLL_A0124"
FT   CDS_pept        complement(136598..136804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0124"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0124"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24887"
FT                   /db_xref="UniProtKB/TrEMBL:B2THY3"
FT                   /protein_id="ACD24887.1"
FT                   /translation="MKGFIIDSTYKEDIIIDKNNINSTVPCNNISNNSSNGSKINLNDV
FT                   SSNYITHYNKDNKYNPYNVVDYL"
FT   gene            complement(137020..137472)
FT                   /locus_tag="CLL_A0125"
FT   CDS_pept        complement(137020..137472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0125"
FT                   /product="transcriptional regulator, PadR family"
FT                   /note="identified by match to protein family HMM PF03551"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0125"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23883"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2THY4"
FT                   /protein_id="ACD23883.1"
FT                   /translation="MSDFNFSDINDIKNEEKRLYEEYKSKVSELKKVKKEKEAVGQVFT
FT                   KGLLPIYVLYILSLNPTNGNEISNQIGIRTNSRWIPSTGGIYPILKKLEKETLIVGIWD
FT                   DPDKKFQKIYHLTPKGKIEYEHKKKLLKPKIEDSLEVFKIIYNDLY"
FT   gene            complement(137474..138322)
FT                   /locus_tag="CLL_A0126"
FT   CDS_pept        complement(137474..138322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0126"
FT                   /product="DegV family protein"
FT                   /note="identified by match to protein family HMM PF02645;
FT                   match to protein family HMM TIGR00762"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0126"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22775"
FT                   /db_xref="GOA:B2THY5"
FT                   /db_xref="InterPro:IPR003797"
FT                   /db_xref="UniProtKB/TrEMBL:B2THY5"
FT                   /protein_id="ACD22775.1"
FT                   /translation="MDKIALLTDSASDICTEDLKKYNIKLLPFKIIFSDKEYDDKLEIT
FT                   SDVLYELLPREIPKTSLPSIERLNNTLNQLIEEGYTHAIIVTLSSEFSGTYNSMRLACE
FT                   SFEGIETFVYDSKSLSMAEGVVVLETAKLIEEGKSFDEIVKIIPELRSKIDIFFTIDTL
FT                   EYLKKGGRIGRVAGTIGDVLNLKPVITIDNNGCFHTYCKARGKKQSASKLLKIAKSYTE
FT                   NNKCKFWVMDGNALDDAKSLCENIKSFDNVVECKLGYSIGPALGVHTGPGLFGFIVEKV
FT                   D"
FT   gene            138621..140726
FT                   /gene="nrdD"
FT                   /locus_tag="CLL_A0127"
FT   CDS_pept        138621..140726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdD"
FT                   /locus_tag="CLL_A0127"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase"
FT                   /EC_number="1.17.4.2"
FT                   /note="identified by match to protein family HMM PF03477;
FT                   match to protein family HMM TIGR02487"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0127"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24894"
FT                   /db_xref="GOA:B2THY6"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="InterPro:IPR012833"
FT                   /db_xref="UniProtKB/TrEMBL:B2THY6"
FT                   /protein_id="ACD24894.1"
FT                   /translation="MLYVVKRDGRTVEFNGEKISQAIKGAALEIGVTLRESQVLETIQK
FT                   VIMYIEDTKKEKITVEAIQNLVEKALREEDKNIAFAYSSYRRERTRVRDIKSDLMKAIE
FT                   KIGVETDRDNANVGNNFSSKLLRIASESNKWHNLSTMPKHLSKAHETGDLYYHDLDSYN
FT                   LTTNCLHIPTKEILMNGFNTGYGTINAPKRIETAAELSCILLQSTQNDMFGGQSHPDFD
FT                   NDLGVFIPPTRDEIKKELKELDIPKEKMNTIMEKTLRRRVHQAMQGVIYNLNTMHSRAG
FT                   SQVPFSSVNIGIPTNDDAALVCEVFLLEYERGLGKGEQPIFPNIIFRVKEGVNREENDP
FT                   YYYLYKLACRVAAKRMNPTFMNIDADFNKEYYDKGYVPATMGCRTYLMKNVNGEPGCKG
FT                   RGNIAPTTINLPRIGLQAKGDVDKFFKILDARLSLSKESLLHRYDVLKNLRVKDLPFIA
FT                   GQHLMVGSENLNPEDSIEPILKQGTWGIGFIGLAEALTALIGKHHGETEEARELGLKII
FT                   GHIRDYCDRLTEEYSLNWSCYATPAEGLSGKFIKQDQKTFGIIKDITDKEYYTNSYHVP
FT                   VGYSISIKDKIDIEAPYHKICNGGHITYIEVDDFPTEDVIMDIINYSYKNTNISYMGVN
FT                   FHIRYCKDCGTYLHSNESKCPTCCSTDIQGISRVTGYLSLDERFGPGKYQERADRISHL
FT                   ESHKKHY"
FT   gene            141154..142308
FT                   /gene="nifV"
FT                   /locus_tag="CLL_A0128"
FT   CDS_pept        141154..142308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nifV"
FT                   /locus_tag="CLL_A0128"
FT                   /product="homocitrate synthase"
FT                   /EC_number="2.3.3.14"
FT                   /note="identified by match to protein family HMM PF00682;
FT                   match to protein family HMM TIGR02660"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0128"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24523"
FT                   /db_xref="GOA:B2THY7"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR013477"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B2THY7"
FT                   /protein_id="ACD24523.1"
FT                   /translation="MSVKNINTDKEINIVDTTLRDGEQTAGVVFANAEKIAIAEMLSEL
FT                   GVDQLEVGIPTMGGDEKAAIKEIVKRNLKPSIMAWNRAVIGDIEQSIDCGVDAVAVSIS
FT                   VSDIHIQHKLRTSREWVLDNMVKSVEFAKKNGLYVSVNGEDASRADQDFLIEFIQAAKQ
FT                   AGADRFRYCDTVGIMEPFKIQKRIKELYETTKFNIEMHTHNDFGMATANAIAGIEGGAT
FT                   HVGVTVNGLGERAGNAALEEVIMALMIVYGYKGDIDTTMLKDLSQYVSRASGRELPKWK
FT                   AIVGSNMFAHESGIHADGALKDPTNYEAFDPAIVGLERQIVIGKHSGRAAVENKFREYA
FT                   IELTKDEATGILELVRSTSVRLKRCLFDKEVVQLYKEYKRINKL"
FT   gene            142371..144293
FT                   /locus_tag="CLL_A0129"
FT   CDS_pept        142371..144293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0129"
FT                   /product="aconitate hydratase"
FT                   /EC_number="4.2.1.3"
FT                   /note="identified by match to protein family HMM PF00330;
FT                   match to protein family HMM PF00694; match to protein
FT                   family HMM TIGR01342"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0129"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23788"
FT                   /db_xref="GOA:B2THY8"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR006250"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:B2THY8"
FT                   /protein_id="ACD23788.1"
FT                   /translation="MGDNLVYKILKNHIVEGNLKTGEPISIKIDKTLTQDSTGTMAYLQ
FT                   LEAMGIDRVKTKKSVAFIDHNMLQQGFENADDHKFIQTVASKYGVYFSKPGNGICHQIF
FT                   LERFATPGDTLTGSDSHTPTAGGVGMLAMGAGGLDVALAMGGGAYNINTPKVVKVELKG
FT                   KLNKMVAAKDVILEVLRICTVKGGVGKVFEYCGEGIKSLSVPERGTITNMGAELGATTS
FT                   IFPSDERTLEFFKAQDREEDWIELKADEDAIYDEEIVINLSDLKPLTAKPHSPDNVVTV
FT                   EDAGRIKVDQVFIGSCTNSSYEDLMKVSKILKGNKVHENVSLVIGPGSRQVMEMIARNG
FT                   ALADIISSGARILENSCGPCIGMGQAPGTNGISLRTVNRNFYGRSGTLSGQIYIVSPET
FT                   AAVSAIKGCLTDPREMDIDIKVDMPEKFIIDDSMILEPAKTNEEVEVVRGPNIKPFPIN
FT                   KALGDKIDGKVLIKVEDNITTDHIMPSNSKLLPFRSNIPYLSEFCFNTVDTEFPKRAKE
FT                   FNGGFIIAGENYGQGSSREHAALAPLYLGVKAVIAKSFARIHKANLINNGIVPIEFKDS
FT                   SDYKKINLVDDLLIENISNNLNTGVLKIKNLTKNSEFEVLVKLTSKEIDVIKAGGRLNY
FT                   VKLNS"
FT   gene            144516..146771
FT                   /locus_tag="CLL_A0130"
FT   CDS_pept        144516..146771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0130"
FT                   /product="putative signaling protein"
FT                   /note="identified by match to protein family HMM PF00563;
FT                   match to protein family HMM PF00990"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0130"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22473"
FT                   /db_xref="GOA:B2THY9"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:B2THY9"
FT                   /protein_id="ACD22473.1"
FT                   /translation="MNNKFKSNIFAYIIPITVIVMLIAIGFSVCIIEVKEVISKGNKSV
FT                   IVKASENNSMFMNYKLNDNIQYMKHISSIFNGLNDFKKEDVMEFLNLEEKKDFLTTGII
FT                   TSDGILSCTDGSINDIKNKDYFKKWEKTNEDIITIDTDLKNGERVFIYITSLFHHDKIQ
FT                   GALYGTLSFKDIEKLFISNSKFYQQVETYILDREGNILIGSGDLFNILKDNNIFSYHDL
FT                   DDIEMLKDDLTNSRDGAVFITLDKSKYILSYSKISDLKDYYVLSLIDASNINEKQYHIT
FT                   SLMTILASFVILIFLVLLIYVNSYRNRKEKLIKDIAFVDNITGGKTLTKFKMDIKEVLV
FT                   ENMNSSYALVEFDIVRFKIINDIWGYKTGNFLLKHISDILENKLLYKEMFCRVRDDLFI
FT                   LLLKYKDKSDIIDRINALDNSMRFFDNGTKEVPNFSLSYGVYVIDGTEEDINKMIDNVA
FT                   FTRETSKSDCNEFIGFYDIRLQSKLIKQKQIEDVMYSALTNRQFELYLQPKYDIKLESC
FT                   IGAEALVRWNNPEKGLINPIDFIPLFEKNGFIVNLDMFIFDEVCSKINKWKENNIKLIP
FT                   ISVNISRINLKNVDYFIKNISEIFNKYDINPNLIEIEITESAIFNHYDNMLEALLRLKA
FT                   MGFSISLDDFGTGLSSLNILKDLPIDTIKLDREFLNSKDSSKKGEIVITNIVRMVKELD
FT                   LNVICEGVETYEQAEFLSEVGCNNAQGYLYARPMPVKDFEEKELTLGLMKDVVLIKP"
FT   gene            147033..147542
FT                   /gene="nrdG"
FT                   /locus_tag="CLL_A0131"
FT   CDS_pept        147033..147542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdG"
FT                   /locus_tag="CLL_A0131"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase
FT                   activating protein"
FT                   /EC_number="1.97.1.4"
FT                   /note="identified by match to protein family HMM TIGR02491"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0131"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24517"
FT                   /db_xref="GOA:B2THZ0"
FT                   /db_xref="InterPro:IPR001989"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012837"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="UniProtKB/TrEMBL:B2THZ0"
FT                   /protein_id="ACD24517.1"
FT                   /translation="MDKKIRLAGIAYESLVNGPGIRRVFFSQGCNHNCKGCFNPDTHDF
FT                   NGGEEKEIDELIEDVLCNPMIKGITFSGGDPFERADEFSYMAKIFKENNKNIWCYTGYK
FT                   FEYINDNLEINKGWKDLINNIDVLVDGKFEEDKKEDGLKFKGSSNQRIIDVKKSLKSNK
FT                   VVIFDI"
FT   gene            147619..148227
FT                   /locus_tag="CLL_A0132"
FT   CDS_pept        147619..148227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0132"
FT                   /product="DNA-3-methyladenine glycosylase"
FT                   /EC_number="3.2.2.-"
FT                   /note="identified by match to protein family HMM PF02245;
FT                   match to protein family HMM TIGR00567"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0132"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24014"
FT                   /db_xref="GOA:B2THZ1"
FT                   /db_xref="InterPro:IPR003180"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036995"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2THZ1"
FT                   /protein_id="ACD24014.1"
FT                   /translation="MILNREFYKRDALEVAKGLLGKILVREIDGVILRGKIVETEAYIG
FT                   SIDKASHAYNGRRTERTEPLFKEGGIAYVYFIYGLYHCFNVISGESDDGQGALIRALEP
FT                   LDNFDYISLKRFNKKFEELSTVKKRELTNGPSKLCMAFGIDKKDNYKVLYEKGDLYIED
FT                   SCDNHEIIETTRIGIDYAEEAIDFPWRFYIKDNKYVSKK"
FT   gene            148355..148471
FT                   /locus_tag="CLL_A0133"
FT   CDS_pept        148355..148471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0133"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0133"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22080"
FT                   /db_xref="UniProtKB/TrEMBL:B2THZ2"
FT                   /protein_id="ACD22080.1"
FT                   /translation="MIIMILWIHLYYGQAKKFYTFIDEKIKFFLNLKKSIKY"
FT   gene            148608..149612
FT                   /locus_tag="CLL_A0134"
FT   CDS_pept        148608..149612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0134"
FT                   /product="transcriptional regulator, lacI family"
FT                   /note="identified by match to protein family HMM PF00356;
FT                   match to protein family HMM PF00532"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0134"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22142"
FT                   /db_xref="GOA:B2THZ3"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B2THZ3"
FT                   /protein_id="ACD22142.1"
FT                   /translation="MASTIKDVASLSKVSVATVSRVLNDLGGYSEETKSRVLKVVDEIG
FT                   YKRNAIARSLSTNTTRTIGVILPDVSTSFDGEIIRGIEDVAHDNNYSVILCNAGSKGVR
FT                   TLEYLRILEERQLDAVIIVSIKIEDEYHKALKKINIPYILISTTSPKYDMPHIKVDDLS
FT                   AAYTATKYLLDRGHRKIAMISGNQDDTIAGLPRVQGYIKALSDYGINVDESLITYGDFS
FT                   YKSGIECMNILLERKKEFTSIFVASDDMAVGVLNVAYRKKIRVPDDLSIVGYDNTKVAI
FT                   MSIPPLTTLSQPLYEMGCKAFNEILSMLNGNDSKKQIIMKHNIAERETVKWLK"
FT   gene            149692..151353
FT                   /locus_tag="CLL_A0135"
FT   CDS_pept        149692..151353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0135"
FT                   /product="oligo-1,6-glucosidase"
FT                   /EC_number="3.2.1.10"
FT                   /note="identified by match to protein family HMM PF00128"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0135"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24877"
FT                   /db_xref="GOA:B2THZ4"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR032091"
FT                   /db_xref="UniProtKB/TrEMBL:B2THZ4"
FT                   /protein_id="ACD24877.1"
FT                   /translation="MKTNWWKESVVYQIYPRSFKDSNGDGIGDIRGIIEKLDYLRELGI
FT                   DVIWLSPVYKSPNDDNGYDISDYKDIMTEFGTMNDFDELLKSAHEKGIKIMMDLVVNHT
FT                   SDEHKWFVESRKSENNKYRDYYVWKKGKDGQPPNNWTSCFSGSAWQYDEETDMYYLHLF
FT                   SKKQPDLNWENPELRSDVYSMMQWWLGKGIDGFRMDVINFISKNQEFPDGVNGDFSKYS
FT                   MNGPRIHEFLEEINEKVLRGKNLITVGEMPGVSVEEAKLYTGEDRNELNMVFQFEHTDL
FT                   GNGKYGKWHKNSFKLTDLKKIMTKWQKGLENEGWNSLYWNNHDQPRVVSRFGNDKKYWK
FT                   ESAKMLATCLHMMKGTPYIYQGEEIGMTNVTFRDLNDYKDIEIINAYNDLVIKNGRSHD
FT                   EMMEGIHDRGRDNARTPMQWNSSVNAGFTTGTPWIKVNPNYNEINAESQINDKDSIFNY
FT                   YKELIKIRKDNEIIVYGNYDLILEDSEEIYAYVRTLNEEQLLVICNFSSNTSEFKLPNN
FT                   INSKYKKLLIANYDECKEETLENISLRPYECRAYLI"
FT   gene            151481..152725
FT                   /locus_tag="CLL_A0136"
FT   CDS_pept        151481..152725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0136"
FT                   /product="sugar ABC transporter substrate-binding protein"
FT                   /note="identified by match to protein family HMM PF01547"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0136"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24133"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:B2THZ5"
FT                   /protein_id="ACD24133.1"
FT                   /translation="MKITKILISCLTICIFSTSLLTGCKSNNVKNKDGKQQVEVFLSKA
FT                   EAINTFKNFEEKFEEQNPDIDVVISSPAQPMTVLKTRLVKNDVPDILTIAGEMNYGDFV
FT                   DAGILEDLSNEKDIIDRIQPAYVNVLKSLEFESNDTLCGIPYACNAGGVVYNKDIFEKL
FT                   KLKVPTTWDEFIDTAEKIKEAEITPFYFTLKDAWTAMPAWNAITANTQSEDFFIERRKN
FT                   EVTFRDEYKPIAEKMETLMDYGHNDNFGIGYNDGNVSFAQGNAAMMIQGNWVIPEILKI
FT                   NPNINLGMFVLPTNNDASKNSIVSGIDLLFAVPKESKNKEAAIKFLDFMTKSENVEQYA
FT                   KEQFAIPAIKDMYQKDKTVEDLNPYFKNGMVLDFPDHHYPASMQVGDLAQAYLFDKDID
FT                   KLLNSLDDRWNRSQQ"
FT   gene            152750..153613
FT                   /locus_tag="CLL_A0137"
FT   CDS_pept        152750..153613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0137"
FT                   /product="ABC-type sugar transport system, permease
FT                   component"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0137"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23336"
FT                   /db_xref="GOA:B2THZ6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B2THZ6"
FT                   /protein_id="ACD23336.1"
FT                   /translation="MKEKRRVFLLMSIPAVILFFIFHTLPLLKGISYSFTNWRGFGTFK
FT                   FVGIKNYISIFSDERIINSYMFTFKFALLSTIIVNVISLILAVGLNSKIKFKSTLRGIY
FT                   FIPNILGGLIVGYIFNYIFTFILTGAGQAIGSEILSKSILGNPNLAWLGVVIVASWQAI
FT                   AFNTIIYISGLQTISEDVYEASAIDGANKWIQFKKITFPLLAPFFTINMVLAMKNFLNV
FT                   FDQIISLTGGGPSGSTESIAVLIYKAGFDGSQFGYQSANSVIYFIVVVVISLLQLRILE
FT                   RREMQL"
FT   gene            153613..154482
FT                   /locus_tag="CLL_A0138"
FT   CDS_pept        153613..154482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0138"
FT                   /product="sugar ABC transporter permease"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0138"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22121"
FT                   /db_xref="GOA:B2THZ7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B2THZ7"
FT                   /protein_id="ACD22121.1"
FT                   /translation="MFAVANKSRKNKAYKINKDEKTNWFVTILMILGTITVLFPLLITV
FT                   LIALKSPQDMMNGIFSLPKVFHFENFTKAIEMTNFFNALKNSLTITITTVILTLITNSM
FT                   VGYAIARNMNKKTYKAMYYYFLSAMFVPFPIIMLPLVKQVSVWSMDNVMGLILLYTVYG
FT                   LSSNVFLYVGFLKSIPVELEEAALIDGASTWQVFYKIIFPMLKPIHATVAILTALWCWN
FT                   DVMLPLVILSNPDFATIPLVQFIFQSQFGTDYNLAFASYLLALIPILLFYLIAQKGIID
FT                   GVTKGAIK"
FT   gene            complement(154642..154824)
FT                   /locus_tag="CLL_A0139"
FT   CDS_pept        complement(154642..154824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0139"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0139"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24425"
FT                   /db_xref="UniProtKB/TrEMBL:B2THZ8"
FT                   /protein_id="ACD24425.1"
FT                   /translation="MSNKENLNKKNECNCTDKFEVAFEEEKAKVDPSKPCDSSNPDYPW
FT                   VSCGVDKKTKDSKEK"
FT   gene            155180..156343
FT                   /locus_tag="CLL_A0140"
FT   CDS_pept        155180..156343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0140"
FT                   /product="putative capsule biosynthesis protein CapA"
FT                   /note="identified by match to protein family HMM PF09587"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0140"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24940"
FT                   /db_xref="GOA:B2THZ9"
FT                   /db_xref="InterPro:IPR019079"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:B2THZ9"
FT                   /protein_id="ACD24940.1"
FT                   /translation="MNNKYNNLNRKSIKNRRQLLMKRKKHRRITIIAIIVIIIVIFGVL
FT                   KLNNKNNLQMSSESKTSFNNNSDNNKEVLISVIGDLTLGTDEKIGYSNSLPEAFDNNNK
FT                   DYLYFMKNVVNLFKNDDYTIENLETTFTDSKIKALKGGGTSFNFKGKKNYANILKYSSI
FT                   DGVTISNNHIYDYGADGMKDTVSALEDAGVDICGEEYKIVKDIKGIKFGFLGYMGWNIS
FT                   DKLKNKIYNDIRDLKNQGVEVIIPYFHWGSESEHEASKNQVELARFSIDSGADAVIGSH
FT                   PHVIQTIENYKGKLIAYSMGNFCFGGNFNPEDKRTFILQIKINLKNKKLNNMEYKIIPT
FT                   MISSRDDKNDYVPTIATNRKEEILKLLNDLSPTLNNKIKDEFFKLNA"
FT   gene            156950..157747
FT                   /gene="gufA"
FT                   /locus_tag="CLL_A0141"
FT   CDS_pept        156950..157747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gufA"
FT                   /locus_tag="CLL_A0141"
FT                   /product="GufA protein"
FT                   /note="identified by match to protein family HMM PF02535"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0141"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22887"
FT                   /db_xref="GOA:B2TI00"
FT                   /db_xref="InterPro:IPR003689"
FT                   /db_xref="UniProtKB/TrEMBL:B2TI00"
FT                   /protein_id="ACD22887.1"
FT                   /translation="MKEITPILAVLIGTGFTFLSTALGAAFVFFFKHDVKPNIQRVFLG
FT                   FAAGIMIAASVWSLLIPAINMAEEQGKIGWIPAAGGFLLGGAFLLLLDTILPHLHATSE
FT                   SPEGMSSSLKRTTMLVLAVTMHNIPEGMAVGLAFGLAANGDATVTLASAMVLALGIGLQ
FT                   NLPEGAAISLPLKKEGLSNTKAFTFGVLSGIVEPIGGIIAFLLTASIQGIMPWFLAFAA
FT                   GAMIYVVAEELIPEANSGDHSNAGTIGVMAGFIIMMILDVALG"
FT   gene            complement(158081..159475)
FT                   /gene="asnS"
FT                   /locus_tag="CLL_A0142"
FT   CDS_pept        complement(158081..159475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="asnS"
FT                   /locus_tag="CLL_A0142"
FT                   /product="asparagine--tRNA ligase"
FT                   /EC_number="6.1.1.22"
FT                   /note="identified by match to protein family HMM PF00152;
FT                   match to protein family HMM PF01336; match to protein
FT                   family HMM TIGR00457"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0142"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23255"
FT                   /db_xref="GOA:B2TI01"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004522"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2TI01"
FT                   /protein_id="ACD23255.1"
FT                   /translation="MKNTVLIKKIYRETDQFLSKEVMISGWIRTLRASNAFGFIEINDG
FT                   SFFKNIQVVFDDKLGNFKEISKLPISSSISVVGTLVATPDAKQPFEIQAKEIVIEGMSN
FT                   SDYPLQKKRHTFEYLRSIAHLRPRSNAFSATFRVRSVAAFAIHKFFQEQGFVYTHTPII
FT                   TGSDCEGAGEMFRVTTLDPKAPELTKEGDIDYTKDFFGKETNLTVSGQLNAECFALAFR
FT                   NIYTFGPTFRAENSNTTRHAAEFWMIEPEIAFADLQDDMELAEAMLKYVIKYVMDECPE
FT                   ELQFFNSFVDKGLLERLNHVVSSDFAKVTYTEAVEILEKCDKEFDYDVSWGIDLQTEHE
FT                   RYLTEEHFKKPLFVTDYPKEIKAFYMRMNEDNKTVAATDLLVPGIGEIIGGSQREERLD
FT                   VLEARMAELGLKKEDYWWYLELRKYGETKHAGFGLGFERLIMYITGMTNIRDVIPFPRT
FT                   PGTSEF"
FT   misc_feature    complement(159567..159817)
FT                   /note="T-box leader"
FT   gene            complement(159882..160580)
FT                   /locus_tag="CLL_A0143"
FT   CDS_pept        complement(159882..160580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0143"
FT                   /product="Ser/Thr protein phosphatase family protein"
FT                   /note="identified by match to protein family HMM PF00149;
FT                   match to protein family HMM TIGR00040"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0143"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24023"
FT                   /db_xref="GOA:B2TI02"
FT                   /db_xref="InterPro:IPR000979"
FT                   /db_xref="InterPro:IPR011152"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:B2TI02"
FT                   /protein_id="ACD24023.1"
FT                   /translation="MKIAIISDIHGNIYSLIRALQDIDNEKVDSIICLGDLVGYGPHPN
FT                   EVIAMIKRRNILCIQGNYDKSVIDNDYTFIRETEINSFSLPWTYNELRAQNRYFLSNLP
FT                   SSISLNIQGKKIIFVHGSPSILNQYLFEDADDTKNIIENMAEDILVCAHTHIPSIKNFD
FT                   EKMYINCGSIGKPKIGRPNLTYCLLDINELSGVKAQIKELEYEYPRIVKDMTLLNFPSK
FT                   LIKNFEKGLE"
FT   gene            160852..161928
FT                   /locus_tag="CLL_A0144"
FT   CDS_pept        160852..161928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0144"
FT                   /product="metallopeptidase, family M24"
FT                   /note="identified by match to protein family HMM PF00557;
FT                   match to protein family HMM PF01321"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0144"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25158"
FT                   /db_xref="GOA:B2TI03"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:B2TI03"
FT                   /protein_id="ACD25158.1"
FT                   /translation="MKTNRVFNVIKEMESQGLSQIIVTSPASIYYLVGKRISPGERMVA
FT                   LYINSSGNHKFIVNKLFPIEENLGVDIIWYTDSDDAVEVLSKVLEKDKVLGIDKDWSAK
FT                   FLIRLMALNVAKGFVNSSPIIDSLRMIKDSEEIELMKKSSQINDRVMLKLQSQLKEGMT
FT                   EKYYQRLLAEIYEEEGASGFSFTPIVAFDTNGADPHSECGSTKLKKGDTIVLDIGGIYN
FT                   YYCSDMTRTVFFGEEPNDHKKEIYEIVKQANLNGIKKVKDGVKFSEIDSAARSYIDDKG
FT                   YGEFFTHRTGHSIGLETHDKGDVSSINHEEVKAGMIFSIEPGIYLKNDIGVRIEDLVLV
FT                   TKDGAEILNSVTKELTVI"
FT   gene            complement(162000..163382)
FT                   /gene="murC"
FT                   /locus_tag="CLL_A0145"
FT   CDS_pept        complement(162000..163382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murC"
FT                   /locus_tag="CLL_A0145"
FT                   /product="UDP-N-acetylmuramate--alanine ligase"
FT                   /EC_number="6.3.2.8"
FT                   /note="identified by match to protein family HMM PF01225;
FT                   match to protein family HMM PF02875; match to protein
FT                   family HMM PF08245; match to protein family HMM TIGR01082"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0145"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22444"
FT                   /db_xref="GOA:B2TI04"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005758"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2TI04"
FT                   /protein_id="ACD22444.1"
FT                   /translation="MSFDFIKDRDKKVHFIGIGGISMSGLAAVLLNSGYKVSGSDFKES
FT                   EILKKLRLSGADIYIGHSEKNIKDVDLVVYTAAIPENNPELIYAKENNIELMNRAEFLG
FT                   SIMKGHKYNVAISGAHGKTTCTSMLSNITLKANLDPTILVGGELDIIGGNFRIGSSDYF
FT                   ITEACEYKRSFLSFFPYVGVILNIDADHLDYYKDIDEITETFGQFADLIPNDGYLIGYV
FT                   GDSRVKEILFKAKCNTLSYGFENADVTARNITFNEKGCASFDVYKHNDKLFDLTLSNPG
FT                   EHNILNALSSICVSLIFDVNYDDIICGLSECKGAHKRFEYKGEVNGVTVIDDYAHHPVE
FT                   IKATLNTSKKIPHNKTFCVFQPHTYTRTKTLFDEFTDAFFDADEVVLMDIYAAREKDTG
FT                   LVSSNDLGVALRAKGVKCTNVHSHDEALEYLKNSAKPNDLLLTVGAGDVVIVGEKYLNQ
FT                   GK"
FT   gene            163673..164488
FT                   /gene="purR"
FT                   /locus_tag="CLL_A0146"
FT   CDS_pept        163673..164488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purR"
FT                   /locus_tag="CLL_A0146"
FT                   /product="pur operon repressor"
FT                   /note="identified by match to protein family HMM PF00156;
FT                   match to protein family HMM PF09182; match to protein
FT                   family HMM TIGR01743"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0146"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23713"
FT                   /db_xref="GOA:B2TI05"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR010078"
FT                   /db_xref="InterPro:IPR015265"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2TI05"
FT                   /protein_id="ACD23713.1"
FT                   /translation="MEKLNRNNRVVAITKILIENSNKIIGLNRFSELLNAAKSTISEDI
FT                   VIVRELLEKLKMGRIETIAGVAGGIKYIPMIGDDVARDFALKLCDQLKDDGRVIPGNII
FT                   YMTDVMYNPEIISTAGVMLSSCFQDKNVDYVITVETKGIPLAYEVARNLGVQLVIARRD
FT                   SQFTEGTTVSINYVSGSSGRLQQMSLSKKSMKPKSRCIFIDDFMKAGGTALGIKDLLTE
FT                   FESELVGIGVLVDNKEINKKLVDEYVSIVELKDVDKESILDIQPSKRFS"
FT   gene            164609..164887
FT                   /gene="spoVG"
FT                   /locus_tag="CLL_A0147"
FT   CDS_pept        164609..164887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoVG"
FT                   /locus_tag="CLL_A0147"
FT                   /product="stage V sporulation protein G"
FT                   /note="identified by similarity to SP:P28015; match to
FT                   protein family HMM PF04026"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0147"
FT                   /db_xref="EnsemblGenomes-Tr:ACD21712"
FT                   /db_xref="GOA:B2TI06"
FT                   /db_xref="InterPro:IPR007170"
FT                   /db_xref="InterPro:IPR036751"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2TI06"
FT                   /protein_id="ACD21712.1"
FT                   /translation="MQITDVRIRKISSEGKMKAIVSVTFDNEFVVHDIKVIEGQNGLFI
FT                   AMPSRKTPTGEFKDIAHPIVMDSREKIQNEILSAYAKAIEEQDVEEE"
FT   gene            165072..166439
FT                   /gene="glmU"
FT                   /locus_tag="CLL_A0148"
FT   CDS_pept        165072..166439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmU"
FT                   /locus_tag="CLL_A0148"
FT                   /product="UDP-N-acetylglucosamine
FT                   diphosphorylase/glucosamine-1-phosphate
FT                   N-acetyltransferase"
FT                   /EC_number="2.7.7.23"
FT                   /EC_number="2.3.1.157"
FT                   /note="identified by match to protein family HMM PF00132;
FT                   match to protein family HMM PF00483; match to protein
FT                   family HMM PF01128; match to protein family HMM TIGR01173"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0148"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22657"
FT                   /db_xref="GOA:B2TI07"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2TI07"
FT                   /protein_id="ACD22657.1"
FT                   /translation="MYKCALVLAAGQGKRIKSDLPKVLHKVCGKEMVNHVIDTIRKAGI
FT                   QDANIIIGKGAELVKERTEEKKVTYSLQSEQLGTGHAVQCASEFLKGKKGTVAVFAGDT
FT                   PLIKESTIKNLFNTHIEAKNAATILTAIVDDPTGYGRIIRSGNEVLKIVEHKDCNEEEL
FT                   KVNEMNSAIYCFDIKLLYESLSKLSNNNEQGEYYLTDVIEILKSAGHNIGAVVTDFEET
FT                   IGVNSRAQLAQAEEILKDRINLKHMENGVTLIDPKTTYIGIDVEIGKDTIIYPNNIFEG
FT                   NTIIGERCTIYQNSRIKDSIIKDEVDIQSSVILDSSIGNNTTVGPFAYIRPESKIGEKA
FT                   RIGDFVEIKKSIIGDGTKVSHLTYIGDAEVGKECNFGCGTVVVNYDGKKKYKTIIGNHS
FT                   FIGCNTNLVSPVQVGDNTYIAAGSTITSEVQEGDLAVARAKQRNIKGWVDKKGLKK"
FT   gene            166486..167445
FT                   /gene="prsA"
FT                   /locus_tag="CLL_A0149"
FT   CDS_pept        166486..167445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prsA"
FT                   /locus_tag="CLL_A0149"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /EC_number="2.7.6.1"
FT                   /note="identified by match to protein family HMM PF00156;
FT                   match to protein family HMM TIGR01251"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0149"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23624"
FT                   /db_xref="GOA:B2TI08"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="InterPro:IPR037515"
FT                   /db_xref="UniProtKB/TrEMBL:B2TI08"
FT                   /protein_id="ACD23624.1"
FT                   /translation="MISHERNIKVFTGNSNCKLAQDIADILGVPVGKSKVSTFSDGEIS
FT                   VDINETVRGTDVFIVQSTCSPVNNNLMELLIMIDAFKRASAGRITAVIPYYGYARQDRK
FT                   AKARDPITAKLVADLVTAAGAHRVLTMDLHASQIQGYFNIPVDHLLGAPILAKHFISKG
FT                   LAEQDDVVVVSPDLGSVTRARKFADNLHAPIAIIDKRRPKANVSEIMNIIGEVEGKRCI
FT                   LIDDMIDTAGTISNAANALKELGAKNVYACCTHGVLSGPAYERLDKSAIEELVLLNTIP
FT                   VDVEMENMKITALSVAPLFAEAIKRIYDDEPISKLFEV"
FT   gene            167557..168243
FT                   /locus_tag="CLL_A0150"
FT   CDS_pept        167557..168243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0150"
FT                   /product="two-component response regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00486"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0150"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25128"
FT                   /db_xref="GOA:B2TI09"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B2TI09"
FT                   /protein_id="ACD25128.1"
FT                   /translation="MDKSFGKVLIINNDIYSNDLMDDYLRLSGYKTKIVLDGNDAKSVF
FT                   LKYVPNIILLDLLTKNLNGMDFLKWVRKQSNIPIIVVTSNNCLFDKVLAFDIGADDYIL
FT                   KPFKAEELLARMKAIMRRCSIESNKTDIISISDLSVNLSTYEVLFKGNIINLPPKEFEL
FT                   LVFLINNPNKVFTRKELLDEIWGNDYKSDCRTIDVHIKRLREKFEPNENYKIITLWRKG
FT                   YKFQIK"
FT   gene            168322..168897
FT                   /gene="pth"
FT                   /locus_tag="CLL_A0151"
FT   CDS_pept        168322..168897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pth"
FT                   /locus_tag="CLL_A0151"
FT                   /product="aminoacyl-tRNA hydrolase"
FT                   /EC_number="3.1.1.29"
FT                   /note="identified by match to protein family HMM PF01195;
FT                   match to protein family HMM TIGR00447"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0151"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25084"
FT                   /db_xref="GOA:B2TI10"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2TI10"
FT                   /protein_id="ACD25084.1"
FT                   /translation="MFLIVGLGNPGSKYDNTRHNIGFEVIDNISNEYNIDINRQKFRGV
FT                   YGEGFIANNKVILLKPTTYMNLSGDSVREVANFYKISNENIIVIYDDISLDIGRLRIRE
FT                   KGSAGGHNGIKSIIANLSTDVFPRIKVGVGQPNIDLVNYVLGKFSKEEKEVLKESIEVA
FT                   TNSVEEIIKQDVNSAMNKFNGFKANKSI"
FT   gene            168912..172415
FT                   /gene="mfd"
FT                   /locus_tag="CLL_A0152"
FT   CDS_pept        168912..172415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mfd"
FT                   /locus_tag="CLL_A0152"
FT                   /product="transcription-repair coupling factor"
FT                   /EC_number="3.6.1.-"
FT                   /note="identified by match to protein family HMM PF00270;
FT                   match to protein family HMM PF00271; match to protein
FT                   family HMM PF02559; match to protein family HMM PF03461;
FT                   match to protein family HMM TIGR00580"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0152"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22167"
FT                   /db_xref="GOA:B2TI11"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR004576"
FT                   /db_xref="InterPro:IPR005118"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR037235"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:B2TI11"
FT                   /protein_id="ACD22167.1"
FT                   /translation="MRLKGLLEPLETGIELQKILKSINEKTYPVGIYGLSDSGRSYMID
FT                   GIFENIEKSIVIVTQSDMEAKNLYEDLILYTNEVYYFPVKETVFYNIDAISGDLRWARL
FT                   NVINEILNNKNKKIVITSVDCFMATYAPHKLFVKYSMTIKQGAEINFNEMSSKLIESGY
FT                   ERVEIVESKGQFSIRGGILDIFPTCSTYPYRVELFGDEVESIRTFNSESQRSIDKVKSF
FT                   KVFPAKEIIVSQESMTKAKESILNEFKEISLDNKEKERIEKLEKVVKSNIESLEENLTF
FT                   ETIDSYLPYFYEEVESFFDYFKNYLFIMNDVKRCKGKLESSYLEFAENFTSFLERGDIL
FT                   PGQEKLLIKEHDTLDKFEESNILFFETLNNTEKFLRPFTNIELKQTTLSNYQGQLDILI
FT                   EDILDKKSKGYKTVILSGTKVRGERLVDTLRDRGVESSYKDNIEEIQFGEVIITCGNQL
FT                   KGFEYPEYKVCVISDKEVFGEAKRKLKQKSKKKKGISKIKSFNELKPGDYVVHVNHGIG
FT                   VYKGIKQIDVSGHKRDYLDIVYDKGDKLYVPVEQLDLIQKYIGSEGKSPKVTKLGGAEW
FT                   QKAKAKVRKSINDIAEDLVKLYATRSTIKGHKFSKDTQWQRQFEDEFPFEETPDQLTSL
FT                   EEIKKDMESDKVMDRLLCGDVGYGKTEVALRAAFKAVMDGKQVALLVPTTILAEQHYKN
FT                   MKKRFSDFPIKIDMVSRFRTAKEQKVTIQRLKEGNVDILVGTHKLVSKDIQFKDLGLLI
FT                   VDEEQRFGVSQKEKIKNIKKNVDVLTLSATPIPRTLHMSLTGARDISVIETPPEERYPV
FT                   QTYVVEQNDQLIRDAILREIGRGGQVYFVYNRVEDINEMARYVQELVPESKVSVTHGQM
FT                   TERQLEKEMISFMDQESNVLVCTTIIETGIDIPNVNTIIVYNSDKMGLSQLYQLRGRVG
FT                   RSNRIAYAYLLYTKDKVLTEVAEKRLKALKDFTELGSGFKIAMRDLEIRGAGNIMGSSQ
FT                   HGHMASVGYDLYCRMLEDTIKLIKGDISKEPIETTVEIKIDAFISENYIEDEIQKIEIY
FT                   KKIAAIEDIEDYNDIKEELEDRYSKIPEPVHNLMDIAYIKSIAKKLFIEEIKEMPKEIR
FT                   FRFASGEDEYKKLFKILMENYKENIILKFGTEPYFSFKTQDMKKEDKLEFLKEILEKLE
FT                   S"
FT   gene            172551..173582
FT                   /locus_tag="CLL_A0153"
FT   CDS_pept        172551..173582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0153"
FT                   /product="putative peptidyl-prolyl cis-trans isomerase"
FT                   /note="identified by similarity to SP:Q81U45; match to
FT                   protein family HMM PF00639"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0153"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22242"
FT                   /db_xref="GOA:B2TI12"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR023058"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:B2TI12"
FT                   /protein_id="ACD22242.1"
FT                   /translation="MNKIKKIVASVVVATLAFSIVGCKMIEKTPESIKNTVLATVGKEK
FT                   ITQGDLDRDLKSITESLKQKYGENYESNADIKDQLKELKTQYLNAIVNEKVILAKSTEL
FT                   NLRPSDEELNKEVDEAVNYYKTAYQTEEQYNAFLEQNGFTEDEFKEYQKNQAVVRYVYQ
FT                   DMVKDVEVNDDDIQKYYDENKETQFSTPGEIDFDKSLQQANEIKSQLDGGADFSEVAKE
FT                   KSQDPGTKDNGGSLGFIEYSSTKYVKEFMDGFKDLKEGEISQPIKSQFGYHIIKVTGVK
FT                   DDGAEVAHILVADKGEGTVTPLEDVKEDIRGQLLQKKQSDVFNEKIEEWKKDVGVKIHD
FT                   KNL"
FT   gene            173774..174325
FT                   /gene="spoVT"
FT                   /locus_tag="CLL_A0154"
FT   CDS_pept        173774..174325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoVT"
FT                   /locus_tag="CLL_A0154"
FT                   /product="stage V sporulation protein T"
FT                   /note="identified by match to protein family HMM PF04014;
FT                   match to protein family HMM TIGR01439; match to protein
FT                   family HMM TIGR02851"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0154"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24573"
FT                   /db_xref="GOA:B2TI13"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR014213"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR039472"
FT                   /db_xref="UniProtKB/TrEMBL:B2TI13"
FT                   /protein_id="ACD24573.1"
FT                   /translation="MKATGIVRRIDDLGRVVIPKEIRRTLRIREGDPLEIFTDREGGVI
FT                   LKKYSPIGELTDFSREYAESLQQAIGHVVLIADKDAFISASGTPKKDYIERKISSELEE
FT                   IMDGRKTVMLDKSQKVVIPLHNDDDESKYVNQVISPILSEGDAIGTVIILSKEDGETLG
FT                   EVELKLAETAATFLGKQMEQ"
FT   gene            174427..175962
FT                   /locus_tag="CLL_A0155"
FT   CDS_pept        174427..175962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0155"
FT                   /product="putative stage V sporulation protein B"
FT                   /note="identified by match to protein family HMM PF01554;
FT                   match to protein family HMM PF01943; match to protein
FT                   family HMM PF03023"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0155"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24281"
FT                   /db_xref="GOA:B2TI14"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR024923"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:B2TI14"
FT                   /protein_id="ACD24281.1"
FT                   /translation="MKKQSLIKGSLILGVAGILTRFLGLFFRWPLIMLIGDEGIGYYQM
FT                   SYPLYMFFVAIASGIPIAISKMISENNAIDDINGIFEIMKESAILMAILGTGTTFALFF
FT                   FAKPIISFLKWDPKAYYSLIGISFAPIIISFITIFRGFFQGLQNMSPSATSQLIEQIGR
FT                   IIFGVGLAVILLPRGIEYSAGGAAFGATAGAIMAGVYLFSKYKKIKKEYGIKKVKTNPD
FT                   VLSDILRIAIPISLGATVGSIMGLIDSIVVPQKLLEAGLTNMQSTVLYAQLTGKASVIV
FT                   NVPLTLSMALCISLIPIIAENFILKNHVEVKRKINMSMKMSAVIAIPCMFGIFFLAEPI
FT                   MRLIFPGRFAGAGILKYLSLSIPFIILTQTTTSILQGTDNYIIPVINLFIGCFIKGILT
FT                   WILVPMKAFNIYGAVIASIIAYLVSSILNLIAMKWKLKIKLNVYEILIKPAYASTLMMI
FT                   LVLISYNYIYKSTTSNGISCLISIFLGIIVYIILIMLLRVFKIEEIKSRFRRN"
FT   gene            175977..177443
FT                   /locus_tag="CLL_A0156"
FT   CDS_pept        175977..177443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0156"
FT                   /product="MazG family protein"
FT                   /note="identified by match to protein family HMM PF00590;
FT                   match to protein family HMM PF03819; match to protein
FT                   family HMM TIGR00444"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0156"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23035"
FT                   /db_xref="GOA:B2TI15"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR004518"
FT                   /db_xref="InterPro:IPR011551"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR024180"
FT                   /db_xref="InterPro:IPR035013"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:B2TI15"
FT                   /protein_id="ACD23035.1"
FT                   /translation="MIKIVGLGPGAKEALTIGCIEELKNCKNIFLRTEKHPTVDYLTEN
FT                   NIEFKTYDYIYDTEESFDEVYFNIANDIINKYKQSGELVYAVPGHPLVAEKSVFNLMKL
FT                   CKKENIDYKVIPAVSFIDAMMESLAIDPIEGLKVIDAFDINNQILDKRIGTIITQVYNP
FT                   FIASEVKLRLLQKYDDETEIVYVRAAGIIGEESIRKIPLYELDMQEDIDYLTSVYIPKD
FT                   LNNKKDFYDLLETVEILRGENGCPWDKEQTHESIKNSLIEESYEVVDAINNEDDDSLIE
FT                   ELGDVLFQVVFHSSIGQEDGYFNINDVVKAICDKMIYRHPHVFKNLNDVNSSKDVLEKW
FT                   DELKKSEKGYETLTEEMNGIAKSLPSLLRAYKVQKKAKRVGFDWDDVSFAFEKVNEELK
FT                   EVKDAYISENKEKIEDEIGDLLFSCVNVARFLGIDGEEALNSTINKFISRFSYIEKKAL
FT                   EKKLNLNEMSLEDMDILWEEAKKLNKSVIK"
FT   gene            177645..177923
FT                   /gene="hup"
FT                   /locus_tag="CLL_A0157"
FT   CDS_pept        177645..177923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hup"
FT                   /locus_tag="CLL_A0157"
FT                   /product="DNA-binding protein HU"
FT                   /note="identified by match to protein family HMM PF00216"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0157"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23926"
FT                   /db_xref="GOA:B2TI16"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:B2TI16"
FT                   /protein_id="ACD23926.1"
FT                   /translation="MNKAELITSMAEKSKLTKKDAELALKSFIESVEEALESGEKVQLV
FT                   GFGTFETRERAAREGRNPRTKEVINIPATTVPVFKPGKEFKDKVNNK"
FT   gene            177974..178234
FT                   /locus_tag="CLL_A0158"
FT   CDS_pept        177974..178234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0158"
FT                   /product="S4 domain protein"
FT                   /note="identified by match to protein family HMM PF01479"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0158"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23351"
FT                   /db_xref="GOA:B2TI17"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR025490"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:B2TI17"
FT                   /protein_id="ACD23351.1"
FT                   /translation="MRLDKYLKVSRIIKRRTVAKEACESGRVSINGKVAKPSTDIKEDD
FT                   IIEITFANRTLKAKIVNIKEHVRKEDAKEMYIIVEGQEDKE"
FT   gene            178367..178660
FT                   /gene="yabP"
FT                   /locus_tag="CLL_A0159"
FT   CDS_pept        178367..178660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabP"
FT                   /locus_tag="CLL_A0159"
FT                   /product="sporulation protein YabP"
FT                   /note="identified by match to protein family HMM PF07873;
FT                   match to protein family HMM TIGR02892"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0159"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22389"
FT                   /db_xref="InterPro:IPR012504"
FT                   /db_xref="InterPro:IPR022476"
FT                   /db_xref="InterPro:IPR038705"
FT                   /db_xref="UniProtKB/TrEMBL:B2TI18"
FT                   /protein_id="ACD22389.1"
FT                   /translation="MENKDENKLNDRNSNLSLENRQKLILSGVIEVISFDSQKIDLTTV
FT                   LGNLSIKGSDLKMNKLDVKNGDVIINGSIDSMAYSGKEVKKSKESIISRLFK"
FT   gene            179227..179442
FT                   /locus_tag="CLL_A0160"
FT   CDS_pept        179227..179442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0160"
FT                   /product="cell division protein"
FT                   /note="identified by match to protein family HMM PF04977"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0160"
FT                   /db_xref="EnsemblGenomes-Tr:ACD21811"
FT                   /db_xref="GOA:B2TI19"
FT                   /db_xref="InterPro:IPR007060"
FT                   /db_xref="UniProtKB/TrEMBL:B2TI19"
FT                   /protein_id="ACD21811.1"
FT                   /translation="MAIDRIEKQLNEKQLQLDEITKKNSRLSDEVEKIDSGSDEYLEKL
FT                   ARERLGMIKPGEKVINSSEQTSNSEK"
FT   gene            179499..179915
FT                   /locus_tag="CLL_A0161"
FT   CDS_pept        179499..179915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0161"
FT                   /product="putative RNA-binding protein"
FT                   /note="identified by match to protein family HMM PF00575"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0161"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24717"
FT                   /db_xref="GOA:B2TI20"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:B2TI20"
FT                   /protein_id="ACD24717.1"
FT                   /translation="MTLEAGNILEGIVVNITNFGAFIEVEGKTGLVHISEVADSYVKDI
FT                   REHLKEQDKVKVKVISIDDNGKISLSIKQANIQKKSVKPVEIDWNSNTEKKKNGSGNFE
FT                   DIMSRFLKDSEERMQDVKKHQEFKGKGAKKCPAK"
FT   gene            180150..180238
FT                   /locus_tag="CLL_A0162"
FT   tRNA            180150..180238
FT                   /locus_tag="CLL_A0162"
FT                   /product="tRNA-Leu"
FT   gene            180258..180335
FT                   /locus_tag="CLL_A0163"
FT   tRNA            180258..180335
FT                   /locus_tag="CLL_A0163"
FT                   /product="tRNA-Met"
FT   gene            180345..180421
FT                   /locus_tag="CLL_A0164"
FT   tRNA            180345..180421
FT                   /locus_tag="CLL_A0164"
FT                   /product="tRNA-Met"
FT   gene            180426..180516
FT                   /locus_tag="CLL_A0165"
FT   tRNA            180426..180516
FT                   /locus_tag="CLL_A0165"
FT                   /product="tRNA-Leu"
FT   gene            180535..180612
FT                   /locus_tag="CLL_A0166"
FT   tRNA            180535..180612
FT                   /locus_tag="CLL_A0166"
FT                   /product="tRNA-Met"
FT   gene            180622..180698
FT                   /locus_tag="CLL_A0167"
FT   tRNA            180622..180698
FT                   /locus_tag="CLL_A0167"
FT                   /product="tRNA-Met"
FT   gene            180703..180793
FT                   /locus_tag="CLL_A0168"
FT   tRNA            180703..180793
FT                   /locus_tag="CLL_A0168"
FT                   /product="tRNA-Leu"
FT   gene            181303..183684
FT                   /gene="spoIIE"
FT                   /locus_tag="CLL_A0169"
FT   CDS_pept        181303..183684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoIIE"
FT                   /locus_tag="CLL_A0169"
FT                   /product="stage II sporulation protein E"
FT                   /EC_number="3.1.3.16"
FT                   /note="identified by match to protein family HMM PF07228;
FT                   match to protein family HMM TIGR02865"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0169"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23544"
FT                   /db_xref="GOA:B2TI21"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR014221"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:B2TI21"
FT                   /protein_id="ACD23544.1"
FT                   /translation="MQYELNINAYKNKKVKKSFLLKMELSRMIFILIGGLLLSRVTLLF
FT                   NQTQNNGIAPLGIAYLIVMGLKCNRSKTAMASIGVLLGYATINSKLPGGMVYLITAAAL
FT                   TLYYEVLNKSEKRKKEFASFFIVFLSFIGYGVFANNYDLGVNITLALINALVVLPVYYI
FT                   IKYSFNCLDEINSNYFFTSEEIVSMAILFCLFVAGIGDISIKYCSLRNVLALLLVVTIA
FT                   YIGGASYGATMGVAMGIILGCSSNNMMASVGFYGVGGLVIGIFKDTGKIFSVLSGILIY
FT                   FALGLYSESINSQFIIEVGASLAIFLFIPKNLYKNIEIEINTEKKQESINQIHLNELKE
FT                   EFTLKLNDLSGVLNQVSKTLEVMDDNDRLLIKNKSCEFVESLADRVCIDCEKKNSCWRM
FT                   NFNSTYNSFQTLIKSAEEESPILPKTLETSCVKHFTLLKSAQDIVTNHIVNSNIKDRFS
FT                   EGRQIISSHINNISYSLGNVLDEFKREVTICSDLERIVKRGLNKSSIEYNDIFCYTDKN
FT                   GRVKIKLTIKDGENCEYYENKLIPLLNDIMHTPLCIIDNGYFINRDTNMCTLLIEEMPK
FT                   YNVISYGAMASKKGETRTGDSYSFGKATDGSYMTILSDGMGSGPDAEKESKATVDLVEK
FT                   FMEAGFDEEVAINTMNSIMGMKFSESEKYATLDLSKIDLYSGEVNFVKIGAASSFIKRG
FT                   DEILVVDSKNLPFGLVDEMELDIIKEEVMPGDILISVSDGILDIDKLNSGNFIWLKEYL
FT                   KDCCTDPRELSENILQKAMTLSENTLKDDMTVLVSKVYAV"
FT   gene            183823..185229
FT                   /locus_tag="CLL_A0170"
FT   CDS_pept        183823..185229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0170"
FT                   /product="tRNA(Ile)-lysidine synthase"
FT                   /EC_number="6.3.4.-"
FT                   /note="identified by match to protein family HMM PF01171;
FT                   match to protein family HMM TIGR02432; match to protein
FT                   family HMM TIGR02433"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0170"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22846"
FT                   /db_xref="GOA:B2TI26"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR012796"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:B2TI26"
FT                   /protein_id="ACD22846.1"
FT                   /translation="MKKKVLSYIIDNNLIKSGDKILIALSGGPDSLCLLNMLKELREEL
FT                   DIEIGAAHLNHLLRGDDAFKDEEFVINTCKEMNIPCYVKRVDINKYSKEHRLSSELAGR
FT                   NVRYDFFDEILKKEGFNKIATAHNANDQAETIIFRMMRGTGLEGLGGIKVYRENKIIRP
FT                   ILCLTRTEVEKYIEEKKLNPRIDKTNFEKIYNRNKIRLDIIPYIQENFNEDIVKTLNRM
FT                   SLLIQKDNALIERLCIKAYNEYCKKDNDSKFFILKKELFGEDEAIITRVIRTALVEYSK
FT                   SHYDFEMKHIYDILELSKKETGKSINLPKNIYVENIYGDIKISSKVKENIKMDKIEFFL
FT                   DKKSIGEDTIHFNNYEFVMSILKNKSNNLLDLKENNLVKYFDLDKIKGNILFRTRKNGD
FT                   RITPLGMNGQKKLKDIFINMKVPQEDRDLIPLICFDDNIGWIVGLKISDNFKVTNNSKN
FT                   ILKIVAKRKE"
FT   gene            185235..185774
FT                   /gene="hpt"
FT                   /locus_tag="CLL_A0171"
FT   CDS_pept        185235..185774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hpt"
FT                   /locus_tag="CLL_A0171"
FT                   /product="hypoxanthine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.8"
FT                   /note="identified by match to protein family HMM PF00156;
FT                   match to protein family HMM TIGR01203"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0171"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22092"
FT                   /db_xref="GOA:B2TI27"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005904"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:B2TI27"
FT                   /protein_id="ACD22092.1"
FT                   /translation="MREDIQEILFDEETLNQKIKEIAAKISVDYKGKELVVVGILKGSV
FT                   LFAAELIKNISIPCEIDFMAVSSYGNSTETSGVVRILKDLDYSIEGKDILLVEDIVDSG
FT                   VTLSYLLKYLKARKANTIEIVSLLNKSARRKAEVYAKYIGFEVPDAFIVGYGIDYAEKY
FT                   RNLPFIGVLKPEVYEK"
FT   gene            185848..187653
FT                   /locus_tag="CLL_A0172"
FT   CDS_pept        185848..187653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0172"
FT                   /product="ATP-dependent metalloprotease FtsH"
FT                   /EC_number="3.4.24.-"
FT                   /note="identified by match to protein family HMM PF00004;
FT                   match to protein family HMM PF01434; match to protein
FT                   family HMM PF06480; match to protein family HMM TIGR01241"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0172"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24392"
FT                   /db_xref="GOA:B2TI28"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:B2TI28"
FT                   /protein_id="ACD24392.1"
FT                   /translation="MKKYSSAALWTVVSIMLILASVAMWETGKGSDSIIYSSFQQKWNQ
FT                   DQIESITIKQDKMTVEGKTKDNKSFVTVVPDDLITSLIKESPKSDVRISFEQPSNSGMW
FT                   LTTLIPSVLLVVIFLVFLFVFTQQSQGGGGGRGVMNFGKSKAKMAMPDSQKVTFKDVAG
FT                   ADEEKAELEEIVDFLKTPSKYIEIGARIPKGVLLVGPPGTGKTLLAKAISGEAGVPFFS
FT                   ISGSDFVEMFVGVGASRVRSLFEDAKKNAPCLIFIDEIDAVGRQRGAGLGGGHDEREQT
FT                   LNQLLVEMDGFGANEGIIMIAATNRPDILDPALLRPGRFDRQVLVGIPDVKGREEILKV
FT                   HTRKKPLEESVELNVLAKRTPGFSGADLENLANEAALLAVRRNKKRISMQDMEEAITRV
FT                   IAGPEKKSRVITDHDKKLTAYHEAGHAVVMKLLPNSDKVHEISIIPRGRAGGYTMQLPN
FT                   EDRAYTSKSKLKNDMIGLLGGRVAEHLILGDISTGAKNDIDRASAIARSMVMEYGMSDK
FT                   IGTISYGSDDSEVFLGRNLGKGRNFSEDISSKIDHEIKDFIDEAYTKAEKLLNGNLNKL
FT                   HAVAQALLEKEKIEGKEFEEIFANN"
FT   gene            187875..189545
FT                   /gene="fhs"
FT                   /locus_tag="CLL_A0173"
FT   CDS_pept        187875..189545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhs"
FT                   /locus_tag="CLL_A0173"
FT                   /product="formate--tetrahydrofolate ligase"
FT                   /EC_number="6.3.4.3"
FT                   /note="identified by match to protein family HMM PF01268"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0173"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22749"
FT                   /db_xref="GOA:B2TI29"
FT                   /db_xref="InterPro:IPR000559"
FT                   /db_xref="InterPro:IPR020628"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2TI29"
FT                   /protein_id="ACD22749.1"
FT                   /translation="MKTDIEIAQEAEMLHIKNVAEKLGLDEENIEYYGKYKCKVSLDVY
FT                   NKVKNNRDGKLVLVTAINPTPAGEGKSTVTVGLGDALNKMGKNTVIALREPSLGPVFGI
FT                   KGGAAGGGYAQVVPMEDINLHFTGDMHAITSANNLLSAAIDNHIHQGNNLRIDSRRIIF
FT                   KRVMDMNDRALRKIIVGMGGKINGFVREDGFTITVASEIMAILCLASDLEDLKHRMGDI
FT                   LIAYDLDGNPVYAKQLEIQGAMALLMKDAIKPNLVQTLENTPALIHGGPFANIAHGCNS
FT                   IMATKLSLKLGDIVVTEAGFGADLGAEKFFDIKCRYGNLKPCCVVIVATIRALKHHGGV
FT                   AKADLNTPNVEALRLGIANLEKQIENIKKFNVEPVVAINKFVSDSDEEVEFIKEFCEKL
FT                   GVKVALSDVWAKGGDGGIELGEAVLDVIEKDKSNFKTLYDTDKTIEEKILTIAKEIYGA
FT                   DGVVYSNEAKKQIGELVKFNLDKLPICMAKTQYSLSDNPNLLAKPSGFNINVQEIRVSN
FT                   GAGFIVVQTGNIMTMPGLPKVPAANKMDVLKDGEIVGLF"
FT   gene            189673..190446
FT                   /gene="coaX"
FT                   /locus_tag="CLL_A0174"
FT   CDS_pept        189673..190446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coaX"
FT                   /locus_tag="CLL_A0174"
FT                   /product="pantothenate kinase, type III"
FT                   /EC_number="2.7.1.33"
FT                   /note="identified by match to protein family HMM PF03309;
FT                   match to protein family HMM TIGR00671"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0174"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22730"
FT                   /db_xref="GOA:B2TI22"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2TI22"
FT                   /protein_id="ACD22730.1"
FT                   /translation="MILLVDAGNTNIVLGVYKDKKYIASWRISTEGNKTSDEYSIQIIQ
FT                   LLNLNNLNPEDVKGIIVSSVVPNIMHSLENMLRRCFGQEPIIVGPGIKTGINIKYDNPK
FT                   EVGADRIVNAVAAFEIYKRPVIIIDFGTATTFCSVTENGDYLGGCICPGLRISADALFE
FT                   RAAKLPRVELEVPKKVICKNTVSSIQSGVLFGYIGQVEYIVKKMKEEMSDGIEPYVIAT
FT                   GGLANLIANETDAIDEVDSDLTLEGLKILYQKNRE"
FT   gene            190452..191417
FT                   /gene="nifR"
FT                   /locus_tag="CLL_A0175"
FT   CDS_pept        190452..191417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nifR"
FT                   /locus_tag="CLL_A0175"
FT                   /product="NifR3 family protein"
FT                   /EC_number="1.-.-.-"
FT                   /note="identified by match to protein family HMM PF01180;
FT                   match to protein family HMM PF01207; match to protein
FT                   family HMM TIGR00737"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0175"
FT                   /db_xref="EnsemblGenomes-Tr:ACD21792"
FT                   /db_xref="GOA:B2TI23"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR024036"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:B2TI23"
FT                   /protein_id="ACD21792.1"
FT                   /translation="MKIGNLSFDNNIFLAPMAGVTDLSFRGLCKEMGCGLVYTEMVSAK
FT                   ALYYGSENTQTLLRVSNEEAPVAVQIFGREPEIMAEICEKYLNPREDVCIIDINMGCPA
FT                   PKIVRNKEGSALMLEPNLAHDIVKAIKKVSKKPVTVKFRKGYDDEHINAVEFGKALEEA
FT                   GADAIAVHGRTRKQMYEGHSDWEIIKKVKEAVSIPVLGNGDVFSPEDAIKMKELTNCDG
FT                   ILIARGSMGNPWIFKQIQDALNGKIVEEISYQDKINMCIRHYELAIKNDGEYKAIREMR
FT                   KHASWYIKGLPRSTDIKNQINILNDSYEVMSILEQYKNTL"
FT   gene            191485..192309
FT                   /locus_tag="CLL_A0176"
FT   CDS_pept        191485..192309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0176"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0176"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24743"
FT                   /db_xref="UniProtKB/TrEMBL:B2TI24"
FT                   /protein_id="ACD24743.1"
FT                   /translation="MDTILYVYLDKKRIYNKYNFFTKIIDLFKTKKLKDIKIDELDILI
FT                   KRVEIPSNLNDVAYEKNLSRILTKYNGKYNELSLNGKSLYNLNYTSEFQKQFISYSVVQ
FT                   SIRFVLMNLNKSIKNSNILVDIDDEKLLVSILKELAKESRNVILLNSSINKIEKIRETI
FT                   MSEYGLSIEVILRECDLPNIDFVVTSKNKEYSCNNVWYIKDFPNNSNKGIFINSILYKV
FT                   PWDTSLKEMPPQLVASIIRKQKKRSIHEILKSNDITLESILYNDDEIILGNQ"
FT   gene            192424..192906
FT                   /gene="greA"
FT                   /locus_tag="CLL_A0177"
FT   CDS_pept        192424..192906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="greA"
FT                   /locus_tag="CLL_A0177"
FT                   /product="transcription elongation factor GreA"
FT                   /note="identified by match to protein family HMM PF01272;
FT                   match to protein family HMM PF03449; match to protein
FT                   family HMM TIGR01462"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0177"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23137"
FT                   /db_xref="GOA:B2TI25"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR006359"
FT                   /db_xref="InterPro:IPR018151"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028624"
FT                   /db_xref="InterPro:IPR036805"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2TI25"
FT                   /protein_id="ACD23137.1"
FT                   /translation="MSEPKQYVMTYEGVKKLEGELEYLKTVKRKEITEKIKVALGYGDL
FT                   SENSEYDEAKNDQAFTEGKILQLENKLKNAVVVDESEIPKDIVSVGSKVKVKDYDFDEE
FT                   VEYSIVGSAEADPMSFKISNESPVGNALVGKKIGDVVEVVVPDGVSKFEILDIKRG"
FT   gene            192951..194456
FT                   /gene="lysS"
FT                   /locus_tag="CLL_A0178"
FT   CDS_pept        192951..194456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysS"
FT                   /locus_tag="CLL_A0178"
FT                   /product="lysine--tRNA ligase"
FT                   /EC_number="6.1.1.6"
FT                   /note="identified by match to protein family HMM PF00152;
FT                   match to protein family HMM PF01336; match to protein
FT                   family HMM TIGR00499"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0178"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25097"
FT                   /db_xref="GOA:B2TIC7"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIC7"
FT                   /protein_id="ACD25097.1"
FT                   /translation="MSTEEMNISELESQYNEQEALRRTKLADLQEAGKDPFDVYKVERT
FT                   HTSEEVKSNYEELEGKNVTVAGRIMSKRGQGKVVFSDIHDRDGKIQLFIKIDLVGEESL
FT                   KSYKTYDLGDWVVATGEVFTTKTGEVSVKVSNFELICKSLKPLPEKWHGLKDPDLRYRQ
FT                   REVDIITNPEVKETFIKRSKIISGIREFLDTKGFLEVETPILAPIAGGAAAKPFVTHHN
FT                   TLDIDMYLRIATELYLKRLVVAGFEKVYEIGRNFRNEGMSVRHNPEFTAIELYEAYSDY
FT                   NDMMEITENMVAYVCEKVNGTTKVTYQGTEIDFMPPWRRVTMVDVVKEHAGVDFTTIKS
FT                   DEEAQAIAKEKHLEFAKPLNTVTKGEVLNALYEEFGEANMIQPTFVMDYPVEISPLTKK
FT                   KRGNEEFTERFEGFVFGRELCNAYSELNDPVVQRQRFEQQAKERELGDDEAYMLDEQFM
FT                   SALETGMPPTGGMGMGIDRLIMFLTDASSIRDVILFPTMKPQK"
FT   gene            194699..194775
FT                   /locus_tag="CLL_A0179"
FT   tRNA            194699..194775
FT                   /locus_tag="CLL_A0179"
FT                   /product="tRNA-Asn"
FT   gene            195092..195168
FT                   /locus_tag="CLL_A0180"
FT   tRNA            195092..195168
FT                   /locus_tag="CLL_A0180"
FT                   /product="tRNA-Asn"
FT   gene            195472..195548
FT                   /locus_tag="CLL_A0181"
FT   tRNA            195472..195548
FT                   /locus_tag="CLL_A0181"
FT                   /product="tRNA-Asn"
FT   misc_feature    195777..195959
FT                   /note="T-box leader"
FT   gene            195982..197373
FT                   /gene="glyS"
FT                   /locus_tag="CLL_A0182"
FT   CDS_pept        195982..197373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyS"
FT                   /locus_tag="CLL_A0182"
FT                   /product="glycine--tRNA ligase"
FT                   /EC_number="6.1.1.14"
FT                   /note="identified by match to protein family HMM PF00587;
FT                   match to protein family HMM PF03129; match to protein
FT                   family HMM TIGR00389"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0182"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24190"
FT                   /db_xref="GOA:B2TIC8"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002315"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR022961"
FT                   /db_xref="InterPro:IPR027031"
FT                   /db_xref="InterPro:IPR033731"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIC8"
FT                   /protein_id="ACD24190.1"
FT                   /translation="MAVEKTMDKIVALCKNRGFVFPGSDIYGGLANSWDYGPLGVEFKN
FT                   NVKKAWWKKFVQESPYNVGLDSAILMNSDVWVASGHVGGFSDPLMDCKECKARFRADKI
FT                   VEDHMTENGAEVASADGWTNEQLKEYIESNNIVCPKCGKMNYTDIRKFNLMFKTFQGVT
FT                   EDAKSEIYLRPETAQGIFVNFKAVQRSSRKKVPFGIAQIGKSFRNEITPGNFTFRTREF
FT                   EQMELEFFCKPGTDLEWHKYWKDYCWNFLLNLNVKTENLRMRDHGEEELSFYSNATSDI
FT                   EYLFPFGWGELWGIADRTDYDLKKHQEHSGQDLNYLDQTNNEKYIPYVIEPSLGADRVT
FT                   LAFLIEAYDEEELDGGDSRTVLHLHPALAPFKAAILPLSKKLSENALEVYSSLSKKFNI
FT                   DFDETGSIGKRYRRQDEIGTPYCITVDFDTLEDQCVTIRNRDTMEQERIKISELEAYIE
FT                   KSLDF"
FT   gene            197560..198936
FT                   /gene="murD"
FT                   /locus_tag="CLL_A0183"
FT   CDS_pept        197560..198936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murD"
FT                   /locus_tag="CLL_A0183"
FT                   /product="UDP-N-acetylmuramoyl-L-alanine--D-glutamate
FT                   ligase"
FT                   /EC_number="6.3.2.9"
FT                   /note="identified by match to protein family HMM PF02875;
FT                   match to protein family HMM PF08245; match to protein
FT                   family HMM TIGR01087"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0183"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23092"
FT                   /db_xref="GOA:B2TIC9"
FT                   /db_xref="InterPro:IPR005762"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2TIC9"
FT                   /protein_id="ACD23092.1"
FT                   /translation="MREDFKKFKDFIYKKRVGVVGIGVSNIPLINFLIKLGAEVTAFDK
FT                   KTEEELGEVSSDFKNKGVNLELGDNYLDKLTGFDVVFKTPSMRIDSECLVKVKKEGAYV
FT                   TSEMEEFVRYCKAKIYGITGSDGKTTTTTIISKMLQEEGYKTWVGGNIGTPLFAQIEEI
FT                   KSEDRVVLELSSFQLMTMNLPMDIAVCTNLAPNHLDMHKDMQEYIDAKKNIFLYQDATN
FT                   TLIVNRENEITYGFKAEAKGVVREFSSKRELKEGAYYKDGILYLSGKEVCKKDNIVIKG
FT                   MHNVENYLAAFIATKNDVSIENMKKVAESFNGVEHRCELVREINGVKYYNDSIASSPTR
FT                   TLAGLKAFDKRVILIAGGYDKHLLFEPLANEGYPYIKELILLGQTKEKIKDVFKELEAS
FT                   KGIKINISEVSTLEEAVKKAQNLARQGDIITLSPACASFDMFPNFMIRGNKFKEIVNEL
FT                   "
FT   gene            complement(199069..200073)
FT                   /locus_tag="CLL_A0184"
FT   CDS_pept        complement(199069..200073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0184"
FT                   /product="putative basic protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0184"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23674"
FT                   /db_xref="InterPro:IPR032485"
FT                   /db_xref="UniProtKB/TrEMBL:B2TID0"
FT                   /protein_id="ACD23674.1"
FT                   /translation="MIKKTLSLLLLCSTLFVVGCTKQEEKQNVNKSNSDISSSNNLSSN
FT                   AISPFILTDSTSFRCPFVFSNEMLIFPNPDESNRISMINAPLPKDILKSSDLNDLVDYY
FT                   TGDLALVNNTLYFADGSNSNSLSSINIPDKTYTSLNKDSVYSLIASNDKLFYINKNDNQ
FT                   KLYSYDTNSNISSALSLDSVGSFIVNGDFLIYQNLSDNSKLYYVKNDGTNRNKLTDYTA
FT                   NSFIPFDGEILFFNTSDNETLYSLNITTLEAKRISTIRGENLKCINNQLFFINNDDSNY
FT                   LYSLSVDLPNSKVDSKPYISESLNNYHLTNAGIFYEKAININNIYYYEFSTKN"
FT   gene            200072..200206
FT                   /locus_tag="CLL_A0185"
FT   CDS_pept        200072..200206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0185"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0185"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24388"
FT                   /db_xref="GOA:B2TID1"
FT                   /db_xref="UniProtKB/TrEMBL:B2TID1"
FT                   /protein_id="ACD24388.1"
FT                   /translation="MKNPPVYVLKINFIIFINIYSINIMITYTKSKEYMWCFRALKYN"
FT   gene            200570..202074
FT                   /gene="rrsB"
FT                   /locus_tag="CLL_A0186"
FT   rRNA            200570..202074
FT                   /gene="rrsB"
FT                   /locus_tag="CLL_A0186"
FT                   /product="16S ribosomal RNA"
FT   gene            202199..202276
FT                   /locus_tag="CLL_A0187"
FT   tRNA            202199..202276
FT                   /locus_tag="CLL_A0187"
FT                   /product="tRNA-Ala"
FT   gene            202279..202355
FT                   /locus_tag="CLL_A0188"
FT   tRNA            202279..202355
FT                   /locus_tag="CLL_A0188"
FT                   /product="tRNA-Ile"
FT   gene            202464..205374
FT                   /gene="rrlB"
FT                   /locus_tag="CLL_A0190"
FT   rRNA            202464..205374
FT                   /gene="rrlB"
FT                   /locus_tag="CLL_A0190"
FT                   /product="23S ribosomal RNA"
FT   gene            205433..205549
FT                   /gene="rrfB"
FT                   /locus_tag="CLL_A0191"
FT   rRNA            205433..205549
FT                   /gene="rrfB"
FT                   /locus_tag="CLL_A0191"
FT                   /product="5S ribosomal RNA"
FT   gene            205555..205632
FT                   /locus_tag="CLL_A0192"
FT   tRNA            205555..205632
FT                   /locus_tag="CLL_A0192"
FT                   /product="tRNA-Phe"
FT   gene            205633..205706
FT                   /locus_tag="CLL_A0193"
FT   tRNA            205633..205706
FT                   /locus_tag="CLL_A0193"
FT                   /product="tRNA-Cys"
FT   gene            complement(205989..206936)
FT                   /locus_tag="CLL_A0194"
FT   CDS_pept        complement(205989..206936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0194"
FT                   /product="magnesium and cobalt transporter"
FT                   /note="identified by match to protein family HMM PF01544"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0194"
FT                   /db_xref="EnsemblGenomes-Tr:ACD21922"
FT                   /db_xref="GOA:B2TID2"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/TrEMBL:B2TID2"
FT                   /protein_id="ACD21922.1"
FT                   /translation="MIQIYKSQSEFDPSLKPIDSIENGCWINIVAPSEEELILVSKKTG
FT                   ISIDFLKAALDDEETSRIDIEDDAILVIVDIPFTEMEENSLTYDTYPLAIIHTDKLLVT
FT                   ICLKNSKIITDFANARIKSFFTFKKSRFILQILNRISTYYLLYLRQIDKKSLMIEKRLH
FT                   KSMKNRELIQLHSLEKSLVYFSTSLKANEITLEKMLKLEMMQKYEEDKDVLEDVIIENK
FT                   QAIEMTEIYSNILASTMDFFASVISNNLNIVMKVLASVTILMAIPTIISGIFGMNVMLP
FT                   LSDNNPHAFSIVMMLTLGICFIVAFILYKKDMFN"
FT   gene            207213..207689
FT                   /locus_tag="CLL_A0195"
FT   CDS_pept        207213..207689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0195"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0195"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22941"
FT                   /db_xref="GOA:B2TID3"
FT                   /db_xref="UniProtKB/TrEMBL:B2TID3"
FT                   /protein_id="ACD22941.1"
FT                   /translation="MHKEVVIRKKAPVIAIVLLIITAMLYLYQGISILGIKNIRLVRFY
FT                   NISIVFLTLSIIFFEIMKCRISYKYSIIANKLIINKIFHNNEKNLESINLADIVYLGKS
FT                   NYIAKEYIVKNKGNYSCGIINKKKFCCIYKRENVYYKFSFNPSDKLIRRLNLNI"
FT   gene            complement(207750..208910)
FT                   /locus_tag="CLL_A0196"
FT   CDS_pept        complement(207750..208910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0196"
FT                   /product="amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0196"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25150"
FT                   /db_xref="GOA:B2TID4"
FT                   /db_xref="InterPro:IPR017144"
FT                   /db_xref="UniProtKB/TrEMBL:B2TID4"
FT                   /protein_id="ACD25150.1"
FT                   /translation="MKQEIISFLSTCDKELNDLSSYLYNNPEESYSETKSSKYICNLLS
FT                   KYNFEVSDNFLDISNSFICKKGTGYPKICFISEYDAVKDYGHITGHNALSTISVGATLA
FT                   LGSVVNKIGGSVILIGCPGEYLGGTKAVMTRQGVFDDIDVVMLAHPDVLTSESGTSSSI
FT                   IPLSIKYEGKGGLTFLNKNIYTALDAILLNLNILNSLQKGFPKDLEINPILSKGGYTPL
FT                   LLPAEAEAKFYIRSKNYKTSEWADNKLRTIAKYVSELTNLEYSTSLYEPSNKELITNRT
FT                   LNRLFSHNLKENSIIDIGKPRDIYAGLSLGDVSHKVPCIHPYICITDDPSIKYGTKDFA
FT                   KATQSEFALKQCKNASLALAFTGMDLIQNETLLNEIKDDFFKNKNI"
FT   gene            209071..209241
FT                   /locus_tag="CLL_A0197"
FT   CDS_pept        209071..209241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0197"
FT                   /product="putative CsfB protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0197"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22464"
FT                   /db_xref="InterPro:IPR019700"
FT                   /db_xref="UniProtKB/TrEMBL:B2TID5"
FT                   /protein_id="ACD22464.1"
FT                   /translation="MENKVCFLCGKKEGSGIILKGEKICSNCECELTNISVVNPKYHYF
FT                   KEKVKNVLFKK"
FT   gene            209394..210071
FT                   /locus_tag="CLL_A0198"
FT   CDS_pept        209394..210071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0198"
FT                   /product="dTMP kinase"
FT                   /note="identified by match to protein family HMM PF02223"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0198"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23875"
FT                   /db_xref="GOA:B2TID6"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/TrEMBL:B2TID6"
FT                   /protein_id="ACD23875.1"
FT                   /translation="MTKGKLIIIESGSDASGKATQAKKLYERLLEEGYNIKKITYPNYD
FT                   SPACMPVKMYLSGEFGNKPEDVNAYVASTFFAIDRFASYNKEWKDFYDNGGIIISDRYT
FT                   TSNMVHQAVKMDEEEKDKYLDWLYNLEFNLYKLPIPDCVMFLDVLPEISQKLMKDRNNK
FT                   FTGEKEKDIHENNKDYLAKSYYNSLEIAEKYNWDKIKCNDGDNLKTIEEIHEEIYKKVK
FT                   KYI"
FT   gene            210186..210518
FT                   /locus_tag="CLL_A0199"
FT   CDS_pept        210186..210518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0199"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAK78280.1; match to
FT                   protein family HMM PF06153"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0199"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24542"
FT                   /db_xref="InterPro:IPR010375"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:B2TID7"
FT                   /protein_id="ACD24542.1"
FT                   /translation="MKLVIAIVQDEDAIDVLDSLTDKNFRVTKLATTGGFLKAGNTTLM
FT                   VGVEEEKLDQALDVIKEVCKKRKETVIAPTPLSSNEGGYIQQCPMQITVGGATIFVVDV
FT                   DKFIKI"
FT   gene            210530..211462
FT                   /locus_tag="CLL_A0200"
FT   CDS_pept        210530..211462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0200"
FT                   /product="DNA polymerase III subunits gamma and tau"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0200"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22414"
FT                   /db_xref="GOA:B2TID8"
FT                   /db_xref="InterPro:IPR015199"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2TID8"
FT                   /protein_id="ACD22414.1"
FT                   /translation="MREIIGHERVINGFDLRKRSNTFSHANLIIGDDGIGKSLVANYLA
FT                   NSILGLKGDKEFVDIINYYPLSSSFGVDDIRNIITEVSKKPFESDKKVLILHKCEKMTI
FT                   QAQNALLKTIEEPPIGVHLILLSESLELILDTIKSRCQTYKLTPLSKEDITKYIENKYF
FT                   DINIENKKAALAYSQGIPGKVEKFIEDDKLNNLRNVLLELLCDLESNKDDFVFKYKEVL
FT                   ASYKDKQSEVLNILISYIRDIMFLKELDSNDLVVNFDKLKEIRDISMRMSYKKLNSMLE
FT                   YIKEARTSLNNNTNYSMTITVLLMGFAEV"
FT   gene            211466..212374
FT                   /locus_tag="CLL_A0201"
FT   CDS_pept        211466..212374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0201"
FT                   /product="PSP1 domain protein"
FT                   /note="identified by match to protein family HMM PF04468"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0201"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24728"
FT                   /db_xref="InterPro:IPR007557"
FT                   /db_xref="UniProtKB/TrEMBL:B2TID9"
FT                   /protein_id="ACD24728.1"
FT                   /translation="MIKVIGVRFKKAGKIYYFDPVNFAVKKENYVIVETARGIEFGQCV
FT                   IGIKEISEDEIVSPLKEVIRIADEKDIQKHKDNKGRENEALEICLKKIQEHGLKMKLID
FT                   VEYTFDNHKVIFYFTADGRVDFRELVKDLATIFKTRIELRQIGVRDEAKMIGGLGPCGR
FT                   PMCCSTFLGDFASVSIKMAKEQNLSLNPTKISGICGRLMCCLNYEQSTYEDIRRRLPKV
FT                   GSIVETIDGKGEVIGNLTVKESVRVKLKRGDEEVIDIYKIEDVKLISGSYEGSIDNSDI
FT                   KLEIESEEDKKLIKELIKEEN"
FT   gene            212518..212688
FT                   /locus_tag="CLL_A0202"
FT   CDS_pept        212518..212688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0202"
FT                   /product="ferredoxin, 4Fe-4S"
FT                   /note="identified by similarity to SP:P00195; match to
FT                   protein family HMM PF00037"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0202"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23930"
FT                   /db_xref="GOA:B2TIE0"
FT                   /db_xref="InterPro:IPR000813"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIE0"
FT                   /protein_id="ACD23930.1"
FT                   /translation="MAFVINDSCVSCGACAGECPVDAISQGDAYYVIDADTCIDCGNCA
FT                   NVCPVGAPVQE"
FT   gene            complement(212846..213484)
FT                   /locus_tag="CLL_A0203"
FT   CDS_pept        complement(212846..213484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0203"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to PDB:1VJN_A"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0203"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23381"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIE1"
FT                   /protein_id="ACD23381.1"
FT                   /translation="MKLTWYGHSCFLITSNNGKRILIDPFDDSIGYNNDFLHSDIIVMS
FT                   HNHFDHSFLKESDNNVKIINTTGIFNLDFINIEGFSSFHDKYNGLKRGPNIIYTFTLDK
FT                   LKICHLGDLGHIPLDLISTKLENIDILFVPIGGHFTLNGAEGAKISKLISPKYIIPIHY
FT                   KTFKSMLYLDDSKNFLISMDNVEKINSNTITSDDLKLYKENSVLLLSLP"
FT   gene            213673..214128
FT                   /locus_tag="CLL_A0204"
FT   CDS_pept        213673..214128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0204"
FT                   /product="transcriptional regulator CtsR"
FT                   /note="identified by match to protein family HMM PF05848"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0204"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22633"
FT                   /db_xref="GOA:B2TIE2"
FT                   /db_xref="InterPro:IPR008463"
FT                   /db_xref="InterPro:IPR040465"
FT                   /db_xref="InterPro:IPR041473"
FT                   /db_xref="InterPro:IPR041902"
FT                   /db_xref="InterPro:IPR041908"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIE2"
FT                   /protein_id="ACD22633.1"
FT                   /translation="MAKLSDIIEEFIKAMFNDSGENVVLIQRNELADQFRCAPSQINYV
FT                   LTTRFTYNKGYLIESKRGGGGHIIIKQLDNDSSSRREEIINQSIGNTITYHNAVNIIDN
FT                   LFESDIITEKECELMKIAINDRTLISVENRNKIRADIFKAMIMVILS"
FT   gene            214143..214718
FT                   /locus_tag="CLL_A0205"
FT   CDS_pept        214143..214718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0205"
FT                   /product="McsA"
FT                   /note="identified by match to protein family HMM PF02151"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0205"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24970"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR025542"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIE3"
FT                   /protein_id="ACD24970.1"
FT                   /translation="MLCEKCKKNEAKINLVKIVNGEKNEIWLCESCAKDISDIPFINSL
FT                   NEIGGLQFENILTGFLNNIGDKKTKPKELVCPKCKMNYSEFEKTSKLGCSECYNVFFEY
FT                   IKPIIKRIHGNVKHVGKIPKFDGESLIKRKKIIKLKQELQSVIKLEEYEKAAVLRDEIK
FT                   ELEEFIFINSKDDKVFLVKEEKGNEKLD"
FT   gene            214702..215721
FT                   /locus_tag="CLL_A0206"
FT   CDS_pept        214702..215721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0206"
FT                   /product="putative ATP:guanido phosphotransferase"
FT                   /note="identified by match to protein family HMM PF00217"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0206"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24219"
FT                   /db_xref="GOA:B2TIE4"
FT                   /db_xref="InterPro:IPR000749"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR022414"
FT                   /db_xref="InterPro:IPR023660"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2TIE4"
FT                   /protein_id="ACD24219.1"
FT                   /translation="MKNWINEECNKEDIVINSNISLSRNLKEKPFSNKLNEIEARENVG
FT                   FIYQIVKSELKDESCIYQLWNEDKELINSYLDKQLISKELIKNKDKTAFVLNSEETLSI
FT                   MINEDDHLKLRCITAGFDLETAFDNITKLDDKIEKRVHYAFDENLGYLTTSPTNLGTGM
FT                   RASVNIHLPALNFNDEISNFSKGLTQIGMDMKGLYEEGNKAYGNMYKISNQVTLGLTEE
FT                   EIIDNLKGAVLNVISEEKKFREVLLTKCKYDIEDKVFRAYGILTSAILLSEKECTELLS
FT                   SVRFGVELSLLDISKNKLNKLLVYTRDSSLQNYLKRKLSNKELNYERAKFVRAILAQN"
FT   gene            215746..218190
FT                   /locus_tag="CLL_A0207"
FT   CDS_pept        215746..218190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0207"
FT                   /product="negative regulator of genetic competence
FT                   MecB/ClpC"
FT                   /EC_number="3.4.21.-"
FT                   /note="identified by similarity to SP:P37571; match to
FT                   protein family HMM PF00004; match to protein family HMM
FT                   PF02151; match to protein family HMM PF02861; match to
FT                   protein family HMM PF07724; match to protein family HMM
FT                   PF07728"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0207"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23763"
FT                   /db_xref="GOA:B2TIE5"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIE5"
FT                   /protein_id="ACD23763.1"
FT                   /translation="MSMDFNKFTERTQSIILEAQIESQEFKHGYVGTEHLLLGLVKEKG
FT                   QQSNILNEFGIDAEIVRDMISRYLGYGELQMPEDDILLTPRAKKLLDESFMEAKKFSHK
FT                   NVSPEHILMALLNQEEGMAYTILKNLKLNFKEIKDKLFIFLNGQYSDENEEIKSPRSEK
FT                   TKTPMLDKYGRDLTQFARDGGLDPVIGRDLENQRVLEILCRRIKNNPCLIGEPGVGKTA
FT                   VIEGLAQRIVEGNIPEILRGKRIVSLDLTALLAGAKYRGEFEDRLKKVMLEIEKDKSII
FT                   IFIDEIHTIIGAGAAEGAIDASNILKPALSRGEIQCIGATTINEYRKHIEKDSALERRF
FT                   QPVNVGEPSKDETLIILRGLREKYEEHHNVNITDKALEAAVELSDRYITDRFMPDKAID
FT                   LIDEACAKVRIKNLIPPANLKSMEDEIKETTKEKEECIRVQDFEKAANMRDIENDLKEE
FT                   LEALRKEWSDKNSNKQLNVDEEDIAEVVSSWTKIPAKKLTEKESEKLLKLENILQKRVI
FT                   GQTEAVESIAKAVRRARVGIKDPNRPIGTFIFLGPTGVGKTELSKALAETMFGDENSII
FT                   RIDMSEYMESNSVSKLIGSPPGYVGYDDGGQLTEAVRRKPYSVVLLDEIEKAHQDVFNI
FT                   LLQIMEDGRLTDSHGKVVNFKNTIVIMTSNVGAHQIKKQKTIGFNTSIDENSEYEKMKD
FT                   NVLEELKRSFKPEFLNRIDDTIVFHKLKEDDLLDIVDLMLKSITKRLENKDIHLNFEKD
FT                   SKKFLINKRIDLNYGARPLRRIITKEVEDKLSEEILLGNIKIGDRIKVNESKDNLVFTK
FT                   LD"
FT   gene            218482..219417
FT                   /locus_tag="CLL_A0208"
FT   CDS_pept        218482..219417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0208"
FT                   /product="putative thioredoxin reductase"
FT                   /note="identified by match to protein family HMM PF00070;
FT                   match to protein family HMM PF07992"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0208"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23162"
FT                   /db_xref="GOA:B2TIE6"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIE6"
FT                   /protein_id="ACD23162.1"
FT                   /translation="MAKEEKSIDLIVIGAGPAGLAAAIYGGRAKLDMIVLEERIIGGQV
FT                   RNSYTIENYPGFEKISGADLADIFQKQVESLGVTIDEFDLIENLVLSDDEKIVETESYI
FT                   YKPKAIIIATGASPKKLPVPEETKYEGKGVHYCAVCDGAMYEGKRIGVVGGGNSALEEA
FT                   IFLTKFAEKVFVIRRYDYFNGEKSLIEEVLNHPKIEVLFNEDLVHLSGENFLEEVTVKN
FT                   KNTGKLSELKLDAVFGYIGTEPKTNGLDKYLKLNDYGYIITNEDMETKINGVYAVGDVR
FT                   EKKYRQITTAVSDGTIALLNAEKYIVQKEK"
FT   gene            219422..219649
FT                   /locus_tag="CLL_A0209"
FT   CDS_pept        219422..219649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0209"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF00462;
FT                   match to protein family HMM TIGR02196"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0209"
FT                   /db_xref="EnsemblGenomes-Tr:ACD21699"
FT                   /db_xref="GOA:B2TIE7"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011911"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIE7"
FT                   /protein_id="ACD21699.1"
FT                   /translation="MIKIYSTSWCPACIKAKRYFDLKGLKYEEINVADKHEDREEVFKA
FT                   SGQRSVPVIDISGNIIVGFDKKRIDDYVNR"
FT   gene            complement(219901..220128)
FT                   /locus_tag="CLL_A0210"
FT   CDS_pept        complement(219901..220128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0210"
FT                   /product="glutaredoxin-like protein, YruB-family"
FT                   /note="identified by match to protein family HMM PF00462;
FT                   match to protein family HMM TIGR02196"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0210"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23195"
FT                   /db_xref="GOA:B2TIE8"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011767"
FT                   /db_xref="InterPro:IPR011911"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIE8"
FT                   /protein_id="ACD23195.1"
FT                   /translation="MVKVYTTDSCPWCVKVKNYLKSKSVDFEELNVQEDMIAREDMVKK
FT                   SKQMGVPVLDINDTIIIGFDKPSIDEALNK"
FT   gene            complement(220196..220363)
FT                   /locus_tag="CLL_A0211"
FT   CDS_pept        complement(220196..220363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0211"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0211"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23596"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIE9"
FT                   /protein_id="ACD23596.1"
FT                   /translation="MITKDSFNNVTLPSKNILRDNDGHVFQHNFDNTYSQNEFSNLVLN
FT                   SNLENNNIIK"
FT   gene            220631..221998
FT                   /gene="radA"
FT                   /locus_tag="CLL_A0212"
FT   CDS_pept        220631..221998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="radA"
FT                   /locus_tag="CLL_A0212"
FT                   /product="DNA repair protein RadA"
FT                   /note="identified by match to protein family HMM TIGR00416"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0212"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24363"
FT                   /db_xref="GOA:B2TIF0"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIF0"
FT                   /protein_id="ACD24363.1"
FT                   /translation="MAKIKSTYICQQCGYEAPKWLGKCPSCNNWNTFNEEIKDDSKVIT
FT                   SLKANNIVQNNQPKNIRDIKSGEKERYDTGIKELNRVLGGGLVRGSLTLISGDPGIGKS
FT                   TLLLQTANNIAVKYGKVLYVSGEESEEQIKIRGDRLGVNSENLFIISETNLDAISIYIE
FT                   QINPNFVIIDSIQTVFKESVSSAPGSVSQVKECSNTIMRMCKGKNIPFFLVAHVTKQGE
FT                   LAGPRVLEHMVDTVLYFEGERTEEYRILRTMKNRFGTTSEIGVFEMQQEGLVEVFDPSK
FT                   IFLEDTSANQEGSVVVGIMEGTRPILIEIQALVSETKAPMPRRTAVGIDNQRLSLILAV
FT                   LEKKLKMFFYNKDVYVNVVGGLNIDGTSADLGLALALISSAKSKEFKLDKTLMVGEVGL
FT                   TGEIRPISSAERLVKEAEKLGFKNVIIPERNLDKIKTDNIKVIGIRHLMEAINKIF"
FT   gene            222016..223080
FT                   /locus_tag="CLL_A0213"
FT   CDS_pept        222016..223080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0213"
FT                   /product="DNA integrity scanning protein DisA"
FT                   /note="identified by match to protein family HMM PF00633;
FT                   match to protein family HMM PF02457"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0213"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22782"
FT                   /db_xref="GOA:B2TIF1"
FT                   /db_xref="InterPro:IPR003390"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR018906"
FT                   /db_xref="InterPro:IPR023763"
FT                   /db_xref="InterPro:IPR036888"
FT                   /db_xref="InterPro:IPR038331"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2TIF1"
FT                   /protein_id="ACD22782.1"
FT                   /translation="MRLEKGMKIKDTLKIMCPGTQLREGLENILRAKTGGLIVIGDNKE
FT                   VMDTVDGGFNLNSDYSPSYVYELAKMDGAIVISEDLKKIVCANAQLIPDPSIVTHETGT
FT                   RHRTAHRIAKQTNNIVIAISQRRNIITVYKGDIKYVLRDSSVILARANQAIQTLEKYVS
FT                   VLERVINNLNLLEFQDLTTLFDVVTAIQRTEMVMRIVEEINMYILELGNEGRLISMQLN
FT                   ELVKHIERDGILLIRDYCKDEDGHNEVYEQIQKLSATELLDLDAIARVLGHAGESLVDT
FT                   LISAKGYRILGKVPRIPSTVIENLIKEFKELNSVIEADIDELDIVEGIGEARAKAIKDG
FT                   LKRIREQILLNKKI"
FT   gene            complement(223125..223523)
FT                   /locus_tag="CLL_A0214"
FT   CDS_pept        complement(223125..223523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0214"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0214"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22219"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIF2"
FT                   /protein_id="ACD22219.1"
FT                   /translation="MKDIIFDDFQNSVNDSLLRHKSILDILTKYSESSSRVNRAVAKSV
FT                   TNCGCININASKQNSLNEDKSVDDLSTYLESHLSGELCENCREIIEKEIGNNLFYLTSL
FT                   CNNLDINLYDVLLKEHDKINTLGKFAFR"
FT   gene            223785..224879
FT                   /locus_tag="CLL_A0215"
FT   CDS_pept        223785..224879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0215"
FT                   /product="pin/tram domain protein"
FT                   /note="identified by match to protein family HMM PF01850;
FT                   match to protein family HMM PF01938"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0215"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24348"
FT                   /db_xref="GOA:B2TIF3"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR041120"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIF3"
FT                   /protein_id="ACD24348.1"
FT                   /translation="MLKKIIRGIFSAIGLLVGYIIAKSLLDIPNIKEMKYLSTLTGSIA
FT                   FITIISLLFGIILYIVSPIIYKAIFNLVEYIEKNIQKLTLIEIICGVLGAIIALILMSF
FT                   IAKPINGIDDKFGPMLFIFLNIISAIIGADILVKKKDDIIALFSNIKKNTGKEKKSKGN
FT                   HVKGVAKVLDTSVIIDGRIFDICETGFIEGPLVIPNFVLDELRHISDSSDSLKRNRGRR
FT                   GLDILNRIQKELSIETQIWEGDFPKISEVDSKLLKLAQTLNGKVITNDYNLNKVAEFQG
FT                   VPVLNINELSNAIKSVVLPGEEMHVDMIKDGKESTQGVGYLDDGTMIVVEGGKKYIGQT
FT                   ITVIVTSVLQTAAGRMIFAKPKDN"
FT   gene            224898..225572
FT                   /gene="ispD"
FT                   /locus_tag="CLL_A0216"
FT   CDS_pept        224898..225572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispD"
FT                   /locus_tag="CLL_A0216"
FT                   /product="2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase"
FT                   /EC_number="2.7.7.60"
FT                   /note="identified by match to protein family HMM PF01128;
FT                   match to protein family HMM TIGR00453"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0216"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23811"
FT                   /db_xref="GOA:B2TIF4"
FT                   /db_xref="InterPro:IPR001228"
FT                   /db_xref="InterPro:IPR018294"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR034683"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2TIF4"
FT                   /protein_id="ACD23811.1"
FT                   /translation="MVSAIVVAGGKGKRMGTVQSKQYLSLNGKPILYYTIKSFLDCKLV
FT                   DNIILVVPSHEIDYCEKEILEKNSLKVNKIVAGGDERYDSVYNGLIEAKGSDIVLIHDG
FT                   VRPFVSKETIENAIKYSEEYGAAAPGVMPKDTIKIIDDNRFSIDTPNRSHLISVQTPQA
FT                   FKFDLIYDCHKKIKNENVNITDDTMVAEYFGNKVYIYPGEYTNIKITTPEDLIIGEYLV
FT                   NR"
FT   misc_feature    225655..225849
FT                   /note="T-box leader"
FT   gene            225895..227607
FT                   /gene="proS"
FT                   /locus_tag="CLL_A0217"
FT   CDS_pept        225895..227607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proS"
FT                   /locus_tag="CLL_A0217"
FT                   /product="proline--tRNA ligase"
FT                   /EC_number="6.1.1.15"
FT                   /note="identified by match to protein family HMM PF00587;
FT                   match to protein family HMM PF03129; match to protein
FT                   family HMM PF04073; match to protein family HMM TIGR00409"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0217"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22388"
FT                   /db_xref="GOA:B2TIF5"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004500"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR023717"
FT                   /db_xref="InterPro:IPR033730"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2TIF5"
FT                   /protein_id="ACD22388.1"
FT                   /translation="MKMSNMLISTLREVPAEAEIDSHKLMLRSGMIRKMASGIYNYMPL
FT                   GLKALKKVEDIIREEMNEAGAQEFLASAMIPAELWQSSGRWDAYGAEMFRVKDRNERDF
FT                   CLGPTHEEVFTDIAKNEIKSYKQLPVNLYQIQTKYRDERRPRFGVMRSREFVMKDAYSF
FT                   DKDQQGLDLSYNKMYEAYVKIFNRCGLDAKCVEADSGAIGGSNSAEFMVKSEVGEDDIV
FT                   FCTECNYAANIEKATARLEEAEKEELIEVEKVSTPDSRGIDEVSEFLNISSKKTVKTLL
FT                   YNVDGKIVAVFVRGDREVNEVKVANASNASGDIEMASHEEYMNATGCGIGFAGPIGIKA
FT                   DLILVDKEVKNMCNFVTGANETGYHIKNVNYGRDFEGTIGDYRNVVEGEACPTCGGKLT
FT                   ISRGTEVGHIFKLGTKYSEAMDAKFIAENGKEAPFIMGCYGIGVTRTMASIIEQHNDEN
FT                   GIVWPLAVAPYHVSVIAVNVKDEEQVKIATKLYEDLKSMGVEALLDDRNERAGVKFKDS
FT                   EIMGIPMRITVGKKIVDGEVEFKLRIGDMEVVKIEDVCQMVKGEFDKNNLKLR"
FT   gene            227627..229039
FT                   /gene="cysS"
FT                   /locus_tag="CLL_A0218"
FT   CDS_pept        227627..229039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysS"
FT                   /locus_tag="CLL_A0218"
FT                   /product="cysteine--tRNA ligase"
FT                   /EC_number="6.1.1.16"
FT                   /note="identified by match to protein family HMM PF01406;
FT                   match to protein family HMM PF09190; match to protein
FT                   family HMM PF09334; match to protein family HMM TIGR00435"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0218"
FT                   /db_xref="EnsemblGenomes-Tr:ACD21855"
FT                   /db_xref="GOA:B2TIF6"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2TIF6"
FT                   /protein_id="ACD21855.1"
FT                   /translation="MRIFNTLTRKKEEFIPITPGEVKMYVCGPTVYNFFHIGNGRTFIV
FT                   FDTIRRYLEYRGYEVKFVQNFTDIDDKMIKKANEEGTTVKEIGDKYIKEYYEDADKLQI
FT                   ERATVNPRATEYIEDIIDFVAQLIEKGYAYEVEGDVYFNTKKFNDYGKLSGQSIEDLQM
FT                   GASNRTSSIADERKNDPMDFAIWKAQKPGEPAWKCPWGMGRPGWHIECSCMAKKILGDT
FT                   IDIHAGGMDLTFPHHENEVAQSEALTGMRFANYWMHSAYVNINNQKMSKSLNNFFTARD
FT                   ILKEYDSDVVRFFMMSAHYRLQINFSKDLLDSAKASVERLYNAIGNLENLIDEVSRENI
FT                   SEEEVNYLNSLKKYREKYIEKMDDDFNTADALTVLFELTKDTNTNINVNSSKELVNKAL
FT                   NLIRELGAPLGLLQKITKGSLEDEIESLIQQRQDARKNKDFALSDKIRDDLKDRGIVLE
FT                   DTPQGVRWKKIN"
FT   gene            229089..229514
FT                   /locus_tag="CLL_A0219"
FT   CDS_pept        229089..229514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0219"
FT                   /product="ribonuclease III"
FT                   /note="identified by match to protein family HMM PF00636"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0219"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23979"
FT                   /db_xref="GOA:B2TIF7"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR008226"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIF7"
FT                   /protein_id="ACD23979.1"
FT                   /translation="MLDDLKIREFNEANVRTLNPLQLAIIGDGVYEIFIRTYILAENEG
FT                   LSANKIHRKAISYVKAQAQSNIMHNLEEYLTEEELRIYKRGRNAKSATVPKNADVRDYR
FT                   MATGFEALIGYLYLIGNKERLEFMLEKSVVVLNEKEV"
FT   gene            229519..230379
FT                   /locus_tag="CLL_A0220"
FT   CDS_pept        229519..230379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0220"
FT                   /product="RNA methyltransferase, TrmH family, group 3"
FT                   /note="identified by match to protein family HMM PF00588;
FT                   match to protein family HMM PF08032; match to protein
FT                   family HMM TIGR00186"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0220"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24568"
FT                   /db_xref="GOA:B2TIF8"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIF8"
FT                   /protein_id="ACD24568.1"
FT                   /translation="MRENTKAGNKRDKNRENNKGNKREINKNRVVENNSYDNSFEERED
FT                   IIIGRNAVLEALKAERTIETLYISNSKLEGSINAIISKAKDKKILIKEVDKRKLDSMCN
FT                   NAVHQGVIARVTPYEYSEVSDILELAEKKGENPFIVILDEVEDPHNLGSIIRTAELFGV
FT                   HGIIIPKRRSASVTTMVYKSSVGAIEHVKVARVTNLNSVIDELKEKGIWVYGTDIRAEE
FT                   YSYQTDFGGACAIIIGNEGKGISKLTLKKCDKLIKIPMVGKINSLNASVAGGIIMYEVL
FT                   KGRLK"
FT   gene            230402..230914
FT                   /locus_tag="CLL_A0221"
FT   CDS_pept        230402..230914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0221"
FT                   /product="tetracycline resistance protein"
FT                   /note="identified by match to protein family HMM PF05991"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0221"
FT                   /db_xref="EnsemblGenomes-Tr:ACD21820"
FT                   /db_xref="InterPro:IPR010298"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIF9"
FT                   /protein_id="ACD21820.1"
FT                   /translation="MKIIFVDGYNVINSWPDLKIKKNNNFDGARRSLIDTMHNYGVYND
FT                   CKVIIVFDAHKVPGSIQKLEAVNKNLSIIFTKDGETADSYIEKEVNLLGRKYEVIVVTS
FT                   DWLEQQTIFQRGAVRMSSLEFYNEVLDVENSIRKRKNKSKVSDKNILSDNIDLEMLKKL
FT                   EKIRRSE"
FT   gene            231001..231621
FT                   /gene="sigH"
FT                   /locus_tag="CLL_A0222"
FT   CDS_pept        231001..231621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sigH"
FT                   /locus_tag="CLL_A0222"
FT                   /product="RNA polymerase sigma-H factor"
FT                   /note="identified by similarity to SP:P17869; match to
FT                   protein family HMM PF04542; match to protein family HMM
FT                   PF08281; match to protein family HMM TIGR02859; match to
FT                   protein family HMM TIGR02937"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0222"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22461"
FT                   /db_xref="GOA:B2TIG0"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014218"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR016371"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIG0"
FT                   /protein_id="ACD22461.1"
FT                   /translation="MGEFLEFKDKLDEEVVLEAKNGNTRAQEYMISKYENFVKAKAKSY
FT                   FLIGADREDIYQEGMIGLYKAIRDFKADKLTSFKAFAELCVTRQIITAIKTATRQKHIP
FT                   LNTYVSLNKPIYEEESERTLLDVLSGIKISDPEELLINKEHMDNIEAAIAKVLSDLELE
FT                   VLMSYLDGKSYQEIACDLDRHSKSIDNALQRVKRKLEKCLGIK"
FT   gene            231699..231774
FT                   /locus_tag="CLL_A0223"
FT   tRNA            231699..231774
FT                   /locus_tag="CLL_A0223"
FT                   /product="tRNA-Thr"
FT   gene            231833..233026
FT                   /gene="tuf"
FT                   /locus_tag="CLL_A0224"
FT   CDS_pept        231833..233026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tuf"
FT                   /locus_tag="CLL_A0224"
FT                   /product="translation elongation factor Tu"
FT                   /note="identified by match to protein family HMM PF00009;
FT                   match to protein family HMM PF03143; match to protein
FT                   family HMM PF03144; match to protein family HMM TIGR00231;
FT                   match to protein family HMM TIGR00485"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0224"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24211"
FT                   /db_xref="GOA:B2TIG1"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIG1"
FT                   /protein_id="ACD24211.1"
FT                   /translation="MSKEKFERSKPHVNIGTIGHVDHGKTTLTAAITTVLANRGFAEAF
FT                   NYAEIDKAPEEKERGITINTAHVEYETENRHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VCSAADGPMPQTREHILLASRVGVDYIVVFLNKADMVDDEELLELVEMEVRELLSEYNF
FT                   PGDDIPVIKGSALKALENPTDETAIAPILELMEAVDSYIPTPERATDKPFIMPVEDVFT
FT                   ITGRGTVATGRVETGILHVGDEVEIVGLSEEKKKVVVTGIEMFRKLLDEAQAGDNIGAL
FT                   LRGVQRADIERGQVIAVPNSVHPHTKFVGQVYVLKKEEGGRHTPFFDGYRPQFYFRTTD
FT                   VTGSIKLPDGMEMVMPGDHIDMNVELITPVAMDEGLRFAIREGGRTVGSGVVTKINA"
FT   gene            233389..233619
FT                   /gene="secE"
FT                   /locus_tag="CLL_A0225"
FT   CDS_pept        233389..233619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secE"
FT                   /locus_tag="CLL_A0225"
FT                   /product="preprotein translocase, SecE subunit"
FT                   /note="identified by match to protein family HMM PF00584;
FT                   match to protein family HMM TIGR00964"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0225"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24966"
FT                   /db_xref="GOA:B2TIG2"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIG2"
FT                   /protein_id="ACD24966.1"
FT                   /translation="MSVKDIAKTKDAPKNSGLLSFFREVKAELKIITWPSKDETKKAFV
FT                   AVGVFAIIYIILVGGLDFIFKNLFEMIFNFK"
FT   gene            233657..234178
FT                   /gene="nusG"
FT                   /locus_tag="CLL_A0226"
FT   CDS_pept        233657..234178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusG"
FT                   /locus_tag="CLL_A0226"
FT                   /product="transcription termination/antitermination factor
FT                   NusG"
FT                   /note="identified by match to protein family HMM PF02357;
FT                   match to protein family HMM TIGR00922"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0226"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22207"
FT                   /db_xref="GOA:B2TIG3"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIG3"
FT                   /protein_id="ACD22207.1"
FT                   /translation="MSDIARWYVVHTYSGYENKVKANLEKAIENRSLESLIYDMQVPME
FT                   EVIEEKDGKQKVSLKKKFPGYVLIKMLMTDESWYVVRNTRGVTGFVGPGSKPVPLSDEE
FT                   VEAMGVLEMPVEIDLEVGESIRIISGPLRDSVAKIQEIVLDKKKIKALVDMFGRETLAE
FT                   LDFNQVEKLV"
FT   gene            234257..234682
FT                   /gene="rplK"
FT                   /locus_tag="CLL_A0227"
FT   CDS_pept        234257..234682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplK"
FT                   /locus_tag="CLL_A0227"
FT                   /product="50S ribosomal protein L11"
FT                   /note="identified by match to protein family HMM PF00298;
FT                   match to protein family HMM PF03946; match to protein
FT                   family HMM TIGR01632"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0227"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23000"
FT                   /db_xref="GOA:B2TIG4"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2TIG4"
FT                   /protein_id="ACD23000.1"
FT                   /translation="MAKKVTGMIKLQLQAGKATPAPPVGPALGQHGVNIMGFCKEFNAK
FT                   TANQAGLIIPVVITVYQDRSFSFILKTPPAAVLIKKELGLESGSGVPNRTKVGSLTKEQ
FT                   VKKIAETKMPDLNAASIETAMKMIEGTARSMGVTIQE"
FT   gene            234737..235426
FT                   /gene="rplA"
FT                   /locus_tag="CLL_A0228"
FT   CDS_pept        234737..235426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplA"
FT                   /locus_tag="CLL_A0228"
FT                   /product="50S ribosomal protein L1"
FT                   /note="identified by match to protein family HMM PF00687;
FT                   match to protein family HMM TIGR01169"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0228"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22701"
FT                   /db_xref="GOA:B2TIG5"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2TIG5"
FT                   /protein_id="ACD22701.1"
FT                   /translation="MGKKYIESSKLIDKSALYNSTEALDLTVKTAKANFDETIELHVRL
FT                   GVDPRHADQQVRGAVVLPNGTGKTVRVLVFAKGDKATEAQEAGADFVGAEDLVQKIQSE
FT                   NWFDYDVVVATPDMMGVVGRIGRVLGPKGLMPNPKSGTVTFDVAKAIAEIKAGKVEYRV
FT                   DKTSIVHCPIGKKSFGTEKLKENFTTLMEALVKAKPAAAKGQYLKSITVSSTMGPGAKI
FT                   NPTKALD"
FT   misc_feature    235472..235601
FT                   /note="ribosomal protein L10 leader"
FT   gene            235637..236140
FT                   /gene="rplJ"
FT                   /locus_tag="CLL_A0229"
FT   CDS_pept        235637..236140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplJ"
FT                   /locus_tag="CLL_A0229"
FT                   /product="50S ribosomal protein L10"
FT                   /note="identified by match to protein family HMM PF00466"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0229"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23433"
FT                   /db_xref="GOA:B2TIG6"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIG6"
FT                   /protein_id="ACD23433.1"
FT                   /translation="MNKNRQLKEAKVAEIKEKLEKAKAVVFAKYQGLTVEEDTALRKNL
FT                   REAGVEYKVYKNTLVSIAAKELGLDGAVEYLEGPVAIAFGYEDVTVGARVLNDFAKDHK
FT                   KLELKAGVVEGEVYDSEKIKQLATIPSKEVLIAKLLGSIKSPLSNFAYLLSAIKDSKES
FT                   ESAE"
FT   gene            236198..236560
FT                   /gene="rplL"
FT                   /locus_tag="CLL_A0230"
FT   CDS_pept        236198..236560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplL"
FT                   /locus_tag="CLL_A0230"
FT                   /product="50S ribosomal protein L7/L12"
FT                   /note="identified by match to protein family HMM PF00542;
FT                   match to protein family HMM TIGR00855"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0230"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24210"
FT                   /db_xref="GOA:B2TIG7"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2TIG7"
FT                   /protein_id="ACD24210.1"
FT                   /translation="MTREDIIQAIKEMSVLELNELVKACEEEFGVSAAAPVAVAGAVAG
FT                   GAAEEKTEFDVILASAGANKIKVIKAVREITGLGLKEAKEIVDGAPKTLKEAVSKEEAE
FT                   DMKAKLAEVGAEVEVK"
FT   gene            236925..240674
FT                   /gene="rpoB"
FT                   /locus_tag="CLL_A0231"
FT   CDS_pept        236925..240674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoB"
FT                   /locus_tag="CLL_A0231"
FT                   /product="DNA-directed RNA polymerase, beta subunit"
FT                   /EC_number="2.7.7.6"
FT                   /note="identified by match to protein family HMM PF00562;
FT                   match to protein family HMM PF04560; match to protein
FT                   family HMM PF04561; match to protein family HMM PF04563;
FT                   match to protein family HMM PF04565; match to protein
FT                   family HMM TIGR02013"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0231"
FT                   /db_xref="EnsemblGenomes-Tr:ACD21931"
FT                   /db_xref="GOA:B2TIG8"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2TIG8"
FT                   /protein_id="ACD21931.1"
FT                   /translation="MVHPVQVGKRTRMSFGKVKDVTEMPNLIEVQLDSYQWFLREGLHE
FT                   VFEDINPITNFTGNLVLEFVDYKLDMDNIKYSVEECKERDATYAAPLKVSVRLQNNETG
FT                   EIKEQEVFMGDFPLMTEQGTFIINGAERVIVSQLVRSPGVYYNYSIDKTGKKLYSATVI
FT                   PNRGAWLEYETDSNDIIYVRIDKTRKLPITILARAMGFGSDQELLDFFGEDERFRASIE
FT                   KDNTKTREEGLLEIYKRLRPGEPPTVDSAISLIDSLFFDAKRYDLSRVGRYKFNKKLAL
FT                   NLRIANQIAAMDVINPSTGEIMVEKGQKISRLLAEDIQNAGIKSVDILVDDKLVRVISN
FT                   NFVDITKQVPFDVSDLQIKELVHYPTLREILDNYSDETTIKEEIKKNLSRLIPKHIIKD
FT                   DIFATISYELGLPYGIGYVDDIDHLGNRRLRSVGELLQNQFRIGLSRMERVVKERMTIQ
FT                   DQESITPQMLINIRPVAAAIKEFFGSSQLSQFMDQTNPLSELTHKRRLSALGPGGLSRE
FT                   RAGFEVRDVHHSHYGRMCPIETPEGPNIGLINSLATFARVNEYGFIETPYRIVDKENAR
FT                   ATEEIRYFTADEEDQCLIAQAKEPLDENGYFVDKKVTVRYLEDVLVVPATDVDLMDVSA
FT                   RQIVSVATAMIPFLENDDASRALMGSNMQRQAVPLLKPQAPIVGTGIEFKAAVDSGVLP
FT                   KARNAGVVTFVSANEIRVKRDSDGGTDNYRLLKFKRSNQSSCINQRPIVNKGEIVFKNQ
FT                   VLADGPSTDLGEIALGKNIRMGFITWEGYNYEDAMLISEELVREDVFTSMHIEEYECEA
FT                   RDTKLGPEEITRDIPNVSEDALKDIDDRGIIRIGAEVRSGDILVGKVTPKGETELTAEE
FT                   RLLRAIFGEKAREVRDTSLRVPHGEAGIIVDIKVFTRENGDELNPGVNELVRCYIVQKR
FT                   KISVGDKMAGRHGNKGVISRILPEEDMPFLPDGRPLQICLNPLGVPSRMNIGQVLEVHL
FT                   GWAASKLGWHISTPVFDGATENEIEECLEKAGYNANGKTVLYDGRTGEPFDNLVTVGIM
FT                   YILKLAHLVDDKIHARSTGPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAAHTLQE
FT                   ILTVKSDDVVGRVKTYEAIVKGENIPEPGVPESFKVLIKELQALCLDVKVLNENHQEVS
FT                   LKEYTDDEIADLEVNIEGSEESVPVVPVVESNIEEVEVEVEVEVETETEDGYREDLDEI
FT                   EYDENFEIETLETDLELDDFNDEH"
FT   gene            240696..244229
FT                   /gene="rpoC"
FT                   /locus_tag="CLL_A0232"
FT   CDS_pept        240696..244229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoC"
FT                   /locus_tag="CLL_A0232"
FT                   /product="DNA-directed RNA polymerase, beta' subunit"
FT                   /EC_number="2.7.7.6"
FT                   /note="identified by match to protein family HMM PF00623;
FT                   match to protein family HMM PF04983; match to protein
FT                   family HMM PF04997; match to protein family HMM PF04998;
FT                   match to protein family HMM PF05000; match to protein
FT                   family HMM TIGR02386"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0232"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22857"
FT                   /db_xref="GOA:B2TIG9"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2TIG9"
FT                   /protein_id="ACD22857.1"
FT                   /translation="MFELNNFDAIQIGLASPEQIREWSRGEVKKPETINYRTLKPEKDG
FT                   LFCERIFGPMKDWECHCGKYKRVRYKGIVCDRCGVEVTKAKVRRERMGHIELAAPVSHI
FT                   WYFKGIPSRMGLLMDMSPRALEKVLYFASYIVIDPKETPLLKKQLLNEKEYREAIDKYG
FT                   EDSFVAGMGAEAIQDLLGQIDLIAGSKELKEDLKQSTGQKRVRIIRRLEVVESFAKSGN
FT                   NPKWMIINVIPVIPPDLRPMVQLDGGRFATSDLNDLYRRVINRNNRLKKLLDLGAPDII
FT                   VRNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSDMLKGKQGRFRQNLLGKRVDYS
FT                   GRSVIVVGPELKMYQCGLPKEMALELFKPFVMKKLVQDGIAHNIKSAKRMVERVLPQVW
FT                   DVLEEVITDHPVLLNRAPTLHRLGIQAFQPVLVEGRAIKLHPLACTAYNADFDGDQMAV
FT                   HVPLSVEAQAEARFLMLAAGNILKPSDGKPVCVPTQDMVLGSYYLTMDRTGAKGEGMTF
FT                   SNKDEAVMAYESKYIDIHAQINVRVYKEIDGVLKSGIIKTTVGKLIFNESIPQDLGFVN
FT                   REDEKEKFNLEIDFLVTKKSLGKVIDQSYMLHGPTKTSIMLDNIKALGYHYSSIGAVTV
FT                   AASDMIVPPVKYDLLHEADETIDKIEKMYKRGFISEDERYERVIEKWTKTTEEVADALM
FT                   DSLDKFNPIYMMADSGARGSKSQIKQLAGMRGLMASPSGKILELPIRASFREGLDVLEY
FT                   FISTHGARKGNADTALKTADSGYLTRRLVDVCQDVIVREEDCGTDNGIYVSEIKEGSEV
FT                   IEELRERLIGRYTAEDVVDPNSGEIIVARNEYMNPIIADKVVSAGIKKVKIRSAFTCNC
FT                   KIGVCAKCYGMNMATAKKIDIGEAVGIIAAQSIGEPGTQLTMRTFHTGGVAGSDITQGL
FT                   PRVEELFEARKPKGLAIVSEIHGNVRIEETKKKRAVFVMGADGDERSYDIPFGSRLKVS
FT                   DGDYIEAGDEITEGSVNPHDIMNIKGVDGARRYLLSEVQKVYRLQGVDINDKHLEVVVK
FT                   QMTRKVKILESGDTELLPGIMIDIFDFQEANDKVREFGGEEAKGEQSLLGITKAALATD
FT                   SFLSAASFQETTRVLTEAAIKGKVDPLIGLKENVIIGKLIPAGTGMMKYKGLNLNTKNE
FT                   KIEENETEIVE"
FT   gene            244527..244904
FT                   /gene="rpsL"
FT                   /locus_tag="CLL_A0233"
FT   CDS_pept        244527..244904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsL"
FT                   /locus_tag="CLL_A0233"
FT                   /product="30S ribosomal protein S12"
FT                   /note="identified by match to protein family HMM PF00164;
FT                   match to protein family HMM TIGR00981"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0233"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24789"
FT                   /db_xref="GOA:B2TIH0"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2TIH0"
FT                   /protein_id="ACD24789.1"
FT                   /translation="MPTISQLVRKGRKSTAVKSTAPALKECPQKRGVCTVVKTTTPKKP
FT                   NSALRKIARVRLTNGFEVTAYIGGVGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDC
FT                   AGVANRMQGRSKYGAKKPKQK"
FT   gene            245050..245520
FT                   /gene="rpsG"
FT                   /locus_tag="CLL_A0234"
FT   CDS_pept        245050..245520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsG"
FT                   /locus_tag="CLL_A0234"
FT                   /product="30S ribosomal protein S7"
FT                   /note="identified by match to protein family HMM PF00177;
FT                   match to protein family HMM TIGR01029"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0234"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24776"
FT                   /db_xref="GOA:B2TIH1"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2TIH1"
FT                   /protein_id="ACD24776.1"
FT                   /translation="MPRKGHIAKRDVLPDPVYNSKVVTKFINSIMEDGKKGVAQKICYE
FT                   AFELIAQRSGKEALEVFEEAMNNVMPLLEVKARRIGGATYQVPMEVRTERRQTLGIRWM
FT                   LIAARKRGEKLMCERVAGELLDASNNTGAAVKKREDTHKMAEANKAFAHYRY"
FT   gene            245599..247665
FT                   /gene="fusA"
FT                   /locus_tag="CLL_A0235"
FT   CDS_pept        245599..247665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fusA"
FT                   /locus_tag="CLL_A0235"
FT                   /product="translation elongation factor G"
FT                   /note="identified by match to protein family HMM PF00009;
FT                   match to protein family HMM PF00679; match to protein
FT                   family HMM PF03144; match to protein family HMM PF03764;
FT                   match to protein family HMM TIGR00231; match to protein
FT                   family HMM TIGR00484"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0235"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22465"
FT                   /db_xref="GOA:B2TIH2"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2TIH2"
FT                   /protein_id="ACD22465.1"
FT                   /translation="MARKYPLDKFRNFGIMAHIDAGKTTTTERILFYTGINHKIGETHD
FT                   GASTMDWMVQEQERGITITSAATTCAWKEHELNIIDTPGHVDFTVEVERSLRVLDGAVT
FT                   VLDAKSGVEPQTETVWRQADKYGVPRMIYVNKMDATGADFFRCISTVRDRLKGNAVPIQ
FT                   IPIGSEENFQGMIDLIRNVAILFYDDLGKDMREEAIPAEYAEKAEEYRAAMIEAIAEAD
FT                   EELMMKYLEGEEITEEELKAGLRKATIANEIYPCICGSSYKNKGVQQMIDGVVDYLPSP
FT                   LDIPAVKGTNLEGEEAERNAADGEPLSALAFKIATDPFVGKLAYTRIYSGIMESGSYVL
FT                   NSTKGKKERIGRLVKMHSNSRQEVESLEAGELGAVIGLKNTGTGDTLCSEKDPIILESM
FT                   EFPEPVISVAIEPKTKAAQEKMGMALAKLAEEDPTFKTWTNEETGQTIIAGMGELHLDI
FT                   IVDRLKREFKVECNVGAPQVAYKETIRKAVKAEAKYAKQSGGKGQYGHAVIEMEPTEGE
FT                   YVFENAIVGGAIPREYIPAVDNGIQEASLNGIIAGYNVINFKVRLVHGSYHEVDSSEMA
FT                   FKIAGSMAFKNAMAKADPVLLEPVEKVEITVPEEYMGDVIGDVNSRRGRMEGMEEVSGA
FT                   QVIRAFVPLSEMFGYATSLRSRTQGRGVYSMVFDHYEEVPKSIQEEVAGNKTK"
FT   gene            247759..248952
FT                   /gene="tuf"
FT                   /locus_tag="CLL_A0236"
FT   CDS_pept        247759..248952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tuf"
FT                   /locus_tag="CLL_A0236"
FT                   /product="translation elongation factor Tu"
FT                   /note="identified by match to protein family HMM PF00009;
FT                   match to protein family HMM PF03143; match to protein
FT                   family HMM PF03144; match to protein family HMM TIGR00231;
FT                   match to protein family HMM TIGR00485"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0236"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23275"
FT                   /db_xref="GOA:B2TIG1"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIG1"
FT                   /protein_id="ACD23275.1"
FT                   /translation="MSKEKFERSKPHVNIGTIGHVDHGKTTLTAAITTVLANRGFAEAF
FT                   NYAEIDKAPEEKERGITINTAHVEYETENRHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VCSAADGPMPQTREHILLASRVGVDYIVVFLNKADMVDDEELLELVEMEVRELLSEYNF
FT                   PGDDIPVIKGSALKALENPTDETAIAPILELMEAVDSYIPTPERATDKPFIMPVEDVFT
FT                   ITGRGTVATGRVETGILHVGDEVEIVGLSEEKKKVVVTGIEMFRKLLDEAQAGDNIGAL
FT                   LRGVQRADIERGQVIAVPNSVHPHTKFVGQVYVLKKEEGGRHTPFFDGYRPQFYFRTTD
FT                   VTGSIKLPDGMEMVMPGDHIDMNVELITPVAMDEGLRFAIREGGRTVGSGVVTKINA"
FT   gene            249430..249738
FT                   /gene="rpsJ"
FT                   /locus_tag="CLL_A0237"
FT   CDS_pept        249430..249738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsJ"
FT                   /locus_tag="CLL_A0237"
FT                   /product="30S ribosomal protein S10"
FT                   /note="identified by match to protein family HMM PF00338;
FT                   match to protein family HMM TIGR01049"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0237"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23645"
FT                   /db_xref="GOA:B2TIH4"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2TIH4"
FT                   /protein_id="ACD23645.1"
FT                   /translation="MSKQKIRIRLKAFDHTILDQSAEKIVETAKTSGAKVVGPVPLPTE
FT                   KDVVTILRAVHKYKDSREQFEIRTHKRLIDIVNPSPKTVDALMRLNLPAGVDIEIKL"
FT   gene            249811..250440
FT                   /gene="rplC"
FT                   /locus_tag="CLL_A0238"
FT   CDS_pept        249811..250440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplC"
FT                   /locus_tag="CLL_A0238"
FT                   /product="50S ribosomal protein L3"
FT                   /note="identified by match to protein family HMM PF00297"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0238"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23577"
FT                   /db_xref="GOA:B2TIH5"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2TIH5"
FT                   /protein_id="ACD23577.1"
FT                   /translation="MKKAIMGKKIGMTQIFNEAGKVIPVTVVEAGPCVVVQKKTVEKDG
FT                   YEAIQVGFGDIREKLVNKPAKGHFEKAGVVLKRTLKEFRLEDVSQYEVGQEIKADVFEI
FT                   GDKIDVSGVSKGKGFQGVIKRWNQQRGPMTHGSKFKRAPGSMGASSDPSRTFKNKRMPG
FT                   HMGCVNTTVMNLEVVKVIAEKNLLLIKGGIPGPNKGTVVIRNAVKA"
FT   gene            250466..251086
FT                   /gene="rplD"
FT                   /locus_tag="CLL_A0239"
FT   CDS_pept        250466..251086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplD"
FT                   /locus_tag="CLL_A0239"
FT                   /product="50S ribosomal protein L4"
FT                   /note="identified by match to protein family HMM PF00573"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0239"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24358"
FT                   /db_xref="GOA:B2TIH6"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2TIH6"
FT                   /protein_id="ACD24358.1"
FT                   /translation="MPTVGLFNQEGKQVGDIQLNANVFEVEVNKHALHQVVVALLANKR
FT                   QGTQSAKTRTEVRGGGIKPWRQKGTGRARQGSIRAPQWIKGGIVFAPKPRDYRVSIPKS
FT                   MRRVAMKSALTSKVNDGQMVVLESLSFEAPKTKQFIEMLSAFNAKKTLIITAESNEAVY
FT                   KSARNIQGVSVIPVNNINVYDLLKFEKLIITKDAVSKIEEVYA"
FT   gene            251086..251382
FT                   /gene="rplW"
FT                   /locus_tag="CLL_A0240"
FT   CDS_pept        251086..251382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplW"
FT                   /locus_tag="CLL_A0240"
FT                   /product="50S ribosomal protein L23"
FT                   /note="identified by match to protein family HMM PF00276"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0240"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23111"
FT                   /db_xref="GOA:B2TIH7"
FT                   /db_xref="InterPro:IPR001014"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2TIH7"
FT                   /protein_id="ACD23111.1"
FT                   /translation="MKLTSHDIIRKPVITEKSMAAMAEKKYTFMVHVNANKSQVKRAVE
FT                   EVFDVKVKDVNTINGLGKTKRMGVHVGKRSDYKKAIVTLTEESKAIEFFDGLQ"
FT   gene            251442..252275
FT                   /gene="rplB"
FT                   /locus_tag="CLL_A0241"
FT   CDS_pept        251442..252275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplB"
FT                   /locus_tag="CLL_A0241"
FT                   /product="50S ribosomal protein L2"
FT                   /note="identified by match to protein family HMM PF00181;
FT                   match to protein family HMM PF03947; match to protein
FT                   family HMM TIGR01171"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0241"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24700"
FT                   /db_xref="GOA:B2TIH8"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2TIH8"
FT                   /protein_id="ACD24700.1"
FT                   /translation="MAVKKFNPITPSRRQMTMPTFEEITSQQPEKSLLVSLKSKAGRNA
FT                   QGKITVRHRGGGVKRKYRIIDFKRNKDSIPAKVATIEYDPNRSAYIALVVYTDGEKRYI
FT                   IAPAGLKVGDVIVSGPDSDIKPGNALPLKNIPVGTVIHNIELQKGKGGQLVRSAGNSAQ
FT                   LMAKEGNYATLRLPSGEMRYVRIECRATIGTVSNPTNDIVNIGKAGRKRHMGWRPTVRG
FT                   SVMNPNDHPHGGGEGKSPVGRPSPVTPWGKPALGYKTRKNKKYSDRFIIKGRNAK"
FT   gene            252343..252621
FT                   /gene="rpsS"
FT                   /locus_tag="CLL_A0242"
FT   CDS_pept        252343..252621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsS"
FT                   /locus_tag="CLL_A0242"
FT                   /product="30S ribosomal protein S19"
FT                   /note="identified by match to protein family HMM PF00203;
FT                   match to protein family HMM TIGR01050"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0242"
FT                   /db_xref="EnsemblGenomes-Tr:ACD21795"
FT                   /db_xref="GOA:B2TIH9"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2TIH9"
FT                   /protein_id="ACD21795.1"
FT                   /translation="MSRSTKKAPFVHEGLLKKIEEMNASGDKKVVKTWSRSSTIYPQMI
FT                   GHTIAVHDGRKHVPVYLSEDMVGHKLGEFVLTRTYRGHVADKTSKRK"
FT   gene            252642..252977
FT                   /gene="rplV"
FT                   /locus_tag="CLL_A0243"
FT   CDS_pept        252642..252977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplV"
FT                   /locus_tag="CLL_A0243"
FT                   /product="50S ribosomal protein L22"
FT                   /note="identified by match to protein family HMM PF00237;
FT                   match to protein family HMM TIGR01044"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0243"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22733"
FT                   /db_xref="GOA:B2TII0"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/TrEMBL:B2TII0"
FT                   /protein_id="ACD22733.1"
FT                   /translation="MEARAIAKYIRMSPMKVRVILDLIRGKQVKEAFAILEYTPREAAV
FT                   VIKKVLKSAVANAENNLELNADNLYVSEAYVGEGPILKRFRPMDHGKAFRINKRTSHVT
FT                   VVVKERA"
FT   gene            252996..253661
FT                   /gene="rpsC"
FT                   /locus_tag="CLL_A0244"
FT   CDS_pept        252996..253661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsC"
FT                   /locus_tag="CLL_A0244"
FT                   /product="30S ribosomal protein S3"
FT                   /note="identified by match to protein family HMM PF00189;
FT                   match to protein family HMM PF00417; match to protein
FT                   family HMM PF07650; match to protein family HMM TIGR01009"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0244"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23467"
FT                   /db_xref="GOA:B2TII1"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2TII1"
FT                   /protein_id="ACD23467.1"
FT                   /translation="MGQKVHPHGLRVGVIKGWDAKWYANKKDFADNLVEDNQIRKFVKK
FT                   ELFSAGISKIEIERAAKRVKLNIYTAKPGVVIGKGGSGIESLKKKLTNYISGKNILINI
FT                   VEVKSVEAEAQLMAENIAAQLEKRISFRRAMKQTMQRAMRHGIKGVKTSCSGRLGGAEI
FT                   ARTEHYHEGTIPLQTLRADIDYGFAEANTTYGKIGVKVWVYKGEVLPTKKVEKEEANA"
FT   gene            253679..254113
FT                   /gene="rplP"
FT                   /locus_tag="CLL_A0245"
FT   CDS_pept        253679..254113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplP"
FT                   /locus_tag="CLL_A0245"
FT                   /product="50S ribosomal protein L16"
FT                   /note="identified by match to protein family HMM PF00252;
FT                   match to protein family HMM TIGR01164"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0245"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24631"
FT                   /db_xref="GOA:B2TII2"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2TII2"
FT                   /protein_id="ACD24631.1"
FT                   /translation="MLMPKRVKHRKVQRGRMKGRATRGNFLAYGDFGLQATTCGWITSN
FT                   QIEAARIAINRYIKRGGKLWIKIFPDKPVTEKPAETRMGSGKGSPEYWVAVVKPDRVVF
FT                   ELSGVTEDVAREAMRLASHKLPVRTKFVTRRDFEEMGGEK"
FT   gene            254113..254325
FT                   /gene="rpmC"
FT                   /locus_tag="CLL_A0246"
FT   CDS_pept        254113..254325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmC"
FT                   /locus_tag="CLL_A0246"
FT                   /product="50S ribosomal protein L29"
FT                   /note="identified by match to protein family HMM PF00831;
FT                   match to protein family HMM TIGR00012"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0246"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22383"
FT                   /db_xref="GOA:B2TII3"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2TII3"
FT                   /protein_id="ACD22383.1"
FT                   /translation="MKARELKELRSSNPQDLTLKLGDLKAELFNLRFQLATGQLENPMR
FT                   IREVKKSIAQIKTILREDEMRALEQ"
FT   gene            254349..254603
FT                   /gene="rpsQ"
FT                   /locus_tag="CLL_A0247"
FT   CDS_pept        254349..254603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsQ"
FT                   /locus_tag="CLL_A0247"
FT                   /product="30S ribosomal protein S17"
FT                   /note="identified by match to protein family HMM PF00366"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0247"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22620"
FT                   /db_xref="GOA:B2TII4"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2TII4"
FT                   /protein_id="ACD22620.1"
FT                   /translation="MERTLRKKRNGRVVSDKMDKTVVVAVETKVRHPLYGKTINKTTKF
FT                   KVHDEKNEAKINDRVLIMETRPLSKDKRWRLVEIVEKAK"
FT   gene            254632..255000
FT                   /gene="rplN"
FT                   /locus_tag="CLL_A0248"
FT   CDS_pept        254632..255000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplN"
FT                   /locus_tag="CLL_A0248"
FT                   /product="50S ribosomal protein L14"
FT                   /note="identified by match to protein family HMM PF00238;
FT                   match to protein family HMM TIGR01067"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0248"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23902"
FT                   /db_xref="GOA:B2TII5"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2TII5"
FT                   /protein_id="ACD23902.1"
FT                   /translation="MIQPQTLLKVADNSGAKEIMCIRVLGGSKRKFGNISDVIVASVKS
FT                   ATPGGVVKKGEVVKAVIVRSAKGLRRADGSYIKFDENAAVIIKDDKQPRGTRIFGPVAR
FT                   ELRDKEFNKILSLAPEVL"
FT   gene            255016..255330
FT                   /gene="rplX"
FT                   /locus_tag="CLL_A0249"
FT   CDS_pept        255016..255330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplX"
FT                   /locus_tag="CLL_A0249"
FT                   /product="50S ribosomal protein L24"
FT                   /note="identified by match to protein family HMM PF00467;
FT                   match to protein family HMM TIGR01079"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0249"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25035"
FT                   /db_xref="GOA:B2TII6"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2TII6"
FT                   /protein_id="ACD25035.1"
FT                   /translation="MKVHVRKSDTVVVISGKDKGKTGEVLKVYPKTGKVLVQGINIVKK
FT                   HQKANKSQVESAIIEREAAINSSKVMLYCNKCKNATRIASKILDDGTKVRVCKKCSETF
FT                   "
FT   gene            255354..255893
FT                   /gene="rplE"
FT                   /locus_tag="CLL_A0250"
FT   CDS_pept        255354..255893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplE"
FT                   /locus_tag="CLL_A0250"
FT                   /product="50S ribosomal protein L5"
FT                   /note="identified by match to protein family HMM PF00281;
FT                   match to protein family HMM PF00673"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0250"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24577"
FT                   /db_xref="GOA:B2TII7"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2TII7"
FT                   /protein_id="ACD24577.1"
FT                   /translation="MTRLQEKYSKEVIPAMIEKFGYKNVMEIPKLEKIVINMGVGEAKE
FT                   NQKVLESAVSDLSLIAGQKPILTRAKKSVANFKIRENMALGCKVTLRKAKMYEFADKLM
FT                   SIALPRVRDFRGVSAKAFDGRGNYSLGIKEQLIFPEIEYDKIDKVRGMDIIFVTTANTD
FT                   EEARELLRFLGMPFAQ"
FT   gene            255910..256095
FT                   /gene="rpsN"
FT                   /locus_tag="CLL_A0251"
FT   CDS_pept        255910..256095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsN"
FT                   /locus_tag="CLL_A0251"
FT                   /product="30S ribosomal protein S14"
FT                   /note="identified by match to protein family HMM PF00253"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0251"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23312"
FT                   /db_xref="GOA:B2TII8"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR023053"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2TII8"
FT                   /protein_id="ACD23312.1"
FT                   /translation="MARKAIIEKWSKTPKYKTRAYTRCRICGRPHAVLRKYGVCRICFR
FT                   ELAYKGEIPGCRKASW"
FT   gene            256126..256524
FT                   /gene="rpsH"
FT                   /locus_tag="CLL_A0252"
FT   CDS_pept        256126..256524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsH"
FT                   /locus_tag="CLL_A0252"
FT                   /product="30S ribosomal protein S8"
FT                   /note="identified by match to protein family HMM PF00410"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0252"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24464"
FT                   /db_xref="GOA:B2TII9"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2TII9"
FT                   /protein_id="ACD24464.1"
FT                   /translation="MVMTDPIADLLTRVRNANAVKHEVVEVPSSNVKKAITNILLQEGY
FT                   IKNIEEYNDGVVPMLRISLKYGANNERVITGIKRISKPGLRVYCKKDEVPKVLNGLGVA
FT                   VISTSKGLVVDREARKDGLGGEVLCYVW"
FT   gene            256597..257139
FT                   /gene="rplF"
FT                   /locus_tag="CLL_A0253"
FT   CDS_pept        256597..257139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplF"
FT                   /locus_tag="CLL_A0253"
FT                   /product="50S ribosomal protein L6"
FT                   /note="identified by match to protein family HMM PF00347"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0253"
FT                   /db_xref="EnsemblGenomes-Tr:ACD21768"
FT                   /db_xref="GOA:B2TIJ0"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2TIJ0"
FT                   /protein_id="ACD21768.1"
FT                   /translation="MSRVGRLPIAVPAGITVTVTPDNVVTVKGPKGELVKTMHKDINIA
FT                   VENNEVIVTRPSDQKAHRALHGLTRALINNMVIGVNEGYQKTLELVGVGYRAQLQGKKL
FT                   VMNLGYSHPVEIEPIEGITFETPAATKVIVKGIDKEKVGAAAADIRKWRLPEPYKGKGI
FT                   KFENEVIRRKEGKTGKK"
FT   gene            257158..257520
FT                   /gene="rplR"
FT                   /locus_tag="CLL_A0254"
FT   CDS_pept        257158..257520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplR"
FT                   /locus_tag="CLL_A0254"
FT                   /product="50S ribosomal protein L18"
FT                   /note="identified by match to protein family HMM PF00861;
FT                   match to protein family HMM TIGR00060"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0254"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23905"
FT                   /db_xref="GOA:B2TIJ1"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2TIJ1"
FT                   /protein_id="ACD23905.1"
FT                   /translation="MFKKVDKKASRTKRHLRVRKKVFGTPDRPRLSVFRSEKNIYVQII
FT                   DDVNAVTIVAASSLDKEFSTNNGGNKEGAKLVGAAVAKKAIEKGITEVVFDRGGYVYHG
FT                   RVQELAEGAREAGLKF"
FT   gene            257540..258037
FT                   /gene="rpsE"
FT                   /locus_tag="CLL_A0255"
FT   CDS_pept        257540..258037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsE"
FT                   /locus_tag="CLL_A0255"
FT                   /product="30S ribosomal protein S5"
FT                   /note="identified by match to protein family HMM PF00333;
FT                   match to protein family HMM PF03719; match to protein
FT                   family HMM TIGR01021"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0255"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23322"
FT                   /db_xref="GOA:B2TIJ2"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIJ2"
FT                   /protein_id="ACD23322.1"
FT                   /translation="MRIDPSTLDLKEKVVDINRVTKVVKGGRNFRFSALVVVGDENGHV
FT                   GVGMGKSIEIPEAIKKGIEDAKKNLVEVAMLGTTVPHQINGKFGTGNVLIMPAKQGTGV
FT                   IAGGPARSVLELAGLKDVRAKSLGSNNPKNMVKATINGLASLRTAEDIAKLRGKSVEEI
FT                   LG"
FT   gene            258049..258228
FT                   /gene="rpmD"
FT                   /locus_tag="CLL_A0256"
FT   CDS_pept        258049..258228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmD"
FT                   /locus_tag="CLL_A0256"
FT                   /product="50S ribosomal protein L30"
FT                   /note="identified by match to protein family HMM PF00327;
FT                   match to protein family HMM TIGR01308"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0256"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22975"
FT                   /db_xref="GOA:B2TIJ3"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2TIJ3"
FT                   /protein_id="ACD22975.1"
FT                   /translation="MAKLKITLVKSLIGRKKEHIATANALGLRKIRATVEHEGTPQIKG
FT                   MLKKIDYLLKVEEI"
FT   gene            258252..258692
FT                   /gene="rplO"
FT                   /locus_tag="CLL_A0257"
FT   CDS_pept        258252..258692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplO"
FT                   /locus_tag="CLL_A0257"
FT                   /product="50S ribosomal protein L15"
FT                   /note="identified by match to protein family HMM PF00256;
FT                   match to protein family HMM PF01305; match to protein
FT                   family HMM TIGR01071"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0257"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22017"
FT                   /db_xref="GOA:B2TIJ4"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2TIJ4"
FT                   /protein_id="ACD22017.1"
FT                   /translation="MKLHELQPAAGSRKAPKRVGRGTGSGLGRNAGKGEKGQNARSGGG
FT                   VRPGFEGGQMPLYRRLPKRGFTNIFAKRYVSINVDRLNIFENGTEITPEVLLERRVVSK
FT                   VLDGVKILGNGNLEKSLIVKGCKFSKSAIEKIEAAGGKVEVI"
FT   gene            258694..259974
FT                   /locus_tag="CLL_A0258"
FT   CDS_pept        258694..259974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0258"
FT                   /product="preprotein translocase, SecY subunit"
FT                   /note="identified by match to protein family HMM PF00344;
FT                   match to protein family HMM TIGR00967"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0258"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23441"
FT                   /db_xref="GOA:B2TIJ5"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIJ5"
FT                   /protein_id="ACD23441.1"
FT                   /translation="MLQTLRNAFKVSELRKKFFWIILLVAVFRIGSHIPVPGINADYLK
FT                   SISQSGGLLSFYDLLSGGAFSRFSIFALGVMPYINASIIMQLLTVAIPQLEQLSKEGED
FT                   GRKKIQNATRYVSLGISFILAFGIYATISNSGATAGIKTSEMLVIIFALVVGSTFCMWL
FT                   GDQLTVNGIGNGTSILIFVNIVSRIPMTMGSIAASKQAGNVSIIEVALFAAFFVALLAI
FT                   VLYFSLAERRIPVQYAGKAVGGSKMMRNQTSHIPLSIIGSAVIAIIFAMSVMDFPRTIA
FT                   TFVPNKSWAMWILTNKTCVFNSESWMYIVLYAILTLFFTWFYTQITFKPDEMAENLHKS
FT                   TGFIPGVRPGEATTRYFERILNRVSVIGGILAAILAVTPTIVQNYTEFKNISFSGTALL
FT                   IIIGVALDFNRQVESQMTMRHYKGFLK"
FT   gene            259999..260646
FT                   /gene="adk"
FT                   /locus_tag="CLL_A0259"
FT   CDS_pept        259999..260646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adk"
FT                   /locus_tag="CLL_A0259"
FT                   /product="adenylate kinase"
FT                   /EC_number="2.7.4.3"
FT                   /note="identified by match to protein family HMM PF00406;
FT                   match to protein family HMM PF05191; match to protein
FT                   family HMM TIGR01351"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0259"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22915"
FT                   /db_xref="GOA:B2TIJ6"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR007862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2TIJ6"
FT                   /protein_id="ACD22915.1"
FT                   /translation="MKIVLLGPPGAGKGTQAKSISNRYSIPHISTGDIFRKNISENTPL
FT                   GMEARSYMDKGLLVPDEVTINMVKDRLQEEDCLSGYLLDGFPRTVAQAEALNEFLENRN
FT                   EQLDTALLIDVPSEFILDRMTGRRVCTSCGGSFHIKFNPPTIDGKCNLCGSDIVQRKDD
FT                   TVETVKERIDVYDKQTQPLIEFYKSKNLLSMVDGTKAIDQVFEDICKLLGEQ"
FT   gene            260650..261399
FT                   /gene="map"
FT                   /locus_tag="CLL_A0260"
FT   CDS_pept        260650..261399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="map"
FT                   /locus_tag="CLL_A0260"
FT                   /product="methionine aminopeptidase, type I"
FT                   /EC_number="3.4.11.18"
FT                   /note="identified by match to protein family HMM PF00557;
FT                   match to protein family HMM TIGR00500"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0260"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22537"
FT                   /db_xref="GOA:B2TIJ7"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIJ7"
FT                   /protein_id="ACD22537.1"
FT                   /translation="MIIIKNNDEIALMRKAGRIVAETLLLLEENIKPGITTAELDRVAE
FT                   EFITKHGAKPSFKGLYGFPSSLCISVNEQVVHGIPGNYKIKDGDIVSIDCGAFIDGFHG
FT                   DAARTFPIGEVTNNAKRLIDVTKESFFEGIKYAKEGNRLGNISHEIQNYIEAAGFSVVR
FT                   DFVGHGIGRKLHEDPEVPNFGREGKGTKLLNGMVLAIEPMVNMGNCKVKTLSNGWTVVT
FT                   ADATLSAHYENTVAILPDGPEILTLIK"
FT   gene            261488..261769
FT                   /locus_tag="CLL_A0261"
FT   CDS_pept        261488..261769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0261"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0261"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22375"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIJ8"
FT                   /protein_id="ACD22375.1"
FT                   /translation="MQSNDLIGKIVLSKAGRDIEHLYVIVRQLDGNYVLLSNGNTKTIN
FT                   KPKKKKLKHLNILEKVDEELKSSIQVCDKSTDLKIKRFLKLRSIVKEG"
FT   gene            261777..261995
FT                   /gene="infA"
FT                   /locus_tag="CLL_A0262"
FT   CDS_pept        261777..261995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infA"
FT                   /locus_tag="CLL_A0262"
FT                   /product="translation initiation factor IF-1"
FT                   /note="identified by match to protein family HMM PF00575;
FT                   match to protein family HMM PF01176; match to protein
FT                   family HMM TIGR00008"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0262"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24876"
FT                   /db_xref="GOA:B2TIJ9"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIJ9"
FT                   /protein_id="ACD24876.1"
FT                   /translation="MSKDDVIEMQGTVLESLPNAMFQVELESGHKILAHISGKLRMNFI
FT                   RILPGDKVTVELSPYDLTRGRITWRAK"
FT   gene            262049..262162
FT                   /gene="rpmJ"
FT                   /locus_tag="CLL_A0263"
FT   CDS_pept        262049..262162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmJ"
FT                   /locus_tag="CLL_A0263"
FT                   /product="50S ribosomal protein L36"
FT                   /note="identified by match to protein family HMM PF00444;
FT                   match to protein family HMM TIGR01022"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0263"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23940"
FT                   /db_xref="GOA:B2TIK0"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2TIK0"
FT                   /protein_id="ACD23940.1"
FT                   /translation="MKVRPSVKPICEKCKVIKRKGRVMVICENPKHKQKQG"
FT   gene            262368..262736
FT                   /gene="rpsM"
FT                   /locus_tag="CLL_A0264"
FT   CDS_pept        262368..262736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsM"
FT                   /locus_tag="CLL_A0264"
FT                   /product="30S ribosomal protein S13"
FT                   /note="identified by match to protein family HMM PF00416"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0264"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22953"
FT                   /db_xref="GOA:B2TIK1"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2TIK1"
FT                   /protein_id="ACD22953.1"
FT                   /translation="MARIAGVDLPREKRVEIALTYIYGIGLSTSQKILSTTGISPDARV
FT                   KDLSEDEVNEIRTYINKNLMVEGDLRRDVALNIKRLVEIGSYRGIRHRRGLPVRGQKTK
FT                   TNARTRKGPKKTMANKKK"
FT   gene            262756..263148
FT                   /gene="rpsK"
FT                   /locus_tag="CLL_A0265"
FT   CDS_pept        262756..263148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsK"
FT                   /locus_tag="CLL_A0265"
FT                   /product="30S ribosomal protein S11"
FT                   /note="identified by match to protein family HMM PF00411"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0265"
FT                   /db_xref="EnsemblGenomes-Tr:ACD21943"
FT                   /db_xref="GOA:B2TIK2"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIK2"
FT                   /protein_id="ACD21943.1"
FT                   /translation="MAQKVKKTRRRKERKNVEHGAAHIKSTFNNSIVTLTDAVGNALSW
FT                   SSAGALGFRGSRKSTPFAAQMAAETAAKSAMEHGLKSIEVYVKGPGSGREAAIRSLQAA
FT                   GLEVTLIKDVTPIPHNGCRPPKRRRV"
FT   gene            263176..263796
FT                   /gene="rpsD"
FT                   /locus_tag="CLL_A0266"
FT   CDS_pept        263176..263796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsD"
FT                   /locus_tag="CLL_A0266"
FT                   /product="30S ribosomal protein S4"
FT                   /note="identified by match to protein family HMM PF00163;
FT                   match to protein family HMM PF01479; match to protein
FT                   family HMM TIGR01017"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0266"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24428"
FT                   /db_xref="GOA:B2TIK3"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2TIK3"
FT                   /protein_id="ACD24428.1"
FT                   /translation="MARYTGATCRLCRREGMKLFLKGDRCFTDKCAFVRRSYAPGQHGA
FT                   SKKKMSNYGIQLREKQKARRIYGILEGQFRTYYEKAEHMKGITGENLLKLLEMRLDNVV
FT                   YRLGYGASRNEARQLVTHGHFLVNGKKVDICSYHVSMNDVITVCEKSRSSEKFKTFVEN
FT                   PKTLPKWLEANVDNYEGKVVAEPSREDIDVPVNETLIVELYSK"
FT   gene            263908..264855
FT                   /gene="rpoA"
FT                   /locus_tag="CLL_A0267"
FT   CDS_pept        263908..264855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoA"
FT                   /locus_tag="CLL_A0267"
FT                   /product="DNA-directed RNA polymerase, alpha subunit"
FT                   /EC_number="2.7.7.6"
FT                   /note="identified by match to protein family HMM PF01000;
FT                   match to protein family HMM PF01193; match to protein
FT                   family HMM PF03118; match to protein family HMM TIGR02027"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0267"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23340"
FT                   /db_xref="GOA:B2TIK4"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2TIK4"
FT                   /protein_id="ACD23340.1"
FT                   /translation="MLEIEKPIIECIEASEDGTYGKYVVEPLERGYGITLGNALRRILL
FT                   SSLPGVATSSVKIDGVLHEFSTVQGVKEDVTELILNIKSLALRMNGEGPKVIYIDAKGP
FT                   GEVTGADIKTDGDVEVVNKDLHIATLDDNGRLYMELTVNRGRGYVTQNKNKSDELPISS
FT                   IAIDSIYTPVKKVNFTVDNTRVGQITDYDKLTLEIWTNGTIKIDEAISLSAKILIEHFK
FT                   LFMSLTNNTNDVEIMIEKEEDKKEKVLEMTVEELDLSVRSYNCLKRAGINTVQELATKS
FT                   MDDMMKVRNLGKKSLEEVERKLKELGLCLKLNDE"
FT   gene            264868..265209
FT                   /gene="rplQ"
FT                   /locus_tag="CLL_A0268"
FT   CDS_pept        264868..265209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplQ"
FT                   /locus_tag="CLL_A0268"
FT                   /product="50S ribosomal protein L17"
FT                   /note="identified by match to protein family HMM PF01196;
FT                   match to protein family HMM TIGR00059"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0268"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22396"
FT                   /db_xref="GOA:B2TIK5"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2TIK5"
FT                   /protein_id="ACD22396.1"
FT                   /translation="MAGYRKLGLPTDQRRAMLRNLVTSLLKHGKIETTVTRAKETRSIA
FT                   EKMITLGKRGDLHARRQALAFIQEELVVKNLFDNVAPKYAERNGGYTRMYKKGPRRGDG
FT                   AEVVILELV"
FT   gene            265462..266313
FT                   /locus_tag="CLL_A0269"
FT   CDS_pept        265462..266313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0269"
FT                   /product="cobalt import ATP-binding protein CbiO 3"
FT                   /EC_number="3.6.3.-"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0269"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24793"
FT                   /db_xref="GOA:B2TIK6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015856"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030947"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIK6"
FT                   /protein_id="ACD24793.1"
FT                   /translation="MNQEMVNCTDVCFKYIRNEEGAREEKYALKNVNLKVKKGEFLVVL
FT                   GHNGSGKSTIAKHMNALLMPSSGTVIVDNLSTSEENNLWEIRSRAGMVFQNPDNQLVAT
FT                   IVEEDVAFGPENLGVEAKEIRKRVDESLEKVGMSEYKRHAPHLLSGGQKQRIAIAGILA
FT                   IQPKCIIFDEPTAMLDPSGRKDVLKTIKDINKNYGITIVLITHYMDEAAQADRIVVMDG
FT                   GEVKMEGTPKEIFPQVEMMKNIGLDVPQVTELTYELRKEGIDIPKEILNVDEMVNAICQ
FT                   LK"
FT   gene            266298..267155
FT                   /locus_tag="CLL_A0270"
FT   CDS_pept        266298..267155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0270"
FT                   /product="cobalt import ATP-binding protein CbiO 2"
FT                   /EC_number="3.6.3.-"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0270"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23857"
FT                   /db_xref="GOA:B2TIK7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015856"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030946"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIK7"
FT                   /protein_id="ACD23857.1"
FT                   /translation="MSIKVENLTHTYMPKTPFEKVALDNVNIEIEDGEFVALIGHTGSG
FT                   KSTFIQHLNGLLEATSGTIIVDGLDITKKQINLTDVRKKVGLVFQYPEYQIFEETIAKD
FT                   IAFGPKNLGLTEDEIKTRVIESMKMVGLDYETYKDQSPFDLSGGQKRRVAIAGVIAMKP
FT                   TTLILDEPTAGLDPKGRDDILEQISKLHKEYNMTIILVSHSMEDVAKIAQRIVVMNHGK
FT                   VELQGKPSEVFKEVDKLEKIGLGVPQVTYLVRELRKKGFEISDDIFTIEGAKKELLRIL
FT                   KEKN"
FT   gene            267251..268054
FT                   /locus_tag="CLL_A0271"
FT   CDS_pept        267251..268054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0271"
FT                   /product="cobalt transport permease, CbiQ family"
FT                   /note="identified by match to protein family HMM PF02361"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0271"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23598"
FT                   /db_xref="GOA:B2TIK8"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="InterPro:IPR024919"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIK8"
FT                   /protein_id="ACD23598.1"
FT                   /translation="MLKDITIGQYIPGESFIHKLDPRTKIMISILFIVCLFIINKFVGY
FT                   TFVFVFLASIILIAKIPLRFIFNGLKPVFLLIALTAVLNVFMIKGTPETLLFKVGFLSV
FT                   YVEGLRLAGFMALRLIFLIVGTSILTLTTSPIELTDGIEKLIRPIGKEMAHELAMMMTI
FT                   ALRFIPTLMDETDKIMKAQKARGADFESGNIINKAKSLVPLLVPLFISSFRRADELAMA
FT                   MEARGYRGGAGRTRMKVLRFTSKDIIAFVVFSLLILWSLVVRVIL"
FT   gene            268070..268804
FT                   /gene="truA"
FT                   /locus_tag="CLL_A0272"
FT   CDS_pept        268070..268804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="truA"
FT                   /locus_tag="CLL_A0272"
FT                   /product="tRNA pseudouridine synthase A"
FT                   /EC_number="5.4.99.12"
FT                   /note="identified by match to protein family HMM PF01416;
FT                   match to protein family HMM TIGR00071"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0272"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22731"
FT                   /db_xref="GOA:B2TIK9"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2TIK9"
FT                   /protein_id="ACD22731.1"
FT                   /translation="MRNIKLIIEFDGTNFCGWQRQIKDRTVQGCLEKAILKITGEKSLT
FT                   NGSSRTDGGVHAKAMVANFITNSSIPGEKFREALNTKLPDDIAVIKSEEVDMDFHARYS
FT                   SKGKMYSYTIVNRYEKLSFGKQYVHHVRKELNVEDMKKACECFIGKHDFKAFMSPGSSA
FT                   KTTVRTIQEFYIEKNEDVIKIFISADGFLYNMVRIIVGTLINIGTGKTKLEDVDNIIND
FT                   GIRKRSGMCVPPNGLVLEKVFY"
FT   gene            268963..269397
FT                   /gene="rplM"
FT                   /locus_tag="CLL_A0273"
FT   CDS_pept        268963..269397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplM"
FT                   /locus_tag="CLL_A0273"
FT                   /product="50S ribosomal protein L13"
FT                   /note="identified by match to protein family HMM PF00572;
FT                   match to protein family HMM TIGR01066"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0273"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22052"
FT                   /db_xref="GOA:B2TIL0"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR023563"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2TIL0"
FT                   /protein_id="ACD22052.1"
FT                   /translation="MKSYIAKAQEVERKWYVVDAAGKPLGRVASQVASILRGKNKPTFT
FT                   PNVDCGDFVIVINAEEVALTGKKLDQKMLRKHSFYPGGLKETPYREVLAKKPEFAFEEA
FT                   VRRMLPKGVLGRQMLKKLKVYRGAEHDHAAQKPEVLELKY"
FT   gene            269425..269817
FT                   /gene="rpsI"
FT                   /locus_tag="CLL_A0274"
FT   CDS_pept        269425..269817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsI"
FT                   /locus_tag="CLL_A0274"
FT                   /product="30S ribosomal protein S9"
FT                   /note="identified by match to protein family HMM PF00380"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0274"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24529"
FT                   /db_xref="GOA:B2TIL1"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2TIL1"
FT                   /protein_id="ACD24529.1"
FT                   /translation="MAKVQYMGTGRRKKSVARVRLVPGNGKVVINKREIETFFGLETLR
FT                   VIVNQPLVLTGTKDKFDVLVNVHGGGFTGQAGAIRHGITRALVKSDETLRPELKKAGFL
FT                   TRDPRMKERKKYGLKKARRAPQFSKR"
FT   gene            270136..271749
FT                   /locus_tag="CLL_A0275"
FT   CDS_pept        270136..271749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0275"
FT                   /product="Na/Pi-cotransporter family protein/PhoU family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF01895;
FT                   match to protein family HMM PF02690; match to protein
FT                   family HMM TIGR00704"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0275"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24909"
FT                   /db_xref="GOA:B2TIL2"
FT                   /db_xref="InterPro:IPR003841"
FT                   /db_xref="InterPro:IPR004633"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIL2"
FT                   /protein_id="ACD24909.1"
FT                   /translation="MESIIMVIIKLMGGLGLFIYGMKLMGDGLENAAGDGLKKILEKVT
FT                   SNPISAVFIGAVVTAVIQSSSATTVMVVGFVNAGLMNLAQAAGIIMGANIGTTVTAQLV
FT                   SFKLDQIAPLFVFVGAAMVMFARGKKRKDIGNIILGFGILFTGMGIMSAAMKPLTSAPL
FT                   FSDFIVSIGNNWFIGVIAGAAITAILQSSSATTGILVALAGANAIDIRIALPIIFGCNI
FT                   GTCITAMIASVGTNKTAHKAAMLHLVFNITGTIIFLPFLGVLGDFVSTTSTDVSRQIAN
FT                   AHTVFNLANTAILLPLNKYIIMLINKLIPGEDEIEKKGPKYIDNRLLETPVIAAGQVIK
FT                   ETIRMANKARKNLELSMKSFIDNDDTLVKQVYENEEIINILEESITAYLVKLSKCDLSD
FT                   KEKGIVASTFHVIIDIERIGDHARNIAELANQKIHKKLKYSEEAMGELYDIYNTTVEAL
FT                   EIAIDSYATRDFEKAKTIIEVERKIDTYQKTYRDKHIKRLYEEKCNAYAGAIFLDLVNN
FT                   FERIGDHSTNIAESVIENYK"
FT   gene            272062..272724
FT                   /gene="cwlD"
FT                   /locus_tag="CLL_A0276"
FT   CDS_pept        272062..272724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cwlD"
FT                   /locus_tag="CLL_A0276"
FT                   /product="N-acetylmuramoyl-L-alanine amidase CwlD"
FT                   /EC_number="3.5.1.28"
FT                   /note="identified by similarity to SP:P50864; match to
FT                   protein family HMM PF01520; match to protein family HMM
FT                   TIGR02883"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0276"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23890"
FT                   /db_xref="GOA:B2TIL3"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="InterPro:IPR014234"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIL3"
FT                   /protein_id="ACD23890.1"
FT                   /translation="MNMKRVLSIFCIIFLILGIPTRVLAEENKSKHVIVIDPGHGGIDG
FT                   GAKSKKGTVEKDINLSISLKLKDQLEELGYNVYLTREDDSELDKKKVNDLNARCNMKKD
FT                   KNCEVFISIHQNMFPQPKCFGAQVWYSNNEKSKLLADNIQNSLKSNIDDGNKRVAKAAK
FT                   DQYRILRDGYDGACVLVECGFLSNNKEEENLKSDEHQEKIAKSISDAVNSYFENTNK"
FT   gene            complement(272933..273700)
FT                   /locus_tag="CLL_A0277"
FT   CDS_pept        complement(272933..273700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0277"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0277"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23330"
FT                   /db_xref="GOA:B2TIL8"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIL8"
FT                   /protein_id="ACD23330.1"
FT                   /translation="MNNINLNKIIRNIVYILTIFLIVLILYNCILLLNSGPFDKTSYKN
FT                   SLRVEKIVTDDIYDVFNINSSYKIKFKENDLNKIPSISKAEILMVNYDPITHESNYSAI
FT                   FFNNDFIKDSSIEIISYINENDFPNITFLEYENLKNEFNNNYIDTISLVDINFSFSNFL
FT                   YYNNEYHHFNNGVQNIDSSTKLPMTYKNIVIDASSQKENTLYVYSGGLFKEFQKDSSIY
FT                   LTKGKTFWMTLNTDSKITYNFSDVESKLKKQDK"
FT   gene            273835..274677
FT                   /locus_tag="CLL_A0278"
FT   CDS_pept        273835..274677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0278"
FT                   /product="fumarate hydratase"
FT                   /note="identified by match to protein family HMM PF05681;
FT                   match to protein family HMM TIGR00722"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0278"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22426"
FT                   /db_xref="GOA:B2TIL9"
FT                   /db_xref="InterPro:IPR004646"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIL9"
FT                   /protein_id="ACD22426.1"
FT                   /translation="MREVNVDCIIDAVKELSIKANYFLGEDIRQALEDSRDKETWNLAE
FT                   DILDKIIINSEIADKEHVPICQDTGMACVFVELGQDVHLIGGNLSEAINEGVRMGYEEG
FT                   FLRKSVVENPLKRINTNDNTPAVIYYDIVPGDKIKITVAPKGFGSENMSKITMLKPSDG
FT                   VEGVKEFILEVVRQAGPNPCPPMVIGVGIGGTFDKSAYLAKKALLRPINIRNDDEYYKD
FT                   LEIELLEKINELGIGPQGFGGRTTALGLNIETYPTHIAGLPVAVNINCHATRHKEIII"
FT   gene            274934..275491
FT                   /gene="fumB"
FT                   /locus_tag="CLL_A0279"
FT   CDS_pept        274934..275491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fumB"
FT                   /locus_tag="CLL_A0279"
FT                   /product="fumarate hydratase, class I"
FT                   /EC_number="4.2.1.2"
FT                   /note="identified by match to protein family HMM PF05683;
FT                   match to protein family HMM TIGR00723"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0279"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24453"
FT                   /db_xref="GOA:B2TIM0"
FT                   /db_xref="InterPro:IPR004647"
FT                   /db_xref="InterPro:IPR036660"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIM0"
FT                   /protein_id="ACD24453.1"
FT                   /translation="MEMKLHTPLTSEKILKLKAGDTVLLSGIIYSARDAAHKRLIELLD
FT                   KDEKLPLSIDNEIIYYVGPSPAKPGSVIGSAGPTTSYRMDSYAPRLLDLGLKGMIGKGA
FT                   RNEKVIKSIRKNKAIYFGAIGGAAALIAKSIVKSEIIAYEDLGAEAIRKMEVKDMPLVV
FT                   IIDSAGNNLYEIGQKDYLDTLK"
FT   gene            complement(275666..276523)
FT                   /locus_tag="CLL_A0280"
FT   CDS_pept        complement(275666..276523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0280"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF02588"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0280"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23533"
FT                   /db_xref="GOA:B2TIM1"
FT                   /db_xref="InterPro:IPR003740"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR019264"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIM1"
FT                   /protein_id="ACD23533.1"
FT                   /translation="MSKISKYKNLIIDTLIIFSGCFIASLGINLFLSHAKLLSGGATGL
FT                   ALILEYTMGLPSGIVVFVINIPLLLLSYKKLDRDFAIYTTIGMLSLSLSLMLTRPFTNI
FT                   IYVNDILLYCIYGGVLCGIGYGLVFLRHGSTGGTDVITMLIRKKYSNFNIGSLGFALNC
FT                   IIIIIGAIIFGLPQALYTLISLFTQSIVLDKMLKGFSSKKLLLILTEKEQEVINYVISD
FT                   LHRGITSLFAEGEYTHNKKKMLYCIVTTRQMLDLKTSIHYIDPAAFITIVDISEVKGRG
FT                   FKNL"
FT   gene            276779..277489
FT                   /locus_tag="CLL_A0281"
FT   CDS_pept        276779..277489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0281"
FT                   /product="TPR-repeat-containing protein"
FT                   /note="identified by match to protein family HMM PF00515"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0281"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24386"
FT                   /db_xref="GOA:B2TIL4"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIL4"
FT                   /protein_id="ACD24386.1"
FT                   /translation="MIKIKLPGSQKLKLTILIILLAITLIILGFEGINNRKKSEFINKQ
FT                   SIENAELIHGDSANLDKEVNEDKNNKIENEEEYKLYNEAYNLFFSGEYDKSIEKSNEII
FT                   SEFPNNAKGYNIRGIAKSYNESFEAGMKDIDKALEIEPQYGYAVFNKALTYELYGKLDE
FT                   ALLWYNKNLEIENYIWTYYGIASIYGRRGDVQNTVKYLSKAIEIDEVAKKEARDESDFN
FT                   PVRDSKEFKDLINN"
FT   gene            277568..278260
FT                   /locus_tag="CLL_A0282"
FT   CDS_pept        277568..278260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0282"
FT                   /product="regulatory protein VanR"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00486"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0282"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23894"
FT                   /db_xref="GOA:B2TIL5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIL5"
FT                   /protein_id="ACD23894.1"
FT                   /translation="MYNVLVVDDEKEIRDAIEIYLRGENLKVFKAADGLEALEILNNEK
FT                   IHVIVLDIMMPKLDGIRTCLKIRETENLPIIMLSAKGEDSDKILGLNVGADDYIIKPFN
FT                   HLELVARVKSQLRRYDKPLNIEDEEQVLTVKDLVIDTVSKSIIVRGEEIKVTATEYKIL
FT                   HLLASNLGKVFSIKEIYEKVWDEPFYKSENTVTVHIRRIREKIEINTKEPEYIKVVWGI
FT                   GYKIEKEI"
FT   gene            278232..280088
FT                   /locus_tag="CLL_A0283"
FT   CDS_pept        278232..280088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0283"
FT                   /product="sensor histidine kinase"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0283"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22940"
FT                   /db_xref="GOA:B2TIL6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIL6"
FT                   /protein_id="ACD22940.1"
FT                   /translation="MDIRLKKKFKANLKSYLKGIYLIDILLMVLITGMLFSSVFEYKDF
FT                   LKQNNNISLIKSVFNEKEYETKRLYEDSKGFSQIIYETTDGLYDLLTGSNEIKEKIGQL
FT                   MKYFNNDVEEYTSDFKLKDNVYFIIRNKHTKELYTNDPFLDSSIKYIKENQIDDLLNNR
FT                   FKKQGVVSIKFDNEKEYNYLVSKGLVNYLDDTIKNFEEVYYTSTDTYKQELMNIRKEII
FT                   SLSLLLLVYVFLIIKTVLIIARRGNKEEKIKSDILNSIMFVIRNGFKYKETSKTLLLSL
FT                   GIIIIILITYLYFLATGGYENNMFVRFFQTYPFKGTILIITGLVLTVIFNVKKTLDIAI
FT                   INEGLEKLNEGNLDEDIPAFGSITIRELINNINLIKEGYKNSLYERVKDEKLKTELISN
FT                   VSHDLKTPLTSIINYVNILKNNDITDDERKDYLAILDSKSLKLKSLIDDLFEMSKINSG
FT                   KIILNKDKLDILSLIHQGIGEYSFLYEYKNINFKVISNEDDMFMELDGKLISRALENII
FT                   INALKYSLDNTRVYIEIEKYDERVEIIVKNIANYEMDFDEEEIFERFARADKSRNSSVE
FT                   GSGLGLAITKSIVELHGGKTKIEREGDMFKIYIILPLNNKDC"
FT   gene            280291..282516
FT                   /locus_tag="CLL_A0284"
FT   CDS_pept        280291..282516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0284"
FT                   /product="ribonucleoside-diphosphate reductase, alpha
FT                   subunit"
FT                   /EC_number="1.17.4.1"
FT                   /note="identified by match to protein family HMM PF00317;
FT                   match to protein family HMM PF02867; match to protein
FT                   family HMM TIGR02506"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0284"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22757"
FT                   /db_xref="GOA:B2TIL7"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR008926"
FT                   /db_xref="InterPro:IPR013346"
FT                   /db_xref="InterPro:IPR013509"
FT                   /db_xref="InterPro:IPR039718"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIL7"
FT                   /protein_id="ACD22757.1"
FT                   /translation="MLRKLCNLAIEGIKDNDGTYTEEKLLKALEHIIRDGMDINDIRKS
FT                   LIQVSLDLTSDMEPNWQYSASTVYIYELYDKVRKNRNLDVKKNLYDNYYEFIKELTEKN
FT                   FYGEYILENYSKEDILELEKEIKPERDFLFNYSGIDLVTKRYLVQDFNRSVIELPQQMF
FT                   MGIAMHLAIPEVKEKRVYWAKRFYNVLSELKATMATPTMSNARKPFYQLSSCFVDTVDD
FT                   SLEGIYKSLDNFAKVSKFGGGMGIYIGKIRSLGSPIRGFKGASGGVIPWVKLFNDTAIA
FT                   VDQLGVRNGSVAIWLDAWHKDIPEFLQIRTNNGDDRKKAHDVFPGVCYPDLFWKLAEEN
FT                   VDNDWYMMCPHEIKNAKGYSLEDFYGEEWETKYFECVEDDRIEKRSIKIKDLVRLIIKS
FT                   AAETGAPFAFFRDNANKMNPNKHKGMIYSSNLCTEIMQNMSAMKVNGDTIIKENDKYNV
FT                   VQNIEAGDFVVCNLSSLVLGNIDVLNDEELECVVETQIRAMDNVIDLNYYSVPFAEITN
FT                   KRYRGIGLGTSGYHHMLANNKIHWTEEKHRTFVDKVYEKINYYSIKASMNLSKEKGKYE
FT                   LFEGSDWDNGNYFELRDYNDEKWIDLKQEVKSFGMRNGYLIAVAPNGSTATIAGTSEGI
FT                   DPIMARFYLEEKKGSIIPKTAPNLSEDNYWYYNTAYNLEQGWCVEMNGIRQRHIDQGQS
FT                   FNLYITTQYTMRQIMNLYIKACKCGVKSIYYVRSKSLEVTECESCSA"
FT   gene            282813..283847
FT                   /locus_tag="CLL_A0285"
FT   CDS_pept        282813..283847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0285"
FT                   /product="ribonucleoside-diphosphate reductase, beta
FT                   subunit"
FT                   /EC_number="1.17.4.1"
FT                   /note="identified by match to protein family HMM PF00268"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0285"
FT                   /db_xref="EnsemblGenomes-Tr:ACD21885"
FT                   /db_xref="GOA:B2TIM2"
FT                   /db_xref="InterPro:IPR000358"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR030475"
FT                   /db_xref="InterPro:IPR033909"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIM2"
FT                   /protein_id="ACD21885.1"
FT                   /translation="MEVKKKPLFNEFGDRDPRLKRVINGNTTNLNDFNNMKYTWASDWY
FT                   RQGMNNFWIPEEINLAQDLKDYKKLLPDERTAYDKILSFLIFLDSIQTANLSNINSYIT
FT                   ASEINLCLTIQSFQEAVHSQSYSYMLDSICSPEERNEILYQWKDDEILLKRNKFIGDLY
FT                   NEFINNPNEYNLIKTLMANYILEGIYFYSGFMFFYNLERNGKMPGSAQEIRYINRDENT
FT                   HLWLFRNIIKELQSENPESFTADLKNELREMMHIGVENEILWGHYVIGDKIQGINKKLI
FT                   EDYIKYLGNKRLKEIGLEPLFSGYEENPATWVDVVANSNSVKTDFFEAKSTAYAKVSTL
FT                   IDDL"
FT   gene            284040..285659
FT                   /gene="ptsP"
FT                   /locus_tag="CLL_A0286"
FT   CDS_pept        284040..285659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptsP"
FT                   /locus_tag="CLL_A0286"
FT                   /product="phosphoenolpyruvate-protein phosphotransferase"
FT                   /EC_number="2.7.3.9"
FT                   /note="identified by match to protein family HMM PF00391;
FT                   match to protein family HMM PF02896; match to protein
FT                   family HMM PF05524; match to protein family HMM TIGR01417"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0286"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24687"
FT                   /db_xref="GOA:B2TIM3"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR024692"
FT                   /db_xref="InterPro:IPR036618"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIM3"
FT                   /protein_id="ACD24687.1"
FT                   /translation="MRRGIAASKGYAIGKVFLTENEEIVITDASVSDIVSEKEKLQKAL
FT                   DSSKSQLQAIKDKAEKEMGAEKAAVFEAHITLLDDPEFTGAMMSEIETNSINGLKAIEN
FT                   VTNSFVTIFESMDNDYMRERAADIKDVSKRIISNFAGKGGDAFAITENNTVIVAHDLTP
FT                   SDTAQLDRSKVVGFITNIGGRTSHAAIMARTLEIPAVLGLGDITSSVKNGDMIIVDGLT
FT                   GDIIINPSEEVLTEYRAKQEKFKAEQEELKKLIDVKTTTKSGRRIEVCGNIGKPEDVLS
FT                   VVANGGDGVGLFRTEFLYMDRDSAPTEDEQFESYKFALEKMEGKQVVIRTLDIGGDKTL
FT                   PYLPLPEEMNPFLGYRAIRLCLDRKEIFKVQLRALLRASIYGNLCVMFPMISGLEEFLQ
FT                   AKEVVEECKAELKAEGKEYSEVIQWGIMVEIPAAAVYADELAKHVDFFSIGTNDLIQYT
FT                   LAADRMSEKVSYLYNPMHPAVLRLIKMTIDGAHKHGKWVGMCGEMAGDEAAIPTLVEYG
FT                   LDEFSMSATSILNAKKIILEQE"
FT   gene            285901..286434
FT                   /gene="chrA"
FT                   /locus_tag="CLL_A0287"
FT   CDS_pept        285901..286434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="chrA"
FT                   /locus_tag="CLL_A0287"
FT                   /product="chromate transport protein"
FT                   /note="identified by match to protein family HMM PF02417"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0287"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23702"
FT                   /db_xref="GOA:B2TIM4"
FT                   /db_xref="InterPro:IPR003370"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIM4"
FT                   /protein_id="ACD23702.1"
FT                   /translation="MNKILEMFISFFKIGAFTFGGGYAMIPLIEEEVVNKKKWLTKEEF
FT                   MDFLIVSQSLPGALAINCSAFIGQKIGGILGEVIAILAVTLPSFFIIILIATFFMQFRD
FT                   NYFVNLAFKGINAAVPMLILFGVISLSKGVKKNLRTLIMIVVALVALIVFNIHPVIVIL
FT                   VSAIYGMIFLREKV"
FT   gene            286438..286962
FT                   /locus_tag="CLL_A0288"
FT   CDS_pept        286438..286962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0288"
FT                   /product="putative chromate transport protein"
FT                   /note="identified by match to protein family HMM PF02417"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0288"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23099"
FT                   /db_xref="GOA:B2TIM5"
FT                   /db_xref="InterPro:IPR003370"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIM5"
FT                   /protein_id="ACD23099.1"
FT                   /translation="MILLKLFIAFFKIGAFSFGGGYAMIPFIQKEIITNNSWLTVSEFM
FT                   DIIGISQMTPGPVSINSATFVGFKVSGILGSLAATIGIITTSFILVTICSKTLEKFKDS
FT                   NLVKSALLGMRPILIALILQAFFDLAKESYLDIKSIIVTLIIGGLLLSHKVHPIICVLI
FT                   SAVLGIVFWSF"
FT   gene            287127..288395
FT                   /locus_tag="CLL_A0289"
FT   CDS_pept        287127..288395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0289"
FT                   /product="tetratricopeptide repeat domain protein"
FT                   /note="identified by match to protein family HMM PF00515"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0289"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22195"
FT                   /db_xref="GOA:B2TIM6"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIM6"
FT                   /protein_id="ACD22195.1"
FT                   /translation="MKKKNKRFYDKAIKYYQNGDLSKALKSCEESLSYSLKNPSILNLK
FT                   GLILYQQGKLDEAITVWKINKDFNNDGIAQNYIHSAKEDEVRVELYELGEKKLKELKID
FT                   EAIKIFKKCKESDFNCIKVDTALALCYQKKGEINKCIDYMNKVLVIDKNYKVANQIKSQ
FT                   LIDLKAYKKESNNFVKSMVVLVGVIFICGTVYIFKDNFKDINNDNNLSMESINKVEEDA
FT                   SNSEDVVTEDKKESEPKTPDVTTNEQDKKVLLDVNKLNEHFENGDVDNIYYDLQNVNEP
FT                   DVSDEYKGLYRRCVNLLKTSGIEVFYEKGMEEFNIQNYEKANVEFSKAYDYCDGSYLNE
FT                   HIMFYKAVTLEQLNNSDEAIKLYELYYEEYPKGSYADNTLYNLSLILNNTDREKSIYYA
FT                   DKLRDEFSESIYFNETINQILNS"
FT   gene            288441..289613
FT                   /gene="iadA"
FT                   /locus_tag="CLL_A0290"
FT   CDS_pept        288441..289613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iadA"
FT                   /locus_tag="CLL_A0290"
FT                   /product="beta-aspartyl peptidase"
FT                   /EC_number="3.4.19.5"
FT                   /note="identified by match to protein family HMM PF01979;
FT                   match to protein family HMM TIGR01975"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0290"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25167"
FT                   /db_xref="GOA:B2TIM7"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR010229"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIM7"
FT                   /protein_id="ACD25167.1"
FT                   /translation="MISIIKDIKVYSPEYIGIKDIVIAGGKIEGIYENLDISNTFIEVN
FT                   VIDGKNKIIFPGFIDSHVHLIGGGGEGGYKTRTPELQLSNLTSSGITTVVGCIGTDSEC
FT                   RGIKSLIAKVKSLKEEGLSSYCYTGSYAVPVKTLTGFIERDIMLIQEIIGVGEIALSDN
FT                   RSSEPTYEDFAKLVAQSRLGGILSSKSGVVNVHIGEGKRKLDYLFKLINESDIPSSQLL
FT                   PTHINRNTNLFMEGLRYVKEGGLIDLTTSSDVNFLEEGELTASEGLKKYIEAGLPIENI
FT                   TFSSDGNGSMPKFDKNKKIIGLGICSVESLYLQVKEGIKKYGIPIETAIKVITSNVADI
FT                   LKLYDKGRIEKGKDADLVIVDENSLDIDIVLCNGIKMVQDGECIVRGTFE"
FT   gene            complement(289714..290343)
FT                   /locus_tag="CLL_A0291"
FT   CDS_pept        complement(289714..290343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0291"
FT                   /product="spore-cortex-lytic enzyme, sleb"
FT                   /note="identified by match to protein family HMM PF07486"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0291"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24463"
FT                   /db_xref="GOA:B2TIM8"
FT                   /db_xref="InterPro:IPR011105"
FT                   /db_xref="InterPro:IPR042047"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIM8"
FT                   /protein_id="ACD24463.1"
FT                   /translation="MKKIYSLFIISLVLYLSVINNNVAYAQVLSDNFHTNVISKEENNE
FT                   TYLNNINLATQCNAELNENTTNKNIDDSTIEVFSYDTQKLYITENDIELMAKLVYAESI
FT                   GEPYDGKVAVASVVLNRVINPSFPNSIKEVIFQKNAFSCVKNGDIKATPNQTCYNAVYD
FT                   AIRGYDPTNEALFFYNPSTATCAWMHQTQKQDMKTIGHHTFFKIKS"
FT   gene            complement(290413..291399)
FT                   /locus_tag="CLL_A0292"
FT   CDS_pept        complement(290413..291399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0292"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0292"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23199"
FT                   /db_xref="GOA:B2TIM9"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIM9"
FT                   /protein_id="ACD23199.1"
FT                   /translation="MINFSIDKKFFKIISLLCGLFILILILLTLFFKNTELNKINKISK
FT                   TIVTINSSLKLDENDATLDFKNTKQILNENLNLLNSLDNNLTNLTLKKSDSNELKGNLS
FT                   NYLKLNINLYNSIISIINNKNNENFQSLYQDLIKNEEALTKETDKLSESGVKISIPKSL
FT                   NKFFISLNRSLNESYKSIRESDIISEQKRDFFVQINDLLNNFSGLKDDVKPALEKIRED
FT                   NRDLSIVIYDINEKRSNFNTIKDSSISISIPVGGENCYEALEEIIASYDSYINSLEKNI
FT                   KNEMNLRDKSKLTLNNIDELYTDTFDKYDYFLSCFDNLQKAILSYKH"
FT   gene            291577..292446
FT                   /locus_tag="CLL_A0293"
FT   CDS_pept        291577..292446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0293"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF02457;
FT                   match to protein family HMM TIGR00159"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0293"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22919"
FT                   /db_xref="GOA:B2TIN0"
FT                   /db_xref="InterPro:IPR003390"
FT                   /db_xref="InterPro:IPR014046"
FT                   /db_xref="InterPro:IPR034701"
FT                   /db_xref="InterPro:IPR036888"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIN0"
FT                   /protein_id="ACD22919.1"
FT                   /translation="MIVLQDFISLIIKSLSNISLWSILDISVVSYIFYKGYMLIKETRA
FT                   EQLLKGIALIIVLIPISYLLKLDMLYFILNKTLTIGVLSVIIIFQPEIRRGLEHIGRSA
FT                   FEDVHYANDKESINIAINEIVNAVHNLSETKTGALIVMEQKTGLAEIVSSGTILDANVS
FT                   SNLLENIFVVNTPLHDGATIIRNNKILASGCVLPLTNNNNINKKLGTRHRAGLGLSEVS
FT                   DALIIIVSEETGVVSLAINGKLSRGYDKERLRNILSNIIENRNKNKKNVKDAKERVRSW
FT                   VRGIKINH"
FT   gene            292416..293639
FT                   /locus_tag="CLL_A0294"
FT   CDS_pept        292416..293639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0294"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF07949"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0294"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22976"
FT                   /db_xref="InterPro:IPR012505"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIN1"
FT                   /protein_id="ACD22976.1"
FT                   /translation="MGKGNKNKSLVAKLICLLLSFGLWLYISNVENPVRTYELKGVPVE
FT                   LINKESISKSNLAIVGEESFTVDLTLEGATSEITKAKKDSFKLTADMSSYALKNGENII
FT                   PIQIVSYPQNINIKNNGFLGIKIKLETLITKDVSLKSQVNITYKENIYKKDLTVSPQKA
FT                   TISGPESQVNKVDRGILVGNIENLEKDINKKFPIKFVTKDNKEVKGITSNADEAELNIK
FT                   VNNGKTVPINIKTIGNSNDGISIESMVAEPKSVHIIGEDKILNSINSIDTQEINISNIT
FT                   ADAEVNTNLKLPEGVTIQENSQNVKVKFSVKKAQEVTKNISCAVEYTNLNPNLIIDSSK
FT                   STANVSISGLESVINSITEAELKATVDLSNISEVGTYTYKPSVISINNRTDFNILSVDE
FT                   VQIVLKNK"
FT   gene            293743..295338
FT                   /locus_tag="CLL_A0295"
FT   CDS_pept        293743..295338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0295"
FT                   /product="oxidoreductase, FAD-binding"
FT                   /note="identified by match to protein family HMM PF01266;
FT                   match to protein family HMM PF03486; match to protein
FT                   family HMM PF07992"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0295"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23493"
FT                   /db_xref="InterPro:IPR028348"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIN2"
FT                   /protein_id="ACD23493.1"
FT                   /translation="MSIRINNLTLSIDDNKEVLTKKICKKLKISDKGIKKLIIIKESLD
FT                   ARKKNEIKFNYCVDIKCDNEKKIVSKIKDNNVRLQEDDNCLQIEKGNVKLSHRPVVVGF
FT                   GPAGMFAALTLAKNGYKPIVFERGEDMDSRTNAVKSFWETGKLNIESNVQFGEGGAGAF
FT                   SDGKLTTRIKDPKCAYILDELVSAGAPEEIKYLGKPHVGTDILKGVVKNIREQIKELGG
FT                   EIHFNSKLEDIKYENNKLKSITVNESELDCEALVLAIGHSPRDTYEMLYKRGVSMEAKP
FT                   FAIGVRIEHPQELINISQYGEYHNHPRLGSAEYRLTYQSDKLKRGVYSFCMCPGGTVVA
FT                   SASEEGRLVSNGMSYHARNLANANSALVVTISTDDFEGDSPLRGMEFQRHYESLAFKLG
FT                   GGNYKAPIQLLGDFMNDRPSTKLGSVIPSYSPGYEFKELKNCLPSYVVEGIKEGIQNFS
FT                   KKIEGYGMEDAVLTGIETRTSAPVKIHRSKTLESITVQGLYPVGEGAGFAGGIVSSAVD
FT                   GVKVAEMIINQFMC"
FT   gene            295512..296420
FT                   /gene="ptb"
FT                   /locus_tag="CLL_A0296"
FT   CDS_pept        295512..296420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptb"
FT                   /locus_tag="CLL_A0296"
FT                   /product="phosphate butyryltransferase"
FT                   /EC_number="2.3.1.19"
FT                   /note="identified by similarity to GB:AAA75486.1; match to
FT                   protein family HMM PF01515; match to protein family HMM
FT                   TIGR02706"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0296"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22165"
FT                   /db_xref="GOA:B2TIN3"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR012147"
FT                   /db_xref="InterPro:IPR014079"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIN3"
FT                   /protein_id="ACD22165.1"
FT                   /translation="MSKNFDDLLSRLKATKKKKLSVAVAQDEPVLEAVMAAKEKGIADA
FT                   ILVGDQEKIRAIADKIKMDLTQFEIIHEPDIKKAALFAVQLVSSGRADMVMKGLVDTAT
FT                   FLRSVLNKEIGLRTGKVMSHVAVFEIEDIDRLIFLTDAAFNTYPDLKAKIQIVNNAVTV
FT                   AHACGIEVPKVAPVCAVEVVNPDMPATIDASLLTTMNNRGQIKGCIIDGPLALDNALSE
FT                   EAAHHKGITGPVAGKADIILLPNIETGNVMYKCLTYTSKSKSGGLLVGTSAPVILTSRA
FT                   DKFETKVNSIALAALVAENAK"
FT   gene            296444..297511
FT                   /gene="buk"
FT                   /locus_tag="CLL_A0297"
FT   CDS_pept        296444..297511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="buk"
FT                   /locus_tag="CLL_A0297"
FT                   /product="butyrate kinase"
FT                   /EC_number="2.7.2.7"
FT                   /note="identified by similarity to SP:Q05619; match to
FT                   protein family HMM PF00871; match to protein family HMM
FT                   TIGR02707"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0297"
FT                   /db_xref="EnsemblGenomes-Tr:ACD21995"
FT                   /db_xref="GOA:B2TIN4"
FT                   /db_xref="InterPro:IPR000890"
FT                   /db_xref="InterPro:IPR011245"
FT                   /db_xref="InterPro:IPR023865"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2TIN4"
FT                   /protein_id="ACD21995.1"
FT                   /translation="MSYKLLIINPGSTSTKIGVYENEKELFEETLRHTNEEIKRYETIY
FT                   DQFQFRKDVILNILKEKNFDITTLSAIVGRGGMLKPVEGGTYAVNDAMIEDLKVGVQGP
FT                   HASNLGGIIAKSIGDELNIPSFIVDPVVTDELDDVARLSGVPELPRKSKFHALNQKAVA
FT                   KRYGKDSGKGYENLNLIVVHMGGGVSVGAHKQGKVVDVNNALDGDGPFSPERAGTVPVG
FT                   DLIKMCFSGQYTESEVYTKVVGKGGFVGYLNTNDVKGVIDNMEAGDKDCEKIYKAFLYQ
FT                   ITKTIGEMAAALNGKVDQILLTGGIAYSPTLVPDLKSNVEWIAPVTVYPGEDELLALAQ
FT                   GAIRVLDGEEKAKIY"
FT   gene            297838..298671
FT                   /locus_tag="CLL_A0298"
FT   CDS_pept        297838..298671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0298"
FT                   /product="HTH DNA-binding protein"
FT                   /note="identified by match to protein family HMM PF01987"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0298"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24168"
FT                   /db_xref="GOA:B2TIN5"
FT                   /db_xref="InterPro:IPR002838"
FT                   /db_xref="InterPro:IPR016031"
FT                   /db_xref="InterPro:IPR036983"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIN5"
FT                   /protein_id="ACD24168.1"
FT                   /translation="MRSSLNITNKLTMLTEMENDSKFQILEYADLNGATDLETAFGLNV
FT                   INESNIKLKQIRIILDESSVKLESGLLSYMKGNIDIKSDIGGVFGLGKKFITSKLTGET
FT                   MFKPVYKGSGEIFLEPSFGHFALIELEDDEIIVDDGLFCACEDGIEVGASLQRNISSTF
FT                   LGNEGLCQTKISGNGIVALEIPVPETEIFKCILIDDTLKVDGNFAILRTGNIEFSVEKS
FT                   SKSITGAITSGEGFVNVYRGTGEVWLIPTKAIYDEMRTKGFKEMTKPSKERNTES"
FT   gene            298754..299050
FT                   /locus_tag="CLL_A0299"
FT   CDS_pept        298754..299050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0299"
FT                   /product="TrpR homolog, YerC/YecD family"
FT                   /note="identified by match to protein family HMM PF01371;
FT                   match to protein family HMM TIGR02531"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0299"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25145"
FT                   /db_xref="GOA:B2TIN6"
FT                   /db_xref="InterPro:IPR000831"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013368"
FT                   /db_xref="InterPro:IPR038116"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIN6"
FT                   /protein_id="ACD25145.1"
FT                   /translation="MSSSDSKIKSEELDLLFKGILELENIDECYNFFEDVATINEIKSL
FT                   AQRFYVAMLLKSKKTYTEIAEVTGASTATISRVNRCLNYGSNGYKVILEKLEK"
FT   gene            299340..300683
FT                   /gene="glmM"
FT                   /locus_tag="CLL_A0300"
FT   CDS_pept        299340..300683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmM"
FT                   /locus_tag="CLL_A0300"
FT                   /product="phosphoglucosamine mutase"
FT                   /EC_number="5.4.2.10"
FT                   /note="identified by match to protein family HMM PF00408;
FT                   match to protein family HMM PF02878; match to protein
FT                   family HMM PF02879; match to protein family HMM PF02880;
FT                   match to protein family HMM TIGR01455"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0300"
FT                   /db_xref="EnsemblGenomes-Tr:ACD21783"
FT                   /db_xref="GOA:B2TIN7"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR006352"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2TIN7"
FT                   /protein_id="ACD21783.1"
FT                   /translation="MDRMFGTDGVRGIANTELTAQIAYNLGRAGAYVLTEGAHKPKILV
FT                   AKDTRISGDMLESALVAGILSVGAEAVILGVVPTPAVAYLTREYNADAGVMISASHNPV
FT                   EYNGIKFFNNKGYKLSDELEDGIQKVIESDFEGVPSPIGIDLGRERIEVAALEDYTEFA
FT                   KQTIPYNLKGMKIALDCANGASYKSAVKAFRDLGADVFVINDNPDGTNINKNCGSTHPE
FT                   ELMDYVVKKGCDLGFAFDGDADRCLAVDENGKLINGDFILMLCANYLKEIGKLKDDTLV
FT                   VTVMSNLGLDIACRGFGIKLEKTKVGDRYVLEEMTKDNYVLGGEQSGHVIFLDYNTTGD
FT                   GLVTALQVASIVKKKEKTLSELCSVMKELPQVLVNATVPNDKKNIYLEDTEIVEAIKEI
FT                   EAKLNGVGRVLIRPSGTEPLVRVMLEGENQAEIDEMAHGLANLILSKI"
FT   gene            300967..302355
FT                   /locus_tag="CLL_A0301"
FT   CDS_pept        300967..302355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0301"
FT                   /product="putative Rhs element Vgr protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0301"
FT                   /db_xref="EnsemblGenomes-Tr:ACD21983"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIN8"
FT                   /protein_id="ACD21983.1"
FT                   /translation="MNDAITYKELKISTFELLYIKDLKINAGINEHSTLNLVGILPQEK
FT                   EDKDINTKCNTPIEVYTLEGEEKKPLYFGIITEIKIKRVAEYFELHVKAESYTYLMDIT
FT                   RRTRSFQNKDLSIYDFIQNITNKYIHGSCNMNIPYETINRLWLQYNETDWEFVKRIASY
FT                   YNVCLFAHSTLEGVHYYLGTPDEYPKSIEAYEYTVTKLIKEYEKIKENDLPDSDENQYI
FT                   NYNVKSHDILDLGACVNFKGHFFYVSKLTYEIEDGILETTYDLQTSQGQNQCRIYNEKL
FT                   QGISLEGTVTDVSSDEIKVKLDIDGKNENSEYCWFKYSTIAASPDGSGWYFMPEINDRA
FT                   RVYFPTHDENEAFAISCIHKINADPSVKYITTINGKKIIFSEDSITISANDSATITLSS
FT                   GGGISISGGSISLNASENISIRAEDSVVVSGKDNVELSCDKGGKVTLDNGGNVVLNGTK
FT                   VKIN"
FT   gene            302369..302734
FT                   /locus_tag="CLL_A0302"
FT   CDS_pept        302369..302734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0302"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0302"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24929"
FT                   /db_xref="InterPro:IPR025460"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIN9"
FT                   /protein_id="ACD24929.1"
FT                   /translation="MGISYVVDKAKIKCSKAIGESVLNKSPDNENLELHGKVMLTIADN
FT                   KPDINITPFPLCESKKNPEVIKNGMKPVPCKPSICNKWMKGEKDVYLNGELALNSGCEL
FT                   TCLYGGLIKIYDDGQRK"
FT   gene            302752..304203
FT                   /locus_tag="CLL_A0303"
FT   CDS_pept        302752..304203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0303"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0303"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23935"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIP0"
FT                   /protein_id="ACD23935.1"
FT                   /translation="MIMNYENIQVELPYEILQIEDLNFKAEINEHHTFNIKALIDENNV
FT                   DKYLNEDTENKQIKIIINNSTIYVGKIIELKISCINHLSYLNIKSISYSYNLDIKRNNN
FT                   AFINLKSTYENIINETLSKYKNYIFKDNITEGKSIDNLIVQYEETDFEFLKRLASHFKS
FT                   VLVVDSGSDVIRFHFGVENVSNKYILENSFNEIENKFDFFNTMQSVTKDCLYEQDFIGW
FT                   KLDNKEYFPLGTEFTYYGQKVCVYKVEMKIKKGEIIYTYELKFLKGIMTEYKINHKLKG
FT                   ASLEGIVKNVKNNEMQIHFCINDNYKDYASNKWFDYCRETSNFYVMPMVGSKVHITFFT
FT                   GDERKVNVTNAIRSAESNAKYYNKILNPSNKSYSTENGQELLMSPDMIQIAQDDGKSIQ
FT                   VTLSSNGSVSISGSNINLSASKKAEVGSKAPFNAKKNPVKPKSISISAKNCVTITRSSG
FT                   SSVNPSEVIQLKEENNIKGIAKLGR"
FT   gene            304234..304758
FT                   /locus_tag="CLL_A0304"
FT   CDS_pept        304234..304758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0304"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0304"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23242"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIP1"
FT                   /protein_id="ACD23242.1"
FT                   /translation="MKYFEMIQDNRISYDYKIENLEWEKLDTDEEEKEIVGIVSFKGKE
FT                   ESVPDFIAYKKRFFVSAELKKVMEMYSEDLKFNLVMFNNIENKIQKEYYDVQSPLIEGL
FT                   SDNSTYHKDHSVDKKIIKYEKVKEYPAFRLKEMETTQFSPKHIFVHLDIVESAIRRELW
FT                   GMIFEEIQVEE"
FT   gene            304761..305387
FT                   /pseudo
FT                   /locus_tag="CLL_A0305"
FT                   /note="hypothetical protein; this gene contains a frame
FT                   shift which may be the result of a sequencing error;
FT                   identified by glimmer; putative"
FT   gene            305392..306342
FT                   /locus_tag="CLL_A0306"
FT   CDS_pept        305392..306342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0306"
FT                   /product="pentapeptide repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0306"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23557"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIP3"
FT                   /protein_id="ACD23557.1"
FT                   /translation="MKEIEEKFLKEEAKPILEKYKEKVLLNILENEDKLKNQILEALMK
FT                   IAGKSKKDEEFKIKYIDFSILKIGILNKTYDVTAIAYGKEWYAGDMIYEVFNIDYIFQG
FT                   LEEIRNDLYQKIKKYVGKIKTCSVDQYILRQVAGYNEYLTYFFIKYLKQYDEEISFNEM
FT                   NKYETLRISYGDYKDYSQTVYYYDDSEKNEDIFKEELKENKIEKLVFSYWTGLKVENFK
FT                   IENQDITCMNLKRSDLQNFILKSCKAVGLNLKAAKLKKCRFISSDLGTTDFSSSILEDV
FT                   VFEDCILRNTKFKNAKLINVYAINNGKAVRLENKK"
FT   gene            306386..307387
FT                   /locus_tag="CLL_A0307"
FT   CDS_pept        306386..307387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0307"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0307"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22587"
FT                   /db_xref="InterPro:IPR029501"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIP4"
FT                   /protein_id="ACD22587.1"
FT                   /translation="MEIAIGIGLAVIACAISSLFVSANQKSSEGLSNAILEFVEESFET
FT                   LKFGVALIASSISGSKEDINCDIKEMTSAVASSSIGDSASRLCDIINTTQNDIISSAVD
FT                   KCWAPEVSGPSIEVFPANNDEGIIITDIPVTEVPSITILDTPIIVEQPNNVEVFPEQRV
FT                   DIPIIIDFPAEKQNEKDNIIFIEGVADPKLFKVSDSALNHSSVGDFTYNPKTGKVSKMK
FT                   GGGHGQANIDFLDANGLKYEVVDTYPNGVRVGNVADHKVKAKRTGSNQSWFPESWTESD
FT                   MVNAGEYVGNLKENINAVDGFISYGEVNGVRVGVIRTNGQISTVFPDATMQP"
FT   gene            307406..307708
FT                   /locus_tag="CLL_A0308"
FT   CDS_pept        307406..307708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0308"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0308"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22057"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIP5"
FT                   /protein_id="ACD22057.1"
FT                   /translation="MKERIKKVIEQRKKLNMNDDMGIQKCWEDITRILSESEENTIKYL
FT                   DDCEKDELYWISEVFEDISENLQSQEFIKCLRRLDMKFPELDMTNDIDLAEEYIM"
FT   gene            308470..309285
FT                   /locus_tag="CLL_A0309"
FT   CDS_pept        308470..309285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0309"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0309"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24931"
FT                   /db_xref="InterPro:IPR029501"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIP6"
FT                   /protein_id="ACD24931.1"
FT                   /translation="MAVGLVQGKALIDAFIAENKEDINCDIKEMTSATNSSGNSVSRLC
FT                   NIINTTQNDIISSAVDKCWAPEVSGPSIEVFPAHNDEGIIITDIPVTEVPSITILDTPA
FT                   IVEQPNNVEVFPEQRVETPIIIDFPAEKQSEKDNIIFIDGVGNTDSLFSQKALEHIFHG
FT                   NINGKGLPSGYHHNNINSQAKLSNVSATDKFGVYKATIEIDGRTKFSTFFPESWDRIKV
FT                   LKSIKEAHSTIKSNEAGWYTGTTNEGMKIKMWISDNGMIDTAFPIYSNK"
FT   gene            309298..309621
FT                   /locus_tag="CLL_A0310"
FT   CDS_pept        309298..309621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0310"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0310"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23947"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIP7"
FT                   /protein_id="ACD23947.1"
FT                   /translation="MKYDYSIFVDDNGYILFKFIKELKLLEYVFEDMSSFGEPIFREFI
FT                   KKVISDESKFEEVYGNMCGMKIRKDYTVITSEYVSSNVLNNLQIKTIELLHLIDMWIKK
FT                   NNL"
FT   gene            309642..310034
FT                   /locus_tag="CLL_A0311"
FT   CDS_pept        309642..310034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0311"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0311"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23610"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIP8"
FT                   /protein_id="ACD23610.1"
FT                   /translation="MFNIHDNEIVSYKVDLKNQKIIIHAEDNDLKPIKSTDIIFSDVLA
FT                   HFFENQLNGSVIFDIGEYNINQFVNENSELLEKQKNYCWPIDYDTIEELTEKLLKDKYC
FT                   YYVISSSYGLSGWVLAKNYEIINTNI"
FT   gene            complement(310111..310329)
FT                   /locus_tag="CLL_A0312"
FT   CDS_pept        complement(310111..310329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0312"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0312"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22986"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIP9"
FT                   /protein_id="ACD22986.1"
FT                   /translation="MLGISTSSYIGNVSILGTFNPSSDGNTSILGMSISSYAGNTSIVG
FT                   SFIPSGIQHLSTAELIISFCVILIISI"
FT   gene            310343..310714
FT                   /locus_tag="CLL_A0313"
FT   CDS_pept        310343..310714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0313"
FT                   /product="putative ribonuclease"
FT                   /note="identified by match to protein family HMM PF00545"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0313"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23516"
FT                   /db_xref="GOA:B2TIQ0"
FT                   /db_xref="InterPro:IPR000026"
FT                   /db_xref="InterPro:IPR016191"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIQ0"
FT                   /protein_id="ACD23516.1"
FT                   /translation="MDESDEMDNIIFIDGVTKNIDDIPWITLKSLPIDEERALLDSLKH
FT                   VDDGTIPNGNLSRRWAIPFRNRDGDLPSGSYREYRVAPPLGITNAGPRRIVKNIDTGEV
FT                   YYTWTHYGDAGEPAFVRIR"
FT   gene            310729..311199
FT                   /locus_tag="CLL_A0314"
FT   CDS_pept        310729..311199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0314"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0314"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24905"
FT                   /db_xref="InterPro:IPR000468"
FT                   /db_xref="InterPro:IPR035905"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIQ1"
FT                   /protein_id="ACD24905.1"
FT                   /translation="MKLLNGICCISSKDNSYVYKDLEDTGYNMHNIKGNDIKSIEDLFK
FT                   WFKKELPQDPPLSGRVNFDALVDSLWGGFDYQGKEKVAIIWTNPMKLIKKDKDRFRILI
FT                   ECLKELTETLTLEEYGINKPIFLKIILVEDDNLFVELNKLIKEIQNNVIKKA"
FT   gene            311378..311575
FT                   /locus_tag="CLL_A0315"
FT   CDS_pept        311378..311575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0315"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0315"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22208"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIQ2"
FT                   /protein_id="ACD22208.1"
FT                   /translation="MSSIETFPIYDDVDIPNIETFPMDESDEMDNIIFIDGVTQAKNLN
FT                   IPKSVARQVKKTFTRSKEEL"
FT   gene            311631..311759
FT                   /locus_tag="CLL_A0316"
FT   CDS_pept        311631..311759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0316"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0316"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23326"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIQ3"
FT                   /protein_id="ACD23326.1"
FT                   /translation="MGGDRSGQRAIDIKGIGQGRIVYETNSDGGIDIIQILTKNDY"
FT   gene            311775..312095
FT                   /locus_tag="CLL_A0317"
FT   CDS_pept        311775..312095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0317"
FT                   /product="putative erythrocyte membrane protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0317"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24110"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIQ4"
FT                   /protein_id="ACD24110.1"
FT                   /translation="MKMKHVLLEMYCSLKSDNEKPTYCEGVGHICIHNKCEYMGCTYCP
FT                   NEIAYANEHGVVEDELDFVGFGGDMNGNDDNKTKELIEKWNKICRKKIDEAYEEYMDYR
FT                   NS"
FT   gene            312361..312720
FT                   /locus_tag="CLL_A0318"
FT   CDS_pept        312361..312720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0318"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0318"
FT                   /db_xref="EnsemblGenomes-Tr:ACD21817"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIQ5"
FT                   /protein_id="ACD21817.1"
FT                   /translation="MNIEFLEDKLRSYEFKYPESFLKAIKLNLVDFDLWYIMDEERAIN
FT                   RLKGLKERYPNRKLIPFARRDDNDDIACFEANKGERVQIIHDFASVGYEQRKEYNCFWD
FT                   WLTEAIKVMIEYNKE"
FT   gene            312853..313914
FT                   /locus_tag="CLL_A0319"
FT   CDS_pept        312853..313914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0319"
FT                   /product="internalin-A"
FT                   /note="identified by match to protein family HMM PF00560"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0319"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22571"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR025875"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIQ6"
FT                   /protein_id="ACD22571.1"
FT                   /translation="MKILFSDKQFEYEIRKKIRKLSGDIEVEDLKSIIELKIIHYSDKP
FT                   QIASLEGIQYCDNLRKLELMGTYLNDIFLIKNIKKLEYLDLSDNNIKDISFICNIKTLK
FT                   YLNLSGNPIKNIDYINDIRSLERINLERTDCEVPNLSNPDKIISFGLPQNCFDLEFLNR
FT                   YKNLKEITLPSCLKTLEVIKEFKNLHNVESLSINNSKVSDLTPLSNLKRLKKLDSFANN
FT                   LDDISPIYNLKELISINVGINKISDISCIESLINLEYFIAEQNLIKDIVPLKNLFQLKE
FT                   LNLSGCRVSDISPLEKLKKLEILNLEDNLLTNINGIEKLDKLKEINLEYNEINDIEMLR
FT                   KLQEKRNDLEVIY"
FT   gene            314197..314610
FT                   /locus_tag="CLL_A0320"
FT   CDS_pept        314197..314610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0320"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0320"
FT                   /db_xref="EnsemblGenomes-Tr:ACD21823"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIQ7"
FT                   /protein_id="ACD21823.1"
FT                   /translation="MNIVPYNEYLLVMPNGDTKGFDDLELAKAYINIYYERVIDHKIDK
FT                   DDYNDATEIGAEEPRRNICTQLGVAEGRCEVYSIDNFIEVIRNNLVFDDEREEIISKLL
FT                   AKEISFNVYDYNLDTILVDIESIDMMEPYGDAD"
FT   gene            314985..315494
FT                   /gene="ilvN"
FT                   /locus_tag="CLL_A0321"
FT   CDS_pept        314985..315494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvN"
FT                   /locus_tag="CLL_A0321"
FT                   /product="acetolactate synthase, small subunit"
FT                   /EC_number="2.2.1.6"
FT                   /note="identified by match to protein family HMM PF01842;
FT                   match to protein family HMM TIGR00119"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0321"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22902"
FT                   /db_xref="GOA:B2TIQ8"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004789"
FT                   /db_xref="InterPro:IPR019455"
FT                   /db_xref="InterPro:IPR027271"
FT                   /db_xref="InterPro:IPR039557"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIQ8"
FT                   /protein_id="ACD22902.1"
FT                   /translation="MRKYVLSVLVKNSSGVLSRVSGLFSRRGYNIDSITAGRTEDPLVS
FT                   RMTITLSGDDDVLEQVKKQLNKLEDVIRVINITSDDSVYRELVLIKVKASGDERAAINE
FT                   TAKIFRCKVVDVSPNTLTIELTGDENKISALIKLMEEYGIEEMVRTGITALQRGISTIK
FT                   NSIDEC"
FT   gene            315668..316927
FT                   /gene="leuC"
FT                   /locus_tag="CLL_A0322"
FT   CDS_pept        315668..316927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuC"
FT                   /locus_tag="CLL_A0322"
FT                   /product="3-isopropylmalate dehydratase, large subunit"
FT                   /EC_number="4.2.1.33"
FT                   /note="identified by match to protein family HMM PF00330;
FT                   match to protein family HMM TIGR01343; match to protein
FT                   family HMM TIGR02083; match to protein family HMM
FT                   TIGR02086"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0322"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23689"
FT                   /db_xref="GOA:B2TIQ9"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR006251"
FT                   /db_xref="InterPro:IPR011823"
FT                   /db_xref="InterPro:IPR011826"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2TIQ9"
FT                   /protein_id="ACD23689.1"
FT                   /translation="MGMTMTQKILAAHAGLESVKAGQLIEVNLDLVLGNDITTPVAINE
FT                   FKKFGVDKVFNKSQIAIVPDHFTPNKDIKAAEQVKYVREFSNKMGIENFFEVGEMGIEH
FT                   CLLPEKGLVVAGDVVIGADSHTCTYGALGAFSTGIGSTDMAAGMATGQTWFKVPSAIKF
FT                   ILKNKPAKWVSGKDIILHIIGMIGVDGALYKSMEFVGDGLNYLSMDDRFTMANMAIEAG
FT                   GKNGIFPVDDKTVEYLKEHTKKEWEVYKADEDAEYDEVIEIELNTLRPTVSFPHLPDNT
FT                   RTIDNVGDIDIDQVVIGSCTNGRISDLRIARDILKGKKVKKGIRCIVIPGTQNIYLQAL
FT                   EEGIIKDLIEAGVVVSTPTCGPCLGGHMGILAKGERCVSTTNRNFVGRMGHVESEVYLA
FT                   SPAVAAASALTGKITDPELV"
FT   gene            316942..317427
FT                   /gene="leuD"
FT                   /locus_tag="CLL_A0323"
FT   CDS_pept        316942..317427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuD"
FT                   /locus_tag="CLL_A0323"
FT                   /product="3-isopropylmalate dehydratase, small subunit"
FT                   /EC_number="4.2.1.33"
FT                   /note="identified by match to protein family HMM PF00694;
FT                   match to protein family HMM TIGR02084; match to protein
FT                   family HMM TIGR02087"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0323"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24511"
FT                   /db_xref="GOA:B2TIR0"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR011824"
FT                   /db_xref="InterPro:IPR011827"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2TIR0"
FT                   /protein_id="ACD24511.1"
FT                   /translation="MNVKGRVFKYGDNVDTDVIIPARYLNTSNHKELASHCMEDIDKEF
FT                   VNNVKDGDIIVANKNFGCGSSREHAPIAIKAAGISCVIASTFARIFYRNSINIGLPILE
FT                   CDEAVKNINHGDELEVDFSTGIIKNLSKNEQYQGEAFPEFMQKIIDNDGLIGYIRNK"
FT   gene            317599..318681
FT                   /gene="leuB"
FT                   /locus_tag="CLL_A0324"
FT   CDS_pept        317599..318681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuB"
FT                   /locus_tag="CLL_A0324"
FT                   /product="3-isopropylmalate dehydrogenase"
FT                   /EC_number="1.1.1.85"
FT                   /note="identified by match to protein family HMM PF00180;
FT                   match to protein family HMM TIGR00169"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0324"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22751"
FT                   /db_xref="GOA:B2TIR1"
FT                   /db_xref="InterPro:IPR004429"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIR1"
FT                   /protein_id="ACD22751.1"
FT                   /translation="MKYNVAVIPGDGIGPDIVTEAVKVLNVVGEKFGHKFEYEYVMAGG
FT                   CSIDKNGEALPKETLDICKASDAVLLGAVGGPRWDDPDSKIRPEQALLGLRSGMNLYCN
FT                   LRPAVLYEPLKNASPLKDEMVKNGIDIAIVRELTGGIYFGERGRDEIDGIESAYDTERY
FT                   STVEIKRIVKIGFKTAMKRNKKLTCVDKANILETSRLWRKVIGEISKDYPEVNVNYLYI
FT                   DNASMQLVKDPTQFDVIVTSNMFGDILSDEASMITGSIGMLPSASLGEGTLGMYEPIHG
FT                   SAPDIAGKGIANPLATILSAAMMLRYSFDLESEAKLIEGAVLSVLEDGYRTGDIMSKGK
FT                   IKVGTNEMGDLVCKKINKGE"
FT   gene            318688..320346
FT                   /gene="ilvD"
FT                   /locus_tag="CLL_A0325"
FT   CDS_pept        318688..320346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvD"
FT                   /locus_tag="CLL_A0325"
FT                   /product="dihydroxy-acid dehydratase"
FT                   /EC_number="4.2.1.9"
FT                   /note="identified by match to protein family HMM PF00920;
FT                   match to protein family HMM TIGR00110"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0325"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23733"
FT                   /db_xref="GOA:B2TIR2"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004404"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2TIR2"
FT                   /protein_id="ACD23733.1"
FT                   /translation="MKSDAIKKGPGKAAQRSLLKALGLTNEEISRPIIGIVSSQNEIIP
FT                   GHMNLDKITEAVRKGILMSGGTPLAIPTIGVCDGIAMGQEGMKYSLVTRELIADSIECM
FT                   AKAHAFDALVLIPNCDKIVPGMVMGALRVNVPSVVISGGPMLAGKYKGKDISLTTMFEA
FT                   VGSYENGTMDEKELCDLEECACPTCGSCSGMFTANSMNCLCEVLGIALPGNGTIPAVFS
FT                   ERIRLAKRAGMAVMDMLKNDIKPRDIINEKSIMNALKADMALGCSTNSVLHITAIANEA
FT                   KVNMNLDIINDLSSKTPDLCKLAPASNVHIENLYAAGGITAMMNELSKKDILDLDCITV
FT                   TGKTQGENIKGVTVKDYEVIRPIDNPYSKNGGIAILRGNLAPDGAVVKRAAVLPEMLVH
FT                   EGPAIVFNSEEEANEAIFNKKINPGDVIVIRYEGPKGGPGMREMLQATAAIAGMGLDDS
FT                   VALITDGRFSGATRGASIGHVSPEAASGGMIGLIEDGDIISIDINNAKLEVKLSYEEIQ
FT                   RRKLKFKPIEPKVKEGYLARYAKLVSSASEGAILK"
FT   gene            320433..322106
FT                   /gene="ilvB"
FT                   /locus_tag="CLL_A0326"
FT   CDS_pept        320433..322106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvB"
FT                   /locus_tag="CLL_A0326"
FT                   /product="acetolactate synthase, large subunit,
FT                   biosynthetic type"
FT                   /EC_number="2.2.1.6"
FT                   /note="identified by match to protein family HMM PF00205;
FT                   match to protein family HMM PF02775; match to protein
FT                   family HMM PF02776; match to protein family HMM TIGR00118"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0326"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24725"
FT                   /db_xref="GOA:B2TIR3"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR039368"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIR3"
FT                   /protein_id="ACD24725.1"
FT                   /translation="MLLTGAEILIKSLVDEGIDTVFGYPGGAVLNIYDELYKYKEKIRH
FT                   VLTCHEQAAAHAADGYARATGKVGVCIATSGPGATNLVTGIATAYMDSIPMVAITGNVA
FT                   KPLLGKDSFQEVDITGITMPITKHNYIVKNIEDLQEVIREAFYIAEEGRKGPVLIDIPK
FT                   DITSNKTEYKKLIPKKITREIDEIKEDSFNEAINYINNCKKPFIYAGGGIVSSEATEEL
FT                   IKFSEKIGAPVSTSLMCTSEFPFDHNLYTGMIGMHGTKASNIGATQCDLLIVLGARFSD
FT                   RVISDQNHIKNAKIIHIDIDPAEINKNIKVNSSIIGDLKYVLNKLIPLVEKKESKDWIN
FT                   FIDSLKGKKHIDGINSGELTPKFLFDNLNKLNDGSFIITTEVGQHQMWASQYFNYTNRR
FT                   SFLSSGGLGTMGYGFGAAIGAQIGKPDKKVFNIAGDGSFGMNCNEMATAVKNKLPLVVI
FT                   VMNNNALGMVRQWQTLFYEKRYSETTLDRQTDYVKLAEAFGAKGFRVEKRENLEEVLKK
FT                   AIASKEPVLIDYVISNDKKVFPMVAPGAPINQLISEEDIN"
FT   gene            322128..323144
FT                   /gene="ilvC"
FT                   /locus_tag="CLL_A0327"
FT   CDS_pept        322128..323144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvC"
FT                   /locus_tag="CLL_A0327"
FT                   /product="ketol-acid reductoisomerase"
FT                   /EC_number="1.1.1.86"
FT                   /note="identified by match to protein family HMM PF01450;
FT                   match to protein family HMM PF07991; match to protein
FT                   family HMM TIGR00465"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0327"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23051"
FT                   /db_xref="GOA:B2TIR4"
FT                   /db_xref="InterPro:IPR000506"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013023"
FT                   /db_xref="InterPro:IPR013116"
FT                   /db_xref="InterPro:IPR014359"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2TIR4"
FT                   /protein_id="ACD23051.1"
FT                   /translation="MTKMYYEEDTDLNLLKGKTIAVIGYGSQGHAHALNAKESGGNVII
FT                   GLYEGSKSWAKAEAQGFEVFSTAEAAKKADIIMILINDELQAAMYKKDIAPNLEAGNML
FT                   MFAHGFNIHFDQITAPNDVDVTMIAPKGPGHTVRSEYQLGKGVPCLVAVHQDATGRALE
FT                   TALAYANAIGGARAGVLETTFRTETETDLFGEQAVLCGGVCALMQAGFETLVEAGYDER
FT                   NAYFECIHEMKLIVDLIYQSGFAGMRYSISNTAEYGDYITGSKIITEETKKTMKKVLKD
FT                   IQDGTFAKDFLLDMSEAGGQAHFKAMRKLAAEHQSEAVGSEIRKLYCWNNEDKLINN"
FT   gene            323994..324251
FT                   /locus_tag="CLL_A0328"
FT   CDS_pept        323994..324251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0328"
FT                   /product="GIY-YIG domain protein"
FT                   /note="identified by match to protein family HMM PF01541"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0328"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22158"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIR5"
FT                   /protein_id="ACD22158.1"
FT                   /translation="MNYVYILECSDNTLYTGWTNDLGKRIKMHSLGKGAKYTRGRTPVK
FT                   LVYYEIFEDKNEAMRREYRIKRLIRSQKEALIKTFDCALL"
FT   gene            324295..325293
FT                   /locus_tag="CLL_A0329"
FT   CDS_pept        324295..325293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0329"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="identified by match to protein family HMM PF00356;
FT                   match to protein family HMM PF00532"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0329"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23180"
FT                   /db_xref="GOA:B2TIR6"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIR6"
FT                   /protein_id="ACD23180.1"
FT                   /translation="MKVTIKEVAKEANVSTSTVSRVLSDSSQISEETKSKVREAVKKLK
FT                   YKPNAIARSLANNKTRIIGVILPNEAQDLLTNPFFIQAMKGMSVYAQSKNYYITYAFSK
FT                   DEAHEAHHVNDFINSNLVDGICLLRAKSDDDNIRYLKETGFPFVVIGRPEETDGILWVD
FT                   NDNFKATYDLVNDLVKRGKKKIAFLGAREEWNLTKDRINGFKVSCQMNGINIKEQDIII
FT                   KEEFTEQEGIEATNELLKLGIPDAIVAEDDMLAFGSLKVFKEKNLKDISIIGFNNTQLA
FT                   EFQNPPLASVDINAYELGYYAAKILIDSLENNNNMDHYIIDTNLVVRDSIK"
FT   gene            325604..327268
FT                   /locus_tag="CLL_A0330"
FT   CDS_pept        325604..327268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0330"
FT                   /product="glycosyl hydrolase, family 13"
FT                   /note="identified by match to protein family HMM PF00128"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0330"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24196"
FT                   /db_xref="GOA:B2TIR7"
FT                   /db_xref="InterPro:IPR006046"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIR7"
FT                   /protein_id="ACD24196.1"
FT                   /translation="MKKIWWKEAIGYQIYPRSFKDSNGDGIGDLRGIISKLDYLKELGI
FT                   DVIWICPMYKSPNDDNGYDISDYQDIMEDFGEMADFDELLTKVHKRGMKLIIDLVINHT
FT                   SDEHKWFVESKSSKDSPKRDWYVWKEGKDGSEPNNWESIFKGSAWEYDENTEEYFLHLF
FT                   SKRQPDLNWENPEVRNELYKMVNWWLDKGIDGFRVDAISHIKKDQTFEDIKSKSNERYV
FT                   SSFEKHMNFPGIHRFLAELADNTFENYDIMTVGEANGVDSEEAELWVGEEDGKFNMVFQ
FT                   FEHLNLWDYDSENKLLVVGLKKALTKWQNNLNGVGWNALFIENHDIPRVISTWGNDENY
FT                   RRECAKALGLMYFMQQGTPFIYQGQELGMTNVKFENINKYDDIKSINIFNERVECGVSK
FT                   EEALKEIWAISRDNSRTPMQWNDSENAGFSNNKPWIDVNSNYKEINVESELKDPNSVLN
FT                   FYKKMIDVKKNSETLSYGEYKLILDEDENIYSYMRILGDKKYMIICNLSDNENLYKYEK
FT                   ETLTFESLILSNYEVNKHDKINSINLKPWECRLYKLM"
FT   gene            327330..328988
FT                   /locus_tag="CLL_A0331"
FT   CDS_pept        327330..328988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0331"
FT                   /product="pts system, iibc component"
FT                   /EC_number="2.7.1.191"
FT                   /note="identified by match to protein family HMM PF00367;
FT                   match to protein family HMM PF02378; match to protein
FT                   family HMM TIGR00826; match to protein family HMM
FT                   TIGR02003"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0331"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25137"
FT                   /db_xref="GOA:B2TIR8"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR011300"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIR8"
FT                   /protein_id="ACD25137.1"
FT                   /translation="MKAKKEKLFSFEFWQKFGKALMVVVAVMPAAGLMICLGKLIGMSG
FT                   DLALMQTIARVVEDLGWGIIGNLHILFAVAIGGSWAKERAGGAFAALIAFILTNRVTGA
FT                   IFGVSSAMLADKTATVTSLFGKQLIVGDYFTSILGAPALNMGVFIGIISGFLGASLYNK
FT                   YYNFNKLPNALSFFNGKRFVPFVVIAGSVVMAIVLSIIWPFAQSGLNAFGVWLAESKDT
FT                   APILSPFIYGCLERLLLPFGLHHMLTIPVNYTELGGVYTILTGANAGHVIAGQDPLWFA
FT                   WISDLINLKGAGDMSAYNNLLTTVTPARFKYGQVVLSSASLIGVALAMYKNVDEDKKHK
FT                   YKSMFLSAGLAVFLTGVTEPIEFMFMFVSPILYGVYAVITGIGFALADIISLRIQAFGF
FT                   VELLTRVPMFVKAGLSMDLVHFVISAVAFFFLNYCTFNFLIKKFKIATPGRRGNYIDSE
FT                   EDESSQNASNTNTTGDELAVKIISLLGERENIIDVDACMTRLRVTVKDKVLVADEKDWK
FT                   KNGALGLVVKDKGIQAIYGPKADVLKSNIQDILGV"
FT   gene            328993..329781
FT                   /locus_tag="CLL_A0332"
FT   CDS_pept        328993..329781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0332"
FT                   /product="endonuclease/exonuclease/phosphatase family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF03372"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0332"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22570"
FT                   /db_xref="GOA:B2TIR9"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIR9"
FT                   /protein_id="ACD22570.1"
FT                   /translation="MKLLTLNCHSWQEENQIDKIKYLAKIISEKNYDAIALQEISQSIE
FT                   AKVINNNLKVDNFAVLLKAELDKYNTNYNFFWDFSHIGYGKYEEGLAVFTKHNIVNEKS
FT                   FFISKGTDREYWKTRKIVQVTFEYNNENIDLYSCHLGWWEDEEEPFKYQVKRLLEENTS
FT                   NNITFFMGDFNNNAFVRNEGYDYLVNKGLVDTFNISKEADNGITVKGNIDGWDENKDKL
FT                   RLDLILSNKKLDVITSKVIFNGTNKDVISDHYGVEISLNL"
FT   gene            complement(329823..330314)
FT                   /locus_tag="CLL_A0333"
FT   CDS_pept        complement(329823..330314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0333"
FT                   /product="MarR-family transcriptional regulator"
FT                   /note="identified by match to protein family HMM PF01047"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0333"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23411"
FT                   /db_xref="GOA:B2TIS0"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIS0"
FT                   /protein_id="ACD23411.1"
FT                   /translation="MHKQDLDKISDSLLTFLFLVKNNVFSENEFIKNFPKPPKEVEDYM
FT                   NEFPMPPSHTKVILYLHKSSSSPISQIASNLGISKSNMTPIIDKLIEYGLVNRYPDSKD
FT                   RRILRVELTAKALDIFEKFRNAAKAKLASKIEILDDDDLYALSDCVSKLYDIMQKIEKK
FT                   "
FT   gene            330616..331842
FT                   /locus_tag="CLL_A0334"
FT   CDS_pept        330616..331842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0334"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="identified by match to protein family HMM TIGR01730"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0334"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24696"
FT                   /db_xref="GOA:B2TIS1"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIS1"
FT                   /protein_id="ACD24696.1"
FT                   /translation="MKKYLSLLLIFNMMWLVGCGNKDVATEQEKSIAVSVKKSKSSDIE
FT                   NKNMFTGTTKVATETSVTTEMAGTIEKTYVSLGQEVKKGDVLLTLKGDDINNSISQSKA
FT                   ALDLAQANYNNTTSGSIENQTNQLENSVKLAQLQYDEAKRNYDMYTALYQADAISEDQY
FT                   KKIELSLNQAKQQLDIAQKSYTTTTEKNIPELQALAEKQLEQAKVSYDVAASNLDKLTL
FT                   VSPVDGVITAKNCDSNEMISQQQPAFIISSPNTLEVNINVAQADINKFSSGQDVEAVID
FT                   GQTINGKVEYVPLIVDPQTSLYQVKILIDNSSNTLKAGMSAEVNLSLEKNENTITIPKK
FT                   AVFEEDGKKYLYIVNDENRAIKTAVETGIETSMDIEVKSGIYSDDTVVVGGITLITDGS
FT                   KVFPVEKED"
FT   gene            331847..335050
FT                   /locus_tag="CLL_A0335"
FT   CDS_pept        331847..335050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0335"
FT                   /product="cation/multidrug efflux pump"
FT                   /note="identified by match to protein family HMM PF00873"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0335"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23580"
FT                   /db_xref="GOA:B2TIS2"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIS2"
FT                   /protein_id="ACD23580.1"
FT                   /translation="MNLTKTSVKRPLTIIMVFLVVIMFGYIGYLKMPANLMPDIEIPVV
FT                   MVTTQWPGAGPEDIDQQISGKIEEKLSAVSNVKKTVSMSQESVSMVVAQFEYGTDLNEI
FT                   LNDVRSKVDSVQSTLPDDVTKSTVLKMDMNAEAISQLVISGGHSSEALMKYAEDTIQPK
FT                   IESAEGVTEAGINGGDKSQVNITVDPAILSNYGVSIQTIKNVLSATNKTFPYGSITQGE
FT                   DKIVLRGIDELNSLEDVKQVQIPVSGGKTVRLDKICDVEYGFAEKQAIYRYNGQDSLVI
FT                   DIQKQQDANTVQVMKDVNKTVEKLNSENPEYKIEIVNDSSEYINDSIKSVMQNLAISAV
FT                   ISFLVIFLFLKSMRASLVVAIAIPTSIIGAIALLYFTGETLNMVTLGSLVIAVGMVVDN
FT                   ATVIIENIFQYRKETVLDIDDCSIKGAQTVTNAIVASTLTTVAIFLPILFTEGFTKIMF
FT                   GALAKTLIYALSLSLIVAVTLVPSIFAKLSKGSNATKLVEKPSPIFDKFNDKYKNVLKV
FT                   ALNHKKIVVLISILLFVASIFGATLIGMDFMASADEGKLSVSISLPEGLELNAGDYYVS
FT                   MAENNLSDIPEIKTTMTTLASSSRSGGNNANIAIELVPKNERKKSTNDIEKEVVQKMET
FT                   VPDCEIKVSASSSMVGGSDGVSLELKGPDIDVLEEIAKLAEEKLNSLQGFRNVGTSLSD
FT                   TTKEAQFKIDKDKVQQYGINTSGIAGLLRTAINGDSVTTATIDDYKVDVNLKFKESSID
FT                   SLEDIKQIKVASQSGQEVPIGAFADITMEDSLKSISKSDGDYTITISATVDDLDTSTAS
FT                   KQAINAINELDMPRDYSISFGGATEMMNESMSGLIFAMVVAIILVYMVMVAQFESFSKP
FT                   FIIMFCIPFAFVGVVIALVITRANLNVVGMLGSILLVGIVVNNGIVLIDYIEQLRKAKP
FT                   NDNLIDIVSIGSATRLRPVLMTTMTTVVGMIPTALSFGSGGETMQPLAVVIIGGLSVST
FT                   LVTLILIPAIYMIFDKVEKKFSSKFNKLKYKITKKVNNLSFRNKEQIDINNEEINYDIN
FT                   LKQIEESTEETLNNNDENK"
FT   gene            335077..336234
FT                   /locus_tag="CLL_A0336"
FT   CDS_pept        335077..336234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0336"
FT                   /product="putative multidrug efflux pump, outer membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0336"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24699"
FT                   /db_xref="GOA:B2TIS3"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIS3"
FT                   /protein_id="ACD24699.1"
FT                   /translation="MKKGLKRLVALTIAGLITSISLIQIPANANTSKPILSLEKAIDSA
FT                   IDNSYQIVLNEEKQDMLEEKDDFYQDVDMDDDGYNDIQMSQNEQKRKFLEDQISVDVTS
FT                   KYNSMVILEKELENIVIDIEIKTKEYENMELKKKIGLVSTIEMQNAKAELEKLKAEKKS
FT                   KEQELKNSKKVFKIITDIDVEDYDLEDNVKFKPLKLDESLDSYLDDRIDTYFRYNKKLA
FT                   DWVEDNYSSTAGSKPTPPNENDYKDEEGNTKPEYKDALNNWSTNYYNWISVSLKDIESE
FT                   YNANTAVDSVNDGKRTMKQTLLTTYTKLVTLEGNITSMKAQLDVLYNKTKITKLQYDLG
FT                   LATKQEYYKQLLTTEQLEVSYNSLINSYNDLKEKIEKPWTLSSGM"
FT   gene            336746..337792
FT                   /locus_tag="CLL_A0337"
FT   CDS_pept        336746..337792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0337"
FT                   /product="cell wall binding repeat protein"
FT                   /note="identified by match to protein family HMM PF01473"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0337"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23685"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR018337"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIS4"
FT                   /protein_id="ACD23685.1"
FT                   /translation="MKWLKNTLKVILIGLIIIASTNINVYASETFYDSNKLKNEIYNNL
FT                   KDWETDFTLNYWGDNIQSVLDSAIDSEDYLERSVSSYNIKINGAKNKFTIQYRTTKSQE
FT                   DFIDYELKRIVNNLIDANMSTIDKVTAINNYLVKIYKYDYSIKSDNVYSALTTKETICQ
FT                   GYAMTAYKMFRILGIDSRIVSGTMNGKGHAWNLVNINGNWYNLDITNNDNIIRDKYLLV
FT                   SDDFLVSNGFHWNKSKYPIAYYNYYNMPKTFTDYNNDNESDIVTYYNGGYWYIEKGYWH
FT                   YFRFSGKDARGWLNNDGNWYYFNNDGKMKVGWLLDNGTWYYCYSNGQMAYNTMIGKYTL
FT                   DENGALIS"
FT   gene            338181..338428
FT                   /locus_tag="CLL_A3607"
FT   ncRNA           338181..338428
FT                   /locus_tag="CLL_A3607"
FT                   /product="glmS glucosamine-6-phosphate activated ribozyme"
FT                   /ncRNA_class="ribozyme"
FT   gene            338548..340374
FT                   /gene="glmS"
FT                   /locus_tag="CLL_A0338"
FT   CDS_pept        338548..340374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmS"
FT                   /locus_tag="CLL_A0338"
FT                   /product="glutamine-fructose-6-phosphate transaminase
FT                   (isomerizing)"
FT                   /EC_number="2.6.1.16"
FT                   /note="identified by match to protein family HMM PF00310;
FT                   match to protein family HMM PF01380; match to protein
FT                   family HMM TIGR01135"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0338"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23152"
FT                   /db_xref="GOA:B2TIS5"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIS5"
FT                   /protein_id="ACD23152.1"
FT                   /translation="MCGIVGYLGSGKATSFLINGLSKLEYRGYDSAGVAVVNNGEIEVR
FT                   KFQGRLSNLANDIKANPVEGNMGIGHTRWATHGAPSDANSHPHLNSKETIAVVQNGIIE
FT                   NYLTLRTWLKGEGYTFKSETDTEVIPNLIDYYYEGNLFDAIIKTLKRLEGSYALGVVCK
FT                   DEPDKLIAVRKECPLIVGLGKDESFIASDIPAVLSYTRDVYLLEDHEIAVLSNEGVKLY
FT                   ETSGKEIQKDIYHVTWNEDAAEKGGFEDFMLKEIHEQPRAIRDTMAGRISMEKSMLLDD
FT                   LKITKEDLENTDRVFIVACGTAYHAGLVGKNLIESFARIPVEVDIASEFRYRNPLVTDK
FT                   SLVIVISQSGETADTLAALRNSKNIGATIIALTNVVGSSVSREADHVLYTLAGPEISVA
FT                   STKAYTTQIIGMYMMAMTFAKILGKLKSDRLEKLKEELLDLPEKLELVLEDREKIKVIA
FT                   EKMYEEKDVFYLGRGLDYAVALEGSLKLKEISYIHAEAYAGGELKHGPIALIEEGTNVI
FT                   ALLTQEALKEKMVSNIVEIKARGAKVIGVCYVGTKGLEEVLDEIIYIPRTMDMFAPVLS
FT                   VAALQLLSYYVAKAKGCDIDKPRNLAKSVTVE"
FT   gene            340498..341172
FT                   /locus_tag="CLL_A0339"
FT   CDS_pept        340498..341172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0339"
FT                   /product="cyclic nucleotide-binding domain protein"
FT                   /note="identified by match to protein family HMM PF00027"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0339"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22225"
FT                   /db_xref="GOA:B2TIS6"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIS6"
FT                   /protein_id="ACD22225.1"
FT                   /translation="MYTPRYYFSNNFKKYEELFRNNEHEVKHYKKGEYLCNIDDSMDTI
FT                   FYIVSGTIKLSMLHPSGNEKNFSFHGNGTIQPFYYPSDCSLEHSVLLLAICDVEVLAFK
FT                   KDDFANIVKDNPELYETMLEGFVKMVNLLMYDTTNILFNDGLVKTCNFLYSCLMSSEFK
FT                   EGVIRISQKDLSAIIGMNRTNTAKYLKLLREKNIIKTSRNNITVLDEKNLLKQCSNELY
FT                   KI"
FT   gene            341425..342768
FT                   /locus_tag="CLL_A0340"
FT   CDS_pept        341425..342768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0340"
FT                   /product="mate efflux family protein"
FT                   /note="identified by match to protein family HMM PF01554;
FT                   match to protein family HMM TIGR00797"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0340"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25155"
FT                   /db_xref="GOA:B2TIS7"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIS7"
FT                   /protein_id="ACD25155.1"
FT                   /translation="MARSFNLVKDSESKLYLKYLAPSIFGMIMLSGYVFVDALCVGRAL
FT                   GGVGLAALNVSTPTISLMYATGFLFATGSATIYSIFKGKNEDENARKMYTFGFISALFM
FT                   GMLYCILGILFVDKIAYFLGATNNTIELTKQYMLTILIFAPFFVLDIFMNVFARNDKAP
FT                   HISMLATIACCSLNIVLDVLFVFGFNLGMFGAAIATAISTVVSFTITFSYSLSKKSGLK
FT                   LKRCIPKLNDFLRIVTNGVSSFISEMSVGVVTIAFNKVILSQIGEIGVSAYGIIANINL
FT                   IFFSIFMGNAQAMQPLVSINYGANEYKRTFNFFKLGVTFAMIVGVVFTSASIFFSYQLS
FT                   SLFVTDQEIIKVTASALKIYGLAYLIMGINLLFDAFFYSVEKPKFAVSISLSRALIIVL
FT                   SMLFILSNVFGSVGIWMTVPVTEVCTLCIGLTLFMKYKHNQLSISLEN"
FT   gene            343326..344849
FT                   /locus_tag="CLL_A0341"
FT   CDS_pept        343326..344849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0341"
FT                   /product="phosphoglucomutase/phosphomannomutase family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF02878;
FT                   match to protein family HMM PF02879; match to protein
FT                   family HMM PF02880"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0341"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23970"
FT                   /db_xref="GOA:B2TIS8"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIS8"
FT                   /protein_id="ACD23970.1"
FT                   /translation="MNNNCLHDLQNGSDIRGVVLTNEDQVINLTNKEIKIITIAFHEWL
FT                   KNKNKLNNLKISVGIDSRITGNEFKHTIINTLVACKVTVYDCKLSTTPSMYMTTIMNDY
FT                   KCDGAIMITASHLPYYYNGIKLFTKNGCLDKEEIQEILNIASKYEDNKEDVFVSEIESR
FT                   RMTIFKPLINDYSKLLVKKIRREINSSKNYNKPLTGMKIILDAGNGSGGFFKEKILEEL
FT                   GADTTGSQFIEPDGTFPNHIPNPETDISMNLISNAVIDNDADLGIIFDTDVDRVALVGR
FT                   EGRFINRSSLIALISAIVLQEHKGSTIVTDSVTSDGVSNFIKKLGGKHHKVKKGYKNII
FT                   NEAMKLNNKNEECYVAIETSGHVALKENYFLDDAAYFASKILIIMAKLKNENKFIEDLI
FT                   SDLELPNEEREIRLAINEKDFNNYANKILYDFTKVIADNDNMQIDEDNCDGIKVVFNER
FT                   FGEGWFTLRLSLHEPKIVINIESSKSSECEKILEFIKNFINNYNVSYLN"
FT   gene            345230..346642
FT                   /locus_tag="CLL_A0342"
FT   CDS_pept        345230..346642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0342"
FT                   /product="cell volume regulation protein A"
FT                   /note="identified by match to protein family HMM PF00999;
FT                   match to protein family HMM PF02080"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0342"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23364"
FT                   /db_xref="GOA:B2TIS9"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR030151"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIS9"
FT                   /protein_id="ACD23364.1"
FT                   /translation="MTIPLILASLVLIICVFSSKVLYRFGVPSLLIFLILGMIFGSEGI
FT                   VGIRFDNYKIAEEIGSFGLVFIMFYGGFCTNWKLAKPVVTKATLMSTIGVIITAGLTGI
FT                   FCTWVLESSLLEGFLLGAVVASTDAASVFSILRSQKLNLKDGLASLLEIESGSNDPIAY
FT                   MLTVIILSFMSGSQQSIFKLLLFQVLFGIIIGVVLAKLSTWILKNIAFEIEGLYPVFVM
FT                   AVAILAYSLSIWIGGNGYLSVYIAGIIIGNSKIQNKKSLVKFFDGISWLMQIMLFFILG
FT                   LLSFPSQIHSAFLPGFLISIFLIFVARPISTFAILSWFKVPIKQQIFVSWVGLRGAASI
FT                   VFAILAVTNDAFINFDIFHIVFFIALFSVSLQGTLISPIAKKLDLVDDEVVVLKTFNDY
FT                   QEEMNTKLVEFEIKPESKLVNKSIIDANIPEDILVVMIKRSGKILHPKGKTIIYGGDIL
FT                   VLTGENFDNIDF"
FT   gene            347231..347992
FT                   /locus_tag="CLL_A0343"
FT   CDS_pept        347231..347992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0343"
FT                   /product="formate/nitrite transporter family protein"
FT                   /note="identified by match to protein family HMM PF01226"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0343"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22148"
FT                   /db_xref="GOA:B2TIT0"
FT                   /db_xref="InterPro:IPR000292"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIT0"
FT                   /protein_id="ACD22148.1"
FT                   /translation="MYISDIEIISKSARNKYELSQNAPRKYTTRAIVAGFYLVVAIILS
FT                   YTIGAILNLNYPELARIMVAATFSIALALIVFLGGELFTGNNMVMAVGVYTKACTLKMA
FT                   LKVWCLSYLGNLLGAIVISFLFVKSGASLSLIQEYISGILTTKFTLSAFELLIRGILCN
FT                   FIVCLGVLSTIRLKSESGKSIMMFWCVFAFVIAGFEHSIANMGIFSVGYFALGGLSMTL
FT                   IIKNLFWVTLGNIIGGGVLLALPLTYMSVEE"
FT   gene            348150..348554
FT                   /locus_tag="CLL_A0344"
FT   CDS_pept        348150..348554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0344"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0344"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22642"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIT1"
FT                   /protein_id="ACD22642.1"
FT                   /translation="MVVVKLEKNKKRQIIFKIKFTDGEENKLFFKRAIIEGKKIKGDFD
FT                   YQVPLRFFIPIVKNINKKDILLDKDSLLYYLEFSDMYDQNYYNETQATPNYMKKWREEG
FT                   CPEIYKVTLDKDNCNIEKEVIFNKPKVYFE"
FT   gene            complement(348645..349205)
FT                   /locus_tag="CLL_A0345"
FT   CDS_pept        complement(348645..349205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0345"
FT                   /product="carbonate dehydratase"
FT                   /note="identified by match to protein family HMM PF00484"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0345"
FT                   /db_xref="EnsemblGenomes-Tr:ACD21908"
FT                   /db_xref="GOA:B2TIT2"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIT2"
FT                   /protein_id="ACD21908.1"
FT                   /translation="MSKLEEIMKFNNDFVENKRFEEFITTKTPKKKMVILSCMDTRLTE
FT                   LLPKAMNIKNGDAKIIKDAGATVIHPFGSVIRSILVAIYEFKAEDIFVVGHHGCGMSNL
FT                   NTKTLISKMIDRGISTNTLSILNNSGINIESWLHGFESVENSIKESVKMIKNHPLIPED
FT                   IRVHGLIISPDTGKIDIIVNGDI"
FT   gene            349456..350037
FT                   /locus_tag="CLL_A0346"
FT   CDS_pept        349456..350037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0346"
FT                   /product="5-formyltetrahydrofolate cyclo-ligase"
FT                   /EC_number="6.3.3.2"
FT                   /note="identified by match to protein family HMM PF01812;
FT                   match to protein family HMM TIGR02727"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0346"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24640"
FT                   /db_xref="GOA:B2TIT3"
FT                   /db_xref="InterPro:IPR002698"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIT3"
FT                   /protein_id="ACD24640.1"
FT                   /translation="MNILEEKKELRKKILKIRKEMNINNKKKFDNIIHNKFLKSKFYSQ
FT                   CRNIFVYVSYDSEIDTKTIIRKALGDGKNIYVPRTNYDTKLMEAVKISSLENLIEDKHG
FT                   ILQPTECKLAVELEKIDLIIMPGVAFDKNGGRMGYGGGFYDRYLNKFSKNICKISLAYD
FT                   FQILDNVPMDIHDATVNYIITENKEIMCNI"
FT   misc_binding    350121..350227
FT                   /bound_moiety="S-adenosyl methionine"
FT                   /note="SAM riboswitch (S box leader); Rfam score 77.93"
FT                   /inference="nucleotide motif:RFAM:RF00162"
FT   gene            350357..351622
FT                   /locus_tag="CLL_A0347"
FT   CDS_pept        350357..351622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0347"
FT                   /product="O-acetylhomoserine
FT                   aminocarboxypropyltransferase/cysteine synthase family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF01053;
FT                   match to protein family HMM TIGR01326"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0347"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23787"
FT                   /db_xref="GOA:B2TIT4"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006235"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIT4"
FT                   /protein_id="ACD23787.1"
FT                   /translation="MKIETKCLHEGYKPKNGEPVALPIYQSTTYRYDSTEAIGKLFDLT
FT                   AEGHMYSRISNPTVGAVEDKIASLEGGIGALCTSSGQAASLISILNILKAGDHIISAAT
FT                   IYGGTINLFAVTLKRFGIECTFVDPDSSDEEIQKEFRENTKVVFGETIANPAIAIFDIE
FT                   RFAKIAHRNNVPLIIDNTFATPILCRPIEFGADIVIQSTTKYMDGHAVQVGGVIVDSGN
FT                   FDWTNGNFSEFTEPDESYHGVIYSKDFGKSAYITKARVQLMRDLGAYIPANAAFLLNLG
FT                   LETLSVRIEKHCRNAEKVAEFLSSNEKVEFVNYPTVKGNKYEDLARKYLPNGCSGVVSF
FT                   SIKGSRENAIRFMDNLKLAENVVHVADIRTCVLHPASSIHRQLTDEQLVSAGITPGLVR
FT                   LSVGLENIDDILEDVKQALDQV"
FT   gene            complement(351867..353798)
FT                   /gene="thrS"
FT                   /locus_tag="CLL_A0348"
FT   CDS_pept        complement(351867..353798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrS"
FT                   /locus_tag="CLL_A0348"
FT                   /product="threonine--tRNA ligase"
FT                   /EC_number="6.1.1.3"
FT                   /note="identified by match to protein family HMM PF00587;
FT                   match to protein family HMM PF02824; match to protein
FT                   family HMM PF03129; match to protein family HMM PF07973;
FT                   match to protein family HMM TIGR00418"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0348"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22278"
FT                   /db_xref="GOA:B2TIT5"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002320"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR033728"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2TIT5"
FT                   /protein_id="ACD22278.1"
FT                   /translation="MIKVTLKDGSVKEFEAGLSVYEIAKSISEGLARNACCGVVNGKVC
FT                   DLREEVKEDVSLSICTFDSQEGKDAVRHSISHVLAYAVKRLFPETKLAIGPSIATGFYY
FT                   DFDKDVAFSAQDLEKLEAEMKKIIKENPSIEKFELPRNEALELMKDEPYKVELINDLGE
FT                   DEIISFYKLGEFTDLCAGPHVMSLKPIKAIKLIRSAGAYWKGDEKNKMLTRIYGTAFLK
FT                   KSELDEYLDAVEEAKKRDHNKLGRELKLFTTDENVGQGLPLLMPKGAKIVQTLQRWVED
FT                   EEERRGYVLTKTPLMAKSDLYKISGHWDHYKDGMFVLGDEEKDEEVFALRPMTCPFQYT
FT                   IYNAEQHSYRDLPIRYGETSTLFRNESSGEMHGLIRVRQFTLADGHLIVTPEQLEEEFK
FT                   GVLELIQYLMKTLGIDEDISYRFSKWDPNNTEKYINDPEAWNKTQDTMRTILDHLKINY
FT                   VEADDEAAFYGPKLDLQCRNVHGKEDTLFTVQIDFALAERFDMSYIDKNGEKKRPYIIH
FT                   RSSIGCYERTLAMLIEKYAGAFPTWLSPVQVKVLPISDKYNDYAESVVKSLRNKGVRIE
FT                   ADYRAEKIGYKIREARLERTPYILVVGEKEAANNEVSVRSRKNDDEGAIKLDAFTERLL
FT                   NEIATKER"
FT   misc_feature    complement(353839..354108)
FT                   /note="T-box leader"
FT   gene            complement(354192..354605)
FT                   /locus_tag="CLL_A0349"
FT   CDS_pept        complement(354192..354605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0349"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0349"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24563"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIT6"
FT                   /protein_id="ACD24563.1"
FT                   /translation="MYLCEICQKQADIHHIVHRSEGGLDIKLNYKYLCSYHHRGKPGPH
FT                   HCEETDILYKLELQNNLFYLLQNNYYKFKELIVLLEVSKNQLKRIVKDLKVYKEGYKKL
FT                   DIIVKIMGGKLYTEEMIENLTLDKLIDNIDKEP"
FT   gene            354861..355421
FT                   /locus_tag="CLL_A0350"
FT   CDS_pept        354861..355421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0350"
FT                   /product="glycerol-3-phosphate responsive antiterminator"
FT                   /note="identified by match to protein family HMM PF04309"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0350"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24236"
FT                   /db_xref="GOA:B2TIT7"
FT                   /db_xref="InterPro:IPR006699"
FT                   /db_xref="InterPro:IPR035928"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIT7"
FT                   /protein_id="ACD24236.1"
FT                   /translation="MSTVELLEQNPIIASVKNEEELALALESSVQIIFVLFGSIMNIKE
FT                   ISNLIDEKGKIGIIHLDLVDGFVSTKEIVISYLKENTKFKGIISTKPHILKIAKNYGLL
FT                   AIQRFFIFDTLSFTNSKNHLVSGADAIEILPGILPKVIEDMSKNTLKPIITGGLIENKQ
FT                   EIISALQSGATCISTTKQELWSV"
FT   gene            355533..356861
FT                   /gene="glpT"
FT                   /locus_tag="CLL_A0351"
FT   CDS_pept        355533..356861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpT"
FT                   /locus_tag="CLL_A0351"
FT                   /product="glycerol-3-phosphate transporter"
FT                   /note="identified by match to protein family HMM PF07690;
FT                   match to protein family HMM TIGR00712; match to protein
FT                   family HMM TIGR00881"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0351"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23578"
FT                   /db_xref="GOA:B2TIT8"
FT                   /db_xref="InterPro:IPR000849"
FT                   /db_xref="InterPro:IPR005267"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR021159"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIT8"
FT                   /protein_id="ACD23578.1"
FT                   /translation="MFNFLKPAPHIERMPAEKIPSSYKRYRIQVFISIYVGYLIYYFVR
FT                   SNFSLAKVYLIDQGFTKTQVGFVASALGLAYGVSKFVMGNVSDRSNPKYFLAIGLILSG
FT                   VTNLFLPNATNIGMMFILMLLNGWFQGMGWPPCGRIMTHWFSDSERGVKMSIWNTAHNV
FT                   GGGFIATVVLLGVSIFGSWKGSFYLPALIAIVGGILYMFFAKDTPQSVGLPPIEEYMDD
FT                   YPEVAEQVEDAEAELTAKEILFKYVFNNKLLWCIALANVFVYLVRYGVINWVPTYLQEV
FT                   RHFNPKDSSIAFALFEYAAIPGTIIVGWISDHIFHGRRAPIGIICMVGVAVATFVYWKS
FT                   SSPMAINCALASIGALIYGPVMLIGVSALDLVPKKAAGTAAGFTGLFGYMGGQVAAEVA
FT                   MGAVVDKFSWDGGFILLMISCVLAIFFLSFTWNSHNIAARKAN"
FT   gene            357290..357886
FT                   /locus_tag="CLL_A0352"
FT   CDS_pept        357290..357886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0352"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0352"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23529"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIT9"
FT                   /protein_id="ACD23529.1"
FT                   /translation="MDELPSEKSLYFHTLIFNKSAGVNSIWGYMPSHKTLLGYFQHSFL
FT                   QESFYKWIHGKENLVTKVPSLPVEAIVREGEKLKKINKDIAKKMRDDYQKLNSLWDAPV
FT                   SKLNLEVRKFIRDFNVRWSGDSNQFIYIKIFKDAKELGDFVVSSSLITSTEKELEKKIG
FT                   VSLEEWKNICENVVKDKEHGEKFRKILLKRLTEVF"
FT   gene            complement(357965..358438)
FT                   /gene="ispF"
FT                   /locus_tag="CLL_A0353"
FT   CDS_pept        complement(357965..358438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispF"
FT                   /locus_tag="CLL_A0353"
FT                   /product="2C-methyl-D-erythritol 2,4-cyclodiphosphate
FT                   synthase"
FT                   /EC_number="4.6.1.12"
FT                   /note="identified by match to protein family HMM PF02542;
FT                   match to protein family HMM TIGR00151"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0353"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24338"
FT                   /db_xref="GOA:B2TIU0"
FT                   /db_xref="InterPro:IPR003526"
FT                   /db_xref="InterPro:IPR020555"
FT                   /db_xref="InterPro:IPR036571"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2TIU0"
FT                   /protein_id="ACD24338.1"
FT                   /translation="MRVGLGYDVHKLVENRKLILGGVEIPYEKGLLGHSDADVLLHAIM
FT                   DSLLGACALGDIGRHFPDTDNKFKGISSIKLLEEVNKLIIKNRYIINNIDSVIIAQKPK
FT                   LAPYIDTMTENISNALNIKIDQINIKATTEEGLGFTGGMLGISSQSICSVIKK"
FT   gene            358893..359924
FT                   /locus_tag="CLL_A0354"
FT   CDS_pept        358893..359924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0354"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0354"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24907"
FT                   /db_xref="GOA:B2TIU1"
FT                   /db_xref="InterPro:IPR024449"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIU1"
FT                   /protein_id="ACD24907.1"
FT                   /translation="MDKLRIRYVFSSSPNMLLIGGKIDINRNKQIESCLKKLSAYDILL
FT                   KDLINYPPKEKQRNIILNVSYYILEDENLRDSVERKRELPIRNICKKIDISEEFLRTWK
FT                   EYILFYYIIFSNVNYKLIQEYLKIEEKSNNVTTLNNTKKTEFFRGLVLKSLNNGAYILT
FT                   SSGEIIKIKCDKNTKVGQEVSGQQKKTFRHYKIHFCILIFLIMIMGMSLYSHYCKPQST
FT                   IIVNTTSAIKLECNFLNKVIYSYSETEKGTKLIISTDVLHKNIDESIKEILDYAINNEM
FT                   VPSDNKILITVNGETLKYGTLKETSKFLNEVNEKNKSENRSQLSVLINNGGNQHKLTTS
FT                   LYE"
FT   gene            complement(360062..360982)
FT                   /locus_tag="CLL_A0355"
FT   CDS_pept        complement(360062..360982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0355"
FT                   /product="polysaccharide deacetylase family protein"
FT                   /note="identified by match to protein family HMM PF01522"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0355"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22996"
FT                   /db_xref="GOA:B2TIU2"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIU2"
FT                   /protein_id="ACD22996.1"
FT                   /translation="MKNLNNFFTKKNITILTCVLICVIISYFMYNNLFLKDTVNKNPNN
FT                   STTTETIDNNQEINDTDKEISDVENEKEVNTNNDLKLTNENVGVPVLYYHSVKNSENNE
FT                   VIIAPQKLRNQLRYIKDSGYTTLTLKELEDYLLNNTPIPEKSIVITFDDGYMDNYTNAF
FT                   PILKDLDMKATIFCITFELDGKYYLSESAIKKMSDYGIDIQSHTAGHPDLTKMTYDEQL
FT                   KEFLESKEILEAITEKPVTSIAYPYGNYNDNSVKAAKDAGFKLGFTTDLGLSDRDDNPL
FT                   LLNRIYISSNYDMDTFKQLLENTKK"
FT   gene            361299..361952
FT                   /locus_tag="CLL_A0356"
FT   CDS_pept        361299..361952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0356"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0356"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23924"
FT                   /db_xref="InterPro:IPR021729"
FT                   /db_xref="InterPro:IPR025303"
FT                   /db_xref="InterPro:IPR037126"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIU3"
FT                   /protein_id="ACD23924.1"
FT                   /translation="MFINNRIKNDNNLKIVEKSINKNLGYLIEDVKILQIEGGKDKNKI
FT                   NNINSKVNSDVMNPIREAEKTSAEYFKDTNIIPNFPYQISSKYIITRNDNNILSFYNDY
FT                   YEFLGGAHGMTTITSYTINKNKEEFLNLNDLFKPGYDYLNIVNKEIEKQIVKNPDNYFD
FT                   SGKIFKGINEKQGFYLDESNLIIYYQLYEIAPYVYGIPEFKIPIKLFEGNFIYS"
FT   gene            362019..362867
FT                   /locus_tag="CLL_A0357"
FT   CDS_pept        362019..362867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0357"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF02588"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0357"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24872"
FT                   /db_xref="GOA:B2TIU4"
FT                   /db_xref="InterPro:IPR003740"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR019264"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIU4"
FT                   /protein_id="ACD24872.1"
FT                   /translation="MKKLLKEYTIITIGLVIVTIGLELFFYSNNIASGGISGLALILNE
FT                   ILGIEPGVVMLLCNIVLFIVAFIFIGGSFGIKSMYAAFGLSFILSAVEKFHKPVAITNN
FT                   LVLATIFGSVLVAMGTAIMYTQNATTGGTSITAKILSKYCHIDFGKGLLISDSVVILLA
FT                   IYTFGVELGLFGLLSVYLTGILIDKFIDGFNLSKQVMIFTDKEELVANYIMKDVERGCT
FT                   VFYGKGGYTKKQNCVILTILSRIQFIKLKQFMMKNDPKAFITVNEITEVLGQGFKNILD
FT                   N"
FT   gene            complement(362999..364045)
FT                   /locus_tag="CLL_A0358"
FT   CDS_pept        complement(362999..364045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0358"
FT                   /product="radical SAM domain protein"
FT                   /note="identified by match to protein family HMM PF04055"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0358"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22407"
FT                   /db_xref="GOA:B2TIU5"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024021"
FT                   /db_xref="InterPro:IPR034422"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIU5"
FT                   /protein_id="ACD22407.1"
FT                   /translation="MKNLIEKASITHELNKNEILQLLSCDDINDDLFKAADKVRERSLG
FT                   NIVHLRGLIEFTNICKRNCLYCGLRRDNENIKRYRLSKEEIIDFAKKAVSYGYKTIVLQ
FT                   GGEDDFFTKEKMVEIIKEIKNLNVALTLSLGEKTYEEYKAFKEAGADRYLLRIETTDKK
FT                   LYKEMDPMMSYDERLNCLKNLGHLGYEVGTGVLVGLPNQTLDSLADDILFFKKLNADMI
FT                   GIGPFIPNEDTPLKYSKGGNLNLALKVMAITRLLLPDINIPATTAMESLHKNGRILALQ
FT                   SGANVVMPNVTEGEYRKLYALYPGKICTGDTPSHCRGCITGKIASINREVSDGYGFRGN
FT                   QNKNSHNK"
FT   gene            complement(364183..366852)
FT                   /locus_tag="CLL_A0359"
FT   CDS_pept        complement(364183..366852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0359"
FT                   /product="cation-transporting ATPase, P-type"
FT                   /note="identified by match to protein family HMM PF00122;
FT                   match to protein family HMM PF00689; match to protein
FT                   family HMM PF00690; match to protein family HMM PF00702;
FT                   match to protein family HMM TIGR01494"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0359"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22713"
FT                   /db_xref="GOA:B2TIU6"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIU6"
FT                   /protein_id="ACD22713.1"
FT                   /translation="MEKYFCKSSEDTLRDFNVSINGLTEEQIKEQLNKYGENLLTEKKK
FT                   KSIISIFLEQFKDLLVIILIAAAIISIATGNIESTIVILVVIAINAILGTIQYVKAEQS
FT                   LSSLKALSSPTAKVIRNSNKIEIPSKDVLPGDILILEAGDLVVADGRIVESFSLQVNES
FT                   SLTGESESVNKISEKIDKTEVALGDQKNMVFSSSLVTYGRGTVLVTSTGMNTELGKIAT
FT                   LMEETQEKKTPLQVSLDDFSKKLAIGVIIICAIVFALNVYRNNTILDSLMFAVALAVAA
FT                   IPEALSSIVTIVLSMGTQKMSKEHAIIKNLRAVEGLGCVSVICSDKTGTLTQNKMTVKS
FT                   IFVDDKLITSEEIDLNNSLSKFLVDSSILCNDSTSVDGKELGDPTEVALTNLGHKFDIN
FT                   EIDYRNKHPRLSEIPFDSDRKLMSTLHNIDNEYLMITKGAIDVLLNRSSLIKTSKGVRK
FT                   ITEKDINDINNMNLKLSSNGLRVLSFGCKKLDDKKDLSLDDEKDFIFIGLISMIDPPRE
FT                   ESKAAVRDCIKASIKPVMITGDHKVTASAIAKEIGILQENDISVDGIELDKMSDKDLLD
FT                   KLEHISVYARVSPEHKIRIVKAWQSKDKIVAMTGDGVNDAPALKQADIGIAMGITGTEV
FT                   SKDAASMILTDDNFATIVKSISNGRNIYANIKNSIRFLLSGNTSGILAVLYSSLRALPV
FT                   PFAAVHLLFINLLTDSLPAIAIGMEKSTRDVLNEKPRDSKESILNKGFVKSILVEGFLI
FT                   AIATITAYHIGLSSGPVGTASTMAFATLCLGRLFHGFNCRGRKSIFALGLFKNKFSWIA
FT                   FGIGLLLLNAVLLVPPLQSLFEVIPLSGANLGYIYLFAFLPTLIIQIYKVIRYDSEKDA
FT                   DINFENKGGKVKEKKQVA"
FT   gene            367228..367926
FT                   /locus_tag="CLL_A0360"
FT   CDS_pept        367228..367926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0360"
FT                   /product="transcriptional regulator, FadR family"
FT                   /note="identified by match to protein family HMM PF00392;
FT                   match to protein family HMM PF07729"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0360"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22907"
FT                   /db_xref="GOA:B2TIU7"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIU7"
FT                   /protein_id="ACD22907.1"
FT                   /translation="MFTPIKTPKVYDQVIEQIKLKIKSGELKKGDKLPSEREMAESLCV
FT                   SRTSIREAIKALEVIGLVESRQGAGNYIKTNFDNSLFEPLSVMFMLQESSLKEMYDLRK
FT                   TLELECGRLASKNITDNELDHLNAILDRMYEAGTEEESLELDIKFHYVIAKAARNVLLI
FT                   NILEVISQLMDEFIKSSRMQILHTGNSREILLSIHENLVRALKFRNEKEVFNAMLEHFD
FT                   LIWKAYGYEE"
FT   gene            complement(368218..368370)
FT                   /locus_tag="CLL_A0361"
FT   CDS_pept        complement(368218..368370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0361"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0361"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24381"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIU8"
FT                   /protein_id="ACD24381.1"
FT                   /translation="MNIASNNVIKRAIGHALWPAILSFPNEIISQIIGIQAKTNKMYTV
FT                   IPPLW"
FT   gene            368385..368516
FT                   /pseudo
FT                   /locus_tag="CLL_A0362"
FT                   /note="lactate permease, truncation; comparison of this
FT                   gene to its homologs suggests this gene has been truncated"
FT   gene            368543..369331
FT                   /locus_tag="CLL_A0363"
FT   CDS_pept        368543..369331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0363"
FT                   /product="electron transfer flavoprotein, beta subunit/FixA
FT                   family protein"
FT                   /note="identified by match to protein family HMM PF01012"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0363"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23120"
FT                   /db_xref="GOA:B2TIV0"
FT                   /db_xref="InterPro:IPR012255"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR033948"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIV0"
FT                   /protein_id="ACD23120.1"
FT                   /translation="MNILVCIKQVPGTSKVEVDPVTGVLKRDGIDSKMNPYDLYALETA
FT                   LRIKENEGGNVKVLSMGPNQALSVIREAYSMGADEGALLSDRKFGGADVLATSYTISQG
FT                   VRKMGDFELIICGKQTTDGDTAQVGPEMAEYLDIPHVANVERIIEIKEKSIIVEMDMPE
FT                   TLEVVEISYPCLITVDKGIFEPRLPSYRKKIATKDKEISIMSLNDFEDRNEKKYGLNGS
FT                   PTQVERIFPPEVNDDREMWTGDSNELAEKIEHKLKEFKFI"
FT   gene            369434..370624
FT                   /locus_tag="CLL_A0364"
FT   CDS_pept        369434..370624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0364"
FT                   /product="electron transfer flavoprotein, alpha
FT                   subunit/FixB family protein"
FT                   /note="identified by match to protein family HMM PF00766;
FT                   match to protein family HMM PF01012"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0364"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23165"
FT                   /db_xref="GOA:B2TIV1"
FT                   /db_xref="InterPro:IPR001308"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR014731"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR033947"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIV1"
FT                   /protein_id="ACD23165.1"
FT                   /translation="MAKLVVNQEKITNKEELIKICPFGALEINDGKVEINGACKMCKLC
FT                   VKKGPKGAIEYIEEEVKSIDKDLWKGISVYVDHVNGKIHPVTYELIGKARELAAKINHP
FT                   VYCVFIGHKVSEEAKELLHYGVNKVFVYDDEELRDFRIEPYAAAFEDFIKNVKPSSILV
FT                   GATTIGRSLAPRMAARFRTGLTADCTILDIKEDTDLVQIRPAFGGNIMAQIVTPNSRPQ
FT                   LATVRYKVMTAPERTDDVNGEIIKCEIKKDKLKSGINVLEIKEKNTEVGISDAEVIVAA
FT                   GRGVKSEKDLAMIKEFAELLGAEFACTRPLIESGWVDAKRQIGLSGRTVRPRLIITCGI
FT                   SGAVQFSAGMNNSEHIFAINNDDKAPIFKVAHYGVVGNIYEIIPQLIEKIKMSKEA"
FT   gene            370629..372032
FT                   /locus_tag="CLL_A0365"
FT   CDS_pept        370629..372032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0365"
FT                   /product="FAD/FMN-containing dehydrogenase"
FT                   /note="identified by match to protein family HMM PF01565;
FT                   match to protein family HMM PF02913"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0365"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22197"
FT                   /db_xref="GOA:B2TIV2"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIV2"
FT                   /protein_id="ACD22197.1"
FT                   /translation="MTYKNVEVKDYEYILSIAENDKERVFFGDEINEDYSHDELGGIKK
FT                   MPDIVVQAISTEEVSKIMKYAYENSIPVTPRGSGTGLVGAAVPIKGGIVIDLCRMNKIL
FT                   EIDEENLTLTLEPGVLLMEIGKYVEEFDLFYPPDPGEKSATIGGNISTNAGGMRAVKYG
FT                   VTRDYVRGLEVVMPNGEVVQLGGKVVKNSSGYSLKDLLIGSEGTLGIVTKAILKLLPLP
FT                   KKSLSLLIPFPTLENAIDTVPKIIKSKTIPTAIEFMQREAILAAEEFLGKSFPDKSSDA
FT                   YLLLTFDGNSTEEIEKAYENVANICLDAEAIDVFISDTEERQESIWSARGCFLEAIKAL
FT                   TTEMDEVDVVVPRNKIGEFVKFTHELESKFNIRIKSFGHAGDGNLHIYILKDQLEDNIW
FT                   HEKLELVMKDMYDKSKELKGQVSGEHGIGFAKKPYLKESLSNDVLSVMEGIKLAFDPKN
FT                   ILNPGKIFK"
FT   gene            372614..373456
FT                   /locus_tag="CLL_A0366"
FT   CDS_pept        372614..373456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0366"
FT                   /product="phospholipase, patatin family"
FT                   /note="identified by match to protein family HMM PF01734"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0366"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23877"
FT                   /db_xref="GOA:B2TIV3"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR037483"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIV3"
FT                   /protein_id="ACD23877.1"
FT                   /translation="MTGLVLEGGAFRGLFTAGVLDALIDINLEIKYIVGVSAGITNGYS
FT                   FVSKQRGRNLEVMERFIDHKRYVGYNNLLKCRSIMDMDFVFDEIPNEHCPFDYEAFDKF
FT                   DGKVLAGSVNVNTGEVEYFDKDYLEKKNTILRATCSIPLLFKFVNIKDQLYADGGLVDA
FT                   IPIKKSISDGNNKNIIVLTRNEGYRKHESKGNKFAYKLYKKKYPKLAHVLRNRHIEYNS
FT                   QLDYCKELENKNEAIVIRPTIEMNVGRFEKNKYKLKDIYNNGYSETMKIKDRLIKFMD"
FT   gene            373625..374839
FT                   /locus_tag="CLL_A0367"
FT   CDS_pept        373625..374839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0367"
FT                   /product="SEC-C motif domain protein"
FT                   /note="identified by match to protein family HMM PF02810"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0367"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22780"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIV4"
FT                   /protein_id="ACD22780.1"
FT                   /translation="MVKKECSNKDTNNEFIENKETDESAELYDNMMDDLFEKYENKMNK
FT                   MFVKGVYSFEVSEQLKSLSKEAVYNIARNLGMNKISTLNKDALIEKVLSEYTEIIANQF
FT                   IYFEEERFNILKGYLNNDGVKIFDHIDEYELSRTAYFMQQGIIFPSTKDEKAVFLMPKI
FT                   VQDIIINRSNTEYIDRLKRNKEVLDLYRGLNKAYGIINTKDVTSLVQRYDIENSGECSI
FT                   NEIIKEAQYYYREYREEKGFFINNNIENWSDLLKDIEKYNKDLEYYNINKSELLDMLGS
FT                   EWTYKSKFGKSFLKEFTNIFEIKKEMVYQIMDDLSFDIQDNDIDDTINSLLELINANNL
FT                   ELRNHVKNIATKFLSNIRLWKYKGATINEMNGDIIEAKSKLIIGRNDPCVCGSGKKYKK
FT                   CCGKN"
FT   gene            375053..376120
FT                   /locus_tag="CLL_A0368"
FT   CDS_pept        375053..376120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0368"
FT                   /product="putative mannose-1-phosphate
FT                   guanylyltransferase/mannose-6-phosphate isomerase"
FT                   /note="identified by match to protein family HMM PF00483"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0368"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24435"
FT                   /db_xref="GOA:B2TIV5"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIV5"
FT                   /protein_id="ACD24435.1"
FT                   /translation="MIYGLILAGGKGSRLYPLSRNNQPKQFLKIINEKSFLVNTVERIK
FT                   PLIDRENIYVVTNRDYEDKIKEEVQDIKEENIFIEPANKETATCIGLSAVRLLKQDADA
FT                   VMVVLPSDHYIQGEKEYLDTLSQAVEMANRRRCIVTLGIEPTRPETGYGYIEMGDRSTG
FT                   NISTYKIARFTEKPNLEVAKDFLLKGTYLWNSGMFVFRADVILREIEKYIPKMHKSLME
FT                   IYKYIGENNEEQVIKEQYEIIDGISIDFGVMQKTRKAFVIKCDFNWDDIGSFNALSRFL
FT                   GKYRSNSISKNVYMEDCESCSVFGEKNLIIGFGIKDLVIVDAGDVILVMDKNKDQEIKH
FT                   LLNKLSDEDKYNEFL"
FT   gene            376394..376975
FT                   /locus_tag="CLL_A0369"
FT   CDS_pept        376394..376975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0369"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0369"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23604"
FT                   /db_xref="InterPro:IPR029002"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIV6"
FT                   /protein_id="ACD23604.1"
FT                   /translation="MINTHKLIAENILNYTNSKSIYLINDHRFIWGNIKPDCVLKYKMI
FT                   KHYFIESIDIIIKKIEKLCSLSLQDVYYKMSVNKFSEELGVVCHFMCDYFCAPHYYRWE
FT                   FKNTSQVKNHVMYEKDLAKIAKEFNSNGIITSNIDVNNIKEFIFDLQNQYEGSMDFKND
FT                   LTYAYYACDSIVNMVLNKVFLNECSLSKVV"
FT   gene            377104..377469
FT                   /locus_tag="CLL_A0370"
FT   CDS_pept        377104..377469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0370"
FT                   /product="cadmium efflux system accessory protein"
FT                   /note="identified by match to protein family HMM PF01022"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0370"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22842"
FT                   /db_xref="GOA:B2TIV7"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR018334"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIV7"
FT                   /protein_id="ACD22842.1"
FT                   /translation="MNNGTNFVENCKCNIIHEDIVMKVKDLLPQEETLYDLAELFKVFG
FT                   DSTRIKIICALFESELCVCDMAALLGMTQSAISHQLRTLKSARLVKFRREGKVIYYSLD
FT                   DEHIKHIFDEGFKHITE"
FT   gene            377487..379754
FT                   /gene="cadA"
FT                   /locus_tag="CLL_A0371"
FT   CDS_pept        377487..379754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cadA"
FT                   /locus_tag="CLL_A0371"
FT                   /product="cadmium-exporting ATPase"
FT                   /EC_number="3.6.3.3"
FT                   /note="identified by match to protein family HMM PF00122;
FT                   match to protein family HMM PF00403; match to protein
FT                   family HMM PF00702; match to protein family HMM TIGR01494;
FT                   match to protein family HMM TIGR01512; match to protein
FT                   family HMM TIGR01525"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0371"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22908"
FT                   /db_xref="GOA:B2TIV8"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIV8"
FT                   /protein_id="ACD22908.1"
FT                   /translation="MENEIKLSLKGLDCANCANKIERKVNDIEDVYEANINFSLGKLTV
FT                   KLHENKDKDKVFNMIKEIVNKLEPDVIVINEKNNFTDNLTTEEINHDNKCNKSCCGNDN
FT                   YSTHTHKSSHTHSHNDDHNHIENISEDNEVNSKTRLFDKKKFIYENQIFIIGLILYLIA
FT                   VLFKENSYLNISIFVVSYILIGGDVLKTAFKNILRGEIFDENFLMTIATIGALAIGEYP
FT                   EAVGVMMFYKIGELFQGYAVNKSRKSITSLMNIRPEYANIITEHGEKRVYPEEVKIDDF
FT                   IIIKPGERIPLDGIVTDGKGSIDTSALTGESLPREINIGDELLSGSINLSSVIKLKVTK
FT                   VFSESTVSKILKLVENSSSKKAKTEKFITKFSRLYTPIVVFLAIAVAIIPPIIIQGEVF
FT                   SDWIYRALIFLVISCPCALVISVPLGLFAGIGGASKKGILIKGGNYIEVLKNVDTVVFD
FT                   KTGTLTKGIFKVTEINSIDMNKEDFLRIVALGESFSNHPIAQSIVKEFKGKLDKKHVEN
FT                   YQELSGYGVKATIEGKNVILGNYKLIEDNHINTKKVEKPGTVVYVVINNKYSGNIVIAD
FT                   EIKEDSIKAIKELKMIGIKRTVMLTGDNKIVADSVAKNIGVDEVRSELLPNDKVLEIER
FT                   LISNGTSRSKVMFVGDGINDAPVLARADIGIAMGGIGSDAAIEAADVVLMKDNPFALVD
FT                   AIKIAKKTNLILWQNIIFALGVKIFVLILGALGIANMWEAVFADVGVTLIAILNSMRTL
FT                   KN"
FT   gene            380146..380778
FT                   /gene="rex"
FT                   /locus_tag="CLL_A0372"
FT   CDS_pept        380146..380778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rex"
FT                   /locus_tag="CLL_A0372"
FT                   /product="redox-sensing transcriptional repressor Rex"
FT                   /note="identified by similarity to PDB:1XCB_G; match to
FT                   protein family HMM PF02629; match to protein family HMM
FT                   PF06971"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0372"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24745"
FT                   /db_xref="GOA:B2TIV9"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR009718"
FT                   /db_xref="InterPro:IPR022876"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2TIV9"
FT                   /protein_id="ACD24745.1"
FT                   /translation="MDKNKNISMAVIKRLPKYHRYLNELMKNDVDRISSKELGEKIGFT
FT                   ASQIRQDLNCFGDFGQQGYGYNVKELYTQINSILGLDKEYNAVLIGAGNIGQAIANYTR
FT                   FDKLGIMITAIFDANPKLIGIKIRDIEIRDIDELGSFLKSDSVDIGVICVPKKSAQRVS
FT                   DELINGGIRGIWNFAPIDLAVPKDVKVENVHLSESVSTLIYQLHQQR"
FT   gene            381125..381907
FT                   /gene="crt"
FT                   /locus_tag="CLL_A0373"
FT   CDS_pept        381125..381907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="crt"
FT                   /locus_tag="CLL_A0373"
FT                   /product="3-hydroxybutyryl-CoA dehydratase"
FT                   /EC_number="4.2.1.55"
FT                   /note="identified by similarity to SP:P52046; match to
FT                   protein family HMM PF00378"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0373"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22262"
FT                   /db_xref="GOA:B2TIW0"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIW0"
FT                   /protein_id="ACD22262.1"
FT                   /translation="MELKNVILEKEGHLAIVTINRPKALNALNSETLKDLDTVLENLEN
FT                   DSNIYAVILTGAGEKSFVAGADISEMKDLNEEQGREFGELGNKVFLRLENLDKPVIAAI
FT                   SGFALGGGCELSMSCDIRIASEKAKFGQPEAGLGITPGFGGTQRLARIVGLGKAKEMIY
FT                   TCDIIKAEEAYRIGLVNKVVSLESLMDEAKAMANKIIANAPIAVKLCKDAINRGMQVDI
FT                   DKAVLIEAEDFGKCFSSEDQTEGMTAFLERREKNFQNK"
FT   gene            381987..383126
FT                   /gene="bcd"
FT                   /locus_tag="CLL_A0374"
FT   CDS_pept        381987..383126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bcd"
FT                   /locus_tag="CLL_A0374"
FT                   /product="butyryl-CoA dehydrogenase"
FT                   /EC_number="1.3.8.1"
FT                   /note="identified by similarity to SP:P52042; match to
FT                   protein family HMM PF00441; match to protein family HMM
FT                   PF02770; match to protein family HMM PF02771; match to
FT                   protein family HMM PF08028"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0374"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23288"
FT                   /db_xref="GOA:B2TIW1"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIW1"
FT                   /protein_id="ACD23288.1"
FT                   /translation="MNFQLTREQELVQQMVREFAENEVKPIAAEVDETERFPMENVEKM
FT                   GKIGMMGIPFAKEFGGAGGDVLSYIMTVEELSKVCATTGVIVSAHTSLCASVINEHGTP
FT                   DQKAKYLPELCQGKKIGAFGLTEPGAGTDAAGQQTTAILDGDHYVLNGSKIFITNGGVA
FT                   ETFIIFAMTDKSQGTKGISAFIVEKSFPGFSIGKLEDKMGIRGSSTTELVMEDCIVPKE
FT                   NLIGKEGKGFGIAMKTLDGGRIGIAAQALGIAEGAFEEAVNYMKERKQFRRPLSAQQGL
FT                   QWYIAEMDVKIEAARHLVYKAACKKQNGQPYSVDAARAKLFAAEVAMDVTTKAVQIFGG
FT                   YGYTKDYPVERMMRDAKITEIYEGTSEVQKMVIAGSILR"
FT   gene            383146..383928
FT                   /locus_tag="CLL_A0375"
FT   CDS_pept        383146..383928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0375"
FT                   /product="electron transfer flavoprotein, beta subunit/FixA
FT                   family protein"
FT                   /note="identified by match to protein family HMM PF01012"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0375"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24232"
FT                   /db_xref="GOA:B2TIW2"
FT                   /db_xref="InterPro:IPR000049"
FT                   /db_xref="InterPro:IPR012255"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR033948"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIW2"
FT                   /protein_id="ACD24232.1"
FT                   /translation="MNIVVCVKQVPDTTAVKIDPKTGTLIRDGVPSIMNPEDKHALEGA
FT                   LQLKETLGAKVTVISMGLPMAKATLREALCMGADEAILLTDRALGGADTLATSKALAGV
FT                   IAKLDYDLVFAGRQAIDGDTAQVGPEIAEHLNIPQVTYVQGVEAKGEGTLLVNRALEDG
FT                   YEKIEIKTPCLLTAIEELNEARYMNVANIFSTNDDEIKVMSADDIDVDKAELGLKGSPT
FT                   KVKKSMTKEVKGAGEVVNKPAKEAVTYVLGKLQEKHYI"
FT   gene            383951..384958
FT                   /locus_tag="CLL_A0376"
FT   CDS_pept        383951..384958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0376"
FT                   /product="electron transfer flavoprotein, alpha
FT                   subunit/FixB family protein"
FT                   /note="identified by match to protein family HMM PF00766;
FT                   match to protein family HMM PF01012"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0376"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22463"
FT                   /db_xref="GOA:B2TIW3"
FT                   /db_xref="InterPro:IPR001308"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR014731"
FT                   /db_xref="InterPro:IPR018206"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR033947"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIW3"
FT                   /protein_id="ACD22463.1"
FT                   /translation="MNIADYRGVWVFAEQREGELQKVSLELLGEGRKIADKLGVKLTAL
FT                   LLGNNIENLSKTLAEHGADEVLVADDKNLEHYTTDAYTKVICDLANERKPGILFIGATF
FT                   IGRDLGPRVAARLSTGLTADCTSLDVEVEDGALLATRPAFGGNLMATIACPEHRPQMAT
FT                   VRPGVFGKVNTDGSNCTVEKVEVKLADSDVRTKVVEIIKAHKDVVDISEAKILVAGGRG
FT                   MGSKENFTLLQELAEVLDGTVAGSRAAVDNGWLERDYQVGQTGKTVRPSIYIACGISGA
FT                   IQHVAGMQESDMIIAINKDETAPIMQVADYAIVGDVKKVLPELIAQAKAVKSAE"
FT   gene            385061..385909
FT                   /gene="hbd"
FT                   /locus_tag="CLL_A0377"
FT   CDS_pept        385061..385909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hbd"
FT                   /locus_tag="CLL_A0377"
FT                   /product="3-hydroxybutyryl-CoA dehydrogenase"
FT                   /EC_number="1.1.1.157"
FT                   /note="identified by similarity to SP:P52041; match to
FT                   protein family HMM PF00725; match to protein family HMM
FT                   PF02737"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0377"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23317"
FT                   /db_xref="GOA:B2TIW4"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR006180"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR022694"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIW4"
FT                   /protein_id="ACD23317.1"
FT                   /translation="MKKVFVLGAGTMGAGIVQAFAQHGYEVIVRDIKDEFVERGIAGIN
FT                   KGLTKQVAKGRMTEEVKEEILSRISGTTDMKLAADCDLVVEAAIENMKIKREIFAELDE
FT                   ICKPETILASNTSSLSITEVASATKRADKVIGMHFFNPAPVMKLVEIIRGMATSQETFD
FT                   AIKELTVAIEKNPVEVAEAPGFVVNRILIPMINEGIGILAEGIASVEDIDTAMKYGANH
FT                   PMGPLALGDLIGLDVCLAIMDVLYNETGDTKYRAHSLLRKYVRAGWLGRKSGKGFYDYS
FT                   R"
FT   gene            386073..386507
FT                   /locus_tag="CLL_A0378"
FT   CDS_pept        386073..386507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0378"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF09719;
FT                   match to protein family HMM TIGR01909"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0378"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22827"
FT                   /db_xref="GOA:B2TIW5"
FT                   /db_xref="InterPro:IPR010181"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIW5"
FT                   /protein_id="ACD22827.1"
FT                   /translation="MLKETVIKYWDDKYDLNCAECLIYASNEEYDLNLSKDALKTMAAF
FT                   GGGMAIGDVCGVISGAIAVIGIMFTDISGHKSPIVKEMTTDFINKFKNKLGSNNCIELR
FT                   KEYRKSKKEGTCIVMVETAADILESIVKRDDNYKLDSNKY"
FT   gene            386582..387508
FT                   /locus_tag="CLL_A0379"
FT   CDS_pept        386582..387508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0379"
FT                   /product="8-oxoguanine DNA glycosylase"
FT                   /note="identified by match to protein family HMM PF00730;
FT                   match to protein family HMM PF07934"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0379"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23494"
FT                   /db_xref="GOA:B2TIW6"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR012904"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIW6"
FT                   /protein_id="ACD23494.1"
FT                   /translation="MDYKSIETSENGVIIRGVKNFKLKHIFECGQVFRFEEIEEDNFII
FT                   IAFGKLIELVQRNNDVFIYNTTEKEFKEIWLNYFDLDRDYSIIKEELSKDELLKQSIEF
FT                   GCGVRVLNQDPFEMLLSFIISARNSIPSIRKTVNKISEKWGNKIEYKGKIYYAFPTIEQ
FT                   IKDAKLDEIKETGASFRSKYLLDTIENVYNSINNNLDSSENEKSLLKRYDLNYIKSLSD
FT                   DECHVALQEFKGVGAKVADCIMLFSMGKTSSFPVDVWVKRAMMHFYNAEEGSLNKIRVF
FT                   ARNKFGKLSGFAQQYLFYYARENNIKV"
FT   gene            387667..389151
FT                   /locus_tag="CLL_A0380"
FT   CDS_pept        387667..389151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0380"
FT                   /product="iron-dependent hydrogenase"
FT                   /note="identified by match to protein family HMM PF00037;
FT                   match to protein family HMM PF02906"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0380"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22026"
FT                   /db_xref="InterPro:IPR004108"
FT                   /db_xref="InterPro:IPR009016"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR027631"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIW7"
FT                   /protein_id="ACD22026.1"
FT                   /translation="MFKFENQLIKLKHDVLSNIVRLAKEDNINKENLEKIPYEMLPGDE
FT                   PQYRESVVHEREVLLERLKLASGFIPNGKGTDELVNIEDEKQILYVIKNACDMCPTKKF
FT                   EVTDACRNCIAHKCQSVCNFGAITYVEGKAYIDPDKCKECGMCKKACPYDAIAEDMRPC
FT                   KRSCPTGALDINSDKRAMIKQEKCVNCGACMAACPFGALEDRSLLVKIVKELTNNSNIY
FT                   AVVAPAITGQLGPKTGYGQVKNAIKKLGFTDMVEAACGADAVTVHESNEFVHRMENGDP
FT                   YMTNSCCPGFLSYIEKMMPDQVDRISGTVSPMVAAGRFIKANDKDAKVVFIGPCTAKKS
FT                   EILRDSIKDAVDYVLTFEELLALFEGFNIDPANFYDIVVDEASIFGRGFGAGGGLTAAI
FT                   ENYIKDKGIECEFKPVKVSGGAEIKKTMMMAKMGRLPGNFIEGMMCEGGCINGSGKILS
FT                   PMKAKASFNKVNQQASMKNVLENSKIDDYKDIDLER"
FT   gene            389349..390044
FT                   /locus_tag="CLL_A0381"
FT   CDS_pept        389349..390044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0381"
FT                   /product="alkaline phosphatase synthesis transcriptional
FT                   regulatory protein PhoP"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00486"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0381"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23290"
FT                   /db_xref="GOA:B2TIW8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIW8"
FT                   /protein_id="ACD23290.1"
FT                   /translation="MKILLVDDEESILNLIKMNLIFENYEVITAECGIDAINLFKSESP
FT                   DLIVLDLMLPDKDGFEVIHEFQSINSEIPIIILSARDQLNNKLLGLQLGADDYITKPFD
FT                   SRELILRIRAISRRINKAKAIGKSEVKNKTNDIIEKGFIKIIIPERRVFIDDKEVIFTH
FT                   IEFEIILLMVQNPFKVFTREELLDKIWGYSFVGNTRAVDIHIKRIRQKLVGNEDVIKTI
FT                   YGVGYRLEV"
FT   gene            390048..391463
FT                   /locus_tag="CLL_A0382"
FT   CDS_pept        390048..391463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0382"
FT                   /product="two-component sensor histidine kinase"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF00672; match to protein
FT                   family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0382"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22789"
FT                   /db_xref="GOA:B2TIW9"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIW9"
FT                   /protein_id="ACD22789.1"
FT                   /translation="MNWGIKGKIVIMNIFILIIAILSIYVVTIYTLYSRVINNSIDMLK
FT                   KESYTSQSFVMKYLEMEDDFHVENVLNEMSPFIATYLSNGCKFRVQIYNNSSLIGDSDN
FT                   YPNISKDDDVIEALKGNKSYIIRRIEEASYILFSSPIYYSDGTIGCIRYVYDLNNENTI
FT                   ITNTIFSMVLFAIVAIIFSSMMSNSFSNRIVRPIVSLKNIARKVSFGDFSKKISINSKD
FT                   EIEDLSNSFNIMSNNIEIMIENLKEEKETQKRFLDNVTHEFKTPLAAILGYSDLLLRVK
FT                   EKKDIEQCVKYIVQSSNRLLKLVEQLLDLSRLNKNELEVKNENIDIKAVIETAAMMLNP
FT                   RMNKFGIKLNMNLVSKNVYADKEKTEQVILNLLDNAIKYSECTEIDIYMEHNEAYVIIY
FT                   IADNGQGIPKEDLKNVFENFYTAHKALQKKYGGSGLGLAICKEFMEKQSGKIEISSLNG
FT                   TTVKLSFKYAISN"
FT   gene            391488..392327
FT                   /locus_tag="CLL_A0383"
FT   CDS_pept        391488..392327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0383"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0383"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22077"
FT                   /db_xref="GOA:B2TIX4"
FT                   /db_xref="InterPro:IPR025031"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIX4"
FT                   /protein_id="ACD22077.1"
FT                   /translation="MINFNYKIVINLFVILIILLASIYVYLKSSIYNNLIVLDDKEQVM
FT                   QYSSHSIPVKVELYSRRWGKLIMNSNDEIKEFWNIVEAMPKSNNFYNSKIENSFNEITG
FT                   TIYYLDGEKGTLYLNNTLRIDDIYYGGNESSAYINRIKNYINDIFCTPSVLSELINDKN
FT                   KITIVDIYNNTKKCGSNDKILIKDEVMNLKRITDNKKLEWAVANKGDLNYHIRIYREES
FT                   EEFHDNKIEEDTNSYDVISLDIYENDYVIVRDYGDEIVNSFYMEGDLNNICDNLFNQ"
FT   gene            392348..393385
FT                   /locus_tag="CLL_A0384"
FT   CDS_pept        392348..393385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0384"
FT                   /product="ABC transporter, substrate-binding protein"
FT                   /note="identified by match to protein family HMM PF01547"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0384"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23615"
FT                   /db_xref="InterPro:IPR026045"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIX5"
FT                   /protein_id="ACD23615.1"
FT                   /translation="MLNTRRGILLIFILLMICIINGCSSNMSSSKEIQNLKNENLVVYV
FT                   AFNEDEAKVLLDGFKEKTGCNYTFLRYPTEELADKINSQKTLGEADIFLGGTADAVELL
FT                   KMNDCLEKYTINSSSEIPIEYMDSDGYWIGLYVEALSIAINEDRWNKEFKDVEKPKTIE
FT                   ELVNPKFKGEIVLADPRTSGTGYTFLSYLAQTMGKDNALEFFKKLKSNVGQFTDSGFTP
FT                   AKKVGMGEYLITVNFINQQLIVRNSGFNVESIVPENTGWTICPIAKIKDGKNKKASEAF
FT                   MNYCVTKEAGISLKDFSMGFSTIPGVNYPNIEKDFTSYKLSKEYDFKKAAKDRKELLED
FT                   LEEIM"
FT   gene            393778..394062
FT                   /gene="groS"
FT                   /locus_tag="CLL_A0385"
FT   CDS_pept        393778..394062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groS"
FT                   /locus_tag="CLL_A0385"
FT                   /product="chaperonin GroS"
FT                   /note="identified by match to protein family HMM PF00166"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0385"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22810"
FT                   /db_xref="GOA:B2TIX6"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2TIX6"
FT                   /protein_id="ACD22810.1"
FT                   /translation="MRIKPLGNRVVIKKLEAEEKTKSGIVLTGSAKEVPQEAEVVAVGP
FT                   GSIVDGTKIEMEVKVGDKVLYSKYSGTEVKLDGEEYMILKQDDILAIVE"
FT   gene            394076..395698
FT                   /gene="groL"
FT                   /locus_tag="CLL_A0386"
FT   CDS_pept        394076..395698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groL"
FT                   /locus_tag="CLL_A0386"
FT                   /product="chaperonin GroL"
FT                   /note="identified by match to protein family HMM PF00118;
FT                   match to protein family HMM TIGR02348"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0386"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22086"
FT                   /db_xref="GOA:B2TIX0"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2TIX0"
FT                   /protein_id="ACD22086.1"
FT                   /translation="MAKMLKFGEDARRSMQVGVDKLADTVKVTLGPKGRNVVLDKKFGS
FT                   PLITNDGVSIAREIELEDPYENMGAQLVKEVATKTNDVAGDGTTTATLLAQAIIREGLK
FT                   NVTAGANPMLIRNGIRMAVDKAVEEIKKISKPVEGKEDIARVAAISAADEEIGKLIADA
FT                   MEKVGNEGVITIEESKSMGTELDVVEGMQFDRGYVSPYMSTDTEKMEAILDTPYILITD
FT                   KKITNIQEILPILEQIVQAGRKLLIIAEDIEGEAMATLVVNKLRGTFTCVAVKAPGFGD
FT                   RRKEMLEDIAILTGGTVIAEELGRDLKEVTLDMLGQAESVKVSKDNTVVVNGKGNPENI
FT                   KDRISQIKAQIEETSSEFDKEKLQERLAKLAGGVAVIKVGAATETELKERKLRIEDALA
FT                   ATKAAVEEGIVPGGGTAYINVIKEVEKLTSDVQDTELGIKIIVKSLEEPLRQIASNAGV
FT                   EGSVIIEKVKNSEVGTGYDALYGKYVNMIKSGIVDPTKVTRSALQNAASVSATFLTTEA
FT                   AVAEIPQKEPAMPAPGMGMDGMY"
FT   gene            395913..396317
FT                   /locus_tag="CLL_A0387"
FT   CDS_pept        395913..396317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0387"
FT                   /product="putative pilin"
FT                   /note="identified by match to protein family HMM PF07963;
FT                   match to protein family HMM TIGR02532"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0387"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24626"
FT                   /db_xref="GOA:B2TIX1"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIX1"
FT                   /protein_id="ACD24626.1"
FT                   /translation="MSNKFCLNDKYKKNKGFTLLELIAVVAIITILATAILPKVTGYIN
FT                   EAKKTKVLDQCRKVVMAVESYNLTHSSNYEKNKNISNIKDDKSVNKYLEDVEFNNLELN
FT                   TTIQNCYDVLNGKEFKLKTGSEMLDLSTIN"
FT   misc_binding    396416..396514
FT                   /bound_moiety="guanine and/or adenine"
FT                   /note="Purine riboswitch; Rfam score 79.10"
FT                   /inference="nucleotide motif:RFAM:RF00167"
FT   gene            396653..398107
FT                   /gene="guaB"
FT                   /locus_tag="CLL_A0388"
FT   CDS_pept        396653..398107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaB"
FT                   /locus_tag="CLL_A0388"
FT                   /product="inosine-5'-monophosphate dehydrogenase"
FT                   /EC_number="1.1.1.205"
FT                   /note="identified by match to protein family HMM PF00478;
FT                   match to protein family HMM PF00571; match to protein
FT                   family HMM TIGR01302"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0388"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23074"
FT                   /db_xref="GOA:B2TIX2"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005990"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIX2"
FT                   /protein_id="ACD23074.1"
FT                   /translation="MATIIKTAYTFDDVLLVPNKSEILPREVSVKTKLTKTISLNIPLM
FT                   SAAMDTVTQSKMAIAMAREGGIGIIHKNMSIEQQAKEVDKVKRQENGIITDPIFLSKEN
FT                   TLQDAENLMGQYRISGVPITENGKLVGILTNRDVTFETDFTKKISDVMTKENLITAPEN
FT                   TSIDEAKEILKKHKIEKLPLVDGEGNLKGLITIKDIDKAKQFPNAAKDSNGRLLCGATV
FT                   GVTADMMDRVDALVKAKVDVITVDTAHGHSRGVMEAVKQIKIKHPELQVIAGNVATAEA
FT                   TEDLIKAGADCVKVGIGPGSICTTRVVAGVGVPQLTAVMDCAEIGKKYGIPVIADGGLK
FT                   YSGDIVKALAAGASVAMMGSLFAGCEEAPGEMEIYQGRSYKVYRGMGSLAAMACGSKDR
FT                   YFQDGNKKLVPEGVEGRVAYKGYVSDTIFQLIGGIKSGMGYLGSKNLDTLYETARFVVQ
FT                   TASGYRESHPHDINITKEAPNYSVGQ"
FT   gene            398194..399735
FT                   /gene="guaA"
FT                   /locus_tag="CLL_A0389"
FT   CDS_pept        398194..399735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaA"
FT                   /locus_tag="CLL_A0389"
FT                   /product="GMP synthase"
FT                   /EC_number="6.3.5.2"
FT                   /note="identified by match to protein family HMM PF00117;
FT                   match to protein family HMM PF00958; match to protein
FT                   family HMM TIGR00884; match to protein family HMM
FT                   TIGR00888"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0389"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22286"
FT                   /db_xref="GOA:B2TIX3"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR022955"
FT                   /db_xref="InterPro:IPR025777"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2TIX3"
FT                   /protein_id="ACD22286.1"
FT                   /translation="MKRDLVLVIDFGGQYNQLIARRVRECNVYCEVHPYNLSVDEIKQM
FT                   NPKGIIFTGGPNSVYGENSPLCDKAIFELGVPIFGICYGSQLMSHILGGKVATAPVSEY
FT                   GKTKVDVNIESKLFEGVSSSTICWMSHTDYIEKAPEEFKVIGNTPVCPVAAMECEDKNL
FT                   YAVQFHPEVMHTEEGTKMLSNFVYNICGCTGDWKMDSFVEKTIEEVRQKVGNGKVLCAL
FT                   SGGVDSSVAAVLLSRAVGKQLTCVFVDHGLLRKNEGDEVEEIFGPNGQYDLNFIRVNAQ
FT                   ERFYEKLAGIEEPEQKRKIIGEEFIRVFEEEAKKIGTVDYLVQGTIYPDVIESGLGKSA
FT                   VIKSHHNVGGLPDYVDFKEIIEPLRLLFKDEVRKAGLELGIPEKLVFRQPFPGPGLGIR
FT                   IIGEVTAEKVKIVQDADAIYREEIANAGIDKEIGQYFAALTNMRSVGVMGDERTYDYAI
FT                   ALRAVTTSDFMTAESADLPWEVLGKVTTRIVNEVKGVNRVMYDCTGKPPATIEFE"
FT   gene            complement(399861..400004)
FT                   /locus_tag="CLL_A0390"
FT   CDS_pept        complement(399861..400004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0390"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0390"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25024"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIX7"
FT                   /protein_id="ACD25024.1"
FT                   /translation="MKAIAFEPDEDNFIKNSIEGHEKEEALLNQLFPEQQSKKRKRKPK
FT                   KE"
FT   gene            400338..401258
FT                   /locus_tag="CLL_A0391"
FT   CDS_pept        400338..401258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0391"
FT                   /product="methicillin resistance protein MecR1"
FT                   /note="identified by match to protein family HMM PF00905"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0391"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23675"
FT                   /db_xref="GOA:B2TIX8"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIX8"
FT                   /protein_id="ACD23675.1"
FT                   /translation="MKKYFYLLEITLVFLILLTACSNNNAIDNNNKTLDERIIDVETEN
FT                   SQYNKEIEKTILNVDFSKYFQGYEGCAVFYLSSSNTYKIYNAEIAQERRSPCSTFKIIS
FT                   TLAALENEVITNDNSKRYWSGEKFWNESWNKDMMLNEAFKTSCIWYYREIINEIGMKKM
FT                   QSFVSNLGYGNEDISDWEGKLNKNNNNRSLTGFWVESSLKISPLEQVDVLYRIFGEDSE
FT                   YREENIETLLSVMELEDQQDNITVYGKTGYGRLKSVSLDSWFIGLFESGNERGYFAVRL
FT                   SETENPNVSSALAKEIALKIISENF"
FT   gene            401665..402828
FT                   /locus_tag="CLL_A0392"
FT   CDS_pept        401665..402828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0392"
FT                   /product="FliB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0392"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22714"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIX9"
FT                   /protein_id="ACD22714.1"
FT                   /translation="MRIIVPDYYKDFKCIASECEDTCCAGWEIVIDDETYEYYKTVNDK
FT                   FGDRFKNEIVTDEDGENIFVLKGDNCSFLNKDKKCDIYINLGKERLCNTCKQYPRFIEE
FT                   YGSTREIGISLSCPEAARIILNNSRKVEFELEENDEMVCTYNDISYDMFIQIISSRKIF
FT                   IDILQDRSIELNKRMAIILNFAKEIQDKIDANKISEITNIRHKYSDDKFIKKLIDQLDN
FT                   YKAKNIEKYKNIFKCLKVYKDIDHINEEWPDVLKYTIKYFYDEEHNVAFYMDKHNQFDK
FT                   YYVDKIYEYEHLMVYFIFRYLMKSLYDYDVIAKVKLAILSYLIIKELNVVRWCNNEQKF
FT                   NKEDQVELMHMYSKDVEHSDENLDELAEVFETNKVFSLENFIVMLMN"
FT   gene            402916..403767
FT                   /locus_tag="CLL_A0393"
FT   CDS_pept        402916..403767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0393"
FT                   /product="polysaccharide deacetylase family protein"
FT                   /note="identified by match to protein family HMM PF01522"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0393"
FT                   /db_xref="EnsemblGenomes-Tr:ACD21742"
FT                   /db_xref="GOA:B2TIY0"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIY0"
FT                   /protein_id="ACD21742.1"
FT                   /translation="MKEYNNMIVKGLIVVIVLLIISLFAFRINHNIKSESVQSDANEST
FT                   NVIKNDNDSIRFDGIDVTDKDMGVTILGYHSIGDKFKKDPLVVSKDLFREHLQAIKDSG
FT                   YTTITLHELYDYLYNGAEIPKKSVVITLDDGYKDNYTNAFSILKEFKMKATMFIIADYL
FT                   DGDVYVLPSQVKEMSDYGIDIEDHTLTHKELSTLNYDGQLKEVKESKIKLENITGKKIN
FT                   FIAYPSGSYNDETLKAVEDAGYSMAFTVKKGQAHKGDSQYEINRVLVDYTYKPRHIKRD
FT                   LK"
FT   gene            403991..404464
FT                   /locus_tag="CLL_A0394"
FT   CDS_pept        403991..404464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0394"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0394"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24831"
FT                   /db_xref="InterPro:IPR019191"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIY1"
FT                   /protein_id="ACD24831.1"
FT                   /translation="MNYYYNDDELNNDCNELRNNEFGDCEFSDYEESCCSDTESANNNS
FT                   ECRRCYKEGFKAGCEKGYKEGFRDGCEKGCKEGREKGYKEGFRDGCEKGCKEGREKGFK
FT                   EGFKEGRQKGYREGLKEGRENGFQEGCEVGFRQGYEKAIKDIKNCLNKKNSCC"
FT   gene            404778..406742
FT                   /locus_tag="CLL_A0395"
FT   CDS_pept        404778..406742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0395"
FT                   /product="putative transcription antiterminator"
FT                   /note="identified by match to protein family HMM PF00359;
FT                   match to protein family HMM PF00874; match to protein
FT                   family HMM PF05043; match to protein family HMM PF08279"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0395"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23659"
FT                   /db_xref="GOA:B2TIY2"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR007737"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036634"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIY2"
FT                   /protein_id="ACD23659.1"
FT                   /translation="MVTQSLERKLFTILEMLADSKGNALKDFSDELGVSTRSIRTYLKQ
FT                   LQEEIPKEVVEIVKTNNSEYKLNIKDDEKFKQLLELNRRQKQKFCQLNNPEERIDYLIN
FT                   RLVELNEIVTIDDLAEEMNVGRTTLVKDLKKVDQKLDEYGLVLKRKTNSGIKIEGDEIN
FT                   LRLIILEHICKTYNDSIILLESNNILTKKEVIKLQEQIVLNLKENKFSVTEALINNLIR
FT                   YITVMLMRLKNDKNITSLQSQYKIIKESEEYEIGKTIKSTIEALKDKKIDDLEIIFIVM
FT                   PLLGRNAPLYHEVLRNLTIGENITLLRKQIFDKVFEFTGLSLEEDEQLIQGLEYHLYYA
FT                   LNRIVLNIKYKNPMLKEIKEKYKLPYEVAKIAASVIEDKYQVQVEDDEVGYLALHFGTY
FT                   VERAGKSFIKIENAAIICGTGLGTAKLLIIKLKKILGEEINFKSFSDLDFTEEMASNYD
FT                   MIFTLVDLDINTEIQIVKITSIFDESQLKGEIESQIFLNKTNEKRNDTEQYILNGMLDK
FT                   KLVFYLNKNNFMDNLEYMLDSLIKSNIVSNEYKERVIAREQKAGTAFGGYIALPHAVDE
FT                   KVNNVIVSYGILDKLIMVDGKEVGLIILLVIPSESQNSQDIIVKTYQEIIDLSSDKKIV
FT                   QKLIKSKNYKEFKEVLGRR"
FT   gene            406746..407162
FT                   /locus_tag="CLL_A0396"
FT   CDS_pept        406746..407162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0396"
FT                   /product="glucitol operon activator protein"
FT                   /note="identified by match to protein family HMM PF06923"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0396"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23300"
FT                   /db_xref="GOA:B2TIY3"
FT                   /db_xref="InterPro:IPR009693"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIY3"
FT                   /protein_id="ACD23300.1"
FT                   /translation="MNSVVFLIIIGITVWVLNFIFGLIQIKDFNKNYIELRRLGKVAIG
FT                   RKKGMINSGTIVLIRIQDDGLILESRKMQGVTVAARVKQFKGLENMYIDSIEENDLKEF
FT                   NKPLKRAILDAVKNYKKFRHEEENKKEADLEVVV"
FT   gene            407194..407754
FT                   /locus_tag="CLL_A0397"
FT   CDS_pept        407194..407754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0397"
FT                   /product="PTS system, glucitol/sorbitol-specific, IIC
FT                   component"
FT                   /EC_number="2.7.1.191"
FT                   /note="identified by match to protein family HMM PF03608;
FT                   match to protein family HMM TIGR00821"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0397"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22161"
FT                   /db_xref="GOA:B2TIY4"
FT                   /db_xref="InterPro:IPR004699"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIY4"
FT                   /protein_id="ACD22161.1"
FT                   /translation="MTQMLELLARGADSFMNLFRAGGNQFMDFVTGIIPLLIALLVTMN
FT                   AIIKFIGDEKVEKLAMKCAKNPITRYLLLPVIGTFVFANPMTLSLGKFMPEKYKPSYYA
FT                   AASFSCHTMNGLFPHINPGELFVFLGIAAGITTLGFSTTDLAVRYLLVGIITNFFRGWI
FT                   TDFTTSYVEKQQGVKLNTEVKLG"
FT   gene            407837..408823
FT                   /pseudo
FT                   /locus_tag="CLL_A0399"
FT                   /note="PTS system, glucitol/sorbitol-specific, IIBC
FT                   component, authentic frameshift; this gene contains a frame
FT                   shift which is not the result of sequencing error;
FT                   identified by match to protein family HMM PF03612; match to
FT                   protein family HMM PF07663; match to protein family HMM
FT                   TIGR00825"
FT   gene            408870..409235
FT                   /locus_tag="CLL_A0400"
FT   CDS_pept        408870..409235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0400"
FT                   /product="PTS system, glucitol/sorbitol-specific, IIA
FT                   component"
FT                   /EC_number="2.7.1.191"
FT                   /note="identified by match to protein family HMM PF03829"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0400"
FT                   /db_xref="EnsemblGenomes-Tr:ACD21984"
FT                   /db_xref="GOA:B2TIY8"
FT                   /db_xref="InterPro:IPR004716"
FT                   /db_xref="InterPro:IPR036665"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIY8"
FT                   /protein_id="ACD21984.1"
FT                   /translation="MKTIYSTKIEKIGENAEEFFAANMFITFKDNAPQELIDYCFIHNE
FT                   NNLLEEIIPQDILSIGDVNYEIKAVGELVNKNLKELGHITYNFLGEEEAQVAGTLYLEK
FT                   KEIAPIAVGTILKIIRN"
FT   gene            409505..410326
FT                   /locus_tag="CLL_A0401"
FT   CDS_pept        409505..410326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0401"
FT                   /product="sorbitol-6-phosphate 2-dehydrogenase"
FT                   /EC_number="1.1.1.140"
FT                   /note="identified by match to protein family HMM PF00106;
FT                   match to protein family HMM PF08659"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0401"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24823"
FT                   /db_xref="GOA:B2TIY9"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIY9"
FT                   /protein_id="ACD24823.1"
FT                   /translation="MTKSWLNLEGKTVIVTGGASGIGKAVAQEFLNNGSNVVVCDMNPN
FT                   APELDMNEKSGKMLYVNTDVTSYDSVKEMVSKTKETFGKIDILVNNAGINIPRLLVDPK
FT                   EENSKYELDEAVFDKIVNVNIKGVFFCAQAVAREMVKEGSGVIVNMSSESGLEGSEGQS
FT                   IYAATKNAVNSFTRSWSKELGKQGVRVVGVAPGILEATGLRTIEYETALSYTRGITVED
FT                   LRAGYSKTSTTPLGRSGKLSEVADLVCYLGSERGSYIHGVTYNVAGGKTRG"
FT   gene            410486..411154
FT                   /locus_tag="CLL_A0402"
FT   CDS_pept        410486..411154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0402"
FT                   /product="putative transaldolase"
FT                   /note="identified by match to protein family HMM PF00923;
FT                   match to protein family HMM TIGR00875"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0402"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23067"
FT                   /db_xref="GOA:B2TIZ0"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR004731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018225"
FT                   /db_xref="InterPro:IPR033919"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIZ0"
FT                   /protein_id="ACD23067.1"
FT                   /translation="MIYILDTANLQEIKRAYEFYPMEGVTTNPSIISKEKGDFIKILKN
FT                   IRKIIGNDSMLHAQVLSLKAEDMIEEAKYIAEQVGGNIYIKIPVTPEGIKAIKILSKEG
FT                   YKITATAIFTAQQALIAAKAGAKFVAPYVNRIDNISGNGVEVVGEIIKLLEFNNLNTKV
FT                   LAASFKNVQQVNDVALRGCQSVTVGSDIMDKLIEHPLTELSVKQFINDWENAYNRVTVL
FT                   "
FT   gene            411344..412693
FT                   /gene="pgi"
FT                   /locus_tag="CLL_A0403"
FT   CDS_pept        411344..412693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgi"
FT                   /locus_tag="CLL_A0403"
FT                   /product="glucose-6-phosphate isomerase"
FT                   /EC_number="5.3.1.9"
FT                   /note="identified by match to protein family HMM PF00342"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0403"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23777"
FT                   /db_xref="GOA:B2TIZ1"
FT                   /db_xref="InterPro:IPR001672"
FT                   /db_xref="InterPro:IPR018189"
FT                   /db_xref="InterPro:IPR035476"
FT                   /db_xref="InterPro:IPR035482"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2TIZ1"
FT                   /protein_id="ACD23777.1"
FT                   /translation="MKKGLTLDLSKTQAFVKDYELDYMEGMVKDSHDRLHSKTGQGNDF
FT                   LGWIDLPVDYDKEEFARIKKAAEKIQSDSDVLIVIGIGGSYLGARAAIEMLTSNFHNVL
FT                   DDNKRKVPKIFYAGNNISSTYMAELLEAIDGKDVSVNVISKSGTTTEPAIAFRIFKSYL
FT                   EKKYGVEEARKRIYATTDKAKGALKGLADVEGYETFVIPDDVGGRFTVLTPVGLLPIAV
FT                   AGINIDEMMQGAADAREAYSNPSLKENDCYKYAVTRNALYNKGKEIEVLVNYEPCIHYF
FT                   NEWWKQLYGESEGKDKKGLFPAAVDFSTDLHSMGQYIQDGRRNLFETVINVEKARKEIT
FT                   IEFSEGDLDGLNFLTGKTMDFVNNKAFQGTLLAHNDGEVPNMVLNVPELSPYYFGHMVY
FT                   FFEKACGISGYLLGINPFDQPGVEAYKKNMFALLGKPGYEDMKDELEKRL"
FT   gene            412697..413143
FT                   /locus_tag="CLL_A0404"
FT   CDS_pept        412697..413143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0404"
FT                   /product="Emg2 protein"
FT                   /note="identified by match to protein family HMM PF02639"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0404"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24619"
FT                   /db_xref="InterPro:IPR003791"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIZ2"
FT                   /protein_id="ACD24619.1"
FT                   /translation="MKIIIDGDACPGISIIEKVAKDRDIPVIIYCDINHFIQSNYSEVK
FT                   IVDSGFQSVDMFVINETKANDIVISQDYGVAAICLPKKARVINPKGFIYDENNIDRLLE
FT                   ERHLSQKIRRGGGKTSNPKKRTNEDNLRLEKNLIKLIELVNKNI"
FT   gene            413295..415322
FT                   /locus_tag="CLL_A0405"
FT   CDS_pept        413295..415322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0405"
FT                   /product="two component regulator three Y motif protein"
FT                   /note="identified by match to protein family HMM PF07495"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0405"
FT                   /db_xref="EnsemblGenomes-Tr:ACD21883"
FT                   /db_xref="InterPro:IPR011123"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIZ3"
FT                   /protein_id="ACD21883.1"
FT                   /translation="MQELQLKNIELIFNKEKPQTRGTEINIKSQVNNPNDDIEYKFIIG
FT                   LNGIWTTIQDYSEKDNCCWKPVYEGEYTVMVQARDKEGKKSFDYVAKEDYLISNKDLVS
FT                   LIDEVKVDKTSLNVGEKCLIEVKTVEKELLYRFYVKDEQGWKPIIDYTTDNTLLYTANN
FT                   AGKKEFLIECKRVDSDENFDDYTTVKINVDDIEDVEITNFICHNTELIVGQDLKFTLET
FT                   KNESNRTILYKYYKISKDGKATCVQDYSTKNYVNYKEYTYGSYRLLACAKDIFSNKEYD
FT                   DRAVLLYDIKPYKDILIKGFSADLSSPQIIETDIKFKAEVEGGLNLLYRYKVKGSYEED
FT                   TGFIRNSEYIWKPRESGRYGISVFVKDASSQCEYEACEEIEFEIEKKGSKPVKIVDVVI
FT                   DKEKSVLINQPVNIMVNAEGGTRLNYSFIIYRNKIKVEKIENRNRNWVNFTPEEKGDYE
FT                   IEIIVKDRYSDKEFDAHTFVYLKANEYIPGEIDYIMLPLKNNYVVGDTIEFESIIQNTK
FT                   SVLVKYVTKINGHLVEETEFIKNKKLRFIPKTSGKYTIEVYAKNIKCTDEYDSKKEVSL
FT                   YINEASPVINTEIIINKKKVKVNHELSFEVKSTGGKDVCYEFYLMEHGNWNKVQSYSKK
FT                   DYYSFIPFIKGKYKILVLSKSYYKNINYEDYAEISFKVLD"
FT   gene            415484..416224
FT                   /locus_tag="CLL_A0406"
FT   CDS_pept        415484..416224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0406"
FT                   /product="lytic murein transglycosylase"
FT                   /note="identified by match to protein family HMM PF01464"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0406"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23564"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIZ4"
FT                   /protein_id="ACD23564.1"
FT                   /translation="MSIDNLNSFSNELMALTAINNSDNSSGDKNNSGTNGLEFALVMQA
FT                   LTDKSNESVNKSNEDSNALEAMKSLENTNTTPGQRLDYMKMVLNENLTSKLNGSSTTST
FT                   VNIDTDDESKQRIYRAVEDASRKYGVDSNLILGIIKQESDFNPKVVSGAGAMGLMQLMP
FT                   ENCEEDGVSDPFNIEQNINGGVKQLKGYIDRYDGNVEMALMAYNAGPGTMQKRGVISVE
FT                   HLYKMPKETQNYIPKVMGYYRSGL"
FT   gene            416439..417155
FT                   /gene="rluB"
FT                   /locus_tag="CLL_A0407"
FT   CDS_pept        416439..417155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rluB"
FT                   /locus_tag="CLL_A0407"
FT                   /product="ribosomal large subunit pseudouridine synthase B"
FT                   /note="identified by match to protein family HMM PF00849;
FT                   match to protein family HMM PF01479; match to protein
FT                   family HMM TIGR00093"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0407"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24256"
FT                   /db_xref="GOA:B2TIZ5"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR018496"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="InterPro:IPR042092"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIZ5"
FT                   /protein_id="ACD24256.1"
FT                   /translation="MERLDKIISNLGYGSRKEAKVLARKGLIEVDGKIIKDSSVTIDPE
FT                   KSIVKINGEEIFYRKYIYLMMNKPTGVISATHDSKDETVIDLLELDHQIFNPFPVGRLD
FT                   KDTVGLLLLTNDGEFNHRMISPKWHVDKVYYAKIDKEVNEKDQQAFKKGVVLDDGYKCL
FT                   EAKLDIISASPEGSEVRITIQEGKYHQVKRMFEACDKKVVYLKREEFGGLILDENLEEG
FT                   EYRELSDEELAILNKN"
FT   gene            417694..419946
FT                   /locus_tag="CLL_A0408"
FT   CDS_pept        417694..419946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0408"
FT                   /product="helicase, UvrD/Rep family"
FT                   /EC_number="3.6.1.-"
FT                   /note="identified by match to protein family HMM PF00580"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0408"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25019"
FT                   /db_xref="GOA:B2TIZ6"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR005751"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIZ6"
FT                   /protein_id="ACD25019.1"
FT                   /translation="MELKSLLNKEQYEGAITIDGQLLILAGAGSGKTRVLTYRMAHMIE
FT                   NIGIAPYNILAITFTNKAAKEMKDRVISLIGSKAENMWISTFHSTCVRILRREIDKIGY
FT                   NSNFTIYDTSDQKVLIKECMKLLNINDKDISDQEILSKIGKAKDTMQTAQSFMIQNESN
FT                   FREKKIAEAYEMYQRRLKENNALDFDDLIFKAVELFKSNPEVLDFYQNKFKYIMVDEYQ
FT                   DTNGAQYELIKLLASKYKNICVVGDDDQCIYQWRGADIQNILDFEKDYPKAKVIKLEQN
FT                   YRSKSNILNAANVVIVNNANRKSKVLRTEQEAGDKIKIYRAFSDSDEGDFVSKQIAEIK
FT                   SKENKEYKDFAILYRTNAQSRIFEESLRRRGIPYKIIGGTRFYDRKEIKDVLAYLKAIV
FT                   NPRDDVSLKRIINVPKRSIGDATVSKIQEFANNFELDMWDALMEVRTIPTLTPRNANNI
FT                   EAFTNLMEEFMSLSETAPISVLIEAILKETEYLKQLEASKEIEDKSRIENLKELVSDAV
FT                   DFEKNNEDKSLAAYLEKVSLVQDTDKIEEQEDTIVLMTVHSAKGLEFPVVFMVGMENGI
FT                   FPGNMSFEKESEMEESRRLCYVGITRAKETLFMTSAEVRRVFGRTVAYSQSDFINEIKQ
FT                   ELKEYVSGNRIGSGNGSNSNVKAQKNDSYSNPHSLRSTIRKEFSKPVNTVINDNDNSGY
FT                   LNANEVTLGRKVQHEKFGIGTIVSVQGSGDDKKLTIAFDKQGVKNLMLSFAKLKAI"
FT   gene            420034..422037
FT                   /gene="ligA"
FT                   /locus_tag="CLL_A0409"
FT   CDS_pept        420034..422037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ligA"
FT                   /locus_tag="CLL_A0409"
FT                   /product="DNA ligase, NAD-dependent"
FT                   /EC_number="6.5.1.2"
FT                   /note="identified by match to protein family HMM PF00533;
FT                   match to protein family HMM PF00633; match to protein
FT                   family HMM PF01653; match to protein family HMM PF03119;
FT                   match to protein family HMM PF03120; match to protein
FT                   family HMM TIGR00575"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0409"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22265"
FT                   /db_xref="GOA:B2TIZ7"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR001679"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004150"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013839"
FT                   /db_xref="InterPro:IPR013840"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="InterPro:IPR041663"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2TIZ7"
FT                   /protein_id="ACD22265.1"
FT                   /translation="MVDKIERIKELVEILNKYSYDYYVLDNPSVSDKDYDKEYDELKLL
FT                   EKETGFVLPYSPTLRIGDVVLQGFNKYTHKGKLWSLDKAQSLDEIKDWHNRNIKFVNEM
FT                   RAQGEDLPDLKYIATKKFDGLTVNLTYNKGGMLEVSATRGNGEIGENVTSQVKTIKSIP
FT                   LKLQENDDLFEVHGEAIMTQEAFEKYNASADIPLKNLRNGAAGALRNLNIKETARRDLS
FT                   AFFYDVGYKEGYQFKTYLEMMDFIKEKGLPIDEYLKVCTSIDDIKKEIEYIEKIRFDLN
FT                   YDIDGLVIAIDDIRTRELLGYTVKYPKWAIAYKFEAQEATTKLLDVEWNVGRSGRIGPT
FT                   AILEPVELAGVTVKRATLNNMDDIKRKGVRIGADVFVRRSNDVIPEIMGTLENTLENSE
FT                   EICPPTECPACGSHVVLNGAHYFCENTLSCKPQLVKTIVHYASRDAMNIAGFSEKTAEQ
FT                   LFEKLNIKSISDLYKLKKEDLINLEKFGEKKSENLLNAIEKSKDCKLYSFIYALGIPNV
FT                   GVKTAKDIVNKFKSIDGLKNATFEELVSVQDVGDIVAQDVIEFFKEEKVINTIDELLNL
FT                   GVNPIFDEVKIVESIFKDKTVVTTGTLQNYSRTEIKTKLESLGAKVSGSVSKKTDYVIA
FT                   GESAGSKLTKAEELGVKIISEEEFEKMLGRES"
FT   gene            422408..422701
FT                   /gene="gatC"
FT                   /locus_tag="CLL_A0410"
FT   CDS_pept        422408..422701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatC"
FT                   /locus_tag="CLL_A0410"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, C subunit"
FT                   /EC_number="6.3.5.-"
FT                   /note="identified by match to protein family HMM PF02686;
FT                   match to protein family HMM TIGR00135"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0410"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24037"
FT                   /db_xref="GOA:B2TIZ8"
FT                   /db_xref="InterPro:IPR003837"
FT                   /db_xref="InterPro:IPR036113"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2TIZ8"
FT                   /protein_id="ACD24037.1"
FT                   /translation="MSVTKKDVEYVAELARLSFNEDEKESLASDLNQILNYVEKLQELD
FT                   TEKEDIIVNPYYIENKFREDEITPSIKLEEVLENAPKTLEEYVLVPTIIREQ"
FT   gene            422720..424177
FT                   /locus_tag="CLL_A0411"
FT   CDS_pept        422720..424177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0411"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase subunit A"
FT                   /EC_number="6.3.5.-"
FT                   /note="identified by match to protein family HMM PF01425;
FT                   match to protein family HMM TIGR00132"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0411"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24243"
FT                   /db_xref="GOA:B2TIZ9"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2TIZ9"
FT                   /protein_id="ACD24243.1"
FT                   /translation="MDFTNYKAHELKNLISKKEASVEEVTKAHLENVKNIDEKVNAFLY
FT                   IAEEEALNDAKALDEKLSKGEDIGLLGGAPLGIKDNISVKNMQNTCASKILEGYISPYD
FT                   ATVSESVKSQGGVILGKLNMDEFAMGSSTENSAYKITRNPWDLDRVPGGSSGGSAAAVA
FT                   SKEVPLALGTDTGGSVRQPASFCGIVGLKPTYGRVSRSGVVAYGSTLDQVGTLGRDVKD
FT                   CALLTQVISGVDHRDFTTANINVPNYENSLSENIKGKKIALPKEFFKDGLDPKVQKAIY
FT                   DALEVFKANGAEITEVSLPLADYAISAYYLLACAEASSNLARFDGVRYGHRSESVEDAV
FT                   DVYFKSRSEAFGKEVKKRIMLGTYALSAGYYDAYYKKALKVRNLIKGEFENIFKDFDAI
FT                   ISPTAPTPAYKIGEKTENALEMYLGDIYTVPVNIAGIPAISLPCGVADGLPVGLQIMGN
FT                   YFKEDTLFNLAYSYEQSTKWHEMHPNL"
FT   gene            424198..425628
FT                   /gene="gatB"
FT                   /locus_tag="CLL_A0412"
FT   CDS_pept        424198..425628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatB"
FT                   /locus_tag="CLL_A0412"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, B subunit"
FT                   /EC_number="6.3.5.-"
FT                   /note="identified by match to protein family HMM PF01162;
FT                   match to protein family HMM PF02637; match to protein
FT                   family HMM PF02934; match to protein family HMM TIGR00133"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0412"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24227"
FT                   /db_xref="GOA:B2TJ00"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2TJ00"
FT                   /protein_id="ACD24227.1"
FT                   /translation="MEFESVIGLEVHAELLTNTKIYCGCTTEFGGKPNTHVCPVCLGLP
FT                   GSLPQLNKRVLELGIKAGLALNCKITKVGRMDRKNYFYPDCPKNYQITQDELPICRDGY
FT                   IDIELESGEVKRIGIERIHIEEDAGKLLHTKRGTLVDFNRAGVPLIEVVSKPDIRTPEE
FT                   ATLYLTKLRSILSSAQISDCKMEEGSLRCDGNISIRERGTEPFGIRSEIKNMNSFKALE
FT                   KALNYEFDRQVEAVTNGEALSVETRRWDETNNKTIVMRSKEQANDYRYFPEGDLVTLNV
FT                   SDEWIEEIRKTIPELPYQKADRFVKEYGLPKYDAHVLTLTDAMADYFDECAKLSGDPKA
FT                   ASNWIMGDISRLMKEESTWVEDLKFSPKELAELIEVIKDGTISSAIGKKVLEDMFAEGK
FT                   SPKTIIDEKGLKQNNDEDAIRQLVNKVLDENPQVIEQYKSGRTRILGFAVGQVMKETKG
FT                   QANPGIVNKLVTEEVEKR"
FT   gene            complement(425690..425989)
FT                   /locus_tag="CLL_A0413"
FT   CDS_pept        complement(425690..425989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0413"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0413"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24997"
FT                   /db_xref="GOA:B2TJ01"
FT                   /db_xref="UniProtKB/TrEMBL:B2TJ01"
FT                   /protein_id="ACD24997.1"
FT                   /translation="MKFLTATFLIVAILFMLVFLFIGIWLFIVAIKSHKQLRYQNYILE
FT                   KICQKLNALSNKMYFNEALKDNTNYSTDDFDLNQATEDSDYDNISSFDKSEELE"
FT   gene            426256..427737
FT                   /locus_tag="CLL_A0414"
FT   CDS_pept        426256..427737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0414"
FT                   /product="putative extracellular solute-binding protein"
FT                   /note="identified by match to protein family HMM PF00496"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0414"
FT                   /db_xref="EnsemblGenomes-Tr:ACD21762"
FT                   /db_xref="GOA:B2TJ02"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:B2TJ02"
FT                   /protein_id="ACD21762.1"
FT                   /translation="MKKYLLPISLIFIIGAFLLGFIQIDNVSSDKKGDDVINYGVEDIP
FT                   DNLKTVTNLSKRNEDIICAVSKGLVSKDIDSNIVPSLAKEIIKSEDGIEYEFKIDDNIY
FT                   WSDGSKITSDDVIVFFRELLKEDDEENIHALLDVYGAREFKDGKTTFEKGVAIKSKDNS
FT                   VIIRLNAKNDKFLSELTKPQYRLRKYLVMWENIKKNYNEVIYSGDYKITSFIDDKITLE
FT                   SNNNDENRRIINLINDSNVELSMASFEIGERDIVINPPQSQLNKLSNDGSLITMPKDTG
FT                   VYLYINDKNNISLQGRREIYKYISESMEDYSYSNEKSFELAEGSYFRENKEDLTKLQTR
FT                   KVISNKEEEWSPPKVLTILCRDNSINRELCRVIEKWFDENTDISIKYSLLKEDEFNDEE
FT                   LQKRYDMILINNEANILEKDKFYKKFVNYMSDSEKEILLSNNCNDDVYLNLENKIFEEY
FT                   TIVPLIFYNENIAYSKKISNIKMDGNGNMDFSSIK"
FT   gene            complement(427810..428919)
FT                   /locus_tag="CLL_A0415"
FT   CDS_pept        complement(427810..428919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0415"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0415"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22981"
FT                   /db_xref="UniProtKB/TrEMBL:B2TJ03"
FT                   /protein_id="ACD22981.1"
FT                   /translation="MMASYYLYSFYNKSDVDSNDYERFSNEILCVLRDYKESLYDLSFE
FT                   ENLNILLCLNIFYKYSENSIAKDLILDLSDFLINRFMIKDYYVNSLENCCLLAICLMES
FT                   YKHTNIISFKETSKEINDKLLSLYDTDKNIFIKLTDKKETKYSCLEINLYLLSLMIHAK
FT                   EEDKISELKPIISNIYRKLYVNNNLLTSWPEAPTLDEVERYKNLSLKSQDMLDETYFRM
FT                   PNLPTPESNGLAPIFVKNLSYSRKKDCFTVPKVSFDSNKNMFSFLLFIYFLKDDIEKEM
FT                   GFNKNKINMTDCRTTTNINDEVSDEINNEIINSSELNDIEIEDIDVSTNSNLKVPDSPK
FT                   LTTDLSKTTSNSYNKSKKSSKDRYNNKKS"
FT   gene            429194..429400
FT                   /locus_tag="CLL_A0416"
FT   CDS_pept        429194..429400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0416"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0416"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24641"
FT                   /db_xref="UniProtKB/TrEMBL:B2TJ04"
FT                   /protein_id="ACD24641.1"
FT                   /translation="MKVDSSNPCEVLLCINIGDDFLYIHISGEKSFNMLISFVEEDFFE
FT                   TLIGIRRPHFELRTIVFTDSFDK"
FT   gene            429716..430465
FT                   /gene="rph"
FT                   /locus_tag="CLL_A0417"
FT   CDS_pept        429716..430465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rph"
FT                   /locus_tag="CLL_A0417"
FT                   /product="tRNA nucleotidyltransferase"
FT                   /EC_number="2.7.7.56"
FT                   /note="identified by match to protein family HMM PF01138;
FT                   match to protein family HMM PF03725; match to protein
FT                   family HMM TIGR01966"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0417"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23175"
FT                   /db_xref="GOA:B2TJ05"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR002381"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR018336"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2TJ05"
FT                   /protein_id="ACD23175.1"
FT                   /translation="MRIDGRKNEQIRHVKVTRHYTKYAEGSVYIEVGDTKVLCNVSIED
FT                   KVPPFMKGTGSGWITAEYNMLPRSTETRKIRDIARLKIDGRTMEIQRLIGRALRSVVDL
FT                   KALGEKTLWIDCDVIQADGGTRTTAISGAFIALVDAVNKLHKIKPFKIYPIRSFVAAVS
FT                   VGIVNEEKILDLCYQEDSKAKVDMNIIMTDEGSFVEVQGTGEESPYTRAELNELLDLGE
FT                   KGIKQMINVQKESLKMDSLWIGTGGNN"
FT   gene            430469..431086
FT                   /gene="rdgB"
FT                   /locus_tag="CLL_A0418"
FT   CDS_pept        430469..431086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rdgB"
FT                   /locus_tag="CLL_A0418"
FT                   /product="non-canonical purine NTP pyrophosphatase,
FT                   RdgB/HAM1 family"
FT                   /note="identified by match to protein family HMM PF01725;
FT                   match to protein family HMM TIGR00042"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0418"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24209"
FT                   /db_xref="GOA:B2TJ06"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:B2TJ06"
FT                   /protein_id="ACD24209.1"
FT                   /translation="MKKLILASNNIKKIKEMKELLKDLNIEIKSLNEENIDIDVEEDGS
FT                   TFEENAKKKAKEIYDFLKSRNERNFLVLSDDSGLEVDYLNGAPGIYSARYAGEHGNDKK
FT                   NNEKLLSELSSVPTSKRTAKFVCQIAMFDEDGRYYSITGDANGCILEKPQGDDGFGYDP
FT                   LFLYRPLNKTFAELTLEEKNDISHRGVALKKLKGTILNLISE"
FT   gene            431098..431577
FT                   /locus_tag="CLL_A0419"
FT   CDS_pept        431098..431577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0419"
FT                   /product="phosphodiesterase, family"
FT                   /EC_number="3.1.-.-"
FT                   /note="identified by match to protein family HMM PF00149;
FT                   match to protein family HMM TIGR00040"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0419"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25020"
FT                   /db_xref="GOA:B2TJ07"
FT                   /db_xref="InterPro:IPR000979"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR041802"
FT                   /db_xref="UniProtKB/TrEMBL:B2TJ07"
FT                   /protein_id="ACD25020.1"
FT                   /translation="MLIAVISDTHRVSNYIKMANEYIKEADIVIHLGDNVEDAEEISKE
FT                   FNGEVYIVSGNCDYKDKYPKEGIIDIEGSRIFFTHGDLYGVKYGLNNIYYKTKELGADI
FT                   ALFGHTHISMIEKYDDVILMNPGSLSLPRNRGRHIGFIEVEKGVKPSVYLKEMVI"
FT   gene            431706..431781
FT                   /locus_tag="CLL_A0420"
FT   tRNA            431706..431781
FT                   /locus_tag="CLL_A0420"
FT                   /product="tRNA-Pro"
FT   gene            431804..431877
FT                   /locus_tag="CLL_A0421"
FT   tRNA            431804..431877
FT                   /locus_tag="CLL_A0421"
FT                   /product="tRNA-Gly"
FT   gene            431891..431969
FT                   /locus_tag="CLL_A0422"
FT   tRNA            431891..431969
FT                   /locus_tag="CLL_A0422"
FT                   /product="tRNA-Arg"
FT   gene            431973..432050
FT                   /locus_tag="CLL_A0423"
FT   tRNA            431973..432050
FT                   /locus_tag="CLL_A0423"
FT                   /product="tRNA-His"
FT   gene            432052..432128
FT                   /locus_tag="CLL_A0424"
FT   tRNA            432052..432128
FT                   /locus_tag="CLL_A0424"
FT                   /product="tRNA-Gln"
FT   gene            432133..432210
FT                   /locus_tag="CLL_A0425"
FT   tRNA            432133..432210
FT                   /locus_tag="CLL_A0425"
FT                   /product="tRNA-Lys"
FT   gene            432218..432304
FT                   /locus_tag="CLL_A0426"
FT   tRNA            432218..432304
FT                   /locus_tag="CLL_A0426"
FT                   /product="tRNA-Leu"
FT   gene            432308..432384
FT                   /locus_tag="CLL_A0427"
FT   tRNA            432308..432384
FT                   /locus_tag="CLL_A0427"
FT                   /product="tRNA-Gly"
FT   gene            432399..432472
FT                   /locus_tag="CLL_A0428"
FT   tRNA            432399..432472
FT                   /locus_tag="CLL_A0428"
FT                   /product="tRNA-Gly"
FT   gene            432484..432561
FT                   /locus_tag="CLL_A0429"
FT   tRNA            432484..432561
FT                   /locus_tag="CLL_A0429"
FT                   /product="tRNA-Lys"
FT   gene            432569..432646
FT                   /locus_tag="CLL_A0430"
FT   tRNA            432569..432646
FT                   /locus_tag="CLL_A0430"
FT                   /product="tRNA-His"
FT   gene            432651..432725
FT                   /locus_tag="CLL_A0431"
FT   tRNA            432651..432725
FT                   /locus_tag="CLL_A0431"
FT                   /product="tRNA-Gln"
FT   gene            432746..432823
FT                   /locus_tag="CLL_A0432"
FT   tRNA            432746..432823
FT                   /locus_tag="CLL_A0432"
FT                   /product="tRNA-Lys"
FT   gene            432828..432914
FT                   /locus_tag="CLL_A0433"
FT   tRNA            432828..432914
FT                   /locus_tag="CLL_A0433"
FT                   /product="tRNA-Leu"
FT   gene            432918..432994
FT                   /locus_tag="CLL_A0434"
FT   tRNA            432918..432994
FT                   /locus_tag="CLL_A0434"
FT                   /product="tRNA-Gly"
FT   gene            433006..433079
FT                   /locus_tag="CLL_A0435"
FT   tRNA            433006..433079
FT                   /locus_tag="CLL_A0435"
FT                   /product="tRNA-Gly"
FT   gene            433125..433201
FT                   /locus_tag="CLL_A0436"
FT   tRNA            433125..433201
FT                   /locus_tag="CLL_A0436"
FT                   /product="tRNA-Arg"
FT   gene            433493..433648
FT                   /locus_tag="CLL_A0437"
FT   CDS_pept        433493..433648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0437"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0437"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25007"
FT                   /db_xref="UniProtKB/TrEMBL:B2TIY6"
FT                   /protein_id="ACD25007.1"
FT                   /translation="MLNKEAEHDSWEMSHQTIGGWIRNMKNLIFRSKKVMDYYSHIQIN
FT                   NGEFVN"
FT   gene            434325..435829
FT                   /gene="rrsC"
FT                   /locus_tag="CLL_A0438"
FT   rRNA            434325..435829
FT                   /gene="rrsC"
FT                   /locus_tag="CLL_A0438"
FT                   /product="16S ribosomal RNA"
FT   gene            435953..436029
FT                   /locus_tag="CLL_A0439"
FT   tRNA            435953..436029
FT                   /locus_tag="CLL_A0439"
FT                   /product="tRNA-Ile"
FT   gene            436416..439325
FT                   /gene="rrlC"
FT                   /locus_tag="CLL_A0441"
FT   rRNA            436416..439325
FT                   /gene="rrlC"
FT                   /locus_tag="CLL_A0441"
FT                   /product="23S ribosomal RNA"
FT   gene            439385..439461
FT                   /locus_tag="CLL_A0442"
FT   tRNA            439385..439461
FT                   /locus_tag="CLL_A0442"
FT                   /product="tRNA-Asn"
FT   gene            439787..440734
FT                   /locus_tag="CLL_A0443"
FT   CDS_pept        439787..440734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0443"
FT                   /product="polysaccharide deacetylase family protein"
FT                   /note="identified by match to protein family HMM PF01522"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0443"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24472"
FT                   /db_xref="GOA:B2TJJ0"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:B2TJJ0"
FT                   /protein_id="ACD24472.1"
FT                   /translation="MSNNVNYRRRSDGKNKKKKIVLFSSIVLVVIVAGMLSAKYIHSKN
FT                   INADASELTNNNEMINANEAGAAPKEETKLDNSGYLTAEEDPNADSAAFVEKYLYEQSL
FT                   GKMPEGADGHKVAYLTFDDGPSESVTPEVLKVLKEKDAKATFFTLGKSINESDRTKELL
FT                   KEIVEDGHAVASHTYSHDYKYLYPQRTVSVENFMSDIEKNNEVFRQVLGKDFVTKTIRF
FT                   PGGLMSWKGQDAVKEELQKGGYNYIEWNALSKDAEGKTKVASELLEEVKKSVNGREKVV
FT                   ILMHDAAGKQETAKALPEVIDYLREQGYELKSIK"
FT   gene            440836..441525
FT                   /locus_tag="CLL_A0444"
FT   CDS_pept        440836..441525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0444"
FT                   /product="alkaline phosphatase synthesis transcriptional
FT                   regulatory protein PhoP"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00486"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0444"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22529"
FT                   /db_xref="GOA:B2TJJ1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B2TJJ1"
FT                   /protein_id="ACD22529.1"
FT                   /translation="MSRILLVEDEESIRGFIKINLKRNDFEVIEAETGEDGLKAAEKFS
FT                   IDLAVLDVMLPGIDGFKVCDELRKRYPKIGIIMLTARTQDMDKIMGLEYGADDYIIKPF
FT                   NPLELILRIKAILRRIGDEKQVKEDINKLIREPFIIDLYSQKLFKNSIEIDVTPKEYLL
FT                   MKLFLKNPNKAFSRDELLNLIWGYDYFGDPKLIDVNIRRLRAKIEDNPSEPEFIETIWG
FT                   KGYRWKG"
FT   gene            441530..442927
FT                   /locus_tag="CLL_A0445"
FT   CDS_pept        441530..442927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0445"
FT                   /product="alkaline phosphatase synthesis sensor protein
FT                   PhoR"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF00672; match to protein
FT                   family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0445"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22949"
FT                   /db_xref="GOA:B2TJJ2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B2TJJ2"
FT                   /protein_id="ACD22949.1"
FT                   /translation="MKSIKNTLIRSFIFLILFIVICMNILLGTFVKKYYYDNAETLLRN
FT                   QIEIATNFYNKYLYKSNLIENIYDNVDSFWNKSNAEVQILDEKGNLLMDSIGVYDDNLH
FT                   EKPDVKKAINGESGSYVGSVSYSNYKVMSVSEPLLNDNEVIGIIRYVISLEEINNELKS
FT                   IVFFFMLISILVLLLGIVISLILSNKIINPIKKLTDISQEMANGNLKVRNNISGDGEVA
FT                   QLASTLDYMAEEIIKREKLKDDFISSVSHELRTPLTSIKGWVITLQDNNTDKETFKLGF
FT                   NILEKETDRLSNMVEELLDFSRLINGKMQLKIEKINIMELIEYIENYMIPRALKECINF
FT                   NVLSNLDNKIYYLDIDRMKQVLINLIDNSFKFVNKNGNVSVIFNQGEEDLKIIVEDNGC
FT                   GISKSDLPKVKEKFYKGANSKSQNGIGLSICEEIVNLHNGYLDIVSEEGKMTRVTISIP
FT                   NTREIDI"
FT   gene            442924..444378
FT                   /locus_tag="CLL_A0446"
FT   CDS_pept        442924..444378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0446"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0446"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23751"
FT                   /db_xref="UniProtKB/TrEMBL:B2TJJ3"
FT                   /protein_id="ACD23751.1"
FT                   /translation="MKKFINIFLVVLISFFIIGCNDVTQNKIYKIKAPENNSLSIKGIW
FT                   QINDYKILDNDIYSLNNKKFSVGENIEICNEYIKLKDVEYRDISYKLKLVKDDYVISYE
FT                   EKYSIGDLNLDKENYEVISIFNNNNILFEFIKKNAKEGFIFYNGALYNVSLIGEVNEFI
FT                   ENNFKSEDHKTDYKEINDYDYPVGVYLGIKSKNEKDNTEEYKTLYISFKNGELQPIREK
FT                   PGLIVPRMNGIWNINKKFIKSDYYYEYFDAKPINYKNPINNDNKSLENINKNRYLSINF
FT                   VGNDYIATEVYEGNNFKGEFNKYEVLPIDNITSNLPIVISDIFDNDANKDFKQTYNNII
FT                   DGFSKEEKEKYSPYVNYSNFSLKRVNGKWIIVGKISPAYGMDGSGYDYTLNLKQNKKLL
FT                   NYDSLLIPWKTLKRELPGIKDAFTSPNKRIALIVTEEGLIIDEIESSKINNVPLDVIEM
FT                   DKNDEIIMAEWCIGDYVDNWEKPFLN"
FT   gene            444568..445950
FT                   /locus_tag="CLL_A0447"
FT   CDS_pept        444568..445950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0447"
FT                   /product="TldD protein"
FT                   /note="identified by match to protein family HMM PF01523"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0447"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24742"
FT                   /db_xref="GOA:B2TJJ4"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR025502"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:B2TJJ4"
FT                   /protein_id="ACD24742.1"
FT                   /translation="MLGKSIVSQVLARCLVTGGDFAEIFEDDSVNNSISLIDGKVEDAI
FT                   GGRNYGIGIRIFKGLKSVYAYTNNNSLDSLLETAYRAALALGNANEKEKNIIINEKKIQ
FT                   TIHPIIFYPKDVNYNKKIDILKLAYNSAKNYNSEISQVITSYGDKEQNILIANSDGLYI
FT                   EDKRIRTRLGINAIASKGSENQTGFEGPGRHMGIEMFENIDPEYHGKEAARIAHTMLHA
FT                   KNCPAGNMAVAIDNGFGGVIFHEACGHALEASSVAKGNSVFANKLEQQIASTKVTAIDD
FT                   GTIANAWGSLNIDDEGNKTQKNILIENGILKGYMIDKLNGRRMNMKPTGSSRRQSYKYQ
FT                   PTSRMTNTYIANGKDNPEDIIKSISDGLYAKKLGGGSVNPVTGEFNFAVQEGYLVKNGV
FT                   IEEPVRGASLIGKGSEVLMDIDMVGNNLELAQGMCGSSSGSIPTNVGQPMIRVKKMTVG
FT                   GR"
FT   gene            445954..447297
FT                   /locus_tag="CLL_A0448"
FT   CDS_pept        445954..447297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0448"
FT                   /product="TldD/PmbA family protein"
FT                   /note="identified by match to protein family HMM PF01523"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0448"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23066"
FT                   /db_xref="GOA:B2TJJ5"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:B2TJJ5"
FT                   /protein_id="ACD23066.1"
FT                   /translation="MEFNLFKEKLMSEAKKAGFDECEIYYSDAESLSINIYEGDVEKYK
FT                   LNNSFGLSFRGKINDKMGYSYTEILDEDSIETLIENAKGAALVIENDDTQFIYEGDNEY
FT                   KEINCYKDELDNIKPDKLIKLALEMENECKRQCDKVVNFGGCGIGYGKSSYGILNSKGL
FT                   DLSTSRNHLTAYVVPIIEDNNEKYDGMGYVIAKGEADINPEKLAKDGLEEALSRIGGRS
FT                   IESGKYKVVINNEAMVSLLGTFSGIFNAEQAQKGLSLLKGKEGEIIASDKLTLIDDPYL
FT                   EDGLGTTAFDDEGVATYKKEVITNGKLNTLLYNLKTAHKANVKSTGNGFKSSYASIVGI
FT                   SPTNFYIKPGKKNFEEICEEVNNGVIITEFAGLHSGANSVTGDFSLASKGFMIENGKKT
FT                   FPIEQITVAGNFFTLIKNVEEIGSDLKFPMSSVGSPCVVIKELSIAGK"
FT   gene            complement(447503..449353)
FT                   /locus_tag="CLL_A0449"
FT   CDS_pept        complement(447503..449353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0449"
FT                   /product="arylsulfatase"
FT                   /note="identified by match to protein family HMM PF00884"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0449"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24102"
FT                   /db_xref="GOA:B2TJJ6"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR012160"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:B2TJJ6"
FT                   /protein_id="ACD24102.1"
FT                   /translation="MHSYKNKLINIFNKNTLNQLILFLFPLIAIVLKCIFFQSFITGNN
FT                   PYSFDFNAGYDYAKPFLNYYLAFVLIFISFSFLFKGKARIIYLFIINILLTAIIILDVC
FT                   YFRGFLTVPSVLIATQTANLDNLSGAVYSMFSPLDYIFLIDLIVLGIYVYFTRRYISKI
FT                   NKRGIKIFLITFIMPILFIGYVPFNIHILNNKDVKDAYLYDNYDPTNTARYFSPIGYHI
FT                   FDLYTVYRDSKPYEFTVEDENNLNKLFNMKNENLPNNDYFGISKGKNLIYIQVESLENF
FT                   VINKTINGKEITPVLNNLTSNGFYFPNMFEQVNEGTSSDCDLMVNTSMFPLRRGSTFFR
FT                   YPNNTYNSLPDILEKNSYSSIAIHPDKGSFWNYSAGLKGIGFDKFNDYYSFNADETIGM
FT                   GISDASYFKQVVPMLKEQSNPFYALTVTLTSHGPFDIPKEYRELGLDPELDASELGGYF
FT                   ESLHYTDAQIGNFLKLLDSEGLLENSVIAIMGDHTGVHKYYNNGIEKLSNKEDWYLDTG
FT                   NPVVPLVIYDTSIKTGKTFDLYGGQIDVMPTLLYMLGIDKEKYEDTALGRNLLNTNKSF
FT                   AILTDGTIKDQNTLSDEDKETYKNILDLSDKMIRANYFKK"
FT   gene            449536..450114
FT                   /locus_tag="CLL_A0450"
FT   CDS_pept        449536..450114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0450"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0450"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25105"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR003787"
FT                   /db_xref="InterPro:IPR019870"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/TrEMBL:B2TJJ7"
FT                   /protein_id="ACD25105.1"
FT                   /translation="MKEIDCRGLSFPKTIRMVKKYFNSIGEGEATVIIEKQADNSNIAN
FT                   LAMNLGYHVDVEENDENIHIFIEKRGCLEAIDETVFSVLITSDKFGSGDSKLGKILLND
FT                   YLNALSDAIKLPKNIIFLNEGVKVFQEIPDSTSWLENIKLLSQEGVNILVHDKSLEYYK
FT                   LEISNNFSEIIDMSDIVDIINESNNLIKL"
FT   gene            450145..451101
FT                   /gene="gidA"
FT                   /locus_tag="CLL_A0452"
FT   CDS_pept        450145..451101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gidA"
FT                   /locus_tag="CLL_A0452"
FT                   /product="tRNA uridine 5-carboxymethylaminomethyl
FT                   modification enzyme GidA"
FT                   /note="identified by match to protein family HMM PF00070;
FT                   match to protein family HMM PF01134; match to protein
FT                   family HMM PF03486; match to protein family HMM PF07992"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0452"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23392"
FT                   /db_xref="GOA:B2TJJ8"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B2TJJ8"
FT                   /protein_id="ACD23392.1"
FT                   /translation="MLEYDLVVIGGGIAGMTAALGAAREGIKNILIFEREHSLGGILNQ
FT                   CIHNAFGKKFLGEKVTGPEYIFFIEEKLKKLNIDIKLNTNVIEVTEDNKINYVNSIEGS
FT                   KEVHAKAIILATGSREVYTGSVMVPTHGLTGIFTLGSAHRLINLEGYLPGKKTVIIAKD
FT                   KWGFLVARRILIEGGSVEAIIIEDEIKELIDEEIENLIDGFSLEIIENSRVVEVYGDSR
FT                   INKVKVLNLKEDVISRIECDSLILSVGFRPENKLAQNLKVDINKNTFVPETNDFETSKE
FT                   SIFACGNLIYGKLALIMEETDGLNCGIKAAEYIKIIN"
FT   gene            complement(451098..451661)
FT                   /locus_tag="CLL_A0451"
FT   CDS_pept        complement(451098..451661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0451"
FT                   /product="lipolytic enzyme, G-D-S-L"
FT                   /note="identified by match to protein family HMM PF00657"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0451"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24117"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:B2TJJ9"
FT                   /protein_id="ACD24117.1"
FT                   /translation="MNKHIDIIFLGDSLTFGYGVPKKDSWVYKIQNNLNLTSLNKGCNG
FT                   DTSTGMLTRYYEDVIKYTPNKIFIMCGSNDLLLGRTVKSIIENIELMIKEALAINSNVI
FT                   IGIPPSIIGNMANKLFSSSPLYIYAEENLTKLKEEIINLTINYNLSYIDFYSITLNNSD
FT                   IYLDGIHLNSFGNDIMYKNAISYF"
FT   gene            complement(451677..452294)
FT                   /locus_tag="CLL_A0453"
FT   CDS_pept        complement(451677..452294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0453"
FT                   /product="endodeoxyribonuclease, RusA family protein"
FT                   /note="identified by match to protein family HMM PF05866"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0453"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23044"
FT                   /db_xref="GOA:B2TJK0"
FT                   /db_xref="InterPro:IPR008822"
FT                   /db_xref="InterPro:IPR036614"
FT                   /db_xref="UniProtKB/TrEMBL:B2TJK0"
FT                   /protein_id="ACD23044.1"
FT                   /translation="MTIYAKVIVNGSPITKSNFKLHNTNGRAILPSNSGKYHDRYAIYE
FT                   QEIALIARSQNPDVILEESLIAILKVYYKSEKRHPDTINITKSIFDGIEKSGLIINDAQ
FT                   ITRIIVEEYYDKGNPRFELELFAESEYEVNYSINKKSVLGNPKLYSPIRKNVLNPNTNK
FT                   NKAIEINKNLCTICNTILKTNDYIKADGGKTLICKKCFNKLF"
FT   gene            452497..453516
FT                   /locus_tag="CLL_A0454"
FT   CDS_pept        452497..453516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0454"
FT                   /product="metalloendopeptidase, glycoprotease family"
FT                   /note="identified by match to protein family HMM PF00814;
FT                   match to protein family HMM TIGR00329"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0454"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23988"
FT                   /db_xref="GOA:B2TJK1"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2TJK1"
FT                   /protein_id="ACD23988.1"
FT                   /translation="MDKKLILAIESSCDETSAAVVVNGREVLSNVISTQIDTHKKFGGV
FT                   VPEVASRMHIEIIDYVVKKALEDANVSLDDIDAIGVTYGPGLIGALLVGLQYAKGLAFA
FT                   SKKPLIGVNHIQGHISANFIQYKDLKPPFISLVVSGGHTFIVSVNDFCDFEVIGKTRDD
FT                   AVGEAYDKVARSLGLGYPGGPKIDKLAKEGDPDAISFPRAKFHEDTLDFSFSGVKSAVL
FT                   NYLNKANMKGIEVNNADVAASFQKAVIDVLKDNVFLTCKKKNVNKIAIAGGVASNSCLR
FT                   ETLKKEGALRNIEILFPEPVLCTDNAAMIGSAAYFNYEKNYVSSFDINAKPNLKLGER"
FT   gene            453519..454523
FT                   /locus_tag="CLL_A0455"
FT   CDS_pept        453519..454523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0455"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0455"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24827"
FT                   /db_xref="GOA:B2TJK2"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B2TJK2"
FT                   /protein_id="ACD24827.1"
FT                   /translation="MNLLPHSNGFQRIKSPKFNLLDFLRRALIIIIVFLITGFLVQSMS
FT                   NFIANEKLKASLKYVRLETKKLEYKIKGTGSYTIVFDGGIGSNIYQWDEICKKLERDSD
FT                   VKTFVYNRKGYGFSDSGERRTPDDQAEDLKNLLKKSGASEPYVFVSEEYGSLISTSFTE
FT                   KYPELVAGLVLINPLSYDLVNTKEYSQSIKWQYYKSKLRFLGSYFYITELSDKLGLIKS
FT                   DIDVEDLPNGAKEEINIHKNKKNYTKAIYDEVGNLYKKDININIDNIIKNKPTYIISNQ
FT                   ITSEMDDTLENSLLTVYKSSVLSSPYALHDQDSIVDGVNNIIKKAKKIEKVSS"
FT   gene            454688..455875
FT                   /locus_tag="CLL_A0456"
FT   CDS_pept        454688..455875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0456"
FT                   /product="peptidase, S1B family"
FT                   /note="identified by similarity to SP:O34358; match to
FT                   protein family HMM PF00089; match to protein family HMM
FT                   PF00595"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0456"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22104"
FT                   /db_xref="GOA:B2TJK3"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR006389"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:B2TJK3"
FT                   /protein_id="ACD22104.1"
FT                   /translation="MDNKENFIDVNENEIKYTDESFIDNNVQKKKKKRKNIITSVAISL
FT                   AIALVGGIFGSGITYLLFKDNISAAQYKNYSPSIFTQETSSETLSTTQAFNKVAPAVVI
FT                   VSTKGLSNSGIFSQEVEGIGSGFIINEDGYILTNYHVIQGANEVKVTLSDGKEVNATVV
FT                   NYDEAKDVAMIKVEDGTKVPAVAELGDSEALLPGDQVIAIGTPLSKEFAQTLTQGVISA
FT                   VNRNVASQSGTSVNLIQTDAAINPGNSGGPLVNSKGQVIGINSMKIGTQLSGTSVEGMG
FT                   FAIPINEVKEKIDSLSKPILNLGIQVREIDNDLAKRYDLPEGIYVAGVEEFSPAEKSGV
FT                   KVGDVITKFDGKNITTFNELKELKSGKEVGDKIKIQVVRDGKNVDLEITLEEKSK"
FT   gene            456037..456456
FT                   /locus_tag="CLL_A0457"
FT   CDS_pept        456037..456456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0457"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0457"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23267"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="UniProtKB/TrEMBL:B2TJK4"
FT                   /protein_id="ACD23267.1"
FT                   /translation="MSGRISVCSICPRENEQIDAVIKLCKDRRSCIYGTVIDESGAAVP
FT                   DAVVKLLQVTGCGGKTPVPLTHTFTDKYGQFLLGPLCPGKRYMLKVYKDNITIRYAPLD
FT                   VDCYEGTCIGVNGTRNDSEEDSDGCCGSNHGGCCR"
FT   gene            456783..457865
FT                   /locus_tag="CLL_A0458"
FT   CDS_pept        456783..457865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0458"
FT                   /product="ethanolamine transporter"
FT                   /note="identified by match to protein family HMM PF04346"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0458"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24051"
FT                   /db_xref="GOA:B2TJK5"
FT                   /db_xref="InterPro:IPR007441"
FT                   /db_xref="UniProtKB/TrEMBL:B2TJK5"
FT                   /protein_id="ACD24051.1"
FT                   /translation="MNNILLSIIAFFFLIGAIDYIEGDKLKLSTYFQDGIQAMGSLAIS
FT                   MVGILSLTPFLTQVLTKFLIPIAQKLYLDASIFPASLIAIDMGGFNLSSELALSNSMGN
FT                   FSGILMSSILGCTISFTLPLAVGLVREELMEIVFKGILCGIITMPVGLFVGGIMLKVQV
FT                   YTLIYNLLPVILLSIILTLGIIFRPRKLIIIFKYLGKMIMFISIIGLIIQGVYSISGIK
FT                   LLNNIMPIEEVITIVGRIALFLGGAYVMLEVIKRSLSKPLNRISKLFNINLNSIAAIIG
FT                   SLASAIVIFSNFDKLDDRGKVICTAFSVGGAYVFGGQMGYVSSVAPKVLSIYIFIKLLC
FT                   GILAVLFALIYLKYEQKYKK"
FT   gene            457891..459027
FT                   /locus_tag="CLL_A0459"
FT   CDS_pept        457891..459027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0459"
FT                   /product="putative arabinose-binding protein"
FT                   /note="identified by similarity to SP:P94528"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0459"
FT                   /db_xref="EnsemblGenomes-Tr:ACD21831"
FT                   /db_xref="GOA:B2TJK6"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:B2TJK6"
FT                   /protein_id="ACD21831.1"
FT                   /translation="MRNILKYCLTFFVTVVIIISCVLYIQDDNNPKVKGYINVFVKEDS
FT                   YEYLKQCSDKFMEDNNKAHIEINSIDDYSEILNNEIYNKYKFTNVLLLNRLEFENLNEN
FT                   NIIKYKDMMKILDTYSKNFSKSRINQVRIEDKSIGVPLNSKPIVLYIRSDMLREYGYSS
FT                   DDINTWDDFIKLGIDIYNRSNGTVQILNATGSDYEDLISLIIMQYIDEDKTEDTIKNEV
FT                   KERIDTLRNNNILNLNSDGKFLARISSIDAMRELKALDVECEWTAINPPSISLGTNRFY
FT                   CEEGDNLIVLDDEQENAELVEKFITYLITNTKVSMDYIQEGKFFSSFLYTYKNIKTEGE
FT                   IKNFTGKSPLVVMSNIEERAPIMKQYDKYIKIKSELLD"
FT   gene            complement(459030..460151)
FT                   /locus_tag="CLL_A0460"
FT   CDS_pept        complement(459030..460151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0460"
FT                   /product="putative mannosyltransferase"
FT                   /note="identified by similarity to GB:BAA07751.1; match to
FT                   protein family HMM PF00534"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0460"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22596"
FT                   /db_xref="GOA:B2TJK7"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:B2TJK7"
FT                   /protein_id="ACD22596.1"
FT                   /translation="MEIAIDARSSTLHQGTGIGTYTNNLISNMLSVNSEDNFTLFCSGK
FT                   FNKDFINENTDIIYSSGKHSGFYEKYYIPNILKEKKIDLYHIPQNGIGLENSDAYKKVV
FT                   TIHDLIPYIMPETVGKGYLERFLKDMPEIIYNSDGILTVSEYSKKDILKFFNGYPEDKI
FT                   FVTPLAANSKFKLLNKINCKNYLSTKFNINESFALYIGGFSSRKNVLGLIKAYMNTYKD
FT                   LKKPYKLVLVGGLKDEGEKLLDFVKINNLEDNVIFPGYVNDDLLPIFYNACDVFVYPSF
FT                   YEGFGLPPLEAMSCGAPVISSTLSSIPEVTSNNAILINPYDEEALKNSLVEVLNNDSLK
FT                   SDLSKKGYNRSLQFTWRQAAIKTLDAYKKIIQS"
FT   gene            460298..461314
FT                   /locus_tag="CLL_A0461"
FT   CDS_pept        460298..461314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0461"
FT                   /product="spore coat protein, CotS family"
FT                   /note="identified by match to protein family HMM TIGR02906"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0461"
FT                   /db_xref="EnsemblGenomes-Tr:ACD21916"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR014255"
FT                   /db_xref="UniProtKB/TrEMBL:B2TJK8"
FT                   /protein_id="ACD21916.1"
FT                   /translation="MRNNDMVLKIKNYIEENYEIEVDNLEKVKNSYKIISKDKGYSIKI
FT                   IKYNFEHFYFILSAIKHLQQNKFSKIPEFIRTKNGKEYISLDGKYAYLTEWIPSRVSNY
FT                   DNPLELAKVSNKLAELHECSKNFTINDRMQPRIGWFSWEDVFKTRSNEILDFKNRISQK
FT                   ANKSNFDLLYLKNIDKELKRAEKSIEGLKRNNYMEIMKKEVFKSGFCHHDYANHNILID
FT                   NNNEINIIDFDYCILDSHLHDLSSLCIRSMKYGKWEDKKADLILKNYQDIIELKKEEIP
FT                   LMREFIRFPQCFWQLGIQVYWEQQSWGEEFFINKLNKYLDDCYEREAFIEDYFKGGD"
FT   gene            461334..462059
FT                   /locus_tag="CLL_A0462"
FT   CDS_pept        461334..462059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0462"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0462"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23102"
FT                   /db_xref="UniProtKB/TrEMBL:B2TJK9"
FT                   /protein_id="ACD23102.1"
FT                   /translation="MQYLNSKGIDIAGKYFEYDKNITNKKAIDQVKTMVNLQKILLGYN
FT                   NESLIRIKSTIGKEIESYKVQIRRLQRDYENIMNRGIENDFEKLIISDGRRLLNQANKA
FT                   IGYIYSHNYFGIIERSMNREELCIGRSDQGNLRFNGNIQIGSLKYISYNLVEEDLYKYI
FT                   KRIKRKNNSIDEEELIKVFVYESHLSNYSINYLRALCSFPRDTLKIWEKYRVNKKLKTY
FT                   EEFSKEFKNSIEYESKIFI"
FT   gene            462153..463196
FT                   /locus_tag="CLL_A0463"
FT   CDS_pept        462153..463196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0463"
FT                   /product="spore coat protein, CotS family"
FT                   /note="identified by match to protein family HMM TIGR02906"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0463"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22139"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR014255"
FT                   /db_xref="UniProtKB/TrEMBL:B2TJL0"
FT                   /protein_id="ACD22139.1"
FT                   /translation="MNRIRYAERKSLCDYDLSFEFFNELGININDISPVRNVFIIYTDN
FT                   GNKILKKVDCNEKKLTLINESLNYIKDKYNNIITYSEFENGSIYKTWKDKTYVVMDLLD
FT                   GREACFTNPLEIKLCAENIALMHKASCGIREELIKKLNEDFLDESLEIKFKKAYDELSF
FT                   FKELVSKYKYKNEFDNLFINNVDKYLQDIIDVEELLSKSKYIDLRKNGQTISLCHNDLA
FT                   YHNFLIKKENVSIIDFDFLTIDLRIMDIADFILKSIKNSAFDIDKMLLAINSYEDVLPL
FT                   MQEEKEILYILLYFPRDFYNISRDYYYKRKKWDYEVYLNRFNSKLNNEQFRKDFIKEYK
FT                   YYILSEH"
FT   gene            complement(463402..464544)
FT                   /locus_tag="CLL_A0464"
FT   CDS_pept        complement(463402..464544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0464"
FT                   /product="mannosyltransferase B"
FT                   /note="identified by match to protein family HMM PF00534"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0464"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25163"
FT                   /db_xref="GOA:B2TJL1"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:B2TJL1"
FT                   /protein_id="ACD25163.1"
FT                   /translation="MRIGIDGRAAKWYRGTGIGTYTHELIRSLNTIDNTNNYLIFMPKC
FT                   DSLNNLNDNFSIQNVESSDDYDNFWDEIKVPNILNNSDMEIYHVPQNGIGISKNINCKK
FT                   VITLHDIIPLRMPETVSDRYLRIFNDELPGILENCHGIITVSEFSKNDIAKEFNFPKEN
FT                   IYVTPLAAEEIYRPLSKCQCKKIVSEKYHIDDNFILYVGGFSPRKNILGLIDAYSKLPY
FT                   STMEKTKLVIVGKKGQSYFRYKERAEKLGVSSNVIFTGFIPLEDMPLFYNATEVLVYPS
FT                   FYEGFGLPPLECMACGTPVIVSNVTSLPEVCYESALLIDPNNIDELSYDIQRVLENSVL
FT                   KLTMVNKSLKRSSKYSWSKTAYETINAYKSILTENKTPIK"
FT   gene            464654..465655
FT                   /gene="cotS"
FT                   /locus_tag="CLL_A0465"
FT   CDS_pept        464654..465655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cotS"
FT                   /locus_tag="CLL_A0465"
FT                   /product="spore coat protein CotS"
FT                   /note="identified by similarity to SP:P46914; match to
FT                   protein family HMM TIGR02906"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0465"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24351"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR014255"
FT                   /db_xref="UniProtKB/TrEMBL:B2TJL2"
FT                   /protein_id="ACD24351.1"
FT                   /translation="MMREFEIERQFDIKIETIKANKGVYYLKTNKGERCLKRINYGPQK
FT                   LLFVYGAKEHLIKNGFGDLDRYYLNVNDEPYALVNEDLYTLSEWLEGRECDFRNIDEVK
FT                   IAAKTLACMHEASKGYDPPENSKLKSDLGRWPHLMEKRTKSLDKMKDIIRKKNIKNDFD
FT                   MIYLKSVEFYRELGKQALQTLKESNYYELCMIAEEEKTFCHHDFTYHNIIIDSNEKPHI
FT                   IDFDYCKREVRTFDISNFMIKVLKRVDWNIDFAKAIIESYNSVSKLRDDEYKVLFAYLQ
FT                   FPQRYWRLANRYYYNEVNWGQNTFTNKLSSIIEEKDKFLSFLNEFKKEYNIE"
FT   gene            465856..466719
FT                   /locus_tag="CLL_A0466"
FT   CDS_pept        465856..466719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0466"
FT                   /product="sporulation peptidase YabG"
FT                   /note="identified by match to protein family HMM PF05582;
FT                   match to protein family HMM TIGR02855"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0466"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23573"
FT                   /db_xref="InterPro:IPR008764"
FT                   /db_xref="UniProtKB/TrEMBL:B2TJL5"
FT                   /protein_id="ACD23573.1"
FT                   /translation="MDIGDVVVRKSYDKDITFKIIDIKNEDGKNVFILKGISIRIIADS
FT                   SEEDLEEVNDKFIASQDKILNTRVNDAIKKALSVRTDFREKANKAPKIKHDNELMFGRP
FT                   GKILHVDGDSDYMETCLKVYKQLSLDAVGRCVPESKQPGIIVDLVREIKPDIVVLTGHD
FT                   GVLKDSRNYLDLNNYRNSKYYLESIKALRDYNSSYDELVIFAGACQSCYECMLDAGANF
FT                   ASSPSRVLIHCLDPVFVCEKIAYTRIDEIVSIRDVIENTITGIKGIGGLQTRGKYREGY
FT                   PKSPFI"
FT   gene            466908..467150
FT                   /locus_tag="CLL_A0467"
FT   CDS_pept        466908..467150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0467"
FT                   /product="protein veg"
FT                   /note="identified by match to protein family HMM PF06257"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0467"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24668"
FT                   /db_xref="GOA:B2TJL6"
FT                   /db_xref="InterPro:IPR009366"
FT                   /db_xref="UniProtKB/TrEMBL:B2TJL6"
FT                   /protein_id="ACD24668.1"
FT                   /translation="METIKTISSIKKDIEKHVGDKVTLRANGGRKKILVNDGVIDSVYD
FT                   SIFVIKLKTDTPRTVTYSYSDVLTKTVQLVFPQSI"
FT   gene            467564..469126
FT                   /locus_tag="CLL_A0468"
FT   CDS_pept        467564..469126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0468"
FT                   /product="LysM domain protein"
FT                   /note="identified by match to protein family HMM PF01476"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0468"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23612"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR024300"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:B2TJL7"
FT                   /protein_id="ACD23612.1"
FT                   /translation="MSQIDAIKESIGFEQLIKESNSDCVLKEEYLIPDTHPDVQEILTV
FT                   EARPVIVSKEFVGDKIALEGRVEYTVLYLAREEGMVVNSVSYTEKFSSNIDLNQEEHKI
FT                   VCELECKVEHIEATIMNERKISIQGVFGIYWEMYKSSEFEFVKDIEGTDDIEILKKTEK
FT                   INRISANEEVELVGKSNIRVGMDKPQISKILKCSLLLHKKEIKILEDKVYLSCYCKLNI
FT                   LYKGDESKEIICIEDDVYLSKEEEVKGVNSDMMYSVSYNIQNNDLMLEEDDLGEVRIIN
FT                   NEFMVKANIKVFSKENVDVIKDAYCPNFPIELKKEEYELGAIQGTNSSEIIIKDNIALN
FT                   ENNLIPEQIICSNGTILISDKQVETDKVIVEGILKVDVLYKTSDQDKYLANVKAEIPFN
FT                   SIIDMQGAKKGMKAIIKCNLESIEATIEANTIAIKASAMLCAKICYEVKKQFICDVIEQ
FT                   EGEVPEKKSSVTIYVVGEEDTLWNLAKKYNTTVDDLIKINEIEDQDNIECGKKLIIPGR
FT                   AIF"
FT   gene            469351..470196
FT                   /locus_tag="CLL_A0469"
FT   CDS_pept        469351..470196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0469"
FT                   /product="cyanophycinase"
FT                   /EC_number="3.-.-.-"
FT                   /note="identified by match to protein family HMM PF03575;
FT                   match to protein family HMM TIGR02069"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0469"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23104"
FT                   /db_xref="GOA:B2TJL8"
FT                   /db_xref="InterPro:IPR005320"
FT                   /db_xref="InterPro:IPR011811"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B2TJL8"
FT                   /protein_id="ACD23104.1"
FT                   /translation="MNENLNGNLIIIGGGEDKEGKKEILKRVCASIDKDKDILLIATIA
FT                   TEYPKEAANKYKRAFGELKVKNIRVLDISERMDSFNEENVELIKNSSLIFFTGGDQLRI
FT                   TSLIGGSPIYSALKEACEKGIFIVGTSAGASVMSDTMIVEGSDEQSPRKCTLKMAPGLG
FT                   LIKDVIIDQHFAQRGRIGRLLTGIAENPEVLGIGIDENTAIIVNQEGKVEVIGAGAVYF
FT                   IDGSKITYTNVSELYGEDILSMYNVKLHILTNGKKFDLIKKLPFEEDKLSNESSTGKDI
FT                   "
FT   gene            470168..472786
FT                   /gene="cphA"
FT                   /locus_tag="CLL_A0470"
FT   CDS_pept        470168..472786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cphA"
FT                   /locus_tag="CLL_A0470"
FT                   /product="cyanophycin synthetase"
FT                   /EC_number="6.-.-.-"
FT                   /note="identified by match to protein family HMM PF02875;
FT                   match to protein family HMM PF08245; match to protein
FT                   family HMM PF08443; match to protein family HMM TIGR02068"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0470"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22120"
FT                   /db_xref="GOA:B2TJL9"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011810"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR013651"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:B2TJL9"
FT                   /protein_id="ACD22120.1"
FT                   /translation="MKVVQERIYEGKNIYSHKKCIRMDVDLQGYCETPSKDIPNFNFNL
FT                   LKLVPELYTHRCGIDEEGGFVTRLKEGTYLAHICEHITIALQNRLGIEVAYGKAREIQG
FT                   DRYYIIFQYEYAKTAMECFKLSMDLINALITQSPINFEERINSIKEILNLDEIGPSTNA
FT                   ICKAAKEYNMPITQLGNSGFYQIGYGKQGKVIEAAISEKTSCVAVDISCDKFLTKQLLA
FT                   NQNIPVALGGKVYNIIDLLKCAEKIEYPVVLKPQYGSKGNGIYLNIKNENELIKSYNNL
FT                   KNKFKDILIEKYIEGNDYRVCVIDYKVVAVSLRIPPFVIGNGKETLKELIENINKDPLR
FT                   GEDHEKPLTKIKIDDQLISYVNKNNLSLSYIPKDNEKVFLRENANISTGGIAIDCTDNI
FT                   CEENINHCINAAKALGLDICGIDLCVDDISCDIAKSNGVIMEVNAAPGIRMHHFPSKGI
FT                   ERNVGKAIINMMYGENPKNIPIVSVTGTNGKTTTTRLINHVLSQMGYSVGMTSTEGIYV
FT                   NNKCIHKGDDSGFNSAKTILLNRDVDIAVLETARGGLIRKGLAYDIADVSVITNITNDH
FT                   LGLDGINSMEELSFVKALVGEAVKENGFTILNADDEWSKTIINRIKANKIFFSKYADNE
FT                   LIQKNIIDGGISVFIENDNIIVVNNHKKYSICSINDVPLSYNGLLKYNLENIMAACGAL
FT                   VGMNIDYCMISKGIMSFNLNNNNGRFNIYEIEDRKIILDYGHNIEGYKAVLSSLDKIKK
FT                   DKDLIGVIGIPGDRCDDIAIEIGEICSEMLDKIIIKEDKDRRGRDEGEIASLLKNGVLR
FT                   KNKNAKIHVCLDEIKALEKALMISKKGDTIVVFFEDLESIVKYINNKNLNNSLNLKLSN
FT                   L"
FT   gene            472967..473809
FT                   /gene="ispE"
FT                   /locus_tag="CLL_A0471"
FT   CDS_pept        472967..473809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispE"
FT                   /locus_tag="CLL_A0471"
FT                   /product="4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol
FT                   kinase"
FT                   /EC_number="2.7.1.148"
FT                   /note="identified by match to protein family HMM PF00288;
FT                   match to protein family HMM PF08544; match to protein
FT                   family HMM TIGR00154"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0471"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25087"
FT                   /db_xref="GOA:B2TJM0"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2TJM0"
FT                   /protein_id="ACD25087.1"
FT                   /translation="MNIKAYAKINISLDVIGKREDGYHLLKMIMQNIDLYDIVQVEKIP
FT                   NGIKLKCNKPYVPTDERNLAYKAAKLFKETYDIKSGIYINIEKNIPVSAGLAGGSTDAA
FT                   AVLKIMNKMFNINVPQSELMDLGLKLGADVPYCICGGTALCEGIGEKVTKLKPFTDKIL
FT                   VVVKPPFGVSTKEVYKAFDLSKVIFHPKTNELISNIEKNNIDFIANNMKNLLENVTLGR
FT                   YKIISTIKEEINTCGALGSMMSGSGPTVFGFFDDILKAQKCYEKMKEKYVDVFITRTI"
FT   gene            473871..474497
FT                   /gene="spoIIR"
FT                   /locus_tag="CLL_A0472"
FT   CDS_pept        473871..474497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoIIR"
FT                   /locus_tag="CLL_A0472"
FT                   /product="stage II sporulation protein R"
FT                   /note="identified by match to protein family HMM PF09551;
FT                   match to protein family HMM TIGR02837"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0472"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23853"
FT                   /db_xref="InterPro:IPR014202"
FT                   /db_xref="UniProtKB/TrEMBL:B2TJM1"
FT                   /protein_id="ACD23853.1"
FT                   /translation="MKKVLSCLMFIIIFSTLIVGCTSSNMVNNNNSEELNYEEVKNSLI
FT                   RFHVIANSDTNEDQSLKLKVRDEVINYLYPYLNKSDSLDESREIIKNNIEEVRSIAEKV
FT                   IKDNNYNYDVNIELSRENFPEKSYGNIVLPQGNYEAFRIIIGSGQGRNWWCVMFPPLCF
FT                   VDESKAKIEYEKTQNKIKEEVNKKDSKDNIKIKFKVVEVIDNLLK"
FT   gene            474535..475527
FT                   /locus_tag="CLL_A0473"
FT   CDS_pept        474535..475527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0473"
FT                   /product="argininosuccinate synthase"
FT                   /note="identified by match to protein family HMM PF02568;
FT                   match to protein family HMM PF05670"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0473"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24967"
FT                   /db_xref="GOA:B2TJM2"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020536"
FT                   /db_xref="UniProtKB/TrEMBL:B2TJM2"
FT                   /protein_id="ACD24967.1"
FT                   /translation="MVKALAMISGGLDSILAAKLIKEQGIEVIGICFKSYFFNEENAKR
FT                   MTEQIGIKLEVIDFSEEHFDLVRNPKHGWGKNMNPCIDCHSMMMNYSGKLLEKFNADFI
FT                   ITGEVLNQRPMSQNRQALNIVKKESGYSDKILRPLCAQNLNPTQMEIDGLVDREKLLKI
FT                   SGRSRAIQMELAEKWGIKDYPSPAGGCKLTEPNYSIRLRELVNRKSDITQREIDLLKYG
FT                   RHFITPNNVKIIVSRTADEGEAFKKLLIKEDLVFLTSKFNGAMVIIPAGNNPTEEDLTL
FT                   ACRFAVRYSKGKDEESVEVKYGNVSTEFNKFKNVDSVTQKELEDYNLNK"
FT   gene            475592..476014
FT                   /locus_tag="CLL_A0474"
FT   CDS_pept        475592..476014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0474"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF09148"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0474"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23904"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="InterPro:IPR015231"
FT                   /db_xref="UniProtKB/TrEMBL:B2TJL3"
FT                   /protein_id="ACD23904.1"
FT                   /translation="MKKKAIITVKSNASMDDNKLIEVISPGEFYIEDDEFRVEYDETEI
FT                   SGMEGTKTIIFIRNNSFTLERKGSTTTKMDFKKRMKSTSLYKTPYGILKLNVDTKSLDI
FT                   NMSENGGTIDVKYSMGMEGQIAMNTNLVVDIKVNDK"
FT   gene            476140..476439
FT                   /locus_tag="CLL_A0475"
FT   CDS_pept        476140..476439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0475"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0475"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23341"
FT                   /db_xref="UniProtKB/TrEMBL:B2TJL4"
FT                   /protein_id="ACD23341.1"
FT                   /translation="MISKMKYINILNGLCKYYGIGEQGLIELLKERENKYLLLLLLKNY
FT                   SCLEQESAKEILRVKSSRSVNNNLKSAQEKLLINRDFRKKYFEIQDNIDRIEIK"
FT   gene            476625..478226
FT                   /gene="pyrG"
FT                   /locus_tag="CLL_A0476"
FT   CDS_pept        476625..478226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrG"
FT                   /locus_tag="CLL_A0476"
FT                   /product="CTP synthase"
FT                   /EC_number="6.3.4.2"
FT                   /note="identified by match to protein family HMM PF00117;
FT                   match to protein family HMM PF06418; match to protein
FT                   family HMM TIGR00337"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0476"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22380"
FT                   /db_xref="GOA:B2TJX8"
FT                   /db_xref="InterPro:IPR004468"
FT                   /db_xref="InterPro:IPR017456"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033828"
FT                   /db_xref="UniProtKB/TrEMBL:B2TJX8"
FT                   /protein_id="ACD22380.1"
FT                   /translation="MSTKYVFVTGGVVSALGKGITAASLGRLLKNRGLNISIQKFDPYL
FT                   NVDPGTMSPYQHGEVFVTDDGAETDLDLGHYERFVDESLTQNSNVTTGKIYSSVIEKER
FT                   RGEYLGGTVQVIPHITNAIKDKVYQVAKERDIDVVITEIGGTVGDIESQPFLEAIRQIK
FT                   SEVGAENVCYIHVTLVPYLGKAGELKTKPTQHSVKELRTIGIQPDIIVCRTEKNLSDDI
FT                   KAKIGLFCNIDGKSVIQNLDADNLYEVPLMLHEEGLDNLVCEKLHLGCKDIDNYEWTLM
FT                   VEKIKSLKEKVEIALVGKYVELHDAYISVVEALNHGGYANNTKVEIRWVNAEELEQKAV
FT                   SEVLAGVDGILVPGGFGDRGIEGKISAIKYARENNIPFLGICLGMQCAVIEYARNMLGY
FT                   DGANSSEINPSTEYPVIDIMNDQKDIENLGGTMRLGQYPCKLDVGSNSYEVYKSELVSE
FT                   RHRHRYEFNNKFREQISESGMKIAGTSPDGRLVEIVEVTNHPWYVAVQFHPELKSRPNK
FT                   PHPLFTGFIGASIKQK"
FT   gene            478609..480234
FT                   /gene="rho"
FT                   /locus_tag="CLL_A0477"
FT   CDS_pept        478609..480234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rho"
FT                   /locus_tag="CLL_A0477"
FT                   /product="transcription termination factor Rho"
FT                   /note="identified by match to protein family HMM PF00006;
FT                   match to protein family HMM PF07497; match to protein
FT                   family HMM PF07498; match to protein family HMM TIGR00767"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0477"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23395"
FT                   /db_xref="GOA:B2TJX9"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004665"
FT                   /db_xref="InterPro:IPR011112"
FT                   /db_xref="InterPro:IPR011113"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036269"
FT                   /db_xref="UniProtKB/TrEMBL:B2TJX9"
FT                   /protein_id="ACD23395.1"
FT                   /translation="MTKQVYEGMTLVELKDIAKKLEIKNISKYKKNELIDEILKKSPNT
FT                   VEKEGVILREKISSKVRNDNNSVSNTTNNKANFNNNTVNNTGFNNNNSSFNNNNSSFNN
FT                   NSSNNNNSFNNGNRSFNNSSNVSNIVNNNNSDNKVDSKNNEENPALKQEKLNNMINESN
FT                   SAKGILEILENNNFGFLRCKNYLTSSEDIYVSPSQIRRFNLRTGDEVQGKIREAKEGEK
FT                   FKALLFVEKVNGEHPERAIGRKYFETLTPIYPKERLRLETSDEKDLSSRLMDIICPIGK
FT                   GQRGIIVAPPKAGKTTLLKKVAQNISTNYPDIKLIVLLIDERPEEVTDMKRSINGEVIY
FT                   STFDEEPQNHAKVSRIVLERAKRMVEQGKDVVILMDSITRLSRAYNLTITPTGRTLSGG
FT                   LDPGALIMPKKFFGAARNIEEGGSLTILATALVDTGSRMDDMIFEEFKGTGNMEVHLDR
FT                   KLQERRIFPAIDIYKSGTRKEDLIFSKEEKDVAYTIRKVMYRDGNIEDVTENLIGMLSK
FT                   TSDNKEFINVFKKVEFEKRRQNNK"
FT   gene            complement(480274..481380)
FT                   /locus_tag="CLL_A0478"
FT   CDS_pept        complement(480274..481380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0478"
FT                   /product="putative monogalactosyldiacylglycerol synthase"
FT                   /note="identified by match to protein family HMM PF04101;
FT                   match to protein family HMM PF06925"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0478"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22423"
FT                   /db_xref="GOA:B2TJY0"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="InterPro:IPR009695"
FT                   /db_xref="UniProtKB/TrEMBL:B2TJY0"
FT                   /protein_id="ACD22423.1"
FT                   /translation="MKKVLILTTSTGQGHNQAADSISASFENSGYETIKYDFLYKSSKF
FT                   LSDLIVTGYEILASRFPSLYGLFYSLTNNNLTNTLLKLVFFFTKKKLYKLINETKPDII
FT                   IATHSLSVNIVTSLKKHGLNIPYIMIVTDFKAHHTYINNYVDAYITGSEYTKQSLIDKG
FT                   INKDKIYPIGIPIKKIFYTKNNSLKNLNDDYFSLLLMSGSLGLNTISLVLKELLKSPHK
FT                   LRITVVCGKNKKLEKSLNTYCSNNSYDNKKLHILGFTNDIPVLMDYCDIIISKPGGLTV
FT                   TESIVKNIPLIIPFAIPGQEMENTEFLVKSGYSIYIKDLTKINNTVEYLINNPIELRNL
FT                   KDKLILQSSNYSVDEIVNIAENLINKNK"
FT   gene            complement(481522..481731)
FT                   /gene="rpmE"
FT                   /locus_tag="CLL_A0479"
FT   CDS_pept        complement(481522..481731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmE"
FT                   /locus_tag="CLL_A0479"
FT                   /product="50S ribosomal protein L31"
FT                   /note="identified by match to protein family HMM PF01197;
FT                   match to protein family HMM TIGR00105"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0479"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24516"
FT                   /db_xref="GOA:B2TJY1"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027491"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2TJY1"
FT                   /protein_id="ACD24516.1"
FT                   /translation="MKQGIHPEYHTDAVVKCACGNSFTTGSVKEELKVEICSKCHPFFT
FT                   GKQKIVDVGGRVEKFNKRFNLDTK"
FT   gene            481909..482496
FT                   /gene="tdk"
FT                   /locus_tag="CLL_A0480"
FT   CDS_pept        481909..482496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tdk"
FT                   /locus_tag="CLL_A0480"
FT                   /product="thymidine kinase"
FT                   /EC_number="2.7.1.21"
FT                   /note="identified by match to protein family HMM PF00265"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0480"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23783"
FT                   /db_xref="GOA:B2TJY2"
FT                   /db_xref="InterPro:IPR001267"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2TJY2"
FT                   /protein_id="ACD23783.1"
FT                   /translation="MSKLYFRYGAMNSGKSTHLMQVAYNYEERGMNVVIIKPSVDNKGG
FT                   DKIVSRLGVEKKVDIMISEKDNIFDLVSEYINQRSKIDCLLVDEVQFMKSNQIDQLFKI
FT                   AVTLDIPIICYGLRTDFKMNGFEGSIRLLLLAHSIEEMKTICACGKKAILNGRKINGRF
FT                   VFEGQQVAIDQENDVHYESLCGECYYKYKKIN"
FT   gene            482526..483434
FT                   /locus_tag="CLL_A0481"
FT   CDS_pept        482526..483434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0481"
FT                   /product="modification methylase, HemK family"
FT                   /note="identified by match to protein family HMM PF07136"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0481"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22969"
FT                   /db_xref="GOA:B2TJY3"
FT                   /db_xref="InterPro:IPR010787"
FT                   /db_xref="UniProtKB/TrEMBL:B2TJY3"
FT                   /protein_id="ACD22969.1"
FT                   /translation="MKRCDVGGQAVIEGVMMRGSKGLATAVRTSKGNIEIKMDRAESIT
FT                   KKYKFLNIPFLRGFFILIDSLKVGMNSLNYSASFFDEDEKPSKFEKWINDKLGDKSNDL
FT                   IMMITLIFSFMISIALFVLLPTSIAALFKNFTTSHIALNFIEAIIRIIILVGYMFIISK
FT                   LDDIYRVLEYHGAEHKTIFCYENEDELTVENVKKCSRFHPRCGTNFLFLIMFVSIIVFS
FT                   FTGWGSITERLILRIILIPVITGITYELIKWLGKNDNSIAKAIAWPGLKLQGLTTKEPD
FT                   DFQIEVAIASLKAAEGIRDDE"
FT   gene            483427..484290
FT                   /gene="prmC"
FT                   /locus_tag="CLL_A0482"
FT   CDS_pept        483427..484290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prmC"
FT                   /locus_tag="CLL_A0482"
FT                   /product="protein-(glutamine-N5) methyltransferase, release
FT                   factor-specific"
FT                   /EC_number="2.1.1.-"
FT                   /note="identified by match to protein family HMM PF05175;
FT                   match to protein family HMM TIGR00536; match to protein
FT                   family HMM TIGR03387; match to protein family HMM
FT                   TIGR03534"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0482"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22200"
FT                   /db_xref="GOA:B2TJY4"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004556"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR019874"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR040758"
FT                   /db_xref="UniProtKB/TrEMBL:B2TJY4"
FT                   /protein_id="ACD22200.1"
FT                   /translation="MNSKSIGELLNVGTVILNECGINTSRLDAELLLGKVLNKEKIYLI
FT                   THREEKIDKTNEEKYMELINKRKEKMPVKYILNECEFMNINFYVEPGVLIPRADTEILV
FT                   EEVLKHIDENDSKKICDLCCGSGAIGIALANLRKNINVDLIDYYETPEKVTLINIEKSN
FT                   ILDRASFMKSDLLNKSINDAKRYDIIVSNPPYIEECEINDLMEDVKNYEPHTALSGGKD
FT                   GLDFYKRIINESINVLNKNGILAFEIGYNQGTDVKELMEEKNFIEVKIVKDLAGLDRVV
FT                   IGKYYK"
FT   gene            484556..485638
FT                   /gene="prfA"
FT                   /locus_tag="CLL_A0483"
FT   CDS_pept        484556..485638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prfA"
FT                   /locus_tag="CLL_A0483"
FT                   /product="peptide chain release factor 1"
FT                   /note="identified by match to protein family HMM PF00472;
FT                   match to protein family HMM PF03462; match to protein
FT                   family HMM TIGR00019"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0483"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25129"
FT                   /db_xref="GOA:B2TJY5"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004373"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2TJY5"
FT                   /protein_id="ACD25129.1"
FT                   /translation="MLLDKLAFIENKYDELSVKISDPSIMQNQNEWRKLCKEQADLEII
FT                   VNAYKEYKQVIEDLQVNKEMLSDESDREMKEMLNEEIASLSQREVELEKEIQILLLPKD
FT                   PNDDKNVFVEIRGGAGGEEAALFAYNLFRMYTRYAERQRWSTEIMSLNETDIGGFKEVV
FT                   FMIKGNGAYSKLKYESGVHRVQRVPDTESSGRIHTSTVTVAVLPEVDDVEIEIADKDVR
FT                   IDVFRASGHGGQCVNTTDSAVRITHLPSGLVVSCQDEKSQLKNKEKAMKVLRSRLFEKA
FT                   EQERADGIAADRKSQVGTGDRSERIRTYNYPQGRITDHRIGLTLYKLDSFLDGDVQEMI
FT                   NALITADQAEKMQKMGNSEM"
FT   gene            485780..486307
FT                   /locus_tag="CLL_A0484"
FT   CDS_pept        485780..486307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0484"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0484"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22652"
FT                   /db_xref="GOA:B2TJY6"
FT                   /db_xref="UniProtKB/TrEMBL:B2TJY6"
FT                   /protein_id="ACD22652.1"
FT                   /translation="MLILAITLPAVLLITNLLNIFYLIYLTLIEFLIVISILIKLNGYN
FT                   VEYKCNNNRLMFKIGILATTSLILCDKVVLVHTNKSDYDMEIIIITSVSFKNSLLRPVP
FT                   PNFLKRHPKLKKEYEKIQEKNPNKTYYFQIVRKGGLKKYLLLDCIYRNCVKAIYTEHSI
FT                   QNIKIARGQTIV"
FT   gene            486326..487375
FT                   /locus_tag="CLL_A0485"
FT   CDS_pept        486326..487375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0485"
FT                   /product="Sua5/YciO/YrdC/YwlC family protein"
FT                   /note="identified by match to protein family HMM PF01300;
FT                   match to protein family HMM PF03481; match to protein
FT                   family HMM TIGR00057"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0485"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23143"
FT                   /db_xref="GOA:B2TJY7"
FT                   /db_xref="InterPro:IPR005145"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR010923"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR038385"
FT                   /db_xref="UniProtKB/TrEMBL:B2TJY7"
FT                   /protein_id="ACD23143.1"
FT                   /translation="MNTNIIKINNIIDDEEKMKEAAQIIKDGGIVAFPTETVYGLGSDA
FT                   LNEDAVKKIFIAKGRPQDNPLIVHVASKNIQSLVEDIPDIAQRLIDKYWPGPLTLILKK
FT                   KSIIPDMTSANLDTIGIRMPNNEIALKLIEMSNTVIAAPSANISGRPSPTDVERCIDDL
FT                   SGRVDCIVGGKKSDIGLESTILDCTVNPPIVLRPGGITLEMLKEIDNRIEIDGAIMKKS
FT                   TGDLKPKAPGMKYRHYAPKAKVKIISGERKKTIEKIKEIVDYYIDNNKKVCILTIQENE
FT                   KEYNKGIKVVLGSKENLLMVAQNLFESLRKCDDLGADVILAEAYEEKGVGIAIMNRLNK
FT                   AAGFDIIEV"
FT   gene            487499..487948
FT                   /gene="rpiB"
FT                   /locus_tag="CLL_A0486"
FT   CDS_pept        487499..487948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpiB"
FT                   /locus_tag="CLL_A0486"
FT                   /product="ribose 5-phosphate isomerase B"
FT                   /EC_number="5.3.1.6"
FT                   /note="identified by match to protein family HMM PF02502;
FT                   match to protein family HMM TIGR00689; match to protein
FT                   family HMM TIGR01120"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0486"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24155"
FT                   /db_xref="GOA:B2TJY8"
FT                   /db_xref="InterPro:IPR003500"
FT                   /db_xref="InterPro:IPR004785"
FT                   /db_xref="InterPro:IPR036569"
FT                   /db_xref="UniProtKB/TrEMBL:B2TJY8"
FT                   /protein_id="ACD24155.1"
FT                   /translation="MKLAIGCDHGGFELKQEIIKFLESEGHKVKDFGTHSTESCDYPDI
FT                   SLPVAEAVVAKEFELGILVCGTGIGIGIAANKVPGIRAALCSDTFSAHATRQHNNANIL
FT                   TMGQRVVGTGLALDIVKTFISSEFEGDRHQKRIDKISAIETKYSK"
FT   gene            487994..488623
FT                   /gene="upp"
FT                   /locus_tag="CLL_A0487"
FT   CDS_pept        487994..488623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="upp"
FT                   /locus_tag="CLL_A0487"
FT                   /product="uracil phosphoribosyltransferase"
FT                   /EC_number="2.4.2.9"
FT                   /note="identified by match to protein family HMM PF00156;
FT                   match to protein family HMM TIGR01091"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0487"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22085"
FT                   /db_xref="GOA:B2TJY9"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005765"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR034332"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2TJY9"
FT                   /protein_id="ACD22085.1"
FT                   /translation="MSKVIEVNHPLVLHKLSMVRSKDTGSKDFKELVKEISMLLTYEAT
FT                   RDINMDEVEIETPVCKTKCRVVSGKKMAIVPILRAGLGMVDGVLSLIPAAKIGHIGLYR
FT                   DEETLQPVEYFCKLPKDIEERDVIVVDPMLATGGSAADALTMLKEKGAKNLKLMCLISA
FT                   PEGIKLVQEKHPDVDIYVASIDEKLNEKGYIVPGLGDAGDRLYGTK"
FT   gene            488738..489232
FT                   /locus_tag="CLL_A0488"
FT   CDS_pept        488738..489232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0488"
FT                   /product="dCMP deaminase"
FT                   /note="identified by match to protein family HMM PF00383"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0488"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23058"
FT                   /db_xref="GOA:B2TJZ0"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR015517"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR016473"
FT                   /db_xref="UniProtKB/TrEMBL:B2TJZ0"
FT                   /protein_id="ACD23058.1"
FT                   /translation="MERTIKENYYLDIAETVLERGTCLRRNYGSIIVKNDEIISTGYTG
FT                   APRGRKNCIDINSCIREKLQVPRGTHYELCRSVHSEANAIISASRRDMIGATLYLVGRD
FT                   VKTREYVENANSCSMCKRLIINAGISYVVIRKDKENYLKIDVEDWIKNDDSLNIDENFG
FT                   Y"
FT   gene            489360..490508
FT                   /gene="mnaA"
FT                   /locus_tag="CLL_A0489"
FT   CDS_pept        489360..490508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mnaA"
FT                   /locus_tag="CLL_A0489"
FT                   /product="UDP-N-acetylglucosamine 2-epimerase"
FT                   /EC_number="5.1.3.14"
FT                   /note="identified by similarity to SP:P39131; match to
FT                   protein family HMM PF02350; match to protein family HMM
FT                   TIGR00236"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0489"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23636"
FT                   /db_xref="GOA:B2TJZ1"
FT                   /db_xref="InterPro:IPR003331"
FT                   /db_xref="InterPro:IPR029767"
FT                   /db_xref="UniProtKB/TrEMBL:B2TJZ1"
FT                   /protein_id="ACD23636.1"
FT                   /translation="MNKKKIITIFGTRPEAIKMAPLVQELNKREEIEAKVCVTAQHREM
FT                   LDQVLELFNIKPDFDLNIMKTRQTLTGITNKVLEGLEEIFEQEKPDMILVHGDTTTTFA
FT                   GALAAFYKQIKVGHVEAGLRTFNKYFPFPEEMNRRLTGNLSDLHFAPTQSSKENLLNEG
FT                   VSENIIYITGNTVIDAMEHTVEENYEFENEELKKIDFNKKVIMVTAHRRENWGEGINNI
FT                   CDSLKQIVLNNEDVELVYLVHLNPIVKDVVFEKLGNLDRVHLLSPLDTKETHNLMNKSY
FT                   LVMTDSGGLQEEAPHLGKPVLVLRDVTERPEAVQYGTVKLVGTDVKKIVDEANKLLNDV
FT                   EAYSSMSKSVNPYGDGIASIRIADAILKYFELSEKEVEEFKI"
FT   gene            490638..491819
FT                   /locus_tag="CLL_A0490"
FT   CDS_pept        490638..491819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0490"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.9"
FT                   /note="identified by match to protein family HMM PF00108;
FT                   match to protein family HMM PF02803; match to protein
FT                   family HMM PF08541; match to protein family HMM TIGR01930"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0490"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24544"
FT                   /db_xref="GOA:B2TJZ2"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:B2TJZ2"
FT                   /protein_id="ACD24544.1"
FT                   /translation="MKEVVIVSAVRTALGSFGGALKTVPAVDLGATVIKEALNRAGVKP
FT                   EAVEEVIMGNVIQAGLGQNPARQSTLKAGLPNEVPAMTINKVCGSGLRAVSLAAQMIKA
FT                   GDADVIVAGGMENMSAAPYVLPGARWGQRMGDAKMVDTMIKDGLWDAFNNYHMGVTAEN
FT                   IAKKWGLTREEQDAFSAGSQQKAQKAIESGRFKDEIVPVMIPQRKGEPKVFDTDEFPRF
FT                   GTTKESLGKLKPAFIKDGTVTAGNASGINDGAAAFVVMSAEKAAELGVKPLAKILSYGS
FT                   KGLDPAIMGYGPFHATKKALEEANLTIADLDLVEANEAFAAQSLAVAKDLGFDMEKVNV
FT                   NGGAIALGHPVGASGARILVTLLHEMEKRDAKKGLATLCIGGGMGTALIVERL"
FT   gene            492863..493228
FT                   /locus_tag="CLL_A0491"
FT   CDS_pept        492863..493228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0491"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0491"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22512"
FT                   /db_xref="GOA:B2TJZ3"
FT                   /db_xref="UniProtKB/TrEMBL:B2TJZ3"
FT                   /protein_id="ACD22512.1"
FT                   /translation="MNREPIKLLKDILKLDLRGGLLVSLIIGILFSFKDASIYFIGVIV
FT                   SLISFMINVYIIISFLGYNNRNKYITMSVPLKIGIVILTSLPFIKNVEYISFYMCGFIS
FT                   HYVFLTFNSIKSEKGSV"
FT   gene            493230..493910
FT                   /gene="atpB"
FT                   /locus_tag="CLL_A0492"
FT   CDS_pept        493230..493910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpB"
FT                   /locus_tag="CLL_A0492"
FT                   /product="ATP synthase F0, A subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="identified by match to protein family HMM PF00119;
FT                   match to protein family HMM TIGR01131"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0492"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22999"
FT                   /db_xref="GOA:B2TJZ4"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR023011"
FT                   /db_xref="InterPro:IPR035908"
FT                   /db_xref="UniProtKB/TrEMBL:B2TJZ4"
FT                   /protein_id="ACD22999.1"
FT                   /translation="MEPSKAVFSFEIGNFPVDVIPEVIVQWIIILAVAITAYLLTRNLK
FT                   QKPNKKQAALEKFYEAVTSLVSNTMGESYVGFVPYVGTLIIYLLLLNFTGLVGIKPPTQ
FT                   NLSVTVGLAITTFVVINFTAIKRNGLGGYLKGFGHPFIGMLPINIMERVMLPVSLALRL
FT                   FGNMLAATILVDLVYTALGHIGMAAQIGLPIIVHGYFDLFDGTIQMLVFTMLTIINIKT
FT                   TAEH"
FT   gene            493943..494158
FT                   /gene="atpE"
FT                   /locus_tag="CLL_A0493"
FT   CDS_pept        493943..494158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpE"
FT                   /locus_tag="CLL_A0493"
FT                   /product="ATP synthase F0, C subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="identified by match to protein family HMM PF00137;
FT                   match to protein family HMM TIGR01260"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0493"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23893"
FT                   /db_xref="GOA:B2TJZ5"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR005953"
FT                   /db_xref="InterPro:IPR020537"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="InterPro:IPR038662"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2TJZ5"
FT                   /protein_id="ACD23893.1"
FT                   /translation="MNLAVIGAGIAVLTGLGAGIGIGIATGRATEAIARQPEAASKIQT
FT                   ALIIGAGLAEATAIYGLIIAFMILTK"
FT   gene            494209..494688
FT                   /gene="atpF"
FT                   /locus_tag="CLL_A0494"
FT   CDS_pept        494209..494688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpF"
FT                   /locus_tag="CLL_A0494"
FT                   /product="ATP synthase F0, B subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="identified by match to protein family HMM PF00430;
FT                   match to protein family HMM TIGR01144"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0494"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23772"
FT                   /db_xref="GOA:B2TJZ6"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="InterPro:IPR005864"
FT                   /db_xref="InterPro:IPR028987"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2TJZ6"
FT                   /protein_id="ACD23772.1"
FT                   /translation="METNYSVIFMTIINFCILVAILKHFFWDKIKGIINERQDFVDEQL
FT                   LKVDEDSEKARMYLLENQRILQTAKEEGKKITESQKEKANKVYDEIVEDANEEAKSLLE
FT                   RAKTDIQREKEKAEYEIKKQAVDLAIELSIKALEENIDESKHRELISNFITKVGM"
FT   gene            494691..495230
FT                   /gene="atpH"
FT                   /locus_tag="CLL_A0495"
FT   CDS_pept        494691..495230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpH"
FT                   /locus_tag="CLL_A0495"
FT                   /product="ATP synthase F1, delta subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="identified by match to protein family HMM PF00213;
FT                   match to protein family HMM TIGR01145"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0495"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22412"
FT                   /db_xref="GOA:B2TJZ7"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="InterPro:IPR020781"
FT                   /db_xref="InterPro:IPR026015"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2TJZ7"
FT                   /protein_id="ACD22412.1"
FT                   /translation="MYEYLDRRYALALYQVAEKKGKVDEYLQDLREICELIENNHEFYE
FT                   VIKHPQISTKKKKKTFISIFKDKIDEELLSFLLILIEKDRILYLREKLNEMEKIDLERK
FT                   NTLKGIIKTAIPLLSNEFDNLRDIFQKKYDKNILFETEVDRNLLGGVYVRVGHDVIDDT
FT                   VKSKIEEMKDLMLKQK"
FT   gene            495241..496755
FT                   /gene="atpA"
FT                   /locus_tag="CLL_A0496"
FT   CDS_pept        495241..496755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpA"
FT                   /locus_tag="CLL_A0496"
FT                   /product="ATP synthase F1, alpha subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="identified by match to protein family HMM PF00006;
FT                   match to protein family HMM PF00306; match to protein
FT                   family HMM PF02874; match to protein family HMM PF09378;
FT                   match to protein family HMM TIGR00962"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0496"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23127"
FT                   /db_xref="GOA:B2TJZ8"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033732"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2TJZ8"
FT                   /protein_id="ACD23127.1"
FT                   /translation="MNIKPEEITSIIKKEIEKYEKQIKTVDSGTIIQVGDGVSRVYGLD
FT                   DCMEGELLEFPNDVYGMALNLEQDNVGCVLLGNEEGIKEGDIVKGSGKIVEVPVGEALI
FT                   GRVVNSLGEELDGKGPINTNQTRPIEVKAPSIIDRSSVNEPLQTGIKAIDSMIPIGKGQ
FT                   RELIIGDRQTGKTALVIDTILNQKGKDVICIYVAIGQKQSTVAHIVNTLTEMGAMDYSI
FT                   IVSSTAADSAPLQYLAPYAGCSIGEYFMNQGKDVLIVYDDLSKHAVAYRTMSLLLRRPP
FT                   GREAYPGDVFYIHSRLLERAAKLSKENGGGSLTALPIIETLAGDITAYIPTNVISITDG
FT                   QIFLESDLFNSGQRPAVNAGISVSRVGGNAQIKAMKQVTGTLRLELAQYRELAAFAQFG
FT                   SDLDKDSKKRLEKGKRLVEILKQDQYKPLEVEKQVIILYTAVNDFLSDIKVEDIKKFEK
FT                   ELLEYVDTHYRELGRQIAEEKVLTDEIKAKLEVAIVEFKKIFLQEA"
FT   gene            496796..497647
FT                   /gene="atpG"
FT                   /locus_tag="CLL_A0497"
FT   CDS_pept        496796..497647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpG"
FT                   /locus_tag="CLL_A0497"
FT                   /product="ATP synthase F1, gamma subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="identified by match to protein family HMM PF00231;
FT                   match to protein family HMM TIGR01146"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0497"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23525"
FT                   /db_xref="GOA:B2TJZ9"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR023632"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2TJZ9"
FT                   /protein_id="ACD23525.1"
FT                   /translation="MGSAGLIEIKRRIKSVESTRKITNAMGLVATSKLRKTRKELFINK
FT                   KFFEETEKIIEKLASTISQDDDSIYFKSNKSKYKLYILVSSDTGLCGSYNNTVVSYLDS
FT                   LVRDEKENIKVITVGSKGLSYVKRIGLDTIADYVDIPDIPTVKEVKIVFESALKMYKDG
FT                   EVSEINVAYLDFVSPVKQEPKAEKLLPIEKITSVPEEFITEPNSEEVLNNALNIHLKGK
FT                   FRNILLSAKCSEQSSRMTAMNGATQNANDILDNLNLKYNRIRQQIITQEISEIVGGAEA
FT                   QK"
FT   gene            497663..499054
FT                   /gene="atpD"
FT                   /locus_tag="CLL_A0498"
FT   CDS_pept        497663..499054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpD"
FT                   /locus_tag="CLL_A0498"
FT                   /product="ATP synthase F1, beta subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="identified by match to protein family HMM PF00006;
FT                   match to protein family HMM PF00306; match to protein
FT                   family HMM PF02874; match to protein family HMM TIGR01039"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0498"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25166"
FT                   /db_xref="GOA:B2TK00"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2TK00"
FT                   /protein_id="ACD25166.1"
FT                   /translation="MPGKIGKVVQVIGPVVDIKFDSDSLPNLYNAISIDMGERTLIAEV
FT                   EQHVGDDIVRTIAMEATEGLKRGMDAVDTEKAISVPVGDQVLGRLFNVLGKPIDNAGEV
FT                   EAEEIYPIHRPAPSFKDQAVEPEMFETGIKVIDLLAPYQRGGKIGLFGGAGVGKTVLIQ
FT                   ELINNIAKEHGGLSVFTGVGERSREGNDLYHEMRESGVIDKTALVFGQMNEPPGARMRV
FT                   ALTGLTMAEYFRDKGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATEMGAL
FT                   QERITSTKNGSITSVQAVYVPADDLTDPAPATTFSHLDATTVLSRSIVELGIYPAVDPL
FT                   ESSSRILDPRLVGEEHYNVATKVKNILERYKELQDIIAILGVDELSDEDKAVVSRARKV
FT                   QRFLSQPFTVGEQFTGMPGKYVSVKETIKGFKEILEGKYDDLPESAFLFIGSVEEAVQK
FT                   AKSLA"
FT   gene            499068..499472
FT                   /gene="atpC"
FT                   /locus_tag="CLL_A0499"
FT   CDS_pept        499068..499472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpC"
FT                   /locus_tag="CLL_A0499"
FT                   /product="ATP synthase F1, epsilon subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="identified by match to protein family HMM PF00401;
FT                   match to protein family HMM PF02823; match to protein
FT                   family HMM TIGR01216"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0499"
FT                   /db_xref="EnsemblGenomes-Tr:ACD21710"
FT                   /db_xref="GOA:B2TK01"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR020547"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="InterPro:IPR036794"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2TK01"
FT                   /protein_id="ACD21710.1"
FT                   /translation="MADTFLLKIVTPDKDIFNGNIKRIFLKNSVGRLEILANHANMVTS
FT                   TISSIVEFTDADGKDRKLFISKGIASIFNNEMTIFSESAEFSDNIDLNRAEKAKERAEK
FT                   RLLEGNKYDKERAELALLRSIERINLKKMN"
FT   gene            499630..500268
FT                   /locus_tag="CLL_A0500"
FT   CDS_pept        499630..500268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0500"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0500"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22766"
FT                   /db_xref="InterPro:IPR036209"
FT                   /db_xref="UniProtKB/TrEMBL:B2TK02"
FT                   /protein_id="ACD22766.1"
FT                   /translation="MKFKYSLFVLILFLFFNMSAISAKDINNDSFYNLENSMVNESYFE
FT                   ENGLKVQFKIKKNINSEQIFLKKYLINELKGKYTKVDDRSFNISNGDVKACVNLWEINN
FT                   YTYVEIILINTNSEYNTKHLEELVENIKKTNTEDVQIFLYYKGKIDSDKSLNDFTRLTS
FT                   LMNFNMLSISNGYTGTGVSKLGEKMNFALVSYNDKSYIIIGTPIIFTTY"
FT   gene            500330..501592
FT                   /gene="murA"
FT                   /locus_tag="CLL_A0501"
FT   CDS_pept        500330..501592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murA"
FT                   /locus_tag="CLL_A0501"
FT                   /product="UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /EC_number="2.5.1.7"
FT                   /note="identified by match to protein family HMM PF00275;
FT                   match to protein family HMM TIGR01072"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0501"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22879"
FT                   /db_xref="GOA:B2TK03"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/TrEMBL:B2TK03"
FT                   /protein_id="ACD22879.1"
FT                   /translation="MEKIIVKGVKKLEGEVDISCAKNSVLPIIAATILCPEDITINNTP
FT                   MLEDVEVICQLLSQLNCDISFSKINDKLKINTKNLNPVDADTDLIRKMRASFLIMGPML
FT                   SRFGYCKLSLPGGCNIGSRPIDLHLKGFKALGADINIGHGFVEVKAKKLIGNRIYLDFP
FT                   SVGATENILTASILANGTTIIENAAEEPEIEDLARFLNSMGANIEGAGQGKITIHGVKK
FT                   LKGINYTPIYDRIEAGTFMIAAGITNSIIKINGVNEDHLRPVIEKLKECGIKFNKLSNN
FT                   SIIVDGTGEKRPVDIKTLPYPGFPTDMQAQMMSLLCLTKGTSIITETIFENRFMHVTEL
FT                   LRMGANIKIDGRTAIIDGAPKLTGAKVKATDLRAGAAMILAGLAAEGETEIGDIYHIDR
FT                   GYVNVEKKFRNLGAEVYRIDV"
FT   gene            501710..502747
FT                   /gene="spoIID"
FT                   /locus_tag="CLL_A0502"
FT   CDS_pept        501710..502747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoIID"
FT                   /locus_tag="CLL_A0502"
FT                   /product="stage II sporulation protein D"
FT                   /note="identified by match to protein family HMM PF08486;
FT                   match to protein family HMM TIGR02669; match to protein
FT                   family HMM TIGR02870"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0502"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24353"
FT                   /db_xref="GOA:B2TK04"
FT                   /db_xref="InterPro:IPR013486"
FT                   /db_xref="InterPro:IPR013693"
FT                   /db_xref="InterPro:IPR014225"
FT                   /db_xref="UniProtKB/TrEMBL:B2TK04"
FT                   /protein_id="ACD24353.1"
FT                   /translation="MRNNKFNKDIKLIILITLITLVMLILSPIVFLKSDFNIFKPFEIN
FT                   KSIVKETYKIELPKNKKVKLYRKDKDKLDEIDIEEYIIGVVASEMPANFDENALKAQAV
FT                   AARTYYINKLNNHCKEASKSEGEICDTTHCQVYMDKDERMKKWSEKDGNKNWDKIKKAV
FT                   KDTEGQVLVYDGKVLEYPQFFAISSGKTENAKDVFSNDIPYLKSTDSAGEEIAPKYKSF
FT                   IEVNLNDFIDKINKNYSNLNLSKDNIGSIMNIISYTEGGSVKELKIGDQIIKGTEFRNL
FT                   FNLNSTNFSWTIKDNIIKIDCTGYGHGVGMSQWGANAMAKDGKKYDEILTHYYNGVEIK
FT                   NITYK"
FT   gene            502920..503645
FT                   /locus_tag="CLL_A0503"
FT   CDS_pept        502920..503645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0503"
FT                   /product="conserved membrane-associated protein"
FT                   /note="identified by match to protein family HMM PF01551"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0503"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24420"
FT                   /db_xref="GOA:B2TK05"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:B2TK05"
FT                   /protein_id="ACD24420.1"
FT                   /translation="MDKNFRQRFRDLLRKESFYIALFLCLCVMAAVGTVSYKRISNQHE
FT                   VAKVQQPEKELTLNINDKSVTNEIPNAERVENTAKEESKVNEKTASKETAKSVASTTVN
FT                   LSNPIEGKLSRGYTYPAPVKVEDNLYRTIRGVNISSKIGTEVKAAADGVVDVVENAGVE
FT                   EGTVVEIKHANGLKTRYGNLDKNVSVKAGDKVTANQVIAKVGDTAKLYDKETFGEYLNL
FT                   QVINPNGEQVNPEKYLKLK"
FT   gene            503736..503990
FT                   /gene="spoIIID"
FT                   /locus_tag="CLL_A0504"
FT   CDS_pept        503736..503990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoIIID"
FT                   /locus_tag="CLL_A0504"
FT                   /product="stage III sporulation protein D"
FT                   /note="identified by similarity to SP:P15281; match to
FT                   protein family HMM TIGR02844"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0504"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22135"
FT                   /db_xref="GOA:B2TK06"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR014208"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="UniProtKB/TrEMBL:B2TK06"
FT                   /protein_id="ACD22135.1"
FT                   /translation="MKDYIEERVLEVAKYIIDSKATIRKTAKVFGVSKSTIHKDMTERL
FT                   PKINPIIAEETHTILELNKAERHIRGGKATKMKYKAIER"
FT   gene            504070..505104
FT                   /gene="mbl"
FT                   /locus_tag="CLL_A0505"
FT   CDS_pept        504070..505104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mbl"
FT                   /locus_tag="CLL_A0505"
FT                   /product="Mbl protein"
FT                   /note="identified by similarity to SP:P39751; match to
FT                   protein family HMM PF02491; match to protein family HMM
FT                   PF06723; match to protein family HMM TIGR00904"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0505"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22884"
FT                   /db_xref="GOA:B2TK07"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:B2TK07"
FT                   /protein_id="ACD22884.1"
FT                   /translation="MWFWRTGTDLGIDLGTATVLVYVKGKGVILKEPSVVAINKNNNKL
FT                   LAVGEEARRMIGRTPGNIVAVRPLRDGVISNYDVTERMLKEFIRKACGKRNITAPKVMV
FT                   CVPSQATEVEKRAVIDAARNSGAKTVHLIEEPLAAAIGAGIDITKPNGNMVIDIGGGTC
FT                   DIAVISLGGIVERSSIKIAGDKFTEAIIKYVRNKYKIMIGEKTAEDLKIGIGSAFKGSR
FT                   SLTAKMKGRNLVTGLPDELEISTEEIREALEESVESIVDVVKTVLERTPPELAADIIEK
FT                   GILMTGGGALLYGLDKLIEFRTGVEVTIAENAIECVAEGTGAVLGQLDKLDNELNSQEI
FT                   VLIE"
FT   gene            complement(505148..505666)
FT                   /locus_tag="CLL_A0506"
FT   CDS_pept        complement(505148..505666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0506"
FT                   /product="putative sporulation protein YyaC"
FT                   /note="identified by match to protein family HMM PF06866;
FT                   match to protein family HMM TIGR02841"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0506"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24093"
FT                   /db_xref="InterPro:IPR009665"
FT                   /db_xref="InterPro:IPR023430"
FT                   /db_xref="UniProtKB/TrEMBL:B2TK08"
FT                   /protein_id="ACD24093.1"
FT                   /translation="MTKHKVNYKSADACFEISESIKDYLNDETIIVCIGTDKCIGDCLG
FT                   PLVGSILKDSSFELPVYGTLSSPIHALNIDDRLEEIYEKHPDSPIIGVDACLGNKDAIG
FT                   EIHTRDYAIHPGKGVGKELPEVGIASIIGIIDTVNNSEVFSSYSIRLSLVMDMAKLISK
FT                   ALIDAYNKK"
FT   gene            505779..506186
FT                   /locus_tag="CLL_A0507"
FT   CDS_pept        505779..506186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0507"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0507"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24071"
FT                   /db_xref="GOA:B2TK09"
FT                   /db_xref="UniProtKB/TrEMBL:B2TK09"
FT                   /protein_id="ACD24071.1"
FT                   /translation="MKRTLTVIFMCFALAMNIYLIFYWQPKDAKVITTSNNDSVSVLSY
FT                   SKSMYKVNKNNIMNILSEDDKKDLTRIICKLSTSDIGKVKEAFDLEDENEGLVTAFKVF
FT                   KTRLSTQDYKKIRDIFSKFIDIDYLDSNLIK"
FT   gene            506347..506433
FT                   /locus_tag="CLL_A0508"
FT   tRNA            506347..506433
FT                   /locus_tag="CLL_A0508"
FT                   /product="tRNA-Tyr"
FT   gene            506438..506515
FT                   /locus_tag="CLL_A0509"
FT   tRNA            506438..506515
FT                   /locus_tag="CLL_A0509"
FT                   /product="tRNA-Val"
FT   gene            506535..506609
FT                   /locus_tag="CLL_A0510"
FT   tRNA            506535..506609
FT                   /locus_tag="CLL_A0510"
FT                   /product="tRNA-Thr"
FT   gene            506617..506701
FT                   /locus_tag="CLL_A0511"
FT   tRNA            506617..506701
FT                   /locus_tag="CLL_A0511"
FT                   /product="tRNA-Tyr"
FT   gene            506707..506784
FT                   /locus_tag="CLL_A0512"
FT   tRNA            506707..506784
FT                   /locus_tag="CLL_A0512"
FT                   /product="tRNA-Val"
FT   gene            506805..506879
FT                   /locus_tag="CLL_A0513"
FT   tRNA            506805..506879
FT                   /locus_tag="CLL_A0513"
FT                   /product="tRNA-Thr"
FT   gene            506886..506970
FT                   /locus_tag="CLL_A0514"
FT   tRNA            506886..506970
FT                   /locus_tag="CLL_A0514"
FT                   /product="tRNA-Tyr"
FT   misc_binding    507110..507211
FT                   /bound_moiety="S-adenosyl methionine"
FT                   /note="SAM riboswitch (S box leader); Rfam score 78.90"
FT                   /inference="nucleotide motif:RFAM:RF00162"
FT   gene            507333..508508
FT                   /gene="metK"
FT                   /locus_tag="CLL_A0515"
FT   CDS_pept        507333..508508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metK"
FT                   /locus_tag="CLL_A0515"
FT                   /product="methionine adenosyltransferase"
FT                   /EC_number="2.5.1.6"
FT                   /note="identified by match to protein family HMM PF00438;
FT                   match to protein family HMM PF02772; match to protein
FT                   family HMM PF02773; match to protein family HMM TIGR01034"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0515"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24839"
FT                   /db_xref="GOA:B2TK10"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2TK10"
FT                   /protein_id="ACD24839.1"
FT                   /translation="MRRLFTSESVTEGHPDKMCDQISDAILDAILTKDPNARVACETCT
FT                   TTGLVMVMGEISTNCYVDIPKVVRETVREIGYDRAKYGFDCDTCSVMTTIDEQSADIAM
FT                   GVDEALESKKGQKDEVEAVGAGDQGMMFGFATNETDAYMPLPIYMAHKLSRRLTEVRKD
FT                   GTLDYLRPDGKTQVTVEYENNKPKRIDTIVISTQHGEEVSLEKIEKDIKEYVINAVVPT
FT                   ELLDSETRYFINPTGRFVVGGPQGDSGLTGRKIIVDTYGGYGRHGGGAFSGKDSTKVDR
FT                   SAAYAARWVAKNLVAAGIADKLEIQLAYAIGVAKPVSIEIETFGTGKMPEDKIVEIVEN
FT                   VFDLRPGAIIRDLDLRKPIFKQTAAYGHFGRTDLDLPWERLNKIEEIKKYI"
FT   gene            508917..511136
FT                   /locus_tag="CLL_A0516"
FT   CDS_pept        508917..511136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0516"
FT                   /product="helicase, RecD/TraA family"
FT                   /note="identified by match to protein family HMM TIGR01448"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0516"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22772"
FT                   /db_xref="GOA:B2TK11"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR006345"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027785"
FT                   /db_xref="InterPro:IPR029493"
FT                   /db_xref="InterPro:IPR041451"
FT                   /db_xref="UniProtKB/TrEMBL:B2TK11"
FT                   /protein_id="ACD22772.1"
FT                   /translation="MEVIDGFVENIVFKSEETGYVVCKIRTAKNLISAVGTIPFIKEGQ
FT                   NVRIKGHWTVHKQFGQQFEISEFEEILPDSLDGIEKYLSAGIIHGIGPVTAKKIIDKFG
FT                   EKTLDILENHIEELMEIEGIGKKKFMIIYESYMEQNGLKEVILHFHKYGLSNNQCMKIY
FT                   KKFGPSSNQIVSENPYILSEEIVGIGFKTADRIAMNLGISDNSEFRIKSGIKHTLNQFC
FT                   LLGNTYMPKEKLIEDCEKLLSIERILIEESVYSIAVSKNIILEKLGEEEAVYLLPYYYC
FT                   ELGVTNKIITLGMQTIQTINSDLDFEINVLEKEYNIKFAASQREAILGAFNNGIEIITG
FT                   GPGTGKTTIIKCIIDIYEKNGMDVILGAPTGRAAKRMTESTGREAKTIHRLLEIGVAED
FT                   DSVFGKSESSPLDTDVIIIDEASMIDIMLMHNLLKAVNLGTRLIIVGDVDQLPSVGAGN
FT                   VLKDLIESQYIKVVRLNEIFRQGTESLITTNAHRINQGEAPILNQKDKDFFFIGEENLN
FT                   KTVNVIIDLINRRLPSFNKQWNRFRDMQVLSPMRKGILGVNNLNINLQKVFNPPSKEKK
FT                   EKKIKEIIFREGDKIMQTKNNYSLKWTRIKGEGEYEGVGVFNGDLGFIQSIDEENKSFT
FT                   ITFDDERKVIYDFMYLDELDLAYATTIHKSQGSEFKVVIIPVFMGSPFLMNRNLLYTGI
FT                   TRAKELVVVVGVKRALIYMVGNTNIMERYSGLKYRIKDILTNAIE"
FT   gene            511171..512184
FT                   /locus_tag="CLL_A0517"
FT   CDS_pept        511171..512184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0517"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0517"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23261"
FT                   /db_xref="UniProtKB/TrEMBL:B2TK12"
FT                   /protein_id="ACD23261.1"
FT                   /translation="MSKYNQLDYEELNYAIDKIAHWYKKNIKFLNIVTVPFNTSYIFSD
FT                   IINEISMQGGKVLYVWGNNRENRELLTLLREINLEITYSYIECGEGISNLTFVNEKNLG
FT                   LIRGKYDLIIFDDIGYFSNIDNSNIRNKMDICSILSHKIIFYGIEKISLNGEFIEISPY
FT                   NYEKPFVEPRILTTRINLNTDIPYNLYEYLKWFVSMRKKVAIYTPDKEKLNLVYDYFET
FT                   QLIMKGVKVIRVSEEDEFKRCSRVLKYKDKAIFIITDKVKELSEYCLVNDAVILFADDL
FT                   RYTYKKFMYLCGKIGQINKELPEVLLVSNSISEDIDKAKELSREFNRKIWEKTSRK"
FT   gene            512160..512813
FT                   /locus_tag="CLL_A0518"
FT   CDS_pept        512160..512813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0518"
FT                   /product="competence protein F"
FT                   /note="identified by match to protein family HMM PF00156"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0518"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23517"
FT                   /db_xref="GOA:B2TK13"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:B2TK13"
FT                   /protein_id="ACD23517.1"
FT                   /translation="MGENIKKIIKIIYESLVSVIYPIENYCILCKRNDYVGICDICRSK
FT                   ITCIKNNDNEIISYGYYGGVIKELILKFKYKNNFTAGDILAEFLEKYIIDNMNYKEYII
FT                   TYIPMTIKSQKKRGFNQCEYIAKKIANSLNIECKKILIKVKDTKEQKMLDKNERKENIS
FT                   GSFDVIKKIDLTDKKIILIDDVTTTGFTIREGHKILKKYGAKEIKLLTLAKSHI"
FT   gene            513209..513742
FT                   /locus_tag="CLL_A0519"
FT   CDS_pept        513209..513742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0519"
FT                   /product="ribosome-associated protein Y"
FT                   /note="identified by match to protein family HMM PF02482;
FT                   match to protein family HMM TIGR00741"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0519"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24172"
FT                   /db_xref="GOA:B2TK14"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR032528"
FT                   /db_xref="InterPro:IPR034694"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="InterPro:IPR038416"
FT                   /db_xref="UniProtKB/TrEMBL:B2TK14"
FT                   /protein_id="ACD24172.1"
FT                   /translation="MKVIVIAKNIELTNALREMVEKKISKLGKYFNSDIEAKATLSVQR
FT                   NRQIVEVMIPFNGVVLRGEEANEDMYRAIDLVAEKLERQIRKQKTKLSRKKSGSLKFGE
FT                   IVDLSPVAVDEEEAKLVKRKRFGVKPMDIDEAILQMELVGHNFFVYQDVDSNKINVIYK
FT                   RKDGDYGLLDPEYK"
FT   gene            514075..516585
FT                   /gene="secA"
FT                   /locus_tag="CLL_A0520"
FT   CDS_pept        514075..516585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secA"
FT                   /locus_tag="CLL_A0520"
FT                   /product="preprotein translocase, SecA subunit"
FT                   /note="identified by match to protein family HMM PF00271;
FT                   match to protein family HMM PF01043; match to protein
FT                   family HMM PF02810; match to protein family HMM PF07516;
FT                   match to protein family HMM PF07517; match to protein
FT                   family HMM TIGR00963"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0520"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24795"
FT                   /db_xref="GOA:B2TK15"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2TK15"
FT                   /protein_id="ACD24795.1"
FT                   /translation="MGLLSAVFGTYSEREVKRIRPIVSKINELDEVMQKLSDDELKAKT
FT                   VEFKERLNNGETVDDILPEAFAVVREASKRVLNMKHYDEQLIGGIVLHQGRIAEMKTGE
FT                   GKTLVATLPAYLNGLTGKGVHIITVNDYLAKRDAEQMGELYGFLGLTTGVIVHELTNEQ
FT                   RREAYNSDITYGTNNEFGFDYLRDNMVIYKEERVQRKLNFTIVDEVDSILIDEARTPLI
FT                   ISGQGEKSTEFYKVADYFVKTLVKEKDYTIDEKANAVMLTDEGFHKAEQTFKVENYADA
FT                   ENVELQHYVTQALKANYAMRRDKDYMVKDGEVIIVDEFTGRLMEGRRYSDGLHQAIEAK
FT                   ENVKIARESKTLATITFQNYFRMYEKLSGMTGTALTEENEFREIYGLDVIVVPTHKPVV
FT                   RIDNPDLVFKSEKGKIMAVVDEIAKAHEVGQPVLVGTVSIEKSELISSMLKKKGVPHQV
FT                   LNAKFHEQEAEIITHAGEKGMVTIATNMAGRGTDIKLGEGVLEIGGLKIIGTERHESRR
FT                   IDNQLRGRSGRQGDSGESTFFISLEDDLMRIFGSEKIQGVVEKLGLEEDEAIESKLVSK
FT                   SIENAQKKVEGNNFDIRKTLLGYDDVMNKQREVIYKQRAEVLEGEDVKEEILHMLRDVI
FT                   SDAVDTHIKEDAEDYRESFLYLISYLNDICIPTNEVNLPALTEMSKEEIIDHLYDVAVK
FT                   SYEDKEAEFTSERLREIERVVLLRSVDTKWMDHINNMDNLKQGIGLRAFKQVDPVQAYQ
FT                   MEGSAMFEEMIDSIKKETVKMLLHVKVERAPERVRVAQETNAVHGDKPSAPVGPVRNLN
FT                   KFGRNDVCPCGSGKKFKNCCGREA"
FT   gene            516919..517896
FT                   /gene="prfB"
FT                   /locus_tag="CLL_A0522"
FT   CDS_pept        516919..517896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prfB"
FT                   /locus_tag="CLL_A0522"
FT                   /product="peptide chain release factor 2"
FT                   /note="identified by match to protein family HMM PF00472;
FT                   match to protein family HMM PF03462; match to protein
FT                   family HMM TIGR00020"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0522"
FT                   /db_xref="EnsemblGenomes-Tr:ACD21926"
FT                   /db_xref="GOA:B2TK17"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004374"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/TrEMBL:B2TK17"
FT                   /protein_id="ACD21926.2"
FT                   /translation="MQEDGFWNDTKRAEEITKESKRIKDKIQRVESVRSKLDDIEVLKE
FT                   IMDDDDEESAYEIINNIKEIEEEIDNYNMEILLSGEYDKNNAILTLHVGVGGTDANDWT
FT                   EMLLRMYTRWCEKKNYKVEMIDLLEGDEAGIKSVTLKVIGEYAYGYLKAEKGIHRLVRI
FT                   SPFNANGKRQTSFASMEVLPELTKEQDIDIRSEDIKIDTYRASGAGGQHINKTDSAVRI
FT                   THLPTGVVVQCQNERSQFSNKDTAMGMLKAKLIELKERAHKEKIEDLTGELKDMGWGSQ
FT                   IRSYVFHPYNLVKDHRTNVEVSNVTAVMDGDLDLFVNSYLKSLK"
FT   gene            complement(518013..519395)
FT                   /locus_tag="CLL_A0523"
FT   CDS_pept        complement(518013..519395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0523"
FT                   /product="aminopeptidase"
FT                   /note="identified by match to protein family HMM PF04389"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0523"
FT                   /db_xref="EnsemblGenomes-Tr:ACD21998"
FT                   /db_xref="GOA:B2TK18"
FT                   /db_xref="InterPro:IPR007484"
FT                   /db_xref="UniProtKB/TrEMBL:B2TK18"
FT                   /protein_id="ACD21998.1"
FT                   /translation="MKKIIYYSNLLLIFIALVFSIFLQTTYYHFNSSNVKNNIKIISSD
FT                   EYEGRLTGSIGNEKAADFIEDWFKNIDLVPLTENYKESFYINTPFKNGNNPSFKILNED
FT                   KVLYDYKYGVDYKEDLLNFNESSVTFNKKDILNIFPTSLTIKHNGKIYLFYTPSCNNFS
FT                   FRSSFNDKSDYQFSIAITTELYNNILDSLRNNNLIKITLPYSKHEKETSNVIGVIKGTS
FT                   KDLPPLVITAHFDHVGQDYLNNCYGGALDNASGTAFLMELSKNLSSFIKPKRDIIFVAL
FT                   TGEEFGLLGSSNFAQNHENLIKNSKIINFDMIGAANTPISIMSGLVCKSNKDANINLLN
FT                   SLETICSNKNINYKIEFEDCSDHASFTNMGMDAVTLCHSDVSKIHTPNDKVEYIDAEAI
FT                   DDVYSLVKDEISNYAYDDFRLVFYNNNFILFLFALFLFIFFLPTMKKKLKQYVNKNKIR
FT                   TL"
FT   gene            519595..519936
FT                   /locus_tag="CLL_A0524"
FT   CDS_pept        519595..519936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0524"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0524"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24061"
FT                   /db_xref="GOA:B2TK19"
FT                   /db_xref="UniProtKB/TrEMBL:B2TK19"
FT                   /protein_id="ACD24061.1"
FT                   /translation="MENISKNQVPQEVKKWNWGAFMLNIFWGIGNNSYLPLLCLIPLFN
FT                   IIWIFVCGAKGNEWAWKKGTYSSAEEFLLVQKTWNKAGLAYFVFTFIIILLYIFVFSAL
FT                   IAGLSSTMY"
FT   gene            complement(519997..520329)
FT                   /locus_tag="CLL_A0525"
FT   CDS_pept        complement(519997..520329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0525"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0525"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24816"
FT                   /db_xref="GOA:B2TK20"
FT                   /db_xref="UniProtKB/TrEMBL:B2TK20"
FT                   /protein_id="ACD24816.1"
FT                   /translation="MIKVVNKITSFLLLFFILVLSLNKLKVIDYSEELRNIFYFLTLIL
FT                   TIFSAINVILTTNSKLFKFINIVIILNLIIGGIISILESGLNMYIYSCLAFTSIYCIID
FT                   MFYKKV"
FT   gene            520666..522837
FT                   /locus_tag="CLL_A0526"
FT   CDS_pept        520666..522837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0526"
FT                   /product="tex domain protein"
FT                   /note="identified by match to protein family HMM PF00575;
FT                   match to protein family HMM PF09371"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0526"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22509"
FT                   /db_xref="GOA:B2TK21"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018974"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR023319"
FT                   /db_xref="InterPro:IPR023323"
FT                   /db_xref="InterPro:IPR032639"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="InterPro:IPR041692"
FT                   /db_xref="UniProtKB/TrEMBL:B2TK21"
FT                   /protein_id="ACD22509.1"
FT                   /translation="MKSIEERLAAELNLGLAQINNVVNLLDDGNTVPFISRYRKEATGG
FT                   LSDEVLRKLSERLTYLRNLDERKDDIKRLINEQGKLNPEIENALEKATTLTEVEDIYRP
FT                   YKPKKKTKATIAVAKGLKPLAELIQSGAFRGNLNEEASKYINEEKGVLKEEEAVQGALD
FT                   IIAENISDEAKFRKHIRELIIKEGFIESKGDSKDTTPYEMYYDYKEEVKKIPPHRILAI
FT                   NRGEKEKVLSVKITVNEDKIIRYLENNVLTRNEVLDEKLKLCIKDSLKRLIYPSIEREI
FT                   RNELTNIGEEGAINIFKENLKALLLQAPIKGKVVMGFDPGFRTGCKIAILDETGKFLEN
FT                   TAVYPTLPKKDIAGTKKVLKELIYKHGVDVISLGNGTASRESEEVIAEMIKEIRDEKGK
FT                   EVSYVIVSEAGASVYSASELATKEYPNLDVTVRGAISIGRRLQDPLAELVKIDPKAIGV
FT                   GQYQHDVTPKKLEQSLAGVVEDSVNTVGVDLNIATPSLLTYISGINSTIAQNIVAYREE
FT                   LGQFKSRKELLKVKRLGQKAYEQCAGFLRVSESKEYLDNTSVHPESYNVAKKLIEILGY
FT                   NKDDLKNNNLDDIDKRAEVNGINKLSNDLDIGELTLKDIIKELKKPGRDPRDEMPTPIL
FT                   KTGIIELKDLKPGMILNGTVRNVSDFGAFVDIGVHQDGLVHKSQMANRFVKHPLDIVKV
FT                   GDIVKVSILEVDQKRKRISLSMKDVDVEA"
FT   gene            523026..523985
FT                   /locus_tag="CLL_A0527"
FT   CDS_pept        523026..523985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0527"
FT                   /product="protein containing oxidoreductase domain"
FT                   /note="identified by match to protein family HMM PF01408"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0527"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22515"
FT                   /db_xref="GOA:B2TK22"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2TK22"
FT                   /protein_id="ACD22515.1"
FT                   /translation="MIKWGIIGLGNIAIRFANSLSHTNEGKLYAIASKTQEKRDYFCDK
FT                   YNCNKVYRDYNELLRDDEIDAVYIALPHGLHKYWSIEALRHKKAVLCEKPVGLNSEEMK
FT                   EIKKEALQNNTFFMEAMKTRFIPLIHDIKEILKSNKLGKIITVEANFCSHVTDIKKGSY
FT                   LLDKKQGGALLDVGIYPLSFVMDMIASPVEQIKSHMEFNEAGVDSYFKAKLTFENGVIG
FT                   TIEGAIDRKKERSAIIKGEKGYIEIPIYNRPEKAIIYINNSKPYIIEKKLEFDDMYGEI
FT                   KEVHDCLQAQKLESKYLSLNESIRVMEVLDEIKNVIYN"
FT   gene            524022..524987
FT                   /locus_tag="CLL_A0528"
FT   CDS_pept        524022..524987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0528"
FT                   /product="exported membrane protein"
FT                   /note="identified by match to protein family HMM PF00892"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0528"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24221"
FT                   /db_xref="GOA:B2TK23"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B2TK23"
FT                   /protein_id="ACD24221.1"
FT                   /translation="MDKEKIYTNRKNIVILAIICCILWGSAYPAIKVGYELFNIGTNDI
FT                   CSKLIFAGYRFAIAGVLVLLLEVINKKNIFNYSLKEFGEITLLGSTQTALQYLFFYIGL
FT                   SYTTGVRGSIINGTGTFASIILAHIIYKNDKLNFNKVIGCIIGFIGVVVVNLNGKAISG
FT                   QAFSMRGEGSLIIAAIIFAASAIYGKKITQDKDASIVTGYQLLIGGIILSILGFLFGGS
FT                   LKGFTLSSILLLIYMALLSSIAFAIWTQLLKFNKVGVISVFNFLVPIFGTLLSAIFLKE
FT                   NIFDIKILISLILVCSGIFLVYNEKAINLNLKLTKKKINR"
FT   misc_binding    525184..525301
FT                   /bound_moiety="flavin mononucleotide"
FT                   /note="FMN riboswitch (RFN element); Rfam score 104.93"
FT                   /inference="nucleotide motif:RFAM:RF00050"
FT   gene            525575..526165
FT                   /locus_tag="CLL_A0529"
FT   CDS_pept        525575..526165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0529"
FT                   /product="riboflavin transporter"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0529"
FT                   /db_xref="EnsemblGenomes-Tr:ACD21982"
FT                   /db_xref="GOA:B2TK24"
FT                   /db_xref="InterPro:IPR024529"
FT                   /db_xref="InterPro:IPR025720"
FT                   /db_xref="UniProtKB/TrEMBL:B2TK24"
FT                   /protein_id="ACD21982.1"
FT                   /translation="MNKNTNKTIKISLLSALALILMYFEFPVIPIFPWLKIDLSDVPAL
FT                   LGAFGFGPLAGVVIELIKNILILLIKGSQSGFVGELANFLVGVSLVLPAGIIYKRNKSK
FT                   KSAILGMALGGICIEIVGIISNVYLLLPAYGMHMNSAELLKYVTVGLIPFNGIKAIIVS
FT                   ILTYILYKKVSVSIFKAEPNFGSPEKSSKTITE"
FT   gene            complement(526200..526655)
FT                   /gene="rimI"
FT                   /locus_tag="CLL_A0530"
FT   CDS_pept        complement(526200..526655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rimI"
FT                   /locus_tag="CLL_A0530"
FT                   /product="ribosomal-protein-alanine acetyltransferase"
FT                   /EC_number="2.3.1.128"
FT                   /note="identified by match to protein family HMM PF00583;
FT                   match to protein family HMM TIGR01575"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0530"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24466"
FT                   /db_xref="GOA:B2TK25"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR006464"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B2TK25"
FT                   /protein_id="ACD24466.1"
FT                   /translation="MKLTTSLMTETDIDAVLEISLLSFPTSWSKESYIQELANPLANYI
FT                   VAKYDDKIIGFVGAWLIIDEAHITNIAVCPDFRRKNVASALLDSLIEINKRAGCISYTL
FT                   EVRASNIPAQELYKKYGFVENGIRKNYYQDNKEDAIIMWRIDEKNNS"
FT   gene            complement(526639..527355)
FT                   /locus_tag="CLL_A0531"
FT   CDS_pept        complement(526639..527355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0531"
FT                   /product="glycoprotease family protein"
FT                   /note="identified by match to protein family HMM PF00814"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0531"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23923"
FT                   /db_xref="GOA:B2TK26"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:B2TK26"
FT                   /protein_id="ACD23923.1"
FT                   /translation="MIILSIDSSSKVATAALLEDGNLLGEITLNNKKEHSTILMTLVEN
FT                   LLDNCNLDIDSIDGFVVSKGPGSFTGLRIGMATIKGLSFGGNKPYVSISSLDALAYSIA
FT                   PFNGIICPVMDALRNNVYTALYKSCNGKLEQIMDYSALDINELVDMLNEKGENVMFIGD
FT                   GLNNTKEYILENCNNCFFPPNHLNLVRASSLGELGLLKLKNGEYDDSNSAPFYLKKPQA
FT                   EREYEKRMKLKSETNN"
FT   gene            complement(527352..527813)
FT                   /locus_tag="CLL_A0532"
FT   CDS_pept        complement(527352..527813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0532"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF02367;
FT                   match to protein family HMM TIGR00150"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0532"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24938"
FT                   /db_xref="GOA:B2TK27"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2TK27"
FT                   /protein_id="ACD24938.1"
FT                   /translation="MEFNVYSIKETTTLGIEIGKLLNSGDIICLTGDLGTGKTHITKGI
FT                   ALGLDIKDDITSPTFTIVNEYDDGRLKLNHFDVYRVNDPDEIYAIGFDDYIFSDSVSII
FT                   EWANYIEDIIPDEFLHINIEKDLEKGDNYRKIILTPYGEKYDYIKELKI"
FT   gene            528143..529009
FT                   /locus_tag="CLL_A0533"
FT   CDS_pept        528143..529009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0533"
FT                   /product="putative ABC transporter substrate-binding
FT                   lipoprotein"
FT                   /note="identified by match to protein family HMM PF01297"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0533"
FT                   /db_xref="EnsemblGenomes-Tr:ACD21949"
FT                   /db_xref="GOA:B2TK28"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="UniProtKB/TrEMBL:B2TK28"
FT                   /protein_id="ACD21949.1"
FT                   /translation="MKKITFIMIIITLTFSVGMGVFANPLLANTENDQKEDREKYLNIM
FT                   TVNKPQYKMVKKIVQNKHNVQYMMTEETDINGFKYNKEIIENVSNMDLFIYSGTSFEPW
FT                   ANSFINELKKGSMGIINLSRGMRLLNYDGNEASKENPYYFEGIDSYKIALYNVKAAVQD
FT                   RDPKNRDYYEENYNNAIKELNNQIEPYNEKIKGLKDYTFLALNDNFDYLTKDLGLHVVK
FT                   LNNYEISEFIKVNNLDENKLIILKDGTEETNMDLSKYKVVNLWKYYGNMSFDELILYNI
FT                   KVLTDLL"
FT   gene            529060..529134
FT                   /locus_tag="CLL_A0534"
FT   tRNA            529060..529134
FT                   /locus_tag="CLL_A0534"
FT                   /product="tRNA-Trp"
FT   gene            529283..529408
FT                   /locus_tag="CLL_A0535"
FT   CDS_pept        529283..529408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0535"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0535"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22183"
FT                   /db_xref="UniProtKB/TrEMBL:B2TK29"
FT                   /protein_id="ACD22183.1"
FT                   /translation="MYELDLKCAGNFKFLKDFIEFLLRNIRVNNYKYILKFIKAI"
FT   gene            529804..530841
FT                   /locus_tag="CLL_A0536"
FT   CDS_pept        529804..530841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0536"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="identified by match to protein family HMM PF00165"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0536"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22391"
FT                   /db_xref="GOA:B2TK30"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR018771"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:B2TK30"
FT                   /protein_id="ACD22391.1"
FT                   /translation="MIKDNLNLNKVIDLEKWVNLQESLAVVTKVAIIIVDYKGNPITKH
FT                   SGCHRFCKAVRANPELVKYCQKCDSRGGLEAVRLNEPYIYLCHYNIVDIAIPIIIDGKY
FT                   IGAVMAGQVKLSNTNASDILEQIVGTSNNFIVKKALEDFKNYYDELPILSYEEVKEIAN
FT                   MLFSLCNYLIEEALDKNLISEMYRNTIKNQSEIDSNILTGYTIKNIEHAKKEISNAIIN
FT                   AYTGEKPSSNGEMITVSNTLKPGIEYLYKHKSENVTAEKMSKICHISSSYFSRLFIKET
FT                   GEKFSTYVSKLKIEWAKSILEETDMNINEISEELGFSESGYFIKIFKRYEGITPFLYRK
FT                   YCKKR"
FT   gene            531084..532223
FT                   /gene="dhaD"
FT                   /locus_tag="CLL_A0537"
FT   CDS_pept        531084..532223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dhaD"
FT                   /locus_tag="CLL_A0537"
FT                   /product="glycerol dehydrogenase"
FT                   /EC_number="1.1.1.6"
FT                   /note="identified by similarity to SP:P45511; match to
FT                   protein family HMM PF00465; match to protein family HMM
FT                   PF01761"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0537"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24976"
FT                   /db_xref="GOA:B2TK31"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR016205"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="UniProtKB/TrEMBL:B2TK31"
FT                   /protein_id="ACD24976.1"
FT                   /translation="MRKAFICPTKYVQGEDELLNLGYFVKSFGKSALLIAHKDDVARVK
FT                   DKLDKTCEKFGITFVESGFTGECSREEVERLQKIAEENKCDCTVGLGGGKAIDTAKCVA
FT                   EGEAVIIVPTIAATDAPTSHSAVLYTPEGAFDDYAYFKQSPSVVLIDTTVIAKAPTRFL
FT                   VSGMGDALSTYFEARATSNSYSNVNAGLPCGYREGLCGEAKGTNTALALAKLCYETLIN
FT                   DGAKAKVASDCNLVTQSLENVIEANILLSGIGFESGGLAGAHAIHDGLTILEGTHKYFH
FT                   GEKVAFGTIAQLVLENAPKEELNQVLDFCLEVGLPVCLSDIGVNTITEDELMEVAKKSC
FT                   IEEESVHSMPFPITVEAVAAAIIAADKIGKDYKVNRGVN"
FT   gene            532223..533983
FT                   /gene="dhaKL"
FT                   /locus_tag="CLL_A0538"
FT   CDS_pept        532223..533983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dhaKL"
FT                   /locus_tag="CLL_A0538"
FT                   /product="dihydroxyacetone kinase, DhaK/DhaL subunit"
FT                   /EC_number="2.7.1.29"
FT                   /note="identified by similarity to SP:P76015; match to
FT                   protein family HMM PF02733; match to protein family HMM
FT                   PF02734; match to protein family HMM TIGR02363"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0538"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22627"
FT                   /db_xref="GOA:B2TK32"
FT                   /db_xref="InterPro:IPR004006"
FT                   /db_xref="InterPro:IPR004007"
FT                   /db_xref="InterPro:IPR012736"
FT                   /db_xref="InterPro:IPR036117"
FT                   /db_xref="UniProtKB/TrEMBL:B2TK32"
FT                   /protein_id="ACD22627.1"
FT                   /translation="MKKIINRPENVVMEMCNGIAMAHPELEFVRKYKVMKKKNINPNKV
FT                   SLISGGGSGHEPAHAGFIGKGMLDAAVCGDVFASPSQIQIYKAIKATASKKGTLLIIKN
FT                   YSGDMMNFKNAAYLANEDGIKVDYVKVDDDIAVKDSLYTVGRRGVAGTVLVHKMAGAAA
FT                   ELGLSLEEVKEIAEKANSNVRSLGFAFSSCTVPAKGTPTFQIAEDEMEFGVGIHGEPGI
FT                   KREKIATADELAERIVDSILNDMKIDGTNHEEVALLINGFGGTPLQELYLFNNSVTAEL
FT                   AKRNIKICRTFVGNYMTSIDMEGASVSIMKLDAQLKELLSEESDTPAFKVLGPVEEVEY
FT                   IGLEVFDDIEKEVSFDVETCESFSHINNEKVSLDNMIYIVDKMSQVIIENEVPFCELDS
FT                   HAGDGDFGMSIAKGFKQLKREWKEILLEEHMSIGEFLNACSLVIMEYCGGASGPIWGSA
FT                   FRTAGKQVGTKTKLTVSEFAEMMQAAVRGIQATGERSFGRGAVVGDKTLIDALVPCADA
FT                   WTDCAKANNNFKEAFEKGAKAAVDGAKKTEEIVARMGRAGTVGDRSLGHPDAGAYGLGV
FT                   IFTEVSKAIK"
FT   gene            complement(534145..534588)
FT                   /locus_tag="CLL_A0539"
FT   CDS_pept        complement(534145..534588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0539"
FT                   /product="penicillin amidase"
FT                   /EC_number="3.5.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0539"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23765"
FT                   /db_xref="GOA:B2TK33"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029132"
FT                   /db_xref="UniProtKB/TrEMBL:B2TK33"
FT                   /protein_id="ACD23765.1"
FT                   /translation="MTNLINYMNVSQAQINDSYFGRIHLKPFGQAGGTMQLPGGYTSPE
FT                   RFVRTAYQKTHIKNPKNSSDAINSCFHIMESVTIPKGIVITNRNAYDYTKYTAFINTNP
FT                   CEYFFKTYDNTQVIKASLWDNCKDSSNPISLGKLERAVKFEEI"
FT   gene            534802..536619
FT                   /locus_tag="CLL_A0540"
FT   CDS_pept        534802..536619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0540"
FT                   /product="CspA"
FT                   /note="identified by match to protein family HMM PF00082"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0540"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25111"
FT                   /db_xref="GOA:B2TK34"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR017310"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR034045"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:B2TK34"
FT                   /protein_id="ACD25111.1"
FT                   /translation="MKLRLCPGYYSADSANFLVEYRGDLKNEIDNVSYVCGDILTNTIG
FT                   VISLPYEYLDQVLIDVPSIKFIDFRSMFVLQDVSPNSIDQILAIKKNPYLNLTGKGVLV
FT                   GIVDTGIDYLNKEFIREDGTSRVAAIWDQTIQDIKAESVYLGNIYSNEEINKAINAYKG
FT                   NEDPYAIVPSKDEIGHGTEMAGIIGARGYNGDFQGVANDCEFVIVKLLESLNFQKILQS
FT                   NNVKYTPIYNSSEIVAGIEYLKNFSVKMNKPMVIYLGVGTTEGSHDVNNLISRYLTSIA
FT                   SVRGIALVAGVGNEGAAEGHASGVIKNIGEIDTMELNIPREIKNFSFLIWVKRPNKMSL
FT                   NVISPTGEESSFIQAKRNKREEINFIFSNAKLKINYYMPEDFSGHEVIQVIFKDINPGI
FT                   WKFVLRGDYISDGEYNVWLQPVITLPENIKFLESNPFSTLTIPSTARKVVTVAYHGLVN
FT                   ESLIATSGKGFNTNGLINPDISTVGINILTTKALGETTLVSGSSAATAVIAGGCALLLQ
FT                   WGIIDGNDTTMYSTKIRSYLIYGAYRKPELTYPNRESGYGSFNLLGTFNVISRKYRKNM
FT                   KAINNDFIEYKINKLFIRIPREMISNVKI"
FT   gene            536606..538327
FT                   /locus_tag="CLL_A0541"
FT   CDS_pept        536606..538327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0541"
FT                   /product="CspA"
FT                   /note="identified by match to protein family HMM PF00082"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0541"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22159"
FT                   /db_xref="GOA:B2TK35"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR017310"
FT                   /db_xref="InterPro:IPR034045"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:B2TK35"
FT                   /protein_id="ACD22159.1"
FT                   /translation="MLRYKSNIPRNIFHNSEYKHYIVQYQGQINDEALQKEGYYIAIVN
FT                   DKYAIISTKKDKKINIDDVLFSEIVYIKGTETYTLEEISPIEASQVRSLQINLPLQLTG
FT                   KNVFVGIIDTGIDYLSDEFMTLDGETRIECIWDQTIITDKEDEIRLVPYGAFYTKEKIN
FT                   KAIKSYNEGKSPYDIVSSIDEIGHGTSMAGLIGATGKNPELKGVAPDCKFAVVKLIEDY
FT                   SNKATFDAKIPVYNITSIFSALEFLYEYALKKSEPMVIYLPLGSNSGNHRGNGILAEYI
FT                   ESISNSRGIVVVTGAGNERARGGHASGSILNAGESRSIELNVSPDQKYLWAEIWVAPPN
FT                   IMTVDIVSPSGENTGVIPAIINLSEDYNFIFEKTSVKITFYIPEVNTGDELIRIDFFNL
FT                   QPGIWKIKLIANMVLDGAYDIWIPQYGLSIGDTSLSPSDPFGTFTNPGGAISVITVAAY
FT                   NQNNNNIVNYSGMSFLDDYIDRVDIAAGGVNALTVAPNNKTKIVNGTSVAAAVVAGTCA
FT                   ILFEWGIIEGNDPYMYSQTMKTYLTRGTRKRPGDTYPNPQWGFGILDVLGIFSNMT"
FT   gene            539060..539136
FT                   /locus_tag="CLL_A0542"
FT   tRNA            539060..539136
FT                   /locus_tag="CLL_A0542"
FT                   /product="tRNA-Trp"
FT   gene            complement(539457..540524)
FT                   /locus_tag="CLL_A0543"
FT   CDS_pept        complement(539457..540524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0543"
FT                   /product="oxidoreductase, 2-nitropropane dioxygenase
FT                   family"
FT                   /note="identified by match to protein family HMM PF03060"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0543"
FT                   /db_xref="EnsemblGenomes-Tr:ACD21787"
FT                   /db_xref="GOA:B2TK36"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B2TK36"
FT                   /protein_id="ACD21787.1"
FT                   /translation="MKFNSLKIGNLIARLPIIQGGMGIGVSASKLASAVANAGGIGIIS
FT                   SAQLGYKDSNFNKDALGSNLNALKEHIITAKNNAPNGIIGVNIMVASSNYAEYVKTAIN
FT                   AGIDLIISGAGLPTMLPKIAKDSKVKLAPIVSSLKSAKVILKLWDRHDNIAPDLVIIEG
FT                   PKAGGHLGFKEEELRNENINFDDTVVQIIEETKKYSAKYNKEIPVVVAGGVYDGYDIAK
FT                   YLKLGADGVQMATRFVATYECDASQEFKDAYINCSKEDIDIVKSPVGMPGRAIKNDFIK
FT                   KTLLGRERITRCYNCLTPCDPKVTPYCISKALMNAVNGNINDGLIFCGENASRIDKMMS
FT                   VKELMNELEEDLINA"
FT   gene            540802..540987
FT                   /locus_tag="CLL_A0544"
FT   CDS_pept        540802..540987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0544"
FT                   /product="conserved domain protein"
FT                   /note="identified by match to protein family HMM PF00269"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0544"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22760"
FT                   /db_xref="GOA:B2TK37"
FT                   /db_xref="InterPro:IPR001448"
FT                   /db_xref="InterPro:IPR018126"
FT                   /db_xref="InterPro:IPR038300"
FT                   /db_xref="UniProtKB/TrEMBL:B2TK37"
FT                   /protein_id="ACD22760.1"
FT                   /translation="MSNSVLVPEAKQGLARFKNEVANELGVPFSNYNGDLSSRQCGSVG
FT                   GEMVKRMVEQYENSIQ"
FT   gene            541357..542058
FT                   /locus_tag="CLL_A0545"
FT   CDS_pept        541357..542058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0545"
FT                   /product="RNA polymerase sigma-70 factor"
FT                   /note="identified by similarity to SP:Q45585; match to
FT                   protein family HMM PF04542; match to protein family HMM
FT                   PF04545; match to protein family HMM PF08281; match to
FT                   protein family HMM TIGR02937"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0545"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23706"
FT                   /db_xref="GOA:B2TK38"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:B2TK38"
FT                   /protein_id="ACD23706.1"
FT                   /translation="MYNSYFNNFFGYEKIFNFINLNIKKDILNEKLNVIKQQINKICEI
FT                   NISKSKNEKENVENNVVNYNKLKKYSTEYKASKGDKQAFVQLITENKLSLYRVSKGILK
FT                   NEEQVEDAIQNTILKAYENIEKLKKHEYFKTWIIRILINECKIIIKKEKRVIYLEENNI
FT                   KSDYEDKYKDMDLERALNVIDKDLRELIVLYYFDDTPQKEIAKILNINEVTVRTRLLRG
FT                   RKKLYELLKLE"
FT   gene            542081..543451
FT                   /locus_tag="CLL_A0546"
FT   CDS_pept        542081..543451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0546"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0546"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24683"
FT                   /db_xref="GOA:B2TK39"
FT                   /db_xref="InterPro:IPR025436"
FT                   /db_xref="InterPro:IPR040680"
FT                   /db_xref="UniProtKB/TrEMBL:B2TK39"
FT                   /protein_id="ACD24683.1"
FT                   /translation="MDNEDFDKILKDKMKSKYNKVPGKIDLMINETLNSIKPKKHRKVI
FT                   SIAIICFCVLFTSIGIGITTTANALGLPVKDFIAEIMGLSHQYSDYASDVNITKESNGV
FT                   NFTITSVLYDGYKLKIAYKVEGTVVDSLEKLAKLSSFLNTKVSVNGKEVNLTSGYSKPI
FT                   NSNTIGGINILDINDSIYDNSFMGLTQLDILDTFSFNISIGDEVDGEKYKWDFNIPISS
FT                   EKIKSKIEEYSLNTIVGDYKIKKVIVTPITTYISGTFKNSKDKISIMNYIVLDDKGREV
FT                   KIDNCNEITGFGGAKFRCEILNNDSELKSLTFIPYKNKQHYSSEEMPSNDEEAKEFKKS
FT                   YAEKLQKKISLTLSEDGFNFTGDSELNITKVVREENKTKIYYETKYPTMVNLRLDISED
FT                   DLKMAINDVENIESIEPGIGVVILNGILENKTYNFIYDSPDKSLEVYEDKAVTIKLE"
FT   gene            543757..544887
FT                   /locus_tag="CLL_A0547"
FT   CDS_pept        543757..544887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0547"
FT                   /product="Ser/Thr protein phosphatase family protein"
FT                   /note="identified by match to protein family HMM PF00149"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0547"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22496"
FT                   /db_xref="GOA:B2TK40"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR041796"
FT                   /db_xref="UniProtKB/TrEMBL:B2TK40"
FT                   /protein_id="ACD22496.1"
FT                   /translation="MKKIKILHTSDLHFDTPFSGMKNNQSIKCREELKEVFEKIIKITL
FT                   ENNIDILLIAGDMFDNLSVNKSTLCFLKSCFEKIDKVKIFISPGNHDPYNEKSFYSIIE
FT                   WPKNVYIFKGNMEKVVLEDLKTIVWGAAFTNNYIYESLVKDVNRIDEYNNIMVIHGEIS
FT                   SKEKNEYNPITEEEIAKSDMDYIALGHRHKYIGVNKVLNTCYAYSGCPQGRGFDELGDK
FT                   GIIVLEISNRYCDYKFIKTSIRNYYEKEINIEGCFGYNQVKSKIFSCIDKENIKDNSYK
FT                   VILIGEINEEFNLREEIIEEMIKKDDYDIRVIDKTEVKIDMDELLKGYSIKSLFARKIY
FT                   EELEKAETEEEKEIIKLALKKGLQSLSGEEVRDYNY"
FT   gene            545300..547615
FT                   /locus_tag="CLL_A0548"
FT   CDS_pept        545300..547615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0548"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0548"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23268"
FT                   /db_xref="GOA:B2TK41"
FT                   /db_xref="UniProtKB/TrEMBL:B2TK41"
FT                   /protein_id="ACD23268.1"
FT                   /translation="MVNKDKEEEIMEKITNTYNSGEENVSFKKAIGVLEKGKKQIKTTR
FT                   KSGELDLLIQKKNILKEELWNAYTLSQENIENEEKLLNNKNEKEEIIKQLDSLELYKKY
FT                   IKKSNLQKDYLEIAQYLKKSEELKKKEEAINEYLNKNYTNINSEFLEELNKEYNRYLNL
FT                   NDIKQEKKRELNILQNKLNEKNNDFKEYKVLDSICEEDIKDKLYVLKIEQENLKEKLYK
FT                   AESIESAIETFKNDLKIRSNKVSNLEYIAKYRDEIEANINLYKDKLKELKYKLESYSSN
FT                   NESSSIQNIKKKMIFIYVLFAVFLVVLFISIFKEDFIIDILTVPLLVVLTKFYLKYSLI
FT                   LKEASIKEKNKISIQKLKNEVEKYEEKLNLYMQEINCKDYENLVKQLSQYDSYKIYKEN
FT                   IYISINSKVKELNDFNIEELKNKYNKNKKVLGSLFKLLECNSIEETINKINIYSKFKKE
FT                   LLPMEYKINSLALELKEIDFQLKDKEEYLRKKTKRMEFENVDILDFHIKIKEYKDKVNK
FT                   MREVKSNLNSVEETYKVLLKDRDIEQIKKEIKNILPDDLSYSYESEEEIEKEIKKSSSK
FT                   LLKTEKQIKDLEHLIEKRYLGKRSIAEIEEELYDVQEKILKCEKEFKALEVASLKLQES
FT                   FKELRSNIGPKLNDEVLKNFNYLTLKNYKDVKISEDYKLKVRDNSLLFDSEILSNGAKD
FT                   QLYLSLRLSFINMLFKNKKIPIFLDDAFIQYDDNRRERALKLLIKEDFNQVIFFTCQTI
FT                   EKNILDNISDNYNLIQLS"
FT   gene            547701..548603
FT                   /locus_tag="CLL_A0549"
FT   CDS_pept        547701..548603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0549"
FT                   /product="periplasmic solute binding protein family"
FT                   /note="identified by match to protein family HMM PF01297"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0549"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22792"
FT                   /db_xref="GOA:B2TK42"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR006128"
FT                   /db_xref="InterPro:IPR006129"
FT                   /db_xref="UniProtKB/TrEMBL:B2TK42"
FT                   /protein_id="ACD22792.1"
FT                   /translation="MKKRFFLALSCILMSLVIIGCSNSNSTNESNKVNNDSKKLQVMVS
FT                   IYPLKEFTEKIGGDKIEVTCLVPENMEPHDYEPKTKDFEKLMNSDIFIYNGLGMEHWID
FT                   SVNNVVSDDKVLKVNSSHGIDVRKEGELVDPHSWLSLIQVQKQCENIKDALISLDEVNK
FT                   DTYEENYNKFKKELQGLYDEYSAKFNDLSQKDFITGHAAFGYLCRDFGLTQKSVENLYG
FT                   EGEPTPKELENLVNFCKENNIKVIFSESLASPKVSETLASEVGAEVVPIYTLESNEDDM
FT                   SYLDAMKSNLDKIYKSLSK"
FT   gene            548878..550671
FT                   /locus_tag="CLL_A0550"
FT   CDS_pept        548878..550671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0550"
FT                   /product="MutS domain protein"
FT                   /note="identified by match to protein family HMM PF00488"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0550"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23946"
FT                   /db_xref="GOA:B2TK43"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR017261"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="UniProtKB/TrEMBL:B2TK43"
FT                   /protein_id="ACD23946.1"
FT                   /translation="MSKSNEFYKSTLKENVAQRQLLIKKINIISVIRLVIVLFMLVIDY
FT                   LLYKSNNYIAIIFITIVLLTMFIITALYHSNKLRDKNITDILIDINQRGIDRINGEFKK
FT                   FEDNGEEYLNYKHKFINDLNIFGSNSLFQLTNTTVTSGGKNRLSEILRIKQNINKNEIL
FT                   MRQEAIKELSSKIQWRQKFIVKGLMNRSSKFNLDDLISWGKEESKVSKINIIISCIFIV
FT                   TNFVSIFLALSAIVPWSFVLLVFMIDFVVLKMLTKSINKDIVLFNNIKQDIIGYSEILE
FT                   LIEDENFNSEYLKELKNKISHKEVSCKREMKKLANLAEWIGDSSYNAYYLVINILFFSD
FT                   VFIMNNLEKWRKTNGLRLMEWLNVMNEFDALNSISNIAFDHEEWVYPNILETSEVYGED
FT                   IGHPLIGDKAVKNSFSLNGIQKVALITGSNMSGKSTFLRSIGCNLVLSYIGAPVCAKMF
FT                   NCGIMSLYTCITTRDSLEESISSFYAEILRIKILIEACKRGEKVFFLLDEIFKGTNSRD
FT                   RHTGATVLINQLMKYGAIGLVSTHDLELCDLEKEDNKIINYNFREFYEDDKIKFDYILR
FT                   RGKSETQNAINLMKLAGIDFK"
FT   gene            550794..551699
FT                   /locus_tag="CLL_A0551"
FT   CDS_pept        550794..551699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0551"
FT                   /product="exonuclease family protein"
FT                   /note="identified by match to protein family HMM PF00929"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0551"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22971"
FT                   /db_xref="GOA:B2TK44"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B2TK44"
FT                   /protein_id="ACD22971.1"
FT                   /translation="MGYVIIDLEFNNLKNITKYEEDFFDKHKELENINLENEIIEIGVI
FT                   KVDKYMKQVAEMREYIKPSIFPVMNPVVTNITKITMDTLEKEGITFKQGMDKLKGMIKE
FT                   GDVICSWAKDDVAEIIINSNYHNYTDLSWIKEYLDLQEYSTKILGHKKAMGLKSALDEL
FT                   KIKVDNTKLHDALNDAEYTLLVFKHIYNSRIVKNYIINDIYSMPAIHVKDLENININEE
FT                   KLDIRCPKCNKKIDLKENFKLLNWRFVSIGICPKCNSKILSELIVKRTLQGKNAYNEVN
FT                   TILKEEAYLNYYYKLEKLNS"
FT   gene            551794..552231
FT                   /locus_tag="CLL_A0552"
FT   CDS_pept        551794..552231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0552"
FT                   /product="CBS domain protein"
FT                   /note="identified by match to protein family HMM PF00571"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0552"
FT                   /db_xref="EnsemblGenomes-Tr:ACD21992"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:B2TK45"
FT                   /protein_id="ACD21992.1"
FT                   /translation="MNIAFFLTPKNEVVYESEDATMRQVMEKMERYGYTAIPLIDKDGK
FT                   YVGTLTEGDLLWKLKNTPDLNFKNTECVNVSDISRRISHKSVSINADIENLISLAISQN
FT                   FVSVVDDNGIFIGIIKRSDIINYCFNEIKKNNEMKKKKEIV"
FT   gene            complement(552286..552942)
FT                   /locus_tag="CLL_A0553"
FT   CDS_pept        complement(552286..552942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0553"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0553"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24481"
FT                   /db_xref="InterPro:IPR009711"
FT                   /db_xref="UniProtKB/TrEMBL:B2TK46"
FT                   /protein_id="ACD24481.1"
FT                   /translation="MSKDLDFINDEKNYWGKIYTDIAYSISENAPFISEEKLKNKKYYV
FT                   KSSVLKDYIKLLDSTELDYKKGGLFKLFKSNNALDKVNNFKTENRQSFKELENCSKCAC
FT                   LNCTFDCKFKSCTSCRFGSYIKSCDKEKVNVRKHDNFIIDLTNNDTGNSSKYRVLATLE
FT                   NCINDKQYIILENVSSSNDKLVLYYYPEIRGDSYGEITDVDEFDFIVEAYQNADY"
FT   gene            complement(552953..553606)
FT                   /locus_tag="CLL_A0554"
FT   CDS_pept        complement(552953..553606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0554"
FT                   /product="phage shock protein A"
FT                   /note="identified by match to protein family HMM PF04012"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0554"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22385"
FT                   /db_xref="InterPro:IPR007157"
FT                   /db_xref="UniProtKB/TrEMBL:B2TK47"
FT                   /protein_id="ACD22385.1"
FT                   /translation="MGVFSRISNMFKAKVNNTLDEMENPIELLDQKLREMEEQLSKAKL
FT                   NSAQILGNVHEIEKNMNNAKKQSEDFESKVKLALSKGDEELAKKALSRKMEIDKKYDSL
FT                   KLSYDNSKVQADALKKSLKELEEEITKTRNYRDEAAARYSNAQASEKINEVLANVQTKN
FT                   NSIQIDNIERKIQRTESRAQGLSELKNLDDFDSQFEKLNEVDLDLELEKYKDNN"
FT   gene            complement(553644..554336)
FT                   /locus_tag="CLL_A0555"
FT   CDS_pept        complement(553644..554336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0555"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0555"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23393"
FT                   /db_xref="GOA:B2TK48"
FT                   /db_xref="UniProtKB/TrEMBL:B2TK48"
FT                   /protein_id="ACD23393.1"
FT                   /translation="MPLELISNVNHNTNNNLIAYADSNIDTSILKSTSTNLLAKSGGKS
FT                   SSGSKSSSKSSSSSKSSSKSSGNSSGFKSGSFNSSSSKSSSESNSTSSSSKKNTTDKSA
FT                   EGFKSGSFSDTKNNSNTDSSNIDKTTTDSNKASSGASKGFSSGSYSSTDNPNDSNSSST
FT                   NSSTQKSESKTYIPSSNSGGLGWYGGSRFFRPMYFGSPSSLIINALVLALIFFVILMLI
FT                   KLYLRRKR"
FT   gene            554899..556035
FT                   /locus_tag="CLL_A0556"
FT   CDS_pept        554899..556035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0556"
FT                   /product="putative 30S ribosomal protein S1 homolog"
FT                   /note="identified by match to protein family HMM PF00575"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0556"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22484"
FT                   /db_xref="GOA:B2TK49"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:B2TK49"
FT                   /protein_id="ACD22484.1"
FT                   /translation="MSDNTMKSFLEEYDVKRINKGQILKGKVLEVNEKEAVVNINYAFD
FT                   GLIAKEEVSIDDKNPMDVLSVDDEIDVYVISPNDGEGYVKLSLIKALVIKEKEQLQKAF
FT                   KEEKNVKVYVKDEIKGGLISYYGNIRVFIPASLASRNMIDLSALKNTELEVRIIELDFR
FT                   NNKVVASRKAIENEEYEKNRKVIWNSLKEGEKRTGVVKKLVKYGAFVDIGGVEGLVHIS
FT                   DLSWNRVNRPEEVVKENDKVEVYIGSIDVEKQKLSLVLKDINKEPWTLHTNEIKSGMIF
FT                   EGKVVKFASFGAFVEIFEGIEGLVHISEITDENIAKPSDALELNQKVKVKVLDFNKDTK
FT                   RLSLSIKDAVETSKEYLQYVDEEDGVSLGELFKNFKFE"
FT   gene            complement(556394..557812)
FT                   /gene="pyk"
FT                   /locus_tag="CLL_A0557"
FT   CDS_pept        complement(556394..557812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyk"
FT                   /locus_tag="CLL_A0557"
FT                   /product="pyruvate kinase"
FT                   /EC_number="2.7.1.40"
FT                   /note="identified by match to protein family HMM PF00224;
FT                   match to protein family HMM PF02887; match to protein
FT                   family HMM TIGR01064"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0557"
FT                   /db_xref="EnsemblGenomes-Tr:ACD21873"
FT                   /db_xref="GOA:B2TK50"
FT                   /db_xref="InterPro:IPR001697"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="InterPro:IPR015793"
FT                   /db_xref="InterPro:IPR015795"
FT                   /db_xref="InterPro:IPR015806"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018209"
FT                   /db_xref="InterPro:IPR036918"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:B2TK50"
FT                   /protein_id="ACD21873.1"
FT                   /translation="MQKTKMIFTIGPASDNEEIIRKFIGIGMNAARLNFSHGTYESHRE
FT                   KIELIKKVREDMGTPTAIVLDIKGPKIRTHNFVNDGVELKTGQEFCFVCGDELLGDEER
FT                   CSITYEELYKDIQVGGEILVDDGLLRFKVIAVEGKSIRCAVTVGGMIKNHKGVNVPNVI
FT                   IRLPSVTEKDIADIKFGCEMGVDFIAASFIRKASDVADVKKILSENNGKHIKVIAKIEN
FT                   QEGVDNIDSIIEQTDAVMVARGDMGVEIPIQKVPIIQKMIIRKCNDSGKFVVTATQMLD
FT                   SMIRNSLPTRAEASDICNAIFDGTDAIMLSGESASGNFPIEAATTMSEIAQEAEAHLDY
FT                   AHLTARLREPSLTDYSGAISYTACRTSNLLNAAAIVAATKSGATATMISRYRPKSPVIA
FT                   ITPYEQVRRSLALTFGVLPMLCEMYNTTDEILVEARRSVFELNFALPGDDIVVAAGMPT
FT                   TQTGGTNMLKIEKL"
FT   gene            558012..559466
FT                   /locus_tag="CLL_A0558"
FT   CDS_pept        558012..559466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0558"
FT                   /product="aminoacyl-histidine dipeptidase"
FT                   /note="identified by match to protein family HMM PF01546;
FT                   match to protein family HMM PF07687; match to protein
FT                   family HMM TIGR01893"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0558"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24991"
FT                   /db_xref="GOA:B2TK51"
FT                   /db_xref="InterPro:IPR001160"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="UniProtKB/TrEMBL:B2TK51"
FT                   /protein_id="ACD24991.1"
FT                   /translation="MRKFKQINCEKVFYYFNEISRIPRGSGNEKGISDYLLNFGKDLGL
FT                   EAIQDDALNIIIKKPASPGYEKSPTVIIQGHMDMVCEKNNEKVHDFTKDPIELVTKDDF
FT                   IYANGTTLGADDGIAVAYAMAILEDNTIEHPAIEVLLTSDEEAGMSGAMALKSGCLDGK
FT                   IVINLDSEDEGKLLVSCAGGIRTKSILNVQWENTPKNKKAFKLIIKGLSGGHSGSDIHL
FT                   GRGNSNKLIGRVLKNILNQMELNLVSLNGGSKNNAIPREATAELLIDADMEKEFLNIIS
FT                   TLREEFKNEFRVKDANIQLEIEELKENIEKVFSKESTDNVINLLYLYPNGINTVSSDIE
FT                   GLTESSTNIGVLTTKENHVEYDSAVRSSVFSLREEIVERIRCLTEILGGTVSNTAGYPE
FT                   WQYKEESKIREICKDVYKQMYNEEAEVVAIHAGVECGLFKEKLGDLDMISFGPDIFDAH
FT                   TPNEHMSISSVERVWSYLLEVLKEIK"
FT   gene            559714..560226
FT                   /locus_tag="CLL_A0559"
FT   CDS_pept        559714..560226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0559"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0559"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24031"
FT                   /db_xref="GOA:B2TK52"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B2TK52"
FT                   /protein_id="ACD24031.1"
FT                   /translation="MIDVEFYYKDFKITSVKKSDINILNEWIILNDKFSVDLFSLDKQL
FT                   FFRRFLEYYLTEEELFLKIEKDGEIYGVFKGRLELQEKSELFIWLYLIDSRFRNKGLGK
FT                   NMLMEILQYFKSKYYIDSFKVGVNLKNEKAIKFWNNVGFNKLRITKNFFEDNKYETSDL
FT                   LILNKIS"
FT   gene            560350..561006
FT                   /locus_tag="CLL_A0560"
FT   CDS_pept        560350..561006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0560"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF05036"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0560"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22153"
FT                   /db_xref="GOA:B2TK53"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:B2TK53"
FT                   /protein_id="ACD22153.1"
FT                   /translation="MKYTRYEYKKRGKMKTIFIILIIALLSILMGMYFSKFIFKGNLDI
FT                   SSFNQQEIVVSDQEFIALQFGYYSNKDNAEAGMTTIPSKYNSYIVEEEGHYRVVIGLYS
FT                   KEDGEKQLENLISQGINAVKINFSISKENLEQNKVAELINAFLKINSTLEDESVKSVKT
FT                   SDYKAWCLNITNKDNLNENNSLKEIGDYINNLPDEVDKNNVNEYLKYFYERLKNM"
FT   gene            561244..561810
FT                   /gene="maf"
FT                   /locus_tag="CLL_A0561"
FT   CDS_pept        561244..561810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="maf"
FT                   /locus_tag="CLL_A0561"
FT                   /product="septum formation protein Maf"
FT                   /note="identified by match to protein family HMM PF02545;
FT                   match to protein family HMM TIGR00172"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0561"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23107"
FT                   /db_xref="GOA:B2TK54"
FT                   /db_xref="InterPro:IPR003697"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2TK54"
FT                   /protein_id="ACD23107.1"
FT                   /translation="MKVILASASQRRQELLIRLCDNFDIIVSDFDEEKVVFENSIDEYV
FT                   QNIALGKAMDIKEKIKEDAIIISADTIVTLDDKILGKPKDEEDAFNMIKLLQGRSHKVY
FT                   SGVVVINTKKDLIIKNSVATEVVFSKMNDDEIRKYIKTKEPLDKAGAYGIQGIGGIFVE
FT                   EIRGCYYNVVGLPLNKLKTMLEEAI"
FT   gene            561854..562543
FT                   /locus_tag="CLL_A0562"
FT   CDS_pept        561854..562543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0562"
FT                   /product="DNA repair protein RadC"
FT                   /note="identified by match to protein family HMM PF04002;
FT                   match to protein family HMM TIGR00608"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0562"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22744"
FT                   /db_xref="GOA:B2TK55"
FT                   /db_xref="InterPro:IPR001405"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR020891"
FT                   /db_xref="InterPro:IPR025657"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2TK55"
FT                   /protein_id="ACD22744.1"
FT                   /translation="MENSLKIKDIPKKERPKEKLLSYGADTLNNSELLAIILRTGTKGE
FT                   NVLQLSNRLLSKFQGLDGVLEASLDDITSIKGIKEGKASQILALAELFKRFRTFKSADR
FT                   DIKIMSPNDLAMLINGEMSLLKQEILKVIFLNTKNIVIGTKDVFKGSLNTSIVHPREIF
FT                   KEAVNKSSAKIIISHNHPSGDPTPSKEDINITLRIKECGEIMGIQLLDHIIIGKNGFIS
FT                   LKEKGFI"
FT   gene            562562..563662
FT                   /locus_tag="CLL_A0563"
FT   CDS_pept        562562..563662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0563"
FT                   /product="Rod shape-determining protein MreB"
FT                   /note="identified by match to protein family HMM PF06723;
FT                   match to protein family HMM TIGR00904"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0563"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23725"
FT                   /db_xref="GOA:B2TK56"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:B2TK56"
FT                   /protein_id="ACD23725.1"
FT                   /translation="MAFFGSGKDMGIDLGTANTLVFAKGKGIVLREPSVVAMNNITRKP
FT                   LAVGSEAKLMIGRTPGNIVAIRPLRDGVIADFDVAQTMLKKLIEKVSTKNAFKSPRIIV
FT                   CYPSGITEVEKRAIEEATKLAGARDVILMEEPMAAAIGAGLPVSEPTGSMIVDIGGGTT
FT                   EVAIISLGGIVTSRSLRVAGDELDQAIISYIKKEFNLMIGERTSEQVKMEIGSAHVTKK
FT                   LNNSANVEVASEADEENDKVNEVVEFNDNDRTMEIKGRDMISGLPKVIEITESQIREAL
FT                   REPVCAIIEAIKTTLEKTPPELAADIMDKGIMLAGGGALLKGLDILINEETNMPVHIAE
FT                   APLDCVVLGAGKALEDFDKISKDQRG"
FT   gene            563666..564511
FT                   /gene="mreC"
FT                   /locus_tag="CLL_A0564"
FT   CDS_pept        563666..564511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mreC"
FT                   /locus_tag="CLL_A0564"
FT                   /product="rod shape-determining protein MreC"
FT                   /note="identified by match to protein family HMM PF04085;
FT                   match to protein family HMM TIGR00219"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0564"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25088"
FT                   /db_xref="GOA:B2TK57"
FT                   /db_xref="InterPro:IPR007221"
FT                   /db_xref="InterPro:IPR042175"
FT                   /db_xref="InterPro:IPR042177"
FT                   /db_xref="UniProtKB/TrEMBL:B2TK57"
FT                   /protein_id="ACD25088.1"
FT                   /translation="MKFLKNKLAVTIIVLSVTFLGLIVYTVKRENKTVIENGASNALKP
FT                   AQTLIYKATNRVKETLDFFLNFSEVKDQSKKLTVENEELKSKLIQYSNLEEENERLRSI
FT                   VNFAEQNNNYNYIGCDIIGYSGGNFLDGYIVNKGENEGIKNGMVVMAAQGLVGQVTSVG
FT                   SNWSIVQSLINENIAVSVMVESTRESTGYLKGYKDNKNRNLAKVYNLPIDSEIKEGDVI
FT                   ITSGVGMIYPKEIKIGEVTHVEEDKIKVMKSAVVKPYVDFNKLEELFIVSPKDTREIKY
FT                   "
FT   gene            564522..565013
FT                   /gene="mreD"
FT                   /locus_tag="CLL_A0565"
FT   CDS_pept        564522..565013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mreD"
FT                   /locus_tag="CLL_A0565"
FT                   /product="rod shape-determining protein MreD"
FT                   /note="identified by match to protein family HMM TIGR03426"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0565"
FT                   /db_xref="EnsemblGenomes-Tr:ACD21705"
FT                   /db_xref="GOA:B2TK58"
FT                   /db_xref="InterPro:IPR007227"
FT                   /db_xref="InterPro:IPR017225"
FT                   /db_xref="UniProtKB/TrEMBL:B2TK58"
FT                   /protein_id="ACD21705.1"
FT                   /translation="MEKLIVILISIGLAILDNSLIPFFSVQGVYPSILFTFAIAYSLVY
FT                   GREKAVLIGSISGILQDLFFFNIFGINSILNLLLCLLASIIGENIFKTKKVIPVISMFL
FT                   ITILKYMGIFIICYFLRVDMHILRSMGMALYNAIVMFFVYELIMKIPDEEYKKRPWRFK
FT                   "
FT   gene            565010..567925
FT                   /locus_tag="CLL_A0566"
FT   CDS_pept        565010..567925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0566"
FT                   /product="penicillin-binding protein"
FT                   /note="identified by match to protein family HMM PF00905;
FT                   match to protein family HMM PF03717"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0566"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23335"
FT                   /db_xref="GOA:B2TK59"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR002137"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:B2TK59"
FT                   /protein_id="ACD23335.1"
FT                   /translation="MIVNKPAKKKKISRYTILSVIMFVIFGVITMKLIYLQVLNYDNYK
FT                   ERANANSTRFVSEKAPRGKIYDQSGNLLATNIQTYTITYTKTTDADKVFYSTMKELFKV
FT                   LEENGEKFQDTLNLKLNDNNEIYFEYKTSDAESRKYEEIRFKRDRGLNDELHKTLFKDV
FT                   EELNDDQNQKINEELVKISPEDTFYYLVKAYNLIQCVDPNPSKEQSAAYSKMSGKEITD
FT                   ILLQNGYSLNDIRNFIVIKDSIKMQSFKGYKAVTIASNIKKDTAFIVYQKLNSLPGIDV
FT                   NLEPVRYYPNQELASSALGYVSSIDSSQSDKYELRGYDVSSDLIGKSGIESAFEEQLKG
FT                   VKGGTTVKVNSQGRVTEELFKLQSYPGNDVHLTIDSEIQYAAEHAFADGIKNIRENDYD
FT                   SDGSRYSNATRGALIAVDVNSGKILSLVSYPNYNPNVFTIPGTVSEEESKDYFSPDYEA
FT                   FANQLIQNKGLSKSVDQLFPKDQNGYREDVYDLYPKPFYNYATMGKIPPGSTFKVLTSI
FT                   AGLEEGVVTPSTTIVDMGVFKEHPETFGPAFGPECLIYTNSRATHGPTDVSKAIQVSCN
FT                   YYFYEVAYRMYMLNGKGIEGLNSIAKYAWEFGLGIPPDSKEKATTGIEIEENFGQTYNF
FT                   ESFKNQSVYYAKYELVDYLEKGDYKGAERNFVPFDIGFSEDDTEKIKEAKKSIKDKVEE
FT                   RLKKVEPGKGIEETEDEFSKSIKPYVKTIVDNSDKYKQSVSKWESEGKKFNADEQVAAV
FT                   TRIITRFTVNDKPAEITSPAQIVYAAIGQGINLYTPMQLASYVSTVANGGTRYKLHLVD
FT                   KITDNDGNVVQEFGSEVLNKVEMNQSTIDVVRNGMSSVNEAEGGTAARTFSSFPIPTAG
FT                   KTGTADFRENQKDIGRSPYATYISFAPADDPKIAVVAVVFDGGHGGEIAPAVKAVYEAY
FT                   FKDQLMGTNYASQSESFKKYVLENPFNTTKPAGNETTGTQN"
FT   gene            568298..568939
FT                   /gene="minC"
FT                   /locus_tag="CLL_A0567"
FT   CDS_pept        568298..568939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="minC"
FT                   /locus_tag="CLL_A0567"
FT                   /product="septum site-determining protein MinC"
FT                   /note="identified by match to protein family HMM PF03775;
FT                   match to protein family HMM TIGR01222"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0567"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24066"
FT                   /db_xref="GOA:B2TK60"
FT                   /db_xref="InterPro:IPR005526"
FT                   /db_xref="InterPro:IPR013033"
FT                   /db_xref="InterPro:IPR016098"
FT                   /db_xref="InterPro:IPR036145"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2TK60"
FT                   /protein_id="ACD24066.1"
FT                   /translation="MHKDGVLIKGNREGINATIDMEKFASFEDMLNMLIKKLSKGKHFY
FT                   KGTTLILNVNLSLIKKNDIKKLKESLLNEIELNEIIFEQLEQESNIQTKIFNGVYEGKT
FT                   KFIRRTVRSGQCLNYPGNIVIIGDVNSGAEVHAAGNIIVLGSLKGSVNAGNTGNKKSII
FT                   AAFLLEPEILKIADVITISPDGLDKPRYPEIAKVKDGTIIVEPYLANKYI"
FT   gene            568958..569755
FT                   /gene="minD"
FT                   /locus_tag="CLL_A0568"
FT   CDS_pept        568958..569755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="minD"
FT                   /locus_tag="CLL_A0568"
FT                   /product="septum site-determining protein MinD"
FT                   /note="identified by match to protein family HMM PF01656;
FT                   match to protein family HMM TIGR01968"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0568"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24691"
FT                   /db_xref="GOA:B2TK61"
FT                   /db_xref="InterPro:IPR010223"
FT                   /db_xref="InterPro:IPR025501"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2TK61"
FT                   /protein_id="ACD24691.1"
FT                   /translation="MGESIVVTSGKGGVGKTTTTANIGTALAALGKRVVVIDGDTGLRN
FT                   LDVLLGLENRIVYTLVDVLEGRCRLKQALIKDKRFQNLCLLPTAQTKDKDDISPQEMLR
FT                   IVNELKEEFDYVIIDSPAGIEQGFENAVIGADSAVIVVNPEITSVRDADRVIGKLDAKG
FT                   LEDHKLIINRLNYEMTKNGDMLDISDIIETLSVELLGVVPDDKNITVSTNKGEPIVLEN
FT                   ESYSGQAFRNIAKRITGEKVDIMNLQQESTGFFTSLKRLFKRK"
FT   gene            569768..570034
FT                   /gene="minE"
FT                   /locus_tag="CLL_A0569"
FT   CDS_pept        569768..570034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="minE"
FT                   /locus_tag="CLL_A0569"
FT                   /product="cell division topological specificity factor
FT                   MinE"
FT                   /note="identified by match to protein family HMM PF03776;
FT                   match to protein family HMM TIGR01215"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0569"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24807"
FT                   /db_xref="GOA:B2TK62"
FT                   /db_xref="InterPro:IPR005527"
FT                   /db_xref="InterPro:IPR036707"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2TK62"
FT                   /protein_id="ACD24807.1"
FT                   /translation="MGFFKGLSSRPTPKQVAKDRLKLILIHDRGEIPTDTLEKIRKEIL
FT                   GVISKYIEIQVDDVEISVNKSEDMEGENTSALIASIPIKSIRR"
FT   gene            570156..571289
FT                   /locus_tag="CLL_A0570"
FT   CDS_pept        570156..571289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0570"
FT                   /product="stage V sporulation protein E"
FT                   /note="identified by match to protein family HMM PF01098"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0570"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24756"
FT                   /db_xref="GOA:B2TK63"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR011923"
FT                   /db_xref="InterPro:IPR018365"
FT                   /db_xref="UniProtKB/TrEMBL:B2TK63"
FT                   /protein_id="ACD24756.1"
FT                   /translation="MLKNFKIDLRLIKEIDKTILVSTTLLVLYGILNVYMCTKGNYGFV
FT                   FVKQQLFWFVLSIIALYFFVAIDYTIIFNYVPIFYWGSVILLLAAKIPGIGVVVNGARG
FT                   WIRIGGVGFQPAELAKIGIIFMLAKKLDEMDGEINDIKNFFILVFYALIPVVFIVTQPD
FT                   MGMTMVCFFIVLGIFYIAGLDMKIIGGGLLSLILLIVIVWNSGLIQSYQKQRFTAFLNP
FT                   EAADATSGYHLTQSLIGIGSGGILGSRPSLKIDGTTGYAAQNVPEVQTDFIFAAISEQW
FT                   GLIGAIVLLTLYGFLIYKMISIARTSKDIFGSIICVGIISYFLFAIFQNIGMTIGLLPI
FT                   TGITLPLISYGGSSLLTTIMSIALVLNIGMRRKKIHF"
FT   gene            571338..571697
FT                   /gene="mgsA"
FT                   /locus_tag="CLL_A0571"
FT   CDS_pept        571338..571697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mgsA"
FT                   /locus_tag="CLL_A0571"
FT                   /product="methylglyoxal synthase"
FT                   /EC_number="4.2.3.3"
FT                   /note="identified by match to protein family HMM PF02142;
FT                   match to protein family HMM TIGR00160"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0571"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23522"
FT                   /db_xref="GOA:B2TK64"
FT                   /db_xref="InterPro:IPR004363"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR018148"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2TK64"
FT                   /protein_id="ACD23522.1"
FT                   /translation="MRIALIAHDKKKQEIIEFAKRNKEALEKYELLATGTTGKMISEET
FT                   GLNIKRYLSGPYGGDQQIGGRIAEGTIGLVVFFRDPLTAQPHEPDVSALLRVCDVHNIP
FT                   VVTNSGTADLIIKQF"
FT   gene            571716..571847
FT                   /locus_tag="CLL_A0572"
FT   CDS_pept        571716..571847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0572"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0572"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22666"
FT                   /db_xref="GOA:B2TK65"
FT                   /db_xref="UniProtKB/TrEMBL:B2TK65"
FT                   /protein_id="ACD22666.1"
FT                   /translation="MLEDYIEAGDINVSSAFFRILFKYVLIYVIGKNLYSNKRLCFK"
FT   gene            572266..573063
FT                   /locus_tag="CLL_A0573"
FT   CDS_pept        572266..573063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0573"
FT                   /product="putative cell wall endopeptidase, family M23/M37"
FT                   /note="identified by match to protein family HMM PF01551"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0573"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23259"
FT                   /db_xref="GOA:B2TK66"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:B2TK66"
FT                   /protein_id="ACD23259.1"
FT                   /translation="MSNYRSQYERYYKNMLNQKKGINSGQSMNLYNSKQAYTNDYRNSK
FT                   KKLGIINKIIFQCVASVILFVIIFSLKIIPIQKTKEVYMISKQYLTQDFSKDINYSYVI
FT                   SVINKVKSTDIKGKAVDCINLLKEKTNKVEKTSIKSKIKDNYCLPVLASYMKLQGDIQG
FT                   VLLEGKEGEQVICSMDGTVVKSTTNDEGQNILINHGDGIQTYYGMIKNSDIKEGDEIKK
FT                   GEYLGDCNKISNTEKTGVVFKFIYMGKEQDPTEYLDFSNLKNV"
FT   gene            573092..573967
FT                   /locus_tag="CLL_A0574"
FT   CDS_pept        573092..573967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0574"
FT                   /product="sterol-regulatory element binding protein"
FT                   /note="identified by match to protein family HMM PF02163"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0574"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25140"
FT                   /db_xref="GOA:B2TK67"
FT                   /db_xref="UniProtKB/TrEMBL:B2TK67"
FT                   /protein_id="ACD25140.1"
FT                   /translation="MKKWYSIFIIEILIIFAIVDFKSTLFISFFWIIAHEFIHILVAKK
FT                   FGCRFYNIKLNLSGTHAELGDIDELSEKKKLILYLSGPAFNIFMVVFLLFIQEYIDSNF
FT                   IKSSIDINLSLGIFNLLPAYPLDGSRVYEILLSKKFLYKEAKKITEIFSFIISIAFFIL
FT                   FTIMIFLHKINISLFLAAILMTYATIIEKEKTMYIIMGDMIKKSRKLEKYDYIENKSIS
FT                   VYYKKGLVNILTLVDKNKFNTFYVIDDDMKLLKIIHEDELLSALKKYGNITLEEYVKKN
FT                   IKNSYENNKM"
FT   gene            574179..576032
FT                   /locus_tag="CLL_A0575"
FT   CDS_pept        574179..576032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0575"
FT                   /product="radical SAM domain protein"
FT                   /note="identified by match to protein family HMM PF04055"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0575"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23945"
FT                   /db_xref="GOA:B2TK72"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR023862"
FT                   /db_xref="UniProtKB/TrEMBL:B2TK72"
FT                   /protein_id="ACD23945.1"
FT                   /translation="MNKISDDILFKVEKPCRYTGGELNQVIKDIKEVDIRFAFCFPDVY
FT                   EVGMSHLGSRILYHTINKRNDTYCERTFAPWPDMEEQLRKNNIPLFTLETQDSLGEFDI
FT                   LGFTLQYEMSYTNILNMLDMSGITIRASERGEDEPIVMAGGPCAYNPEPLYDIVDFFEI
FT                   GEGEEMMDDVLEVYKKYKGKGKKKEFLREISKIQGIYVPSLYDVTYKEDGTIKEFKPKY
FT                   DDVSKVVTKRIINNYTDVDFPENIIVPYTEVVHDRVVLETFRGCTNGCRFCQAGMIYRP
FT                   VREKKREDLVKQARELVKNTGYQEISLSSLSTCDYSEIEKLIKDLMEEHEPNKVGIALP
FT                   SIRVDAFSVDLIKEIQKVRKTGLTFAPEAGSQRMRDIINKGLTEERILEAAKSAFESGW
FT                   SKLKLYFMIGLPYENIEDCAAIGELAEKIVAKYYEIPKGVRNKGLRVTVSTSILVPKPF
FT                   TPFQWSAMERMEIVNKKINAVKDSIKTRAINYNYHEQKTSFMESLFARGDRRLCDVLIK
FT                   AFEKGAKFDGWSEYFKYDSWMESLEECNVDGEFYVYREREYSEILPWDFINIGVNRKYL
FT                   EIENEKAKREELTQNCRKGCTGCGVNVNFKEGECFEGAILN"
FT   gene            576016..576729
FT                   /locus_tag="CLL_A0576"
FT   CDS_pept        576016..576729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0576"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0576"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22920"
FT                   /db_xref="InterPro:IPR018768"
FT                   /db_xref="UniProtKB/TrEMBL:B2TK73"
FT                   /protein_id="ACD22920.1"
FT                   /translation="MRYLIKYTKEANVKFISHLDLMRTIQKNIRRAELPMEYSKGFNPH
FT                   MTMSIAQPLAVGVYSDGEYMDLVFAEEMNEKEIIDRLNSVSSSGIKFKEATKIPYVEGE
FT                   KKVPQGMALIDAARYTAKVPYENIENLENEVNELLNKSDWKTIKKSKKGEKEVDIKTMI
FT                   REFKFWIKDDYLIINMVINSGSREHLAPELVVKYIQERTSNVKTESFVDIKREEMYFLK
FT                   GERLLPLYKALEFNK"
FT   gene            576808..578256
FT                   /locus_tag="CLL_A0577"
FT   CDS_pept        576808..578256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0577"
FT                   /product="ribonuclease, Rne/Rng family"
FT                   /note="identified by match to protein family HMM PF00575;
FT                   match to protein family HMM TIGR00757"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0577"
FT                   /db_xref="EnsemblGenomes-Tr:ACD21942"
FT                   /db_xref="GOA:B2TK74"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004659"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019307"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:B2TK74"
FT                   /protein_id="ACD21942.1"
FT                   /translation="MKEIFIERKESLLRIGIRENDKLVESIVEENKNEPIIGEIYKARV
FT                   KKILPAINSIFVDLGLNKEGYLYYSEELKNNGIKKGEDILVEVVKEPINDKGAKLTTKV
FT                   SIPGKYAVLNCYDKGIHFSKRIVDEEKKKEILENLQELNDVGITIRTEAINTEVKTLKN
FT                   EIDRLYNEFLNINKSLKYSTQVKKVYGEDLSLFRILRNTIGQNPVKIYVDNKKDFEKIE
FT                   DFSKDENNVVLELYSGLRNIFDFYGLEKELLKLRHNKVNLPCGGYIIIDKTEAMYVIDV
FT                   NSGKNIKGRSFDKTILETNLEAAKEIGNQVKVRNLSGIIVIDFIDMRDKSQKNIVMKEL
FT                   EESLSSDKGNTKIFKFTELDLVQISRRRQGKSIYEYMEENCMTCNGHGRILKLSYIQDL
FT                   IKNEILRIKEDNTISSFYIEIDNVYKERIKGDLFNFLKEIDCLDKEIYLNYIENMEGFK
FT                   IEPLIFQSQKVNLEKYKITQFDTI"
FT   gene            578451..578762
FT                   /gene="rplU"
FT                   /locus_tag="CLL_A0578"
FT   CDS_pept        578451..578762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplU"
FT                   /locus_tag="CLL_A0578"
FT                   /product="50S ribosomal protein L21"
FT                   /note="identified by match to protein family HMM PF00829;
FT                   match to protein family HMM TIGR00061"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0578"
FT                   /db_xref="EnsemblGenomes-Tr:ACD21957"
FT                   /db_xref="GOA:B2TK75"
FT                   /db_xref="InterPro:IPR001787"
FT                   /db_xref="InterPro:IPR018258"
FT                   /db_xref="InterPro:IPR028909"
FT                   /db_xref="InterPro:IPR036164"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2TK75"
FT                   /protein_id="ACD21957.1"
FT                   /translation="MYAVLATGGKQYRVQEGDVIYVEKLDAEVDSTVELTEVLAVANDE
FT                   GIKVGAPVVEGAKVTAKVLAQGKQKKVIVFKYKAKKDYRRKNGHRQPYTKLVIEKIEA"
FT   gene            578767..579153
FT                   /locus_tag="CLL_A0579"
FT   CDS_pept        578767..579153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0579"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04327"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0579"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24918"
FT                   /db_xref="InterPro:IPR007422"
FT                   /db_xref="InterPro:IPR036764"
FT                   /db_xref="UniProtKB/TrEMBL:B2TK68"
FT                   /protein_id="ACD24918.1"
FT                   /translation="MIKVEINYKDNSIIGFVINNHALCGDRDFRNDVSLVGETFDMICN
FT                   SVSVLSQSIIIGLDEVLKLNSTYEISDGYLKLDLNDFDEKEIEQAQVLLQTFEKSLESV
FT                   ILSLDEMFGSKKRKEYITLLKEEV"
FT   gene            579158..579457
FT                   /gene="rpmA"
FT                   /locus_tag="CLL_A0580"
FT   CDS_pept        579158..579457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmA"
FT                   /locus_tag="CLL_A0580"
FT                   /product="50S ribosomal protein L27"
FT                   /note="identified by match to protein family HMM PF01016;
FT                   match to protein family HMM TIGR00062"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0580"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24605"
FT                   /db_xref="GOA:B2TK69"
FT                   /db_xref="InterPro:IPR001684"
FT                   /db_xref="InterPro:IPR018261"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2TK69"
FT                   /protein_id="ACD24605.1"
FT                   /translation="MLIMNLQLFAHKKGVGSSKNGRDSESKRLGVKSTDGEFVLAGNII
FT                   VRQRGTKIHPGNNVGRGKDDTLFAKIDGVVKFERVGKDKKKASVYPVNVEAIAE"
FT   gene            579960..581246
FT                   /locus_tag="CLL_A0581"
FT   CDS_pept        579960..581246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0581"
FT                   /product="GTPase, Obg family"
FT                   /note="identified by match to protein family HMM PF01018;
FT                   match to protein family HMM PF01926; match to protein
FT                   family HMM PF09269; match to protein family HMM TIGR00231;
FT                   match to protein family HMM TIGR02729"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0581"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23605"
FT                   /db_xref="GOA:B2TK70"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006074"
FT                   /db_xref="InterPro:IPR006169"
FT                   /db_xref="InterPro:IPR014100"
FT                   /db_xref="InterPro:IPR015349"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR035101"
FT                   /db_xref="InterPro:IPR036346"
FT                   /db_xref="InterPro:IPR036726"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2TK70"
FT                   /protein_id="ACD23605.1"
FT                   /translation="MFIDKAKVFIKSGKGGDGAISFRREKYVPLGGPNGGDGGDGGDII
FT                   LQVDTGITTLLDFKYKKKFIAEDGENGGASKCYGRAGQDLIIKVPMGTIIREEESNKVI
FT                   VDLSKKGQEFVLVRGGRGGKGNTKFATATRQAPHYAEPGMPGEELSIVLELKLLADVGL
FT                   LGFPNVGKSTLLSMTTKATPKIANYHFTTLKPNLGVVAIDGIEPFVMADIPGIIEGAAE
FT                   GVGLGIQFLKHIERTRLLVHIVDISGIEGREPFEDFVKINEELKKYSVKLWDRPQIVVA
FT                   NKSDLLYDDEVFEEFERKVKELGFAKVYKMSAATRDGVDEVIKEAARMLKEIPVKELEI
FT                   SEDEMYIPEEKRFTYVIDIEKDDEYNTYVISGTFVDRLLSAVNIHDADSLRYFHKVLKN
FT                   KGIMNELREMGIEDGDVVRLNDFEFEYLL"
FT   gene            581268..581564
FT                   /locus_tag="CLL_A0582"
FT   CDS_pept        581268..581564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0582"
FT                   /product="CRS1/YhbY domain protein"
FT                   /note="identified by match to protein family HMM PF01985;
FT                   match to protein family HMM TIGR00253"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0582"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23360"
FT                   /db_xref="GOA:B2TK71"
FT                   /db_xref="InterPro:IPR001890"
FT                   /db_xref="InterPro:IPR017924"
FT                   /db_xref="InterPro:IPR035920"
FT                   /db_xref="UniProtKB/TrEMBL:B2TK71"
FT                   /protein_id="ACD23360.1"
FT                   /translation="MLTGKQRAYLRGLGSNMAPIFQVGKNGIEENFLTQVAQALEKREL
FT                   IKIKVLENSGLDTRETSDLICKALRCEGVQAIGNKMVLYKKSKNKPKIEIPTK"
FT   gene            581874..582476
FT                   /gene="nadD"
FT                   /locus_tag="CLL_A0583"
FT   CDS_pept        581874..582476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadD"
FT                   /locus_tag="CLL_A0583"
FT                   /product="nicotinate-nucleotide adenylyltransferase"
FT                   /EC_number="2.7.7.18"
FT                   /note="identified by match to protein family HMM PF01467;
FT                   match to protein family HMM TIGR00125; match to protein
FT                   family HMM TIGR00482"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0583"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22384"
FT                   /db_xref="GOA:B2TKI3"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR005248"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2TKI3"
FT                   /protein_id="ACD22384.1"
FT                   /translation="MKRYGIIGGTFDPIHYGHLYIAYEAKKQLNLDNVIFMPAGNPPHK
FT                   EGKKVTDSLLRYKMVKKAIEDFSGFSISDYEIDKKGFSYTYETLEHFKNNDVELFFITG
FT                   ADCLMDIETWERADTILSLCNLVVFSRGGFSNKNLIKQKEYIEKKYSVNIIVLPLKRLE
FT                   ISSTDIRKRINNKERVDFFVPRSIIKLIEENSLYKEE"
FT   gene            582481..583056
FT                   /locus_tag="CLL_A0584"
FT   CDS_pept        582481..583056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0584"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01966;
FT                   match to protein family HMM TIGR00488"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0584"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22413"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR005249"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:B2TKI4"
FT                   /protein_id="ACD22413.1"
FT                   /translation="MISIEEMKLYLKDNLKQNRYNHTLGVVETAKKLAEINGISIEKAE
FT                   IAAFAHDVAKNLSLEKMQSIIDKNNLELTNTEKENSNLWHSIIAPIEARNKLEIDNEEI
FT                   LDAIRWHTTGKENMSILTKIIYIADMIEPGRDFPGVEKIRQTTFENLDAGVLLGLTESM
FT                   KDLLNRNLIIDLNTIKARNYFLLKDIIF"
FT   gene            583126..584421
FT                   /locus_tag="CLL_A0585"
FT   CDS_pept        583126..584421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0585"
FT                   /product="membrane-bound protein LytR"
FT                   /note="identified by match to protein family HMM PF03816;
FT                   match to protein family HMM TIGR00350"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0585"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24945"
FT                   /db_xref="GOA:B2TKI5"
FT                   /db_xref="InterPro:IPR004474"
FT                   /db_xref="InterPro:IPR027381"
FT                   /db_xref="UniProtKB/TrEMBL:B2TKI5"
FT                   /protein_id="ACD24945.1"
FT                   /translation="MGKKRIKRSKRSNKSNKSNKNKTENIKMKNLLEEGILLILALVIT
FT                   FTIVVIGSGFLFLGKINKNDMIEPNKVSMSKPVNILLLGTDIGDPSQPNNKAIKRTDTI
FT                   MVLNYNPDNKNLQVVSIPRDTLIDVNGRNLKINSAYAIGGEKRVKSEVEKLLNISVNYI
FT                   AKIDYNAFREFIDAIGGIKMQIERNMIYDDEGQNLHINFKKGEVVKLDGKKAEEFFRWR
FT                   KNNDGSGFANGDLDRIENQQKFMSKVIEKCTSPMIIFKIPNIIKALGDNIDTNMPPFKV
FT                   ISYGLKFARINSEKIDMKIAQGTPKDINGESFLVFDKNLNKDIITSLSSTGKGTEDVSK
FT                   SDITIKVFNGTKITGLAATLRDELTKVGYTRVDVGNIPERNESSILTNNENIAGKVKSS
FT                   IGISKIEKKPDKPEYKDYDVVIILGKDFKKFE"
FT   gene            584446..585342
FT                   /locus_tag="CLL_A0586"
FT   CDS_pept        584446..585342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0586"
FT                   /product="pseudouridine synthase, RluA family"
FT                   /EC_number="5.4.99.-"
FT                   /note="identified by match to protein family HMM PF00849;
FT                   match to protein family HMM TIGR00005"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0586"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23955"
FT                   /db_xref="GOA:B2TKI6"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:B2TKI6"
FT                   /protein_id="ACD23955.1"
FT                   /translation="MSILQDKVSNIDGKIKIREYLKEKLDLSTRLIRSASKDQRIYVNN
FT                   SAVRMNYMIKNGDIIKIDLNRNESQNINPEKIDLDIVYEDEDVLVINKQPFIIVHPTKN
FT                   FQSGTLANGILYYFQETNQNCIVRLVSRLDMNTSGLIIIAKNQFSHSRLSKDMKEKLQK
FT                   RYLAIVHGNLEEKEGTIDLPIYKPEGIEYGSMRVVDERGQRSITHYKVIESFEGGDLVE
FT                   CLLETGRTHQIRVHLSHLGHPIYGDELYGVGAEENLIKRQALHAYGLNFASPRSLKELS
FT                   LRAELPDDMKELLEKIK"
FT   gene            complement(585356..586687)
FT                   /locus_tag="CLL_A0587"
FT   CDS_pept        complement(585356..586687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0587"
FT                   /product="serine-type D-Ala-D-Ala carboxypeptidase"
FT                   /note="identified by match to protein family HMM PF00768;
FT                   match to protein family HMM PF07943"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0587"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22109"
FT                   /db_xref="GOA:B2TKI7"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR012907"
FT                   /db_xref="InterPro:IPR015956"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="InterPro:IPR037167"
FT                   /db_xref="UniProtKB/TrEMBL:B2TKI7"
FT                   /protein_id="ACD22109.1"
FT                   /translation="MENVMKSHLKTLIFFLFIFLVSSINVMAVSSPPEINAEGSVLMDA
FT                   STGEILFSKNPDKVLEPASTTKVMTAILTLENCDLNEEVVVTEDFTKIDGTTIGLLKGD
FT                   IVTVKDLLLGLLLESGNDAANALACHVSSSIDKFAVLMNKKATEIGAVNTHFKNPSGLP
FT                   DPEHLTTAHDLALIMNEAIKNDKFLELSKVMTYEIPIKNDSSRTIWINNKNHMINKNSM
FT                   YYYQYTLTGKNGYTTKSNHTYTVAAENNGHILVASYLNALDKDKNFEDMRTVFNYGFNN
FT                   FYFSNIYKKGQEIDSIKLHNGLTVPLIASKDVNCVVPNEDKDKLNTYIKFENKNLNRLS
FT                   FNEGDVILKGTVYLNDKELCKLDLCAGISRNYSIKEDIYSFIEKNKRNLIIGAIISGVT
FT                   LLIILTLAIEYNKKKNRKKRLLEITTSIPKIQDDQLKKRRRRQD"
FT   gene            586892..587512
FT                   /locus_tag="CLL_A0589"
FT   CDS_pept        586892..587512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0589"
FT                   /product="DNA-binding protein, ComEA family"
FT                   /note="identified by match to protein family HMM PF00633;
FT                   match to protein family HMM TIGR00426"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0589"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24567"
FT                   /db_xref="GOA:B2TKI9"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004509"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="UniProtKB/TrEMBL:B2TKI9"
FT                   /protein_id="ACD24567.1"
FT                   /translation="MINKANKKIGIIAILVIILVVCLSTYIKSGKDKLVKNDNTSIFVE
FT                   EENPNINEDEKIEKLKDKNIVVEIKGEVKKPDVYQLNDESIVKDVIEIAGGLTEEADIS
FT                   NINRAQKLKNHELIYIHNKSEVKDNVSYAQNTVTTSNNSGKININCAQLEELKNLNGIG
FT                   EAKAKRIIEYRENIGAFNSIEDIKNIDGIGEKSFEKLKDQIDV"
FT   gene            587695..588399
FT                   /locus_tag="CLL_A0590"
FT   CDS_pept        587695..588399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0590"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0590"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23743"
FT                   /db_xref="UniProtKB/TrEMBL:B2TKJ0"
FT                   /protein_id="ACD23743.1"
FT                   /translation="MSKKICTIIMTLMITTSLIGCISIDSNKAEDKNNASTATEVKNSD
FT                   ENLQGSWAEDYSLEKTKGYFKDYLSKMEKVTEELGMKYSKEDVVKENDGSTISVNSIYF
FT                   DNEKPDPNKIESMYFGMKIFGEDLSSGEIELKLSLNFDSAEVIKSGNFDLGNTSFSKYI
FT                   AAFTGQSSRDYSEINKKIIDGLKSEKAEGIIENSIDGLKEEIRFNKNYIVYKLSTKTYD
FT                   FKNPNPTLENNN"
FT   gene            588425..588802
FT                   /locus_tag="CLL_A0591"
FT   CDS_pept        588425..588802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0591"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0591"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23124"
FT                   /db_xref="GOA:B2TKJ1"
FT                   /db_xref="InterPro:IPR010432"
FT                   /db_xref="UniProtKB/TrEMBL:B2TKJ1"
FT                   /protein_id="ACD23124.1"
FT                   /translation="MSKEENNINEKEDTILNDTKAKEETNNETKELLMGETNENNSNEE
FT                   EKPSLLKKIFASVIDQLVTISISGIALIIFDFIIGFMGYKVSMPIGILIIFYFIVNALY
FT                   IPLMEKTKLRKSIGRKVINIK"
FT   gene            588819..590171
FT                   /gene="rumA"
FT                   /locus_tag="CLL_A0592"
FT   CDS_pept        588819..590171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rumA"
FT                   /locus_tag="CLL_A0592"
FT                   /product="23S rRNA (uracil-5-)-methyltransferase RumA"
FT                   /EC_number="2.1.1.-"
FT                   /note="identified by match to protein family HMM PF01938;
FT                   match to protein family HMM PF05175; match to protein
FT                   family HMM PF05958; match to protein family HMM TIGR00479"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0592"
FT                   /db_xref="EnsemblGenomes-Tr:ACD21803"
FT                   /db_xref="GOA:B2TKJ2"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030390"
FT                   /db_xref="UniProtKB/TrEMBL:B2TKJ2"
FT                   /protein_id="ACD21803.1"
FT                   /translation="MKRGSEVKVKIEKTQFPSTGIGYLEDKPVYVKNTYPGQVVTGRVK
FT                   KNRKEYAELKLTGVEERADYEIDAICPHFGSCGGCSSQTLSYEKQLQVLEDEIKDLFKE
FT                   ADVTTGEFLGVLGSSEQWEYRNKMEFTFGDEEKGGDLSIGMHMRGKSFGIMTVDHCKIV
FT                   DEDYRRIIRLTADYFGKQDLPYYRVMKREGYLRHLVIRKAQNTGEILVNLVTTTQIDFD
FT                   LSEYVELLKSQDYKGTLVSILHTENNSFSDAVIPEKVNVLYGRDYIQEKLLGLDFKISP
FT                   FSFFQTNTKGAESLYSLVRDFMGSSENKVVFDLYCGTGTIGQIVAPNAKKVVGIELIEE
FT                   AVEAAKENAKLNGLNNCEFLAGDVAEIIKTVKDKPDIIILDPPRSGVHPKALDYVIKFN
FT                   APEIVYVSCNPKTLVTDLKVLIERGYKIIQTQVKDMFPNTPHAETIVKLIK"
FT   gene            complement(590240..591397)
FT                   /locus_tag="CLL_A0593"
FT   CDS_pept        complement(590240..591397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0593"
FT                   /product="phage integrase family protein"
FT                   /note="identified by match to protein family HMM PF00589"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0593"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24736"
FT                   /db_xref="GOA:B2TKJ3"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR028259"
FT                   /db_xref="UniProtKB/TrEMBL:B2TKJ3"
FT                   /protein_id="ACD24736.1"
FT                   /translation="MQGSVRKRGNKWYYYFDVAKSDGKRKKIERAGGNTKKEALEALRK
FT                   ALSEYDNVGTIITESNISVSDYFDYWFNEYVLINCKYSTQVSYKRLIKNHLKPSLGIYQ
FT                   LKKITSSRLQELINLKYRNGFSKNYLGNLYGVLSGAFKYAVYPSNFIKENPMTFVKMPK
FT                   YNTKLINNPDDLKIITLEDYNNILKRFPYGSNMYIPLQISFNTGLRAAEVMSLTWDCID
FT                   FENQTLRVEKILYRNEFKKWVFGSPKTHSSYRTIKIGNTLLSLLKKFHKDQKENKLRYG
FT                   PFYVKHDYDFVCLKENGELLTTDSLKYLSKVVNYELGIDFKFHSLRHTHATMLLEAGAN
FT                   IKDIQQRLGHSKLATTMDVYSHVTKKMSQDSVRLFEEAIKKLPPS"
FT   gene            complement(591381..591554)
FT                   /locus_tag="CLL_A0594"
FT   CDS_pept        complement(591381..591554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0594"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0594"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25041"
FT                   /db_xref="UniProtKB/TrEMBL:B2TKJ4"
FT                   /protein_id="ACD25041.1"
FT                   /translation="MIWNNVLKITFGNKIVYEKSLYKKSICIQNTKTNFNEKNTSKCKT
FT                   LNMEVLKHARKC"
FT   gene            complement(591739..592113)
FT                   /locus_tag="CLL_A0595"
FT   CDS_pept        complement(591739..592113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0595"
FT                   /product="putative DNA-binding protein"
FT                   /note="identified by match to protein family HMM PF01381"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0595"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22761"
FT                   /db_xref="GOA:B2TKJ5"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B2TKJ5"
FT                   /protein_id="ACD22761.1"
FT                   /translation="MSKFPERLKELRESKDLLSKDFAKIMNVEPATITNWEKGNRFPKD
FT                   DVLIKIADYFDCSIDYILGRTDNPCAKIYLGKLHDKTVELEIDKDYPYKLTPKDVDNML
FT                   KQLDAVGLDIEKLINNSKNK"
FT   gene            592313..592501
FT                   /locus_tag="CLL_A0596"
FT   CDS_pept        592313..592501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0596"
FT                   /product="conserved domain protein"
FT                   /note="identified by match to protein family HMM PF01381"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0596"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23062"
FT                   /db_xref="GOA:B2TKJ6"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B2TKJ6"
FT                   /protein_id="ACD23062.1"
FT                   /translation="MYSRLKGLMVENSITQQNLAKILDISISTLNFKINGKSDFTIMEA
FT                   KKVSRILNKSIEEVFNI"
FT   gene            592553..592762
FT                   /locus_tag="CLL_A0597"
FT   CDS_pept        592553..592762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0597"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="identified by match to protein family HMM PF01381"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0597"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22516"
FT                   /db_xref="GOA:B2TKJ7"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B2TKJ7"
FT                   /protein_id="ACD22516.1"
FT                   /translation="MTRVLKTKEFRELKNLTVSKLSYKSGVAIGYITELENGKYKNPSL
FT                   QIICKLSKALNITPNDLIDKNLWN"
FT   gene            592779..593000
FT                   /locus_tag="CLL_A0598"
FT   CDS_pept        592779..593000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0598"
FT                   /product="DNA binding domain, excisionase family protein"
FT                   /note="identified by match to protein family HMM TIGR01764"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0598"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22639"
FT                   /db_xref="GOA:B2TKJ8"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:B2TKJ8"
FT                   /protein_id="ACD22639.1"
FT                   /translation="MEAVLYTVSEAAELLKINRNSVYDLLKHNVIKGLKLGSLKITRNE
FT                   LLKFLEENNGKDLSNLKEIKELNFDKVD"
FT   gene            593078..593710
FT                   /pseudo
FT                   /locus_tag="CLL_A0599"
FT                   /note="putative phage replisome organizer; this gene
FT                   contains a premature stop which may be the result of a
FT                   sequencing error; identified by match to protein family HMM
FT                   PF09681; match to protein family HMM TIGR01714"
FT   gene            593852..594070
FT                   /locus_tag="CLL_A0600"
FT   CDS_pept        593852..594070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0600"
FT                   /product="DNA replication protein DnaD"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0600"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22841"
FT                   /db_xref="InterPro:IPR006343"
FT                   /db_xref="InterPro:IPR034829"
FT                   /db_xref="UniProtKB/TrEMBL:B2TKK0"
FT                   /protein_id="ACD22841.1"
FT                   /translation="MAIDKALEVNKTDMTYINGILKNWKREGYPSDEEDHKSNNNKSGS
FT                   ELKFDNFEAREYDYDSLEKRLLGWENE"
FT   gene            594253..594555
FT                   /locus_tag="CLL_A0601"
FT   CDS_pept        594253..594555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0601"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0601"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22126"
FT                   /db_xref="GOA:B2TKK1"
FT                   /db_xref="UniProtKB/TrEMBL:B2TKK1"
FT                   /protein_id="ACD22126.1"
FT                   /translation="MNNLKHTKIGITSFILISIVVINTISSVVCPLKMPYVNPSAIEIL
FT                   GMTMISLISFILGLIAMFQKGSKKILPKITVIISGIFLIPAIAGLVKGIFLRLTI"
FT   gene            596220..596861
FT                   /locus_tag="CLL_A0602"
FT   CDS_pept        596220..596861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0602"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0602"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24622"
FT                   /db_xref="UniProtKB/TrEMBL:B2TKK2"
FT                   /protein_id="ACD24622.1"
FT                   /translation="MRIEKIRVIQLKNEYIKTFEGQDKLKNIVENIINCDEKVEYSEDD
FT                   FRISDIAMEAYYRDLYLDENSKNQKIFQDLFLGLKDFKYTYSRWESEMKIKNPTKEQIA
FT                   KHIIDTWFYEISPDDTEEIENIDQSQAYVFHEDVDLKCIPADRVKEIILDFDKENIINT
FT                   ANNLKKELNSCGIFVEKFDDDDRKLIDDIMKIFEKSVEENTDILYIINYL"
FT   gene            complement(597233..597433)
FT                   /locus_tag="CLL_A0603"
FT   CDS_pept        complement(597233..597433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0603"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0603"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23450"
FT                   /db_xref="InterPro:IPR024419"
FT                   /db_xref="UniProtKB/TrEMBL:B2TKK3"
FT                   /protein_id="ACD23450.1"
FT                   /translation="MEINELVSLIGNVGFPVAVSAYLLIRLEKQLNSLSTSINKLNTII
FT                   STKLGVVIDTNKSNDDSNNVA"
FT   gene            complement(597874..598350)
FT                   /locus_tag="CLL_A0604"
FT   CDS_pept        complement(597874..598350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0604"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0604"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23449"
FT                   /db_xref="UniProtKB/TrEMBL:B2TKK4"
FT                   /protein_id="ACD23449.1"
FT                   /translation="MARKKEFKIEKDDIAYEEEVEEFGFTDYIPTGENSIQLFSIEEDS
FT                   GPENENINDNNSILKTKEEVNTKMEQKTISINNNISSNPLLFDNRNTPIANGAAPPIDG
FT                   EAANIKRSYTLRKSTVRKINELKSIHPDIGICVSTIVDIAIDYYHTHIVNNNMD"
FT   gene            598615..598857
FT                   /locus_tag="CLL_A0605"
FT   CDS_pept        598615..598857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0605"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0605"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22498"
FT                   /db_xref="UniProtKB/TrEMBL:B2TKK5"
FT                   /protein_id="ACD22498.1"
FT                   /translation="MIKNNIKICSEDSDCFDKKQIALAIRNATLNDCLECSLIEGVIIS
FT                   GCEACSLKFICDGIEDLSDEYIEHTTKVVSTFNFD"
FT   gene            599847..601277
FT                   /locus_tag="CLL_A0606"
FT   CDS_pept        599847..601277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0606"
FT                   /product="DNA mismatch repair enzyme MutH"
FT                   /note="identified by match to protein family HMM PF02976"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0606"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25118"
FT                   /db_xref="GOA:B2TKK6"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011337"
FT                   /db_xref="InterPro:IPR037057"
FT                   /db_xref="UniProtKB/TrEMBL:B2TKK6"
FT                   /protein_id="ACD25118.1"
FT                   /translation="MYYKYDRSNKESIENYARRLLNKSLKDLDENNKEHKFNNKKSKGR
FT                   LGQTVEEEYFGYKVNSRQEADFNEVGVELKVCPIRTIKAKPKSNSIREQIGYSAKERIV
FT                   LSIIDYFKLNEETWENNSIMKKCKELLLMFYMNEKNIPKEELVFKIISLWTPSEQDLKI
FT                   IENDWNTIALKVKKGKAHEISEGDTMYLGACTKGSTAEKSKRGQPNSDVMAPQRAFSYK
FT                   RQYVDYIIEELLQKEQVRKSKAIKSLSDEHMLFYEKIYNVFNRILNKSVSEIISLYSID
FT                   RERKAKNYIRLIVDDVCKKVFGDKLENFEEFKKANIELKTIFLKLNGMPKESMSFEQID
FT                   YCEIVNEEWETSTIRDKFENKKHLWIIFKSKVNFEKQSELSLNDIVLDNVMFWNMPISD
FT                   LDSSMYKVWLDTTDKIKQGVYNDFIKISDGEIAHIRPKGQNSKDLTSTPQGTEERKKCF
FT                   WLNAKYIKEQIEKVNSIF"
FT   gene            601302..602426
FT                   /locus_tag="CLL_A0607"
FT   CDS_pept        601302..602426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0607"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0607"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23884"
FT                   /db_xref="GOA:B2TKK7"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/TrEMBL:B2TKK7"
FT                   /protein_id="ACD23884.1"
FT                   /translation="MAGYIVSLNDKDSLKYCIENGVYSTNLSSPKNNLWKIHHEGTFAD
FT                   YFGMKEGDNIYFFIDRKIYGIGELIKEKYDCKYWNYIDADKPENYEYNNIKDTMILDKE
FT                   ENLNNRCFCIFKPYPNFFINGVDMDDVLASNPSKFRMLRAFWKLSFVKIDEEENSALKD
FT                   IILKRNEEYIFKNDDNSFKYNRDLQKQLLKKINKSYIMNSKNILKSCSKNEIIKHEMAI
FT                   ESGIMDILSNDENTIFGQWDYISHQVIASPFKPIDYMDKMDVFGFRYINKFNTISKYLV
FT                   MELKKDAATTDAIDQTMKYVDWINSEYAFGDYGMIQAFLVAYDFSDEVIKYKNSVCIRN
FT                   YTKGRRPTIADTWTCIRLMKYRFKNNKLNFYEVK"
FT   gene            602625..603899
FT                   /locus_tag="CLL_A0608"
FT   CDS_pept        602625..603899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0608"
FT                   /product="DNA-cytosine methyltransferase family protein"
FT                   /note="identified by match to protein family HMM PF00145;
FT                   match to protein family HMM TIGR00675"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0608"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24205"
FT                   /db_xref="GOA:B2TKK8"
FT                   /db_xref="InterPro:IPR001525"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR031303"
FT                   /db_xref="UniProtKB/TrEMBL:B2TKK8"
FT                   /protein_id="ACD24205.1"
FT                   /translation="MKYTICELFAGVGGFRVGFEKSSSDWKTVWANQWEPSKKVQHAFE
FT                   CYRSHFETSGGINEFSNIDISQVPEEHIPGHTVLVGGFPCQDYSVASTGAKGIQGKKGV
FT                   LWWEIERILKAKRPPFMILENVDRLLKSPSKQRGRDFGIIISCLAKLGYSVEWRVINAA
FT                   EYGFQQRRRRTFIFAVHNTTNYYEELNKQSVYEELQHAGFFSSIFNIETFKEEHINSID
FT                   IKEKYDLDILEISNNFTFEFKNSGIYRNGLIYTVETTPSNLLAEHQLTLRDILEEHVDE
FT                   KYILSEGDLEKWTYLKGPKAIERTSKDGHKYTFREGGIAFPDPIDKPARTMLTSEASKN
FT                   RSTHVVSDIETGKLRILTPLECERINGFPDNWTNTGMTQSFRYFCMGNALVVNLIENMG
FT                   RKLHKIVSNEGNKYIKEIAVTNIIE"
FT   gene            604093..604839
FT                   /locus_tag="CLL_A0609"
FT   CDS_pept        604093..604839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0609"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0609"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24942"
FT                   /db_xref="UniProtKB/TrEMBL:B2TKK9"
FT                   /protein_id="ACD24942.1"
FT                   /translation="MDIYEFLANELINLVPNNKFICLNNFGKNRWFGFIYRGYEGLMSK
FT                   PRENSNNVKRKKEGYFDIYVCTGDRYKERNGYKPVTHYNAFQDLLENSNLENCYRIWRG
FT                   ESPMEITSNLEEQESLCTLALLMFEQELNWGNEIWQRQTNFPPRIESPYQRPRDMIMGF
FT                   LGIVFYYRDVDAILNWKYKKINGELTKTTATFGQGYRYLDNDYRRFFEELQLDNAAMPL
FT                   MIEQCLEDFRNKVKLVPDNKYYIDKQ"
FT   gene            604855..606156
FT                   /locus_tag="CLL_A0610"
FT   CDS_pept        604855..606156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0610"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0610"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23559"
FT                   /db_xref="InterPro:IPR024975"
FT                   /db_xref="InterPro:IPR041409"
FT                   /db_xref="UniProtKB/TrEMBL:B2TKL0"
FT                   /protein_id="ACD23559.1"
FT                   /translation="MIIKFEDLQDANLIVNGIYKSGNKGNYSDEALSKLMRCENSCGFR
FT                   KKGSLKNPNLQYVVLYSTGKQKDWKNILNVDTSEFIYYGDQNKVNKEIHDTPKKGNEVL
FT                   RRTFEDLKKRNRSNIAPFFVFIKQEKRDVKFIGLAVPGSKNRSIEECLQVVTIDKINGQ
FT                   IKNYKAIFTILDVKEINRRWLDDLEKENGLTSQYVPIEWKLWVEDSIYNTSLIKEIEEQ
FT                   DGENLNKLSVEKELLENININELNHLVKNIDELQFEITYKPMDNEKEENLDDKTEIKNK
FT                   FIKPRKNKNYIEEYTKKQIIGAIGECIILKNEKERLKNSRQAELVRKADDIEWSSKFIG
FT                   DGLGYDIKSFDIKDGKVINKYIEVKTTVGQDEYFEITVNEVNKSKTLNTNGLYVLARVY
FT                   NLDIKNKTANFYFKEGNLESNYDLKTRVYIAYRK"
FT   gene            606267..607034
FT                   /locus_tag="CLL_A0611"
FT   CDS_pept        606267..607034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0611"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0611"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24329"
FT                   /db_xref="GOA:B2TKL1"
FT                   /db_xref="UniProtKB/TrEMBL:B2TKL1"
FT                   /protein_id="ACD24329.1"
FT                   /translation="MDSYKKLKRYVIIKYISIISTTILFMVLFSFYCFNIIFNEAISNK
FT                   WLIATIISIVLYVASIVYFIINDPINNIDKYSLKELLEYCTRVKSKIFFLEILAYISSV
FT                   TKNIFYNEDNNESREKEISRMIDGIFSNENIKINTKKNAFKEMCRKCIKFLEAPITEDD
FT                   KVLQELEISKIIKEFIDSKSDSKERAIKLSLELQDKAFFLFNITALVGIFIAMWCTSKK
FT                   ITPGDTYIYAIASIILILHSIIEKAINIRKYKF"
FT   gene            complement(607127..607714)
FT                   /locus_tag="CLL_A0612"
FT   CDS_pept        complement(607127..607714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0612"
FT                   /product="RNA polymerase sigma factor, sigma-70 family"
FT                   /note="identified by match to protein family HMM TIGR02937"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0612"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23338"
FT                   /db_xref="GOA:B2TKL2"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B2TKL2"
FT                   /protein_id="ACD23338.1"
FT                   /translation="MDFKYAEMLAKKSKDGDNLSKEKLIEEFRPFIRNLSRKTFIHGYD
FT                   KNDIENECYKNLFKCLNSYDLRKHRFVAYATNGIKNNLNNLIKKSKNRDNAEGSPALTL
FT                   TDNLEHTLPSNNENLEDILCDRCDLEILKAAIENLTEEEQELIDFIFFKNNTIKLYSDL
FT                   KNMCYSTAVNRKTVTLRKIVRIINNFNKKYVN"
FT   gene            607828..608529
FT                   /locus_tag="CLL_A0613"
FT   CDS_pept        607828..608529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0613"
FT                   /product="N-acetylmuramoyl-L-alanine amidase"
FT                   /EC_number="3.5.1.28"
FT                   /note="identified by match to protein family HMM PF01476;
FT                   match to protein family HMM PF01520"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0613"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23917"
FT                   /db_xref="GOA:B2TKL3"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:B2TKL3"
FT                   /protein_id="ACD23917.1"
FT                   /translation="MEKVSTLAIDIGHNVNFDGGAVGIRREDELNKLVGEVLINKFKST
FT                   NINVINCTPYNAVSLHDSLNQRTVAANKGKADLFISIHHNSGGGRGSEALCLTGGIAEK
FT                   VGNSVLKEISSIGFYNRGVKDRRDLFVINQTIMPALLIECTFCDSASDMNGYNPESVAN
FT                   AIFKGICNVFEIYSNEEVGFNENQIYYNVVKGDTLCKIASKFNTTIEKLVAINGIKDKN
FT                   MIYVGQDIIIK"
FT   gene            608853..609098
FT                   /locus_tag="CLL_A0614"
FT   CDS_pept        608853..609098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0614"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0614"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24926"
FT                   /db_xref="GOA:B2TKL4"
FT                   /db_xref="UniProtKB/TrEMBL:B2TKL4"
FT                   /protein_id="ACD24926.1"
FT                   /translation="MLEIFGLILGFIGFMGIIITSGLCFYSRYSTKCKYKPKQILMFFI
FT                   VFSMALVVSSEILWTDSNKENKINKSNTEESNKIIK"
FT   gene            609126..610199
FT                   /locus_tag="CLL_A0615"
FT   CDS_pept        609126..610199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0615"
FT                   /product="metallo beta-lactamase family protein"
FT                   /note="identified by match to protein family HMM PF00753"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0615"
FT                   /db_xref="EnsemblGenomes-Tr:ACD21978"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR035681"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:B2TKL5"
FT                   /protein_id="ACD21978.1"
FT                   /translation="MKATKKLISLSMTVLLSTFSLGCKQANAINKTNIETTKTQETSVG
FT                   DMKVHYIDVGQADSELIQVDGKNILIDAGNNDSMAYNYLKQLGIKKIDYVMITHPHSDH
FT                   IGGMTQIINEFDIGEFYAPKVNHTTKTFENMIKALQSKGIKLTAPTPGDTLNIGNATLQ
FT                   FLAPNSAKYEDMNNYSIACKLKYGNTSYVFMGDAEALSEGEILAKQLDISADVLKLGHH
FT                   GSHSSTSQTFLDKVNPRYAIVSCGKGNDYGHPHKETIDKLNAKNIEILRTDVSGTIIST
FT                   SDGNNINFNVNASGTSTGNTNNNQDTKKQITNVWVANKTAKVYHSSKECSNMKSPIEMS
FT                   LQDAQTKGLNPCSKCSK"
FT   gene            complement(610277..610495)
FT                   /locus_tag="CLL_A0616"
FT   CDS_pept        complement(610277..610495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0616"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0616"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22933"
FT                   /db_xref="InterPro:IPR021321"
FT                   /db_xref="UniProtKB/TrEMBL:B2TKL6"
FT                   /protein_id="ACD22933.1"
FT                   /translation="MEYSLSLVFLNTIGSKSALTITDVKQDISADEVKALMNLIIEKDF
FT                   FLTSKGSFVKTYSAQLVQREVTKFEVK"
FT   gene            complement(610539..610769)
FT                   /locus_tag="CLL_A0617"
FT   CDS_pept        complement(610539..610769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0617"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0617"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23495"
FT                   /db_xref="InterPro:IPR012454"
FT                   /db_xref="UniProtKB/TrEMBL:B2TKL7"
FT                   /protein_id="ACD23495.1"
FT                   /translation="MAITKLQTGCTLAIEVQKGEDKLGDPIYTKKNFSSVNPKRTPEEV
FT                   FEVAEAFKKVFADDCRNYFIIDTSKLMQEED"
FT   gene            611570..613606
FT                   /locus_tag="CLL_A0618"
FT   CDS_pept        611570..613606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0618"
FT                   /product="penicillin-binding protein 3"
FT                   /note="identified by match to protein family HMM PF00905;
FT                   match to protein family HMM PF03717; match to protein
FT                   family HMM PF05223"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0618"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22580"
FT                   /db_xref="GOA:B2TKL8"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR007887"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:B2TKL8"
FT                   /protein_id="ACD22580.1"
FT                   /translation="MEKKIKRLFIFSLIIIGILVVAAFIFASMKANSINVKQSEKLLQE
FT                   YFELLNEKKYDLMYDKLSDESKNEISKESFIERNKNIYEGIGAKNITIDSIKVKVDGSD
FT                   ILATFQCNMNTIAGNLNFNNTMEIYRIRDEIKVNWSSNLIFPELNNDYKVKVQITDSRR
FT                   GDILDRNNIKLATDDDVAEIGIVIEELGENQKESINEISKELEVPSEYIEKQLSQSYVK
FT                   PNMFVPIKVVSYNNEMVNKVLKFPGIAIKDKPSRVYPLEEKAAHLIGYIQNVTAEDLEK
FT                   NSDKSYSASSVIGKSGLEAIYEDRLRGIDGIKINIVDKNSNEIKVIYNREVKHGEDIKL
FT                   TIDSALQQTAYDALEDNNGATVSINPNTGEVLALVSTPAYNPNDFVLGLSTEKWNDLNT
FT                   NESKPLYNRFQSNITPGSAFKPITAAIGIEENVLDPNEDKGIVGLKWQKDDSWGGYKVT
FT                   RVHAYSLPANLENALIFSDNIYFARVALDIGAENFEKKLKEFGIGEKIPFEYGVSVSQF
FT                   SSEDGINNEILLADSGYGQGNILMNPLQLSMMYTMFTNEGNILKPYLEYKENSEKSVWK
FT                   NNVISRQTAEIILNDLHSVVSKPNGTAHALFEQGINIAAKTGTAEIKLAQDDESGTEIG
FT                   WVVATTTNKENNILVTTFVEDVKDKGGSGYVIPIVKKIIQEMK"
FT   gene            613868..615514
FT                   /locus_tag="CLL_A0619"
FT   CDS_pept        613868..615514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0619"
FT                   /product="ggdef domain protein"
FT                   /note="identified by match to protein family HMM PF00990;
FT                   match to protein family HMM PF07719; match to protein
FT                   family HMM TIGR00254"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0619"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23813"
FT                   /db_xref="GOA:B2TKL9"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:B2TKL9"
FT                   /protein_id="ACD23813.1"
FT                   /translation="MKQFKKQYVVILLVIIGINIIGVVYFLNKYEQNKKAGELNELMKT
FT                   FVVDDNNNEKEISDMKDFISKNPNLDRRNIAKFNLNLTKLYILDLFDWGNLDDAIDSFV
FT                   KTQIESGLSKQWDIAAWSYADISQIYIDFYTYDIAEECLERALNYASRCEMEEFFYEYC
FT                   YTTLAMIYARTNRSDLAMDYYNKALEYDSEDRVEYESMEQRRKIVLSRILLNEKKYDEC
FT                   KKNLNEIREYIHSYETYPSRILWVSGILFPYLEIQAKVGLLTQDYDGLIHYMDEMFTYA
FT                   LIYNQNSILLNFLTDIATMIDKENIVDLPVEVEKAISNYTLKLIRLYPEEYQLRNIQTG
FT                   AHMYNSNETNITLLIQKYKVNDLYKIIITVSCIVVIVIIILVLMVRYNERSSVIDEVSK
FT                   SYNRRYFNKIYKKIQREKVPFGILMYDIDYFKQINDCNGHEVGDKVITEISEIIMELLD
FT                   SNSTLFRYGGDEFCIISKKRNLDEMISLAELIHIVTDHMKCADGKVEITLSIGGATTEN
FT                   SKDIMSLVDDNLYEAKRRGRNCAVVKNKKIN"
FT   gene            615963..618116
FT                   /locus_tag="CLL_A0620"
FT   CDS_pept        615963..618116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0620"
FT                   /product="chitinase A"
FT                   /note="identified by match to protein family HMM PF00704"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0620"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22852"
FT                   /db_xref="GOA:B2TKM0"
FT                   /db_xref="InterPro:IPR001223"
FT                   /db_xref="InterPro:IPR001579"
FT                   /db_xref="InterPro:IPR008965"
FT                   /db_xref="InterPro:IPR009470"
FT                   /db_xref="InterPro:IPR011583"
FT                   /db_xref="InterPro:IPR012291"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR029070"
FT                   /db_xref="UniProtKB/TrEMBL:B2TKM0"
FT                   /protein_id="ACD22852.1"
FT                   /translation="MKVMRLKKLLAGLVVTTMSLSFLGIPAHAKTITNKDQKKVVGQSS
FT                   KKDLKRKIIGYFPEWAYKSEVQGYFNVADLQWDSLTHIQYSFGLVDPSTNKIKLGDKYS
FT                   ALEEDFANYDLSYKGKKIDLDPTLPYKGHFNVLQTMKKDYPNVKLLMSVGGWAGSRGFY
FT                   TMLDTDEGIDTFADSCVDFIRKYNFDGIDIDFEYPSSTSESGNPADFDLSEPRRSNLNE
FT                   RYNILMKTLREKIDEASEKYNKDYILSAAVTASPWVLGGINDNTYAKYLDFLSVMSYDY
FT                   HGGWNEYVENLAGIYPDQEDRETASQIMPTLCMDWAYRFYRGVLPSEKIIMGIPYYTRG
FT                   WENVQGGQDGLHGSSRTPASGKYNIWGDDLDNDGELEPAGANPLWHVLNLMEQDPNLKL
FT                   YWDDVEKVPHVWQSKESVFLSFENEKSIDERVKYIKNKNLGGALIWVMNGDYGLNPNYV
FT                   EGSNKINEGKYTFGDTLTKILSSGLKNIGNCKETDDDSTSSLEPVNVEVSLDGKYDHPN
FT                   YTYDIKIKNCTDKKIDGGWDVSFDLPKSALYKSSWGGTYSLKDNGDFKTVIIKSGDWQS
FT                   IEPGATVTIQGMIGLCFSGVRNITFNGMNPIGPSMDKVKEVEIDELRNVIEEVPKEIIE
FT                   ELPKEITEELPKEIISDESTIKEELKEMEEDKSKEKLIDSTEELPKDTTMDKGVIEDNL
FT                   KDEFIDNSEKEIKNNLKETIENN"
FT   gene            618479..620221
FT                   /locus_tag="CLL_A0621"
FT   CDS_pept        618479..620221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0621"
FT                   /product="hypothetical sigma-54-dependent transcriptional
FT                   regulator YgeV"
FT                   /note="identified by match to protein family HMM PF00158;
FT                   match to protein family HMM PF02954"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0621"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22102"
FT                   /db_xref="GOA:B2TKM1"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:B2TKM1"
FT                   /protein_id="ACD22102.1"
FT                   /translation="MKINLADIKEIINKYSVLLSNLLTIDVEIVDDKLIRVAATGIYEK
FT                   RIGENIRDQGYVYKKSLDTGKTLVIENPGKDTLCDECKKKGICSEFMEICVPIKYEETT
FT                   FGVIGLVCSNEDQKERLKSNLHIMITFLEQIAEFISIKVIEQNQIFENENSIKFFKEIV
FT                   NSVDDGIITVDIKDEIITANNNALKLLKVKPNIIGKKITVGETDEYTPKGGIYNFNIEN
FT                   EKFKIIGKVVKNCINNKDCNKIIIFKELITIEEELKNNSINCDSIIGQADNIAELKNKI
FT                   KKVSYTDATILITGESGTGKELVARAIHSEGNRKNMPFIAINCGAIPENLLESELFGYI
FT                   KGAFSGASSGGRIGKFELANNGVIFLDEIGDMPLYLQVKILRVLQEKTIVKIGSNKLIN
FT                   LNIRVIAATNKNLKKLVDEGKFRADLYYRLNIIPMEVPSLRDRGDDVLLITKMLIEKYN
FT                   ARCNKYIHTIHKELIKIFKDYSWPGNIRELENIVEFMISLSGENGVLEKSMLPTSFVQS
FT                   YNEELKNRRDEICMDDDIMTLREIEKIYIKKALEKYGNSTKSKMKVAKKLGIGIATLYR
FT                   KLEE"
FT   gene            620602..621801
FT                   /locus_tag="CLL_A0622"
FT   CDS_pept        620602..621801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0622"
FT                   /product="M20/DapE family protein YgeY"
FT                   /note="identified by match to protein family HMM PF01546;
FT                   match to protein family HMM PF07687; match to protein
FT                   family HMM TIGR03320; match to protein family HMM
FT                   TIGR03526"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0622"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24437"
FT                   /db_xref="GOA:B2TKM2"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017706"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:B2TKM2"
FT                   /protein_id="ACD24437.1"
FT                   /translation="MDFKNIKVKANAYEADMTKFLRDLIAIPGESANEELVIKRIAQEM
FT                   EKLGFNKVEIDNMGNVLGYMGTGKTLIAYDAHIDTVGIGEISNWTFDPYKGYETEEEIG
FT                   GRGASDQLGGIVSATYGAKIMKDLDLLSDKYTVLVTGTVQEEDCDGLCWQYIHNEDKIK
FT                   PEFVVITEPTNGNIYRGQRGRMEIRVEVKGISCHGSAPERGDNAIYKMADILQEIRVLN
FT                   DNLHYDEFLGKGTVTVSEIFYNSPSRCAVADMCAISLDRRLTDGETFESALEEVRNLPF
FT                   AKKYNAKVTMYKYERPSWTNLVYPTDCYFPTWVIPEDAPATKSMVEAYEGMYGKPLVDK
FT                   WTFSTNGVSIMGRYGIPCIGFGPGKEEEAHAPNEKTWKADLVKCAAVYAAVPTIYCENK
FT                   "
FT   gene            621858..623051
FT                   /locus_tag="CLL_A0623"
FT   CDS_pept        621858..623051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0623"
FT                   /product="putative carbamoyltransferase"
FT                   /note="identified by match to protein family HMM PF00185;
FT                   match to protein family HMM PF02729; match to protein
FT                   family HMM TIGR03316"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0623"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23616"
FT                   /db_xref="GOA:B2TKM3"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR017702"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/TrEMBL:B2TKM3"
FT                   /protein_id="ACD23616.1"
FT                   /translation="MSIMDKYIDKLNKLNFEDMHENDFMLTWDKSNDELEAVFTVAEAL
FT                   RNLRENNISPKIFDSGLGISLFRDNSTRTRFSFASACNLLGLEVQDLDEGKSQVAHGET
FT                   VKETANMISFMADVIGIRDDMFIGKGHTYMQNVSEYVKEGNENGTLEQRPTLVNLQCDI
FT                   DHPTQAMADTLHLINELGGVENLKGKKVAMTWAYSPSYGKPLSVPQGIIGLLTRFGMDV
FT                   VLAHPEGYEVMSEVEEVAKKNAKESGGSFTKTNSMEEAFKDADIVYPKSWAPYVAMEKR
FT                   TDLYAKGDQVGIDELEKELLKQNADHIDWQCTEELMKLTKDGKAIYMHCLPADITGVSC
FT                   EVGEVDASVFDRYRKSLYKEASFKPYIIAAMIFLSKVKNPQETLAKLVEKDKPRHFE"
FT   gene            623365..624297
FT                   /gene="arcC"
FT                   /locus_tag="CLL_A0624"
FT   CDS_pept        623365..624297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arcC"
FT                   /locus_tag="CLL_A0624"
FT                   /product="carbamate kinase"
FT                   /EC_number="2.7.2.2"
FT                   /note="identified by match to protein family HMM PF00696;
FT                   match to protein family HMM TIGR00746"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0624"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23920"
FT                   /db_xref="GOA:B2TKM4"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR003964"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:B2TKM4"
FT                   /protein_id="ACD23920.1"
FT                   /translation="MKKKIVIALGGNALGNTLKEQMTAIKTTAKAIVDLIEDGNEVVIS
FT                   HGNGPQVGMINIAMSELHKLDSKYSICPMSVCVAMSQGYIGYDLQNQIKEELLNRNINK
FT                   NVSTIITQVEVDSKDEAFKNPTKPIGSFMTKEEADIAIKNGDNVIEDSGRGYRRIVASP
FT                   KPVSIVEIGTIKSLIRDGQVVIACGGGGIPVIKEGNHLKGVGAVIDKDFASCTLAKELD
FT                   ADCLIILTAVEKVAINFGKENEQWLADVNVTDMKKYLEEGHFAPGSMKPKVEAGIEFAS
FT                   SKEGRYSLITLLEKAKDGITGKTGTRIKY"
FT   gene            624336..625544
FT                   /gene="dpaL"
FT                   /locus_tag="CLL_A0625"
FT   CDS_pept        624336..625544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dpaL"
FT                   /locus_tag="CLL_A0625"
FT                   /product="diaminopropionate ammonia-lyase"
FT                   /EC_number="4.3.1.15"
FT                   /note="identified by match to protein family HMM PF00291;
FT                   match to protein family HMM TIGR01747; match to protein
FT                   family HMM TIGR03528"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0625"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23421"
FT                   /db_xref="GOA:B2TKM5"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR010081"
FT                   /db_xref="InterPro:IPR019871"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:B2TKM5"
FT                   /protein_id="ACD23421.1"
FT                   /translation="MENIEWKKNQLPKTNNENLLDFLNKDEITKARDFHKSFPQYKETP
FT                   LVSLENLSKDIGLGGIYIKDESYRFGLNAFKVLGGSLAMAKYMAQKLNKDISELPYEKL
FT                   ISPELREELGEITFVTATDGNHGRGVAWTANKLKQKSVVYMPKGSSKTRLENIRKEGAE
FT                   ASITDMNYDDAVRLAAKYASENNGIVIQDTAWEGYEEIPAWIMQGYGTMGLEALNQLAE
FT                   YGVERPTHIFIQAGVGSLAGAIQGFFASVFKENCPKTVIVESNLADCLYKSAKANDGNL
FT                   IAVGGDMQTIMAGLACGEANTIGWKVLKEYSDTFVSSPDYVAANGMRILGNPLRGDKKV
FT                   ISGESGAVTSGLLYEIMKNDKYKDLKESLELDENSKVLLFSTEGDTDPDKYKEIVWRGQ
FT                   YNK"
FT   gene            625571..626902
FT                   /locus_tag="CLL_A0626"
FT   CDS_pept        625571..626902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0626"
FT                   /product="putative selenium metabolism protein SsnA"
FT                   /note="identified by match to protein family HMM PF01979;
FT                   match to protein family HMM TIGR03314"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0626"
FT                   /db_xref="EnsemblGenomes-Tr:ACD21933"
FT                   /db_xref="GOA:B2TKM6"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR017700"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B2TKM6"
FT                   /protein_id="ACD21933.1"
FT                   /translation="MLLVGNGRVITQDNKEPYLEDGCIAIKDNMILEVGNTDELKEKYK
FT                   DYEFIDAEEKVIMPGLINTHHHIYSAFARGLTLNNPPSKSLIDILENVWWKIDKKLTLE
FT                   DVKYSTYTTLIECVKNGVTTVFDHHASPMSASRSLFTIADAATHLGIRGVYAYEVSDRD
FT                   GDEILNEGIEENVNFIKVSNEREDDMVKGMFGMHASFTLSDESLKKCVNSMKGLDAGYH
FT                   IHAAEGIDDLNHCLKNNNKRVIERLNDFGILGEKTICAHCIHINKREIDILKETNTNVV
FT                   NNPESNMGNAVGCAPVMEMMKNEVVVGLGTDGYTSDMFESMKVENIIHKHNLCNSNVGF
FT                   VETNRMLFENNRNIAGKYFTKPLGILKEGAYADLIIVDYNPLTPMNENNLNGHIMFGMS
FT                   GRGVDTTIINGKVVMKNRQIITVNEDKIFKESRKISGEFWKNLN"
FT   gene            626916..627608
FT                   /locus_tag="CLL_A0627"
FT   CDS_pept        626916..627608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0627"
FT                   /product="YczE"
FT                   /note="identified by match to protein family HMM PF02588"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0627"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24952"
FT                   /db_xref="GOA:B2TKM7"
FT                   /db_xref="InterPro:IPR038750"
FT                   /db_xref="UniProtKB/TrEMBL:B2TKM7"
FT                   /protein_id="ACD24952.1"
FT                   /translation="MKEKLVLKQWLVKVPLDILGLFLCASGIVLAIQSNLGPSPWDVLQ
FT                   VGLSIQLPISIGQASQLVSIVMLLFTWYKGIIPGIGTLAEAFFIGFFIDLIYKYIPICT
FT                   PEETLFRIIMLVAGISMLAFGIVTSLKAGLGVGSRDQLMEYLIGKTGRPVEKVRPIMEL
FT                   IALVIGALLKGPIGIGSIFVATFIGYLIRFSAKILNYNFDAYNHYTLLDMWNNSNFSKE
FT                   KSIANKHI"
FT   gene            627680..629041
FT                   /locus_tag="CLL_A0628"
FT   CDS_pept        627680..629041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0628"
FT                   /product="hydroxydechloroatrazine ethylaminohydrolase"
FT                   /EC_number="3.5.4.43"
FT                   /note="identified by match to protein family HMM PF01979;
FT                   match to protein family HMM PF07969"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0628"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22084"
FT                   /db_xref="GOA:B2TKM8"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B2TKM8"
FT                   /protein_id="ACD22084.1"
FT                   /translation="MNKTLFIKNIKSLISCDENDSVYEDVNIFVENGVIKYIGKDLYEA
FT                   NETIDATNMLVYPGLINTHHHLYQTFTRNLPQVQKLELFPWLIYLYEIWKGIDSEIIRY
FT                   SSLVGMGELMKNGCTTCFDHHYVFPKSEEEKLIDTQFSVAKELGIRMHASRGSMSLSKK
FT                   DGGLPPDSVVQNIDKILYDSERLVKKFHNPNKFSMSQVSLAPCSPFSVTSELMKETANL
FT                   ARWLGVRLHTHLAETIDEERFISEKFGMRPLEYMKSLGWVGEDVWYAHGIHFNDDELKI
FT                   LAKTKTGVAHCPISNMKLSSGIAKIPQMIKLGIPVGLAVDGSASNDGSNLLEEIRVCYL
FT                   LHRLNSSKDAPTGYEILKLATRGSAKVLGRNDIGELSVGKAADLFMINSKRLEFVGTQF
FT                   DPKSILGTVGIKGNVDYTIVSGEVVVKEGKLVNIDEEKITYEANKSVERLISKA"
FT   gene            629079..630167
FT                   /locus_tag="CLL_A0629"
FT   CDS_pept        629079..630167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0629"
FT                   /product="dihydroorotate dehydrogenase family protein"
FT                   /note="identified by match to protein family HMM PF00037;
FT                   match to protein family HMM PF01180; match to protein
FT                   family HMM TIGR01037"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0629"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24866"
FT                   /db_xref="GOA:B2TKM9"
FT                   /db_xref="InterPro:IPR005720"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR023359"
FT                   /db_xref="UniProtKB/TrEMBL:B2TKM9"
FT                   /protein_id="ACD24866.1"
FT                   /translation="MADLKVNILGMEFDNPIFTAAGPGAKDGELCVLAVKGGAGGLVTK
FT                   TISEKPADVPRPCMAKTNAGFLNTELWSELPKEQWIEKEYKRAKEAGVPMIVSMGYTAD
FT                   QIKKVAPLVKPYADAVELSTHYVGTDIAPIVDAMKAAKAALDCPVFMKMSPHTDIQKIA
FT                   KALEDAGADGLVMINSVGPCMAIDVETGYPIMGSQTGYGWLSGSSVKPVAIRNIYDASK
FT                   VIKIPIIGVGGVTCGRDAAEMLMAGAQSVQVCTEAILKGPSIYGKIAKELNDFLDSHGY
FT                   KDVNEIIGLAHKKCEERNFRTESIAPTVKQDVCIKCGICKTSCVYDAIEVSNELIIDNK
FT                   KCFGCGLCVTRCPQNALSMQYK"
FT   gene            630362..630736
FT                   /locus_tag="CLL_A0630"
FT   CDS_pept        630362..630736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0630"
FT                   /product="endoribonuclease L-PSP"
FT                   /note="identified by match to protein family HMM PF01042;
FT                   match to protein family HMM TIGR00004"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0630"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25114"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR019897"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:B2TKN0"
FT                   /protein_id="ACD25114.1"
FT                   /translation="MKKIINTQNAPEAIGPYSQGVIIDKLVYTSGQLPINPKTKVLETE
FT                   IKKATKQSIENCKAILEEAGTNLENVIKTTVFVKDLNDFSAVNEVYAKFFTQNFPARSC
FT                   VQIAKLPMDAPVEIEVIATL"
FT   gene            630817..631362
FT                   /locus_tag="CLL_A0631"
FT   CDS_pept        630817..631362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0631"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0631"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23801"
FT                   /db_xref="GOA:B2TKN1"
FT                   /db_xref="InterPro:IPR004948"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2TKN1"
FT                   /protein_id="ACD23801.1"
FT                   /translation="MYKNILITGKIQCGKSTLINKILNELTIPYSGYRTVPYYEKEEKA
FT                   GYYIESVNLKSELKEKISVNTSNISSPKCNVFVKGFDIIGVEILKNSIEDKVSKIILLD
FT                   EIGILEKCSPKFIEEINNCLNNEKLVIGVLKKKNDEFLNGISERKDTFIIDIEEKTDEE
FT                   RQIIKKQVIEYIENVFIG"
FT   gene            631903..634464
FT                   /locus_tag="CLL_A0632"
FT   CDS_pept        631903..634464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0632"
FT                   /product="selenium-dependent molybdenum hydroxylase 1"
FT                   /note="identified by match to protein family HMM PF00111;
FT                   match to protein family HMM PF01315; match to protein
FT                   family HMM PF01799; match to protein family HMM PF02738;
FT                   match to protein family HMM TIGR03311"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0632"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22604"
FT                   /db_xref="GOA:B2TKN2"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017697"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:B2TKN2"
FT                   /protein_id="ACD22604.1"
FT                   /translation="MFKFILNGQEKSVDENKKLLKYLRDDCNITSVKNGCSEGACGTCM
FT                   VIVDGKAIKACVLTTEKVNGKTITTIEGFTDREREVFAYAFTEAGAVQCGFCIPGMVIS
FT                   AKALFNRTLEPTMEDVKKALIGNICRCTGYVKIEKAIMMAAEIFRKNKEVPKVSCKGLI
FT                   GEPMARVDARDKTLGLGEYTDDIRIEGMVYGAALRSKYPRALVKSMDITEAENLKGVIK
FT                   IVTAEDIPGQRYLGHLKKDTPALIKVGEETRYLGDAVALVAAETEEIAKEALKYIKVDF
FT                   EELKPLSSPMEALKDDAPKIHEGGNVLVHEHLVRGNADEAIKKSKYVVTNKYSVPFTEH
FT                   AFLEPEAAVAVPDGEDGLIVYTGTQSIYDDLREIGSLLNLGEDKLRIISEYVGGGFGGK
FT                   EDMSCQHHTALLAYLIKKPVKMCLTRQESIMVDTKRHAMEMEFTTACDENGKLTAMKAE
FT                   IIADTGAYASLGGPVLQRACTHAAGPYNYQNMVVDGIAVYTNNTPGGAFRGFGVTQSAF
FT                   ATECNLNQLAEMVGIDPFEIRMLNAIRPGEVLANGQIADEGTALVETLEAVKDSYYSNK
FT                   YAGIACTFKNAGVGVGIPDTGRCKVKVIDGKVHIRTSAACIGQGVGTVVVQVVGEILGI
FT                   PASQIVYETPDTRITPNSGTTTASRQTVFTGEATRIASLKLKEALKGKSLQELEGIEFL
FT                   GEYIGITDKMGSPKENPVSHVAYGFATQVVIIDEKGKLVKVVAAHDVGKAINPKNVEGQ
FT                   IEGGVVMGLGYGLTEDYIIENSVPKVKFGTLGLLRATQVPEIVPIIIEKNTQELSFGAK
FT                   GVGEITCIPTAPAVQGAYYKLDGIFRRELPLKNTFYKKIKK"
FT   gene            634470..634658
FT                   /locus_tag="CLL_A0633"
FT   CDS_pept        634470..634658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0633"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0633"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23078"
FT                   /db_xref="GOA:B2TKN3"
FT                   /db_xref="UniProtKB/TrEMBL:B2TKN3"
FT                   /protein_id="ACD23078.1"
FT                   /translation="MYYYNKGWNYKAIIILFTITVFLLLGRFIKPLKIFYDNSYVLGMI
FT                   ISIIIYTVYLVKAKKYN"
FT   gene            634690..636081
FT                   /gene="hydA"
FT                   /locus_tag="CLL_A0634"
FT   CDS_pept        634690..636081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hydA"
FT                   /locus_tag="CLL_A0634"
FT                   /product="dihydropyrimidinase"
FT                   /EC_number="3.5.2.2"
FT                   /note="identified by match to protein family HMM PF01979;
FT                   match to protein family HMM TIGR02033"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0634"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22313"
FT                   /db_xref="GOA:B2TKN4"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR011778"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B2TKN4"
FT                   /protein_id="ACD22313.1"
FT                   /translation="MSLLIKNGTIATASDIYEGDIYIEDGIIKEIGINIIKKADEIIDA
FT                   KGKYVIPGGVDVHTHLNLDVGIAVANDDFYTGTVAAAFGGTTTIVDHMGFGPKGCNLKH
FT                   QIDVYHGYAKGNAVIDYSFHGVIQHVNDNIINEMEKIVEEEGVPSFKLYLTYDYMIDDE
FT                   GVLRVLKRLKDLQGVATIHCENHGSIKLLREKYVSNGLKSVKYHPLSRPVESEAEAINR
FT                   MINMASIVEDAPLYIVHLSSGLGLDYIKMAKERGEKVYAETCPQYLILDESKYNLPNNE
FT                   ALKYTISPPLRSKSDIEKLWKGINEGDIQTIATDHCPFSLSKDKQMGKDDFTKCPNGAP
FT                   GIEERISLIFSEGVMKGRINLNKFVELCCTNPAKMFGLYPKKGTIQVGSDGDIVIIDPE
FT                   REVTLTNSNLHSNVDYSAYEGIKVKGYPVITISRGQIIVKDNKFIGQKGYGKFIKRSKV
FT                   DLDNI"
FT   gene            complement(636253..636726)
FT                   /gene="guaD"
FT                   /locus_tag="CLL_A0635"
FT   CDS_pept        complement(636253..636726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaD"
FT                   /locus_tag="CLL_A0635"
FT                   /product="guanine deaminase"
FT                   /EC_number="3.5.4.3"
FT                   /note="identified by similarity to SP:O34598; match to
FT                   protein family HMM PF00383"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0635"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25043"
FT                   /db_xref="GOA:B2TKN5"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:B2TKN5"
FT                   /protein_id="ACD25043.1"
FT                   /translation="MQKKDIMDLCVEKCKEGMLNLDGGPFGAAIVKDGEIIALANNTVI
FT                   STNDPTAHGEVNAIRQACSKLSTFDLTGCELYTTSEPCPMCMSAIIWANISKVYYGCTV
FT                   KDAADIGFRDEHILNFLKGDCTNKKVLDLEQIDKSNCMTAFKMWINNQNKTSY"
FT   gene            637371..639662
FT                   /locus_tag="CLL_A0636"
FT   CDS_pept        637371..639662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0636"
FT                   /product="putative xanthine dehydrogenase,
FT                   molybdopterin-binding subunit"
FT                   /note="identified by similarity to SP:Q46799; match to
FT                   protein family HMM PF01315; match to protein family HMM
FT                   PF02738"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0636"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24242"
FT                   /db_xref="GOA:B2TKN6"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:B2TKN6"
FT                   /protein_id="ACD24242.1"
FT                   /translation="MTNNIVGNSVIRFDAVAKVTGKAKYVDDFFVNDMLVGKVLRSPHA
FT                   HAIIKDIDTSKAKKLEGVEAVITHEDLPKIKFATAGHPWSLDPSHRDIDDRLILTNKAR
FT                   FVGDAIAAVIAVDEIVAAKALELIDVDYEVLEPIVDSEDALKENAPIIHEERPNNILSS
FT                   FGSEIGNVEEDLKKADRIFEGNFETSIVQHCHMENHSTYAYVDGEDRIVIVSSTQIPHI
FT                   VRRIVGQALGIQWGKIKVIKPYIGGGFGNKQDVVIEPLTAAMSLAVDGRPVRYTLDREE
FT                   CFIDTRTRHSMKIKFKTAVSKEGKLISLDIKNLINNGAYASHGHSVALSAGGKFRGVYD
FT                   FNSIKYSPTTVYTNLPAAGAMRGYGAPQMCYALESHIEDICRELNMDSIEFRTKNFISE
FT                   GYVEPLSKNVVRAFALPECIEKGKELIKWDEKKKEYKNQSGDKRKGVGMACFSYFTGTH
FT                   PVALEPAGARIVMNQDGSVQLQIGATEIGQGSDTVFGQMVAEILGLRIDMVHVISNQDT
FT                   DITPFDTGSYASRQTFVSGAAVKKCALEVKDKVLAFASSKCGLEASELDIENCKIVEKR
FT                   LGRVICPLEEIAMESYYDRIKCCPITSDTSVNVRVNSIAYGATFAAVEVDIKTGKIEVL
FT                   EIYNIHDSGMIMNPMLAEGQVHGGVSMGLGYALSEQMLFDKKTGKPLNNNLLDYKLQTI
FT                   MDTPTIGSAFVEKYEPAGGFGQKSIGENTTVSPAPAIRNAVLDATGVAFNKIPMNPQSV
FT                   FEKFKEVGLV"
FT   gene            639680..640552
FT                   /locus_tag="CLL_A0637"
FT   CDS_pept        639680..640552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0637"
FT                   /product="putative xanthine dehydrogenase, FAD-binding
FT                   subunit"
FT                   /note="identified by match to protein family HMM PF00941;
FT                   match to protein family HMM PF03450"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0637"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22660"
FT                   /db_xref="GOA:B2TKN7"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036683"
FT                   /db_xref="UniProtKB/TrEMBL:B2TKN7"
FT                   /protein_id="ACD22660.1"
FT                   /translation="MFDINEILEPETLEEALELLDKNKELKIIAGGTDVLIKLHHNKMK
FT                   DAELLSLRKINGLDEINMLEDESIEVGAMASFSKIFRDEIVQKHIKILAEGAVSMGGPQ
FT                   VRNMATIGGNVCNGAVSADSAPALFSLNAKLKLKSKNSERIIPIQEFYIGPGRVDIKNN
FT                   EILTNLIIKKEDYENLTGHYIKFSNRKAMDIAMVSVAVVSSIENEKFKDLRIALGVSAP
FT                   TPIRCNEAENYAKGIEATEENIEKIAELAVRASKSRNSWRASKDFREHLIKELTKRGIK
FT                   KTIEIEGEK"
FT   gene            640554..641027
FT                   /locus_tag="CLL_A0638"
FT   CDS_pept        640554..641027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0638"
FT                   /product="putative xanthine dehydrogenase, iron-sulfur
FT                   binding subunit"
FT                   /note="identified by similarity to SP:O32143; match to
FT                   protein family HMM PF00111; match to protein family HMM
FT                   PF01799"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0638"
FT                   /db_xref="EnsemblGenomes-Tr:ACD21906"
FT                   /db_xref="GOA:B2TKN8"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:B2TKN8"
FT                   /protein_id="ACD21906.1"
FT                   /translation="MSNAKMKKISMTVNDKSYELEVDIRESLLDVLRNKIHCTGVKCGC
FT                   HVGECGACTVLIDGVPTDSCIYMAVWANGKSIVTIEGVKKDGKLSKVQQAFIDEGAVQC
FT                   GFCTPGLVLTSTALVNSGKKYTDDEIKREISGHLCRCTGYQKIFNATKKSLQK"
FT   gene            641314..642702
FT                   /locus_tag="CLL_A0639"
FT   CDS_pept        641314..642702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0639"
FT                   /product="xanthine permease"
FT                   /note="identified by match to protein family HMM PF00860;
FT                   match to protein family HMM TIGR00801; match to protein
FT                   family HMM TIGR03173"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0639"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23223"
FT                   /db_xref="GOA:B2TKN9"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR017588"
FT                   /db_xref="UniProtKB/TrEMBL:B2TKN9"
FT                   /protein_id="ACD23223.1"
FT                   /translation="MSSENNTKTVDKVNEMLPIGQLATFGLQHVLAMYAGAVAVPLIIG
FT                   AAVGLSPEQLSLLVAADLFTCGIATLLQAIGIGNFAGIKLPVILGCTFAAVGPLIIIGK
FT                   SLGMDYAYGSIIVGAIVVILIAPLYGKLLKFFPTVVTGSVVTIIGLSLINVGVTSCGGG
FT                   ANAADFGSVRNILLSIFVMLVILISNKYLKGFFQSIAVLNGIILGTIVGSFMGMVDFSI
FT                   VSEAKWISFVKPFTFGIPKFDTGAIFMMTLVMITVMVESTGTFLGVSKLCGKKLTEKDI
FT                   VKGLRAEGLATILGGIFNSFPYTTFNQNLGLLSLSKVFSRFVVVASGIILMALGLIPKF
FT                   AALATIIPQPVIGGATTIMFGTVAVAGIKMLLDIDLEKNSNVLIVATSLAVGLGITAVP
FT                   TLLSQTPQFVQSIFGSGIVSGSIVAIILNAWLNHGEAESNFSDNCDDDNHIKLKDRQEC
FT                   EIKS"
FT   gene            642936..643967
FT                   /locus_tag="CLL_A0640"
FT   CDS_pept        642936..643967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0640"
FT                   /product="putative iron chelate uptake ABC transporter,
FT                   solute-binding protein"
FT                   /note="identified by match to protein family HMM PF01497"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0640"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24402"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:B2TKP0"
FT                   /protein_id="ACD24402.1"
FT                   /translation="MRKLKRVSSVILTFILITTFFIGCGKSKEVTSKVDQAITVEDQLG
FT                   RKVEIKGEVNKIISSYPITTSLLVALGLKDKVAGVEMKPKDRELYRRVAPEFLDKPQVG
FT                   SAKSISVEECAKINPDLVIMPTRTKEMIPKFEELNIPVIAVEPESLDSFLDCIKLLGKS
FT                   TNTEDRANEIVKYYEDNLEKVKKLNENNANKPKVYLSGSANILRTCTSKMYQNYMIEAS
FT                   GGNNVTSSLEDGYWVDISAEQLLAYNPDIIYIVQYAKYSVEDVLNDERLKDLNAVKNKK
FT                   VFVIPSVIEPWDYPTPSSILGILWMTNNINPDKYSTEEFEKTAKDFYKKFFNLEVDNKD
FT                   IGI"
FT   gene            643964..644953
FT                   /locus_tag="CLL_A0641"
FT   CDS_pept        643964..644953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0641"
FT                   /product="iron chelate uptake ABC transporter, FeCT family,
FT                   permease protein"
FT                   /note="identified by match to protein family HMM PF01032"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0641"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22777"
FT                   /db_xref="GOA:B2TKP1"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:B2TKP1"
FT                   /protein_id="ACD22777.1"
FT                   /translation="MNLKYSKVISSIVLLLLIIISLLIGRYHIKPIDIINTMLHGQSDS
FT                   LEFNLIWNIRFSRVVLVSISGAALSLSGIVYQSIFQNPIVSADVLGVSSGASLGAAIAI
FT                   VFLPFSPIIIQVMAFAFGIGAVIFSLLLSRQMRSNRILALIIAGIVTGAISSSFLMIIK
FT                   YLADPYKELPSIDFWLMGGFYNSTWNNVVYVFILTTISAVILFLLRWKLKVLTMGDDQA
FT                   KLLGVNVKVIRIIAIFSATLLVSTVVSVAGIISWIGLLAPHIVKFYAKDDISEVMGLTM
FT                   VVGAIILIIADTIARSLTSVEIPVSILTSLVGAPFLVYILNRKENTIR"
FT   gene            644950..645729
FT                   /locus_tag="CLL_A0642"
FT   CDS_pept        644950..645729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0642"
FT                   /product="putative iron ABC transporter, ATP-binding
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0642"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23521"
FT                   /db_xref="GOA:B2TKP2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2TKP2"
FT                   /protein_id="ACD23521.1"
FT                   /translation="MKNDLEINNLTVKYSNKTVLKDINLELNKGEVTILLGLNGAGKTT
FT                   LLKSMIGLMKRTTGEVIYNNKDILKLSNKERGKLISYIPQNLHTSQNYSVQDIILMGIT
FT                   PYLGMFDMPSKEHHELVKDILKKLNIEYLKDKYISEISGGERRLVYLARIFIQNSKIIF
FT                   LDEPNTFLDYVKQHEFFKFISDLIRKNNLINLITVHDINLALRYADKIVILSSNEIVDV
FT                   IDCKVDGYEKKFVILMEKIYNKKLEIAYTKFGPVIVC"
FT   gene            645803..646600
FT                   /locus_tag="CLL_A0643"
FT   CDS_pept        645803..646600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0643"
FT                   /product="conserved hypothetical protein TIGR03172"
FT                   /note="identified by match to protein family HMM TIGR03172"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0643"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24800"
FT                   /db_xref="InterPro:IPR017587"
FT                   /db_xref="UniProtKB/TrEMBL:B2TKP3"
FT                   /protein_id="ACD24800.1"
FT                   /translation="MKIFKCENMKIDNVTSLIQALNIDINKKMIISFVGGGGKTSSIYE
FT                   LGSELSKLGKKVIITTTTHMQMPEKNFVLTDKENDILNLLNTENMITVGQKCIKKSDHD
FT                   KYKNLISKENKGREKIQGFSIKSTKNLIKYCDFLLIEADGAKRLPLKMPANHEPVILEE
FT                   SNLVIGVCGIDALGQSIKEICHRKELVTEFLNVDEEHKISEEDIAKILSSEKGQRKNVK
FT                   CDYKVIVNKVDDEEKLNIAKNIFDEFLKLGINELIFTTFKNYI"
FT   gene            646737..647525
FT                   /locus_tag="CLL_A0644"
FT   CDS_pept        646737..647525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0644"
FT                   /product="selenium-dependent molybdenum hydroxylase system
FT                   protein, YqeB family"
FT                   /note="identified by match to protein family HMM TIGR03309"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0644"
FT                   /db_xref="EnsemblGenomes-Tr:ACD21975"
FT                   /db_xref="InterPro:IPR017695"
FT                   /db_xref="UniProtKB/TrEMBL:B2TKP4"
FT                   /protein_id="ACD21975.1"
FT                   /translation="MIVIKGAGDLATGVATRLKKCGFDIVMTEISQPTTVRRTVAFSQV
FT                   VYDKKVEVEGITAVLASNKEDINKIVEEGRVAVLVDEKAKIIDEIKPEIIIDAIIAKKN
FT                   LGTKIDDANIVIALGPGFTAGIDCHCVIETKRGHYLGKAIYKGSAIPNTGVPGEVGGFS
FT                   KERIIRATTDGKIAPVSKIGDYVKKGDIVAYVNETPIFAKLDGIVRGMLQKDVNVFKGM
FT                   KSGDIDPRCEKNHCFTISDKARSIGGGVLEAILHLSNFKF"
FT   gene            647622..648242
FT                   /locus_tag="CLL_A0645"
FT   CDS_pept        647622..648242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0645"
FT                   /product="selenium metabolism protein YedF"
FT                   /note="identified by match to protein family HMM PF01206;
FT                   match to protein family HMM TIGR03527"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0645"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24033"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR003787"
FT                   /db_xref="InterPro:IPR019870"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/TrEMBL:B2TKP5"
FT                   /protein_id="ACD24033.1"
FT                   /translation="MNKIIDAKGKNCPIPVIMAKKEIDNGNVNFVVEVDNKIANENLKK
FT                   LGNSMGFEIKSQEANGIFKVHFLKAGRDNNKSEICEECNEIIEEIKKDKLSTWSIFIGK
FT                   EIIGSGSEELGKSLMKMYFYTMTESDDLPKSILFMNEGVKIPALNEQVVEHLKDLEKKG
FT                   VEILVCGTCLNFYGLEEELKVGKVSNMYEISNYMKAASKVITL"
FT   gene            648382..649419
FT                   /gene="selD"
FT                   /locus_tag="CLL_A0646"
FT   CDS_pept        648382..649419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="selD"
FT                   /locus_tag="CLL_A0646"
FT                   /product="selenide, water dikinase"
FT                   /EC_number="2.7.9.3"
FT                   /note="identified by match to protein family HMM PF00586;
FT                   match to protein family HMM PF02769; match to protein
FT                   family HMM TIGR00476"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0646"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24854"
FT                   /db_xref="GOA:B2TKP6"
FT                   /db_xref="InterPro:IPR004536"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR023061"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2TKP6"
FT                   /protein_id="ACD24854.1"
FT                   /translation="MSKDIKLTSLTKNSGCAAKIGPGVLHSVLSSLPKFEDENLIVGFD
FT                   TSDDACVYKINDDTVVIKTVDFFPPMVDDPYTFGQVAAANALSDVYAMGGNPSIAMNLI
FT                   CFPSCLDISIMREILAGGYDKVKEAGAVIAGGHTIADPTPKYGLCVSGFARPEEILSNS
FT                   NAKTGDVIILTKPLGIGIMNTAAKAELIDENKIKEVTSIMSTLNKYAKECTLGLEIHSC
FT                   TDVTGFGLIGHSYEMASGSKKTIEIFSESIPIIDGALDYAKMGIIPEGMYNNLDYLKDK
FT                   FAVGANISQELQDVLIDPQTSGGLLLSLPEKQAKEFLSRIENFTPYARIIGQVLDKGDK
FT                   PIVIK"
FT   gene            649662..650788
FT                   /pseudo
FT                   /locus_tag="CLL_A0647"
FT                   /note="2-hydroxyacyl-CoA dehydratase beta-subunit,
FT                   degenerate; this region contains one or more premature
FT                   stops and/or frameshifts; identified by similarity to
FT                   GB:AAA97231.1"
FT   gene            650834..651595
FT                   /gene="hgdC"
FT                   /locus_tag="CLL_A0649"
FT   CDS_pept        650834..651595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hgdC"
FT                   /locus_tag="CLL_A0649"
FT                   /product="2-hydroxyglutaryl-CoA dehydratase component A"
FT                   /note="identified by similarity to SP:P11568; match to
FT                   protein family HMM PF01869; match to protein family HMM
FT                   TIGR00241"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0649"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24062"
FT                   /db_xref="InterPro:IPR002731"
FT                   /db_xref="InterPro:IPR008275"
FT                   /db_xref="UniProtKB/TrEMBL:B2TKP7"
FT                   /protein_id="ACD24062.1"
FT                   /translation="MSKYTLGIDSGSTTTKGVLFDGKTIVRTMLVKTAAKPRESISKIY
FT                   NELYSNNVKYTITTGYGRDLLKEADRTITEITCHAKGAAFLNPNIKGVIDIGGQDSKAI
FT                   LLDESLNVVDFLMNDKCAAGTGRFVEVMMRILEEDITNIDEFVKDKKPVNITSMCTVFA
FT                   ESEIISLLAKDVHRGDIALGIIHSICRRTANFAQKLNLKDEVFFSGGLASSEVFRATLE
FT                   SYLKQKVSINELSQFAGAIGAATIGYVLAEC"
FT   gene            651943..652536
FT                   /locus_tag="CLL_A0650"
FT   CDS_pept        651943..652536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0650"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0650"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22425"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B2TKP8"
FT                   /protein_id="ACD22425.1"
FT                   /translation="MMKINLILLASGDSTRFRSNKLLTIVNNKPMYMNVIDEVLKINFH
FT                   KIVLVTQYEDIKLALLNKNIEVVMNKNSELGISHSIELAMKKDVEADAYMFMVCDQPFI
FT                   KSQTIENLIFRFMKSKKGMACVEFNGNLGNPTIFSKKYIHELLNLKGDVGGKAVMKKHL
FT                   DDLEKVSIVDEIEIKDIDTREELINISYNNIYMR"
FT   gene            652541..653605
FT                   /locus_tag="CLL_A0651"
FT   CDS_pept        652541..653605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0651"
FT                   /product="putative xanthine dehydrogenase accessory factor"
FT                   /note="identified by match to protein family HMM PF02625"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0651"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23394"
FT                   /db_xref="InterPro:IPR003777"
FT                   /db_xref="InterPro:IPR027051"
FT                   /db_xref="UniProtKB/TrEMBL:B2TKP9"
FT                   /protein_id="ACD23394.1"
FT                   /translation="MMKKKFYKDLFEKLNLNKEVFIVTVIQGSYDSKNIAGQKLFKSKK
FT                   FMAIENDNLKNFWDEILSKIDFDKGTYVLELDNDIKLFIEYIIGKPNLIVCGGGHVALP
FT                   LCEMANLLEFNVTVIDNREEFANKERFPMASNVMCKDFNEAFEEVEFNKNSYFAIVTRG
FT                   HKYDRECLEIILKNDFYYVGMIGSKGKVQFVISSLLEKGYKKEDIDKVHTPIGLSIGAK
FT                   TPAEVAVSILSEIIQVKNEKIISTIPDDISNTISNTNEPMVLTTIIEKHGSGPRDPGTK
FT                   MLIKKNGEFIGTVGGGSVEYSVYKRALKLFEEKESILEEYNLSNSASAKLGMACGGHIK
FT                   VFFEFINCDYNKTK"
FT   gene            653857..654669
FT                   /gene="cbiQ"
FT                   /locus_tag="CLL_A0652"
FT   CDS_pept        653857..654669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbiQ"
FT                   /locus_tag="CLL_A0652"
FT                   /product="cobalt ABC transporter, permease protein CbiQ"
FT                   /note="identified by match to protein family HMM PF02361;
FT                   match to protein family HMM TIGR02454"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0652"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23933"
FT                   /db_xref="GOA:B2TKQ0"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="InterPro:IPR012809"
FT                   /db_xref="UniProtKB/TrEMBL:B2TKQ0"
FT                   /protein_id="ACD23933.1"
FT                   /translation="MKIKLKEKLHNHSEGIYSIDFYAYQSQIGHWNSMFKVLFAFITLL
FT                   FCIIADNFYVSLTIVFTMAFITIYKGGIHFREYLHLLTIPLVFMILGSIAIAIGISTRP
FT                   LGQYNLNFHWFYLYSSNESIIKTLKIMMKAFGAISAMYMMTLSTSASEIISVLRKLHIP
FT                   KLIIELMNMVYRFIFILLDVQCKMKNSAQSRLGYVDFRTSCYSFGSTAGNLLIVSLKKA
FT                   NAYYDAMESRCYDGEMNFLEEDKNIEISQIVVSIIYILCLIILWLITR"
FT   gene            654678..655514
FT                   /locus_tag="CLL_A0653"
FT   CDS_pept        654678..655514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0653"
FT                   /product="cobalt import ATP-binding protein CbiO 2"
FT                   /EC_number="3.6.3.-"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM TIGR01166"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0653"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24974"
FT                   /db_xref="GOA:B2TKQ1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005876"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2TKQ1"
FT                   /protein_id="ACD24974.1"
FT                   /translation="MMDGSSNEVILQVRNLNYKYNNEKTVLSNINIDIHEGEKVAILGS
FT                   NGAGKSTFFLNINGVLTPKNGEIIYRGKKISKKELNELRKNIGIVFQDADNQIIASTVL
FT                   AEVSFGPMNLKLPKEKVKIRVEEALSYMNLTDFKNRPPHYLSGGEKKRVSIADIIAMQS
FT                   EVIIFDEPTASLDPLNTIMLEEVLKKLSEEKKTLLISTHDVDFAYRWAERVIVFANGEI
FT                   IADGTPLQIFKDDKIIKCANLKRPTMLDVYEILVDKGLIKNNSIYPKNIVEFTNML"
FT   misc_binding    655625..655811
FT                   /bound_moiety="adenosylcobalamin"
FT                   /note="cobalamin riboswitch; Rfam score 114.45"
FT                   /inference="nucleotide motif:RFAM:RF00174"
FT   gene            655942..656688
FT                   /gene="cbiM"
FT                   /locus_tag="CLL_A0654"
FT   CDS_pept        655942..656688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbiM"
FT                   /locus_tag="CLL_A0654"
FT                   /product="cobalamin biosynthesis protein CbiM"
FT                   /note="identified by match to protein family HMM PF01891;
FT                   match to protein family HMM TIGR00123"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0654"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22858"
FT                   /db_xref="GOA:B2TKQ2"
FT                   /db_xref="InterPro:IPR002751"
FT                   /db_xref="InterPro:IPR018024"
FT                   /db_xref="UniProtKB/TrEMBL:B2TKQ2"
FT                   /protein_id="ACD22858.1"
FT                   /translation="MKEQKTIKKIAIIFALLFGITPAVNAMHIMEGYLPVKYCVSWGII
FT                   SLPFLIAGFFSIKKTLREDRKSLVILAMSGAFIFVISSLKIPSVTGSCSHMTGTGLGAI
FT                   LFGPFAVGILGIIVLIFQAILLAHGGITTLGANTFSMSIAGPILSYIIYILCKKLKVNK
FT                   KLGIFLAASLGDLFTYSITSLQLAIAYPSPDGGIGASAIKFLGVFAPTQIPLAIVEGIL
FT                   TVIVIIGLETYAKSELTSIGFMKEGK"
FT   gene            656691..657011
FT                   /locus_tag="CLL_A0655"
FT   CDS_pept        656691..657011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0655"
FT                   /product="cobalt/cobalamin transport protein CbiN"
FT                   /note="identified by match to protein family HMM PF02553"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0655"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23822"
FT                   /db_xref="GOA:B2TKQ3"
FT                   /db_xref="InterPro:IPR003705"
FT                   /db_xref="UniProtKB/TrEMBL:B2TKQ3"
FT                   /protein_id="ACD23822.1"
FT                   /translation="MSKNKKTVIILLIIALIITIVPLFALKGAEFGGSDDAGSEMIEEI
FT                   HGEYEPWFTPVMETWIDGELPGEIESLLFCVQTGIGVGVFAFFMGRFVERKKWQTGSNK
FT                   EC"
FT   gene            657286..657432
FT                   /locus_tag="CLL_A0656"
FT   CDS_pept        657286..657432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0656"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0656"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24491"
FT                   /db_xref="GOA:B2TKQ4"
FT                   /db_xref="UniProtKB/TrEMBL:B2TKQ4"
FT                   /protein_id="ACD24491.1"
FT                   /translation="MSVLFTIINILLIVFIGIGIFKCVKWLRNFANKVENLDKKIDDVL
FT                   KKL"
FT   gene            657504..657638
FT                   /locus_tag="CLL_A0657"
FT   CDS_pept        657504..657638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0657"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0657"
FT                   /db_xref="EnsemblGenomes-Tr:ACD21829"
FT                   /db_xref="GOA:B2TKQ5"
FT                   /db_xref="UniProtKB/TrEMBL:B2TKQ5"
FT                   /protein_id="ACD21829.1"
FT                   /translation="MENMSIMSGAIAFGIIPKLILWVMEVYALFLGIKALKIYIDKNS"
FT   gene            complement(657723..658328)
FT                   /locus_tag="CLL_A0658"
FT   CDS_pept        complement(657723..658328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0658"
FT                   /product="TetR-family transcriptional regulator"
FT                   /note="identified by match to protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0658"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23397"
FT                   /db_xref="GOA:B2TKQ6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:B2TKQ6"
FT                   /protein_id="ACD23397.1"
FT                   /translation="MDDNINNKRKLRIIDAAIKVFTNKSFEEITMREIAATAGLTTGAI
FT                   YYHYKSKDDLLYDVINHSIHFIYKISEKDGTNLKDKDVLLSEIKNEVTIRLSKKDEQKL
FT                   HLLLISYLISKNGELKEKYKENYNIIIDKVANMYIYTFGVENEKLKKSLASIFVAALDG
FT                   MAIQYSLGLLPQKQTDFIKVFNDFFAESIPLFMKRHLE"
FT   gene            658596..659519
FT                   /locus_tag="CLL_A0659"
FT   CDS_pept        658596..659519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0659"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0659"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23500"
FT                   /db_xref="GOA:B2TKQ7"
FT                   /db_xref="UniProtKB/TrEMBL:B2TKQ7"
FT                   /protein_id="ACD23500.1"
FT                   /translation="MFLFQPIPWHSWLMFFIVLGGLMLFNEIGRYNKYTGIALFIVLPI
FT                   LLTIFVWPNTSGAKSGQSTANWFQWAKTYSALAGCIIFMGLRFSKKIQAKKWYYVLPPA
FT                   ILAINITEAVIREFQVYGMNETINGMTYIGGPWNIMNGIAGILNMLTICGWFGIIVSTD
FT                   KQKDMIWPDMLWFWIIAYDLWNFGYLYNCVTDRAFYGGLALLLSCTIPAFSIKKGAWLQ
FT                   HRAQTLALWMMVVMIFPGFFTGGKYAVASTHNPRAYMVVSIIALAANILVVAYQVYTIV
FT                   KNKKNPLKDEIYTELKSYNTIKKSNM"
FT   gene            659598..661097
FT                   /locus_tag="CLL_A0660"
FT   CDS_pept        659598..661097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0660"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0660"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24597"
FT                   /db_xref="GOA:B2TKQ8"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B2TKQ8"
FT                   /protein_id="ACD24597.1"
FT                   /translation="MHYDVIVIGGGNGGLSVGATLAKKGKKICLLEKHNIPGGCGTSFR
FT                   RGRFEFEVALHQLSSVGTEESPGPTRKIFEELGIMDQLDLSTLNSLYRIVLPGKVDVTM
FT                   PTDVNEAIVYLSKKFPEYTEQIKQFYNLVFSLFKEANEIQNVSVDKISKEKFPIYFKYA
FT                   LKTAQEVLDEFFEDRNLQLCLNAYWSFMGTPPSIFPFIILAGNISVYMKFKPKYLKGGS
FT                   QVISQALAEVIRNNNGEVKFNCGAKKIIVENGKAVGVITEDDEKLTADVIVSNISPTTT
FT                   YFDLLESKNVPKEAVQYLSNFKPSISALTCFIGLDCAPEDIGIKEAMNIFYKSADVNKD
FT                   FLKANIIEIEDDPIVFTCYTIDDPTVSPKGTSIITAGCIKYGKPWLELSPEKYYETKYQ
FT                   CANAIVDRIEVNYPGFRDHIEEISVATPLTHMRYLNTPEGCVYGYEQDLKSTGFFYPNK
FT                   SMIKNLEFTGGFVGLCGFSPNYIQGYKKANEILANYWNGGI"
FT   gene            661100..662254
FT                   /locus_tag="CLL_A0661"
FT   CDS_pept        661100..662254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0661"
FT                   /product="putative oxidoreductase"
FT                   /note="identified by match to protein family HMM PF00111;
FT                   match to protein family HMM PF00175; match to protein
FT                   family HMM PF00970; match to protein family HMM PF08030"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0661"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23478"
FT                   /db_xref="GOA:B2TKQ9"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:B2TKQ9"
FT                   /protein_id="ACD23478.1"
FT                   /translation="MKEFISEIENINKIIGEIEILKKNGKDYSIDRGRTKKLIDRLHPK
FT                   TLDLILSEIIDRTEDSKTFRFVSKNGYLPIFEAGQYINVFVEIQGVRTSRPYSISSSPK
FT                   QRAYYEITVARIKNGFVSDYFLDKAKVGDNFQSSSPSGEFHYNPVFHGKNLVFLAGGSG
FT                   ITPFMSMIKDVLNSGLDRNINLIYGIKNEESAIFLEELKEFNSRHNNFNLTLVASEPQD
FT                   DYTGESGFITGDLIKRKVTNINSSSFYICGPQVMYDFCRKELKSLGVKNSKIHQEMFGS
FT                   RQDIQNEPGWPDDLTGKEEFNISLSDGRSLKGFSGESLLTSLERAGVRVNVCCRSGECS
FT                   LCRVKLVSGTIFQPRGVLQRYVDEKYGYIHSCKSYPISDVKIVL"
FT   gene            662389..663555
FT                   /locus_tag="CLL_A0662"
FT   CDS_pept        662389..663555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0662"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0662"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24217"
FT                   /db_xref="UniProtKB/TrEMBL:B2TKR0"
FT                   /protein_id="ACD24217.1"
FT                   /translation="MPEKELHIYIDKLLDLSGINIDMKTNPKLILEVLKEDMLLSEFEP
FT                   VKVILKESLEEPVFLKPMFEKTIKSIVTKQPAIYEFLTEAIELNLFTKVKEEKSKNEIL
FT                   RSIHHAYILNEITKEIVKNIDFVFEIQEYLLKQRSKYGIGTNFVDALDSLKKLYNGSMF
FT                   EPTKIVGMDMVYRSRALVRRRGIINEYDVQAQIDGLKLNILEAAVTDKNSGYIDNAIVG
FT                   AVLSAIPPDTVSLTDDENKVMLFHLSRKWVSLYETWNLAFVIGNLAYLPVLIPKLLIPS
FT                   VIDAEHNEYLITRSAALWLSTLFHQFAVLNKRENIPLKNSKELAMLWGKVNLKYAEELA
FT                   KEEAGKELSDFNDVLKITLGDIMEKMKHSITSVPLSKDETERLTRIYN"
FT   gene            663758..665713
FT                   /locus_tag="CLL_A0663"
FT   CDS_pept        663758..665713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0663"
FT                   /product="aco operon expression regulatory protein"
FT                   /note="identified by match to protein family HMM PF00158;
FT                   match to protein family HMM PF01590; match to protein
FT                   family HMM PF02954; match to protein family HMM PF07728"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0663"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23221"
FT                   /db_xref="GOA:B2TKR1"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B2TKR1"
FT                   /protein_id="ACD23221.1"
FT                   /translation="MENYMTFIDNAWKKFIATGEVDPKVRSDIGDSWIRCRKYGVDPNN
FT                   GRGSIKHHNIDELIKNNIELISVARPIMESVYSMVSGSGFALFLSDKDGYLLEIIGDQD
FT                   IMERVNELNFLKGELWTENIVGTNAIGTALYLNKPVQTIGAEHYGVNQHSWTCSASPIH
FT                   DEDGNLIGCINMSGNYYNAHSHTMGIVTAAAQSIQKQMALTISYKLLNVTFDSISEGMI
FT                   VINEDMKVKRVNGRALEILNISSEEAIKMDINNVLRGVHFHKLLNENNRSLNNIEWDFN
FT                   INSSIVKCVINVVPLNISGKNNGMVITFTEVKRVHKLVNKFVGYKAQYKFDDIMTTNND
FT                   MKKMMAFAKKAATSDCNILIQGESGTGKELIAQSIHNYSERHKGPFVAVNCASIPRELV
FT                   ESELFGYEKGAFTGALKEGHPGKFELADGGTIFLDEIGELPLDTQSKLLRVLDNGKVIR
FT                   VGGTYEKQLDVRVIGATNRVLKKEISKQNFREDLYYRLSVMEIKTIPLRDRIDDIDVLI
FT                   KYFIEKLNLKNRDKIIRINDYYVDELKKYNWPGNIRELRNVVERDYYLSDNEITNINNM
FT                   YYIEESNKTNNKTVKEIFNIKEDIKIIPLEYLEKNAIYDAIKKCNGNIQLASKLLKIGR
FT                   ATLYRKIKKYGIDVSK"
FT   gene            665967..667040
FT                   /locus_tag="CLL_A0664"
FT   CDS_pept        665967..667040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0664"
FT                   /product="(R,R)-butanediol dehydrogenase"
FT                   /EC_number="1.1.1.4"
FT                   /note="identified by match to protein family HMM PF00107;
FT                   match to protein family HMM PF08240"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0664"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22181"
FT                   /db_xref="GOA:B2TKR2"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2TKR2"
FT                   /protein_id="ACD22181.1"
FT                   /translation="MKAALWYAKKDVRVEEIEEPKVTSNGVKIKVKWCGICGSDLHEYL
FT                   GGPIFIPVGEPHPLSGTTAPVVLGHEFSGDIVEVGENVTKFKVGDRVIVEPIVACGKCP
FT                   ACLEGKYNLCSSLGFHGLCGSGGGLAEYTVFPEEFIHKIPDEMSYEQAALVEPMAVALH
FT                   SIRVGNFKIGDTALVLGSGPIGLATIECLKAAGAKLVVVLQRKSIRQEYAKRAGADVVL
FT                   DPNEVDIAEEVKKLTNGLGVDVAFETTGAQIGFDTGINSLKFEGTMVITSIWENGVTFN
FT                   PNALVFTEKKIVGTLAYRHEFPATMAQMNDGRIKAEGYVTKRIHLDDIVEEGFGALTGP
FT                   EKKKHVKILVTPDKGLL"
FT   gene            667061..667948
FT                   /locus_tag="CLL_A0665"
FT   CDS_pept        667061..667948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0665"
FT                   /product="conserved electron-transfer protein"
FT                   /note="identified by match to protein family HMM PF00175"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0665"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24672"
FT                   /db_xref="GOA:B2TKR3"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR012165"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR019480"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:B2TKR3"
FT                   /protein_id="ACD24672.1"
FT                   /translation="MYKIVSKRELTNNIFLMDIEAPRVAKSAEPGQFIIIKNDEKGERV
FT                   PLTIAGYNREEGTVSIVFQTVGKSTQELAQYEVGSYVADFVGPLGQPSEFIHEDLESLK
FT                   KKKLIFVAGGVGAAPVYPQVKWMHDNGIDVDVIVGSRTKDLLILEEEMKAVAGTLYVAT
FT                   DDGSYGFNGRVTDCLQGLVNEGNKYDHAVVIGPMIMMKFMADLTKKLDIPTTVSLNPIM
FT                   VDGTGMCGACRVTVGGEIKFACVDGPEFDGHLINYDESMRRQAMYKTEEGKAKLALEEG
FT                   NTHSHGGCGCRGDK"
FT   gene            667951..669342
FT                   /gene="gltA"
FT                   /locus_tag="CLL_A0666"
FT   CDS_pept        667951..669342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltA"
FT                   /locus_tag="CLL_A0666"
FT                   /product="glutamate synthase (NADPH), homotetrameric"
FT                   /EC_number="1.4.1.13"
FT                   /note="identified by match to protein family HMM PF00070;
FT                   match to protein family HMM PF07992; match to protein
FT                   family HMM TIGR01316"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0666"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23734"
FT                   /db_xref="GOA:B2TKR4"
FT                   /db_xref="InterPro:IPR006004"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B2TKR4"
FT                   /protein_id="ACD23734.1"
FT                   /translation="MDIKERMVRVPVREQNPKVRATNFEEVCLGYNEEEAIKEASRCLN
FT                   CKNPKCVEGCPVSINIPGFISHVKEGNFEEAAKEVSKYSALPAVCGRVCPQESQCEGKC
FT                   VLGIKGDSVSIGKLERFTADWASTNDVDLSETASKNGIKVAVIGSGPSGLTCAGDLAKK
FT                   GYDVTIFEALHKAGGVLEYGIPEFRLPKEKVVKNEVDNIRKLGVKIETNVIVGRTITID
FT                   ELFEEEGFKAVFIGSGAGLPKFMGIEGENANGVCSANEFLTRVNLMKAAVDGYDTPVRA
FT                   GKKVAIVGGGNVAMDAARTALRLGAESHIVYRRGESELPARVEEVHHAKEEGVIFDVLT
FT                   NPKEILVDENGWVKGMKCIKMELGEPDESGRRSPVEIAESEFIMDVDTVIMSLGTSPNP
FT                   LISSTTQGLEINKRRCIIAEDETGLTSKEGVYAGGDAVTGAATVILAMGAGKKAAQAID
FT                   EYLTK"
FT   gene            669679..671388
FT                   /locus_tag="CLL_A0667"
FT   CDS_pept        669679..671388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0667"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /note="identified by similarity to SP:P39214; match to
FT                   protein family HMM PF00015; match to protein family HMM
FT                   PF00672"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0667"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22774"
FT                   /db_xref="GOA:B2TKR5"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="UniProtKB/TrEMBL:B2TKR5"
FT                   /protein_id="ACD22774.1"
FT                   /translation="MLKTIKSKLIFLVIIFVITIVFMGIYSTKTLNNVNQKSTIISKEF
FT                   IPAIVYSEELNTMTSDFRLLEYSHIVATTPEIMEEKEKAMEEKEKEIQKKLDMYSKTIY
FT                   REEDKELFDIVKEEWNKYLGLHNQVIGLSKELKTQEAMNIMSEDLREAFNKASSSLIKL
FT                   ADLNKKMTENASLEGDKEYSTSIKINIIIIAVLSVLSIIFGVIIINAIRKPLNMLKVEL
FT                   DSLAERGGDLTKEIEINSEDEIKDLSVSLNKFIQNLRNIIKQVNESSNSIDDVTEIIKN
FT                   NVTKLNSDIEEVSATTEELAANMEETAASSEEMLATSQEIEEVVKSISQKSQEGAIKAG
FT                   EISNRAEDTKINVQASEKKSIELFKSTKLELEEAIQASKVVEQINVLSESIMQITSQTN
FT                   LLALNAAIEAARAGEAGKGFSVVAEEIRKLAEQSKDTVIEIQNITGKVTSAVRNLSSSS
FT                   DKLLRFMSIDVYNDYKEMLDVACKYSEDAEFVDSLVTDFSSSSEELLASLQEVIKTIDG
FT                   VSQAANEGAGGTTDIASSILQVNDKSNSVLENALKSQENAKRLKEEISKFKI"
FT   gene            671594..672280
FT                   /locus_tag="CLL_A0668"
FT   CDS_pept        671594..672280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0668"
FT                   /product="peptidyl-prolyl cis-trans isomerase,
FT                   cyclophilin-type"
FT                   /note="identified by match to protein family HMM PF00160"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0668"
FT                   /db_xref="EnsemblGenomes-Tr:ACD21729"
FT                   /db_xref="GOA:B2TKR6"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:B2TKR6"
FT                   /protein_id="ACD21729.1"
FT                   /translation="MLIKSIKKYTKLILLLVFVSSLGLVGCGNFKDNDTKQNVESNSTT
FT                   EDTDSNSPEEIENLPLATINVKDYGVIEAVLYPETAPNTVNNFIDLANKGFYNNLKFHR
FT                   IIKDFMIQGGDPKGDGTGGPGYSIEGEFASNGIPNGLKHTKGVLSMARSQNPNSAGSQF
FT                   FIMTGDAPHLDGEYAAFGKVVSGFDVLDKIGSVKTKSQDIPKDDVIIESITVDSKGVEY
FT                   NEPNKK"
FT   gene            672363..673076
FT                   /locus_tag="CLL_A0669"
FT   CDS_pept        672363..673076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0669"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06912"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0669"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23937"
FT                   /db_xref="GOA:B2TKR7"
FT                   /db_xref="InterPro:IPR010699"
FT                   /db_xref="UniProtKB/TrEMBL:B2TKR7"
FT                   /protein_id="ACD23937.1"
FT                   /translation="MFTKDININMCKNKHVNTSESVHLGILLAIVGGFLDAYTFVCRGG
FT                   VFANAETGNIVLVGVEVTKGNFKGAVMAFLPILAFIIGVIVAERINEFEFCIVVVDSHR
FT                   AILIIEMLVLFIIGFVPTTIPNIFVTTTISFVSSVQISSFRKLVDSPYSTTMCTGNLRS
FT                   ASQAAYMAFRKKDKTYTIKSIRYCIIIISFLVGACLGGVSTLKIGVRSVWISVIVLLCA
FT                   ILLFTIDEIRFKEQC"
FT   gene            673380..673895
FT                   /locus_tag="CLL_A0670"
FT   CDS_pept        673380..673895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0670"
FT                   /product="GnaT-family acetyltransferase"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0670"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22038"
FT                   /db_xref="GOA:B2TKR8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B2TKR8"
FT                   /protein_id="ACD22038.1"
FT                   /translation="MLYSDINLQREVYRDDVFDIAKWLKDEEVSKYLNEKNGITNSLDS
FT                   LANNSTLPVMTQYFNNNGPFYMIEHKNKSIGYLKIVTKDNNNSAEIVVAIGDKKKWGKG
FT                   IGTIAVKKALSEAFLKYRVNKVVAKIHKENYRSSKVFKKVGFIENELLEKETKYLITFN
FT                   EYISQFSS"
FT   gene            674082..674948
FT                   /locus_tag="CLL_A0671"
FT   CDS_pept        674082..674948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0671"
FT                   /product="oxidoreductase, short chain
FT                   dehydrogenase/reductase family"
FT                   /note="identified by match to protein family HMM PF00106"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0671"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24350"
FT                   /db_xref="GOA:B2TKR9"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2TKR9"
FT                   /protein_id="ACD24350.1"
FT                   /translation="MNFPNSFPAQHQTKHPGFEYEMSPVPVYDDPNYNKSGDLLSNKVA
FT                   LITGGDSGIGRAVSIAYAKQGADIVIVYYNENRDAEETKKLIENIGRKCTIINGDIGKS
FT                   EFCNEAIKKTISEYGKLDILVNNAAVQYECQDIKNLSDEQFDKTFNVNAYGTFYMTREA
FT                   LKYLKQGSCIINTASVVAFKGNETLIDYSMTKGAIIALTRSLALSLAKNKSGIRVNAVA
FT                   PGPVWTPLIPSSFDSTKVTTFGANTPMGRAGQPVECAGAYVFLASECASYITGQTIHIN
FT                   GGEIVNS"
FT   gene            675112..675843
FT                   /locus_tag="CLL_A0672"
FT   CDS_pept        675112..675843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0672"
FT                   /product="hydrolase, alpha/beta hydrolase fold family"
FT                   /note="identified by match to protein family HMM PF00561"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0672"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23589"
FT                   /db_xref="GOA:B2TKS0"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B2TKS0"
FT                   /protein_id="ACD23589.1"
FT                   /translation="MSKSYSNIINNKTANIYYEVHGKGEALVLLHGNGEDLEYFKNQIE
FT                   YFSNKYMVIAIDTRGHGKSTKGNIPFDFWLFSDDVISILDKVNIKKAHILGFSDGGNTA
FT                   LHLGLKYPDRIRSLILNGANFNPNGVKFLVQAPVILGYYLSIIFSPCSNKAKNNRDILN
FT                   LMVNNPKLFKEQLEKIKIPTLVIAGDNDMIKENHTKLISKLIENSEVNIISNSSHFVAA
FT                   ENPKEFNKIVEDFLNKHKIED"
FT   gene            676135..677121
FT                   /locus_tag="CLL_A0673"
FT   CDS_pept        676135..677121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0673"
FT                   /product="putative 3-oxoacyl-[acyl-carrier-protein]
FT                   synthase III"
FT                   /note="identified by match to protein family HMM PF08541;
FT                   match to protein family HMM PF08545"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0673"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22783"
FT                   /db_xref="GOA:B2TKS1"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:B2TKS1"
FT                   /protein_id="ACD22783.1"
FT                   /translation="MNIKIRAIETEYPENIVDNEFYIKHFKEQGKDINRLLEAFGRKER
FT                   RIVNNDSDTTLSMGIQASLKVLESANLKGDDIDLIIFSSQFPEYICPTQALIVHNAIKG
FT                   KNDTIVMDLNVNCLGMLVTLDTASRQLLQNKKLKRALIIGSDYASIHMKHSDELCYPMF
FT                   ADAACAMILEKTNEECGFIDSDYFTDSRKYSAVMYPQCGSSSYYKDTTSYDDMKFGWSE
FT                   CDDDVIDIAVNSINKLLKDNNLNISDISAFCLSQFALPIINGCIDRLRLDSKKVIFVGD
FT                   KFGYTGTSSPLMAFNDGVKSGKIKRGDYVVFWSIAATRTACSVLYKY"
FT   gene            677247..678035
FT                   /locus_tag="CLL_A0674"
FT   CDS_pept        677247..678035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0674"
FT                   /product="nucleotidyltransferase domain protein"
FT                   /note="identified by match to protein family HMM PF01909"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0674"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22025"
FT                   /db_xref="GOA:B2TKS2"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="InterPro:IPR025117"
FT                   /db_xref="UniProtKB/TrEMBL:B2TKS2"
FT                   /protein_id="ACD22025.1"
FT                   /translation="MDKIKNLIEDFSKRQEIESIALGGSRATKLNDNNSDYDLYVYLNS
FT                   DLSKEVRKNILDKYCNYIELNNTYWEAEDDCYLNDGTIIEIIYRSMSEFENELKSVVLD
FT                   CNAHNGYTTCMWSNINECVVLYDKNNKLKDLKDKYNIKYPEELRKNIIEKNLKLLDGYI
FT                   PSFSMQIEKAIIRGDIVSINHRITEFLASYFDIIFAVNELQHPGEKRLISICLSSCKYL
FT                   PKDFEENLDKLLSGNRNKENVMSVVNKIVDNIKELVLNIK"
FT   gene            complement(678106..678288)
FT                   /locus_tag="CLL_A0675"
FT   CDS_pept        complement(678106..678288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0675"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0675"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23975"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2TKS3"
FT                   /protein_id="ACD23975.1"
FT                   /translation="MDIKQQILNTMSEANKPLSAGEVEKLSGLDRKDIDKTFKELKKEE
FT                   LIISPVRCKWEPANK"
FT   gene            complement(678398..678940)
FT                   /locus_tag="CLL_A0676"
FT   CDS_pept        complement(678398..678940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0676"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0676"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23345"
FT                   /db_xref="GOA:B2TKS4"
FT                   /db_xref="UniProtKB/TrEMBL:B2TKS4"
FT                   /protein_id="ACD23345.1"
FT                   /translation="MFQLYFYYKLYFLLSIPFIVLLATLFHYTYKLSNNSLLVGIFTPV
FT                   NESIWEHLKLAIYPTIIWYSISNIIFNNIILDWKKWFHTCTISMIIASITIVVFYYTYT
FT                   GALGIHSLALDIFSLILGVSIGQYIGFKAYANYDLSNNYLYSALFFITIFLFTLFTFVQ
FT                   PKIPLFMDSTNGKYGIN"
FT   gene            679213..679587
FT                   /locus_tag="CLL_A0677"
FT   CDS_pept        679213..679587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0677"
FT                   /product="endoribonuclease L-PSP"
FT                   /note="identified by match to protein family HMM PF01042;
FT                   match to protein family HMM TIGR00004"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0677"
FT                   /db_xref="EnsemblGenomes-Tr:ACD22379"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:B2TKS5"
FT                   /protein_id="ACD22379.1"
FT                   /translation="MLKVTNADKAPKAIGPYSQAISFGDLLFASGQIPLDPLSGEIVGE
FT                   DIEEQATQVIKNIGAILESNDINFSNVIKTTCFLANMNDFSKFNEVYAKYFISNPARSC
FT                   VAVKELPKSVLCEVEVIAAK"
FT   gene            complement(679793..680236)
FT                   /locus_tag="CLL_A0678"
FT   CDS_pept        complement(679793..680236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0678"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0678"
FT                   /db_xref="EnsemblGenomes-Tr:ACD24458"
FT                   /db_xref="UniProtKB/TrEMBL:B2TKS6"
FT                   /protein_id="ACD24458.1"
FT                   /translation="MNPLLSMIFSALFPNSPLSGMMNAMGGNQMMGNNPMMGGNQMMGN
FT                   NQMMNGNPMMNMFGGGNNNQNQGMGGNPLLNMLMGGMNPNMMNGANMMNNPNMNNNPLM
FT                   NMLMGNQNNGVNPFNGMNNMNNMNNMNKNMNKNMNNNNSNHRR"
FT   gene            680414..680713
FT                   /locus_tag="CLL_A0679"
FT   CDS_pept        680414..680713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0679"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0679"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23443"
FT                   /db_xref="InterPro:IPR024997"
FT                   /db_xref="UniProtKB/TrEMBL:B2TKS7"
FT                   /protein_id="ACD23443.1"
FT                   /translation="MNNNKEMLDGVSTNSTKEVTTPSSNSQSISAVIKNSGEITGYELS
FT                   NGQRISKEEGVKMAKDGNIAGVSVSVSKKGEEYLRSLPDQNESNNLSSLPTISD"
FT   gene            complement(680792..681604)
FT                   /locus_tag="CLL_A0680"
FT   CDS_pept        complement(680792..681604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0680"
FT                   /product="putative ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLL_A0680"
FT                   /db_xref="EnsemblGenomes-Tr:ACD23431"
FT                   /db_xref="GOA:B2TKS8"
FT                   /db_xref="UniProtKB/TrEMBL:B2TKS8"
FT                   /protein_id="ACD23431.1"
FT                   /translation="MLGKLMKYETKATGRTLLPLYAALLIFALINKIFMNNDFSVINTD
FT                   TLGGIPAFLSVFAYGCTMAAVFIVTFFIIVQRFYKNILGDEGYLMNTLPVAPWQNIFSK
FT                   LLIAVMWTIVSGIVAILSVFILAFNSNALNPNFFKDLCTAFSSIYQYWGISGYMVGLEF
FT                   IIAALVQMAMGIIMIYASISIGHLFNKRKILSSFGAFIVLNLIMNTILSTLAITFSDKV
FT                   SNYMISWNISSINQFHGVFISAIAINALFFICYFLITNYIIKNKLNLE"
FT   gene            complement(681598..682302)
FT                   /locus_tag="CLL_A0681"
FT   CDS_pept        complement(681598..682302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLL_A0681"
FT                   /product="ABC transporter, ATP-binding protein"
FT