(data stored in ACNUC7421 zone)

EMBL: CP001059

ID   CP001059; SV 1; circular; genomic DNA; STD; PRO; 33103 BP.
XX
AC   CP001059; AAKA01000000-AAKA01000079;
XX
PR   Project:PRJNA15637;
XX
DT   06-MAY-2008 (Rel. 95, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 4)
XX
DE   Shigella boydii CDC 3083-94 plasmid pBS512_33, complete sequence.
XX
KW   .
XX
OS   Shigella boydii CDC 3083-94
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales;
OC   Enterobacteriaceae; Shigella.
OG   Plasmid pBS512_33
XX
RN   [1]
RP   1-33103
RA   Rasko D.A., Rosovitz M., Maurelli A.T., Myers G., Seshadri R., Cer R.,
RA   Jiang L., Ravel J., Sebastian Y.;
RT   ;
RL   Submitted (01-MAY-2008) to the INSDC.
RL   J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850,
RL   USA
XX
DR   MD5; 9ffff55eecc2c0f67d1f16a2ec3544eb.
DR   BioSample; SAMN02604039.
DR   EuropePMC; PMC3232798; 21911569.
DR   EuropePMC; PMC3535970; 23114770.
DR   EuropePMC; PMC3789690; 24098597.
DR   EuropePMC; PMC3911010; 24162569.
DR   EuropePMC; PMC4914624; 27090180.
XX
CC   Source DNA and bacteria available from Jacques Ravel, Institute for
CC   Genome Sciences, Department of Microbiology and Immunology,
CC   University of Maryland School of Medicine;
CC   jravel@som.umaryland.edu.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..33103
FT                   /organism="Shigella boydii CDC 3083-94"
FT                   /plasmid="pBS512_33"
FT                   /strain="BS512; CDC 3083-94"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:344609"
FT   gene            139..726
FT                   /locus_tag="SbBS512_0002"
FT   CDS_pept        139..726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SbBS512_0002"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SbBS512_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACD06005"
FT                   /db_xref="UniProtKB/TrEMBL:B2TSE4"
FT                   /protein_id="ACD06005.1"
FT                   /translation="MYIHIVPKLYHLMANKCSLKSISIPELDFIIDSESLSVGRPWPNK
FT                   CLWVGMRKGRKSVNGLVLQTDKKLRWFTTIYTWDIEDMGLIYHQVNTYIEDDDFDMVSQ
FT                   EILLNGSFDKWSNRVHSAYENKPPARIQPKMESLLNKPGENSHDVWEEFEWGDFLLSRE
FT                   ESLLLHTIQSERLSTDCSLFKRQPSIESALVI"
FT   gene            738..2891
FT                   /locus_tag="SbBS512_0003"
FT   CDS_pept        738..2891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SbBS512_0003"
FT                   /product="DNA topoisomerase 3"
FT                   /EC_number="5.99.1.2"
FT                   /note="identified by match to protein family HMM PF01131;
FT                   match to protein family HMM PF01396; match to protein
FT                   family HMM PF01751; match to protein family HMM TIGR01056"
FT                   /db_xref="EnsemblGenomes-Gn:SbBS512_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACD06026"
FT                   /db_xref="GOA:B2TSE5"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005738"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR025589"
FT                   /db_xref="InterPro:IPR034144"
FT                   /db_xref="UniProtKB/TrEMBL:B2TSE5"
FT                   /protein_id="ACD06026.1"
FT                   /translation="MRLFIAEKPAVANDIVKALGGNFTRHDGWFESDNAIVTNCFGHII
FT                   ESQPPENYNPEYKAWKVETLPLRLYPVKYQPVESAAKQVKTILELIRRGDVTEIVHAGD
FT                   PDDEGQLLVDEVLEYAGNTKPVKRVLINDNTLPAVKKALANLKDNRDFKGLYLKALARS
FT                   VADAVYGFSMTRAYTIPAKARGYQGVLSVGRVQTPVLGLIVNRTRANQNHKSSFYYTMT
FT                   GVFQRGADVIRANWKPGEFAPLTDRKLLDKAWADGTAASLAGKPATVEAAATDDKKTAA
FT                   PLPFNLVRLQQYMNKKFKMTAQKTLDITQQLREKYKAITYNRSDCSYLSDEQFSEAPQV
FT                   IDALKSVFPQSLDIDSSRKSKAFNSAKVTAHTAIIPTASVPDVNALSTDERNVYLAIAQ
FT                   HYLVQFMPEKAYQEVSVAIQCGDESFYARARKTTDSGFEAFLGAETTDEGESEDNDDSA
FT                   FELLCKIRTGETLTTKEVIVNEKKTTPPPLFTEASLLAALVRVADFVTDPTIKKLLKDK
FT                   DKDKKDEHGGIGTPATRAAILETLKKRNYITLEKGKLIPTDTGYALIDALPGIAVNPDM
FT                   TALWSEKQAAIENGDLTVEQFINDLYGELTGMISDVDLGEMKIEPAAPAGQFQRLDSPC
FT                   PSCGKHIVIRPKGYFCTGCEFKIWSEFYGKKITQAQAEKLVKSGKTDLIKGFKKKSGGT
FT                   YDTVLVLEDKKTGKLGFPARAKK"
FT   gene            2888..3094
FT                   /locus_tag="SbBS512_0004"
FT   CDS_pept        2888..3094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SbBS512_0004"
FT                   /product="conserved domain protein"
FT                   /note="identified by match to protein family HMM PF05321"
FT                   /db_xref="EnsemblGenomes-Gn:SbBS512_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ACD05990"
FT                   /db_xref="InterPro:IPR007985"
FT                   /db_xref="InterPro:IPR036666"
FT                   /db_xref="UniProtKB/TrEMBL:B2TSE6"
FT                   /protein_id="ACD05990.1"
FT                   /translation="MKTKQEWLFQLRKCTSRDTLEKVIEINRYKLPLSESEAFYSAADH
FT                   RRAELVMNKLYDKVPSGVWKYVH"
FT   gene            3112..3576
FT                   /locus_tag="SbBS512_0005"
FT   CDS_pept        3112..3576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SbBS512_0005"
FT                   /product="DNA-binding protein H-NS family"
FT                   /note="identified by similarity to SP:P18955; match to
FT                   protein family HMM PF00816"
FT                   /db_xref="EnsemblGenomes-Gn:SbBS512_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ACD05995"
FT                   /db_xref="GOA:B2TSE7"
FT                   /db_xref="InterPro:IPR001801"
FT                   /db_xref="InterPro:IPR027444"
FT                   /db_xref="InterPro:IPR027454"
FT                   /db_xref="InterPro:IPR037150"
FT                   /db_xref="UniProtKB/TrEMBL:B2TSE7"
FT                   /protein_id="ACD05995.1"
FT                   /translation="MSELTKEDEYGIISRTMMNIRSLRVFAREVDFEQLLEMQDKLNVV
FT                   VEERREEAEREAVERQELEAKRQQAIEYIISLGLDPESLLAPVTADTVKTRRKAKGGVR
FT                   KAKYRFKDENGEIREWSGNGKRPLALQKLLDEGHFMEDFLIDKLQPGQVE"
FT   gene            3683..4336
FT                   /locus_tag="SbBS512_0006"
FT   CDS_pept        3683..4336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SbBS512_0006"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:SbBS512_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ACD06034"
FT                   /db_xref="UniProtKB/TrEMBL:B2TSE8"
FT                   /protein_id="ACD06034.1"
FT                   /translation="MIKSKKVVVIFVALSSFLLAGCDSPKDANKQNFEKAINTRLEKEC
FT                   ITISPLGMFDSKPYPVQVAVAQANRYTSQERADEINSRQFSALDVLVKADLLTVKDTLV
FT                   DDVIGFTKTGKKVPGREYALTDEGKKYLKSPERPDFCVGHYKVDEIVDFTEPGDAMGMK
FT                   ITQVNYTFSPTSIAEWAKRDDVRTAFLGLESDLKEKQTKRITLVLKNDGWSAER"
FT   gene            4817..5716
FT                   /locus_tag="SbBS512_0007"
FT   CDS_pept        4817..5716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SbBS512_0007"
FT                   /product="resolvase"
FT                   /note="identified by match to protein family HMM PF00589"
FT                   /db_xref="EnsemblGenomes-Gn:SbBS512_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ACD06027"
FT                   /db_xref="GOA:B2TSE9"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR016423"
FT                   /db_xref="UniProtKB/TrEMBL:B2TSE9"
FT                   /protein_id="ACD06027.1"
FT                   /translation="MLSDAPLLQVIIAGTSKKTGAEIKKLSHLPASIFQISRSDAWNLT
FT                   LSPDAARNMRDLAAQIGAGMPKYLIAPEVSLLLSYIDDLNIRMYFETLWNTGARLNEAL
FT                   ALKPADFMLTPTRQYPQPVVILKTLKQRLKEAERRPGRPTTRHPPLHPDPRYRKPQEPA
FT                   VRLVPVLDAGYALRMREYLATWKKRIKHQPVWDITSRQTPLNWINTAVARAERDGVTFS
FT                   VPVTPHTFRHSYAMHLTMSGVPPRVLQSLLGHRYARSTEIYTRVFSLDVLTGSGLSFTC
FT                   DPRRAKQLLGYPERINDE"
FT   gene            5821..6480
FT                   /locus_tag="SbBS512_0008"
FT   CDS_pept        5821..6480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SbBS512_0008"
FT                   /product="plasmid partition protein A, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SbBS512_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ACD05997"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2TSF0"
FT                   /protein_id="ACD05997.1"
FT                   /translation="MGKIITVAGHKGGIGKSTVLCSLCVCAIRKGKTACFLETDSQGSI
FT                   KDFIEERKTNERLSEIPYFECYTDIPAMARKLAARFDYVFVDTPGMKSPAFVKALSCAD
FT                   ILFTFIEPGAGIEINTLGRLVFDIKTAQAGVNPSMKAWIVLNKCSTNPSDSEASELRRQ
FT                   LNDDPDWLPVPRQRIYMRTAHKKAYNSGMGVHEYDDKRGNKARGEIELLLKETDVL"
FT   gene            6574..6876
FT                   /locus_tag="SbBS512_0009"
FT   CDS_pept        6574..6876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SbBS512_0009"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SbBS512_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ACD06014"
FT                   /db_xref="UniProtKB/TrEMBL:B2TSF1"
FT                   /protein_id="ACD06014.1"
FT                   /translation="MAKLPKKIDQEIKPLDLRQFVSSAAQKPASASAVTRINLTMTDDD
FT                   LDTAQVFQNKYGASRAEVIRAALAALRLVSAEERRRLFDDIRKNSPKAGRPTVNK"
FT   gene            6912..7163
FT                   /locus_tag="SbBS512_0010"
FT   CDS_pept        6912..7163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SbBS512_0010"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SbBS512_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ACD06010"
FT                   /db_xref="GOA:B2TSF2"
FT                   /db_xref="UniProtKB/TrEMBL:B2TSF2"
FT                   /protein_id="ACD06010.1"
FT                   /translation="MLMKAIKSVFNFYMLNLQPFIGVVLAGYGVWKFSGDSISALLEPA
FT                   SYFVIGTVVLFVWYIAWQKERSKEEEFKSSIKPEDFVK"
FT   gene            7225..7440
FT                   /locus_tag="SbBS512_0011"
FT   CDS_pept        7225..7440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SbBS512_0011"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SbBS512_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ACD06039"
FT                   /db_xref="GOA:B2TSF3"
FT                   /db_xref="UniProtKB/TrEMBL:B2TSF3"
FT                   /protein_id="ACD06039.1"
FT                   /translation="MEHCIVDLGIINYHPVITWTVPVAFFFLVVLAGIVFNIGRKSNLI
FT                   VFILAMLLPVTTVFIFMLLGGKIDMC"
FT   gene            complement(7747..8274)
FT                   /locus_tag="SbBS512_0012"
FT   CDS_pept        complement(7747..8274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SbBS512_0012"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SbBS512_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ACD06031"
FT                   /db_xref="InterPro:IPR024402"
FT                   /db_xref="UniProtKB/TrEMBL:B2TSF4"
FT                   /protein_id="ACD06031.1"
FT                   /translation="MIFNRNKKRDEQHNSAVVLPSAENVFSDFIKNNPALTTNAFTAIG
FT                   EVDCFTKVPLLSNNESEFLGILSRNIIPDYSVFPKIRLIEFVRPHGSEEAVKDLIREVQ
FT                   NITCDFVLKSYDETVLAVIQFGETATVRQQKKKLIIQRVCAMTGISFFEFKNTVDMMGS
FT                   EDFCQFLRDDEE"
FT   gene            8236..8358
FT                   /locus_tag="SbBS512_0013"
FT   CDS_pept        8236..8358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SbBS512_0013"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SbBS512_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ACD06004"
FT                   /db_xref="UniProtKB/TrEMBL:B2TSF5"
FT                   /protein_id="ACD06004.1"
FT                   /translation="MLFISFFITVKYHFIFLLKEPAAGTGKNIVFGQSDSNVNI"
FT   gene            complement(8409..8813)
FT                   /locus_tag="SbBS512_0014"
FT   CDS_pept        complement(8409..8813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SbBS512_0014"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SbBS512_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ACD05994"
FT                   /db_xref="GOA:B2TSF6"
FT                   /db_xref="UniProtKB/TrEMBL:B2TSF6"
FT                   /protein_id="ACD05994.1"
FT                   /translation="MKDNIVDFQRIRDSMNDHSTDVANDAVYSDKKKISRFFYLLTPVR
FT                   YLLAASLYLVVVIPLGILAGFRFLLQFLGGIAVMGLTIAWYMGADVSSYVVLAAWIALT
FT                   VCGCAEQIFEWWIESRFAFRLFGIGRTPEE"
FT   gene            complement(8826..9698)
FT                   /gene="pir"
FT                   /locus_tag="SbBS512_0015"
FT   CDS_pept        complement(8826..9698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pir"
FT                   /locus_tag="SbBS512_0015"
FT                   /product="replication initation protein Pi"
FT                   /note="identified by similarity to SP:P03067; match to
FT                   protein family HMM PF01051"
FT                   /db_xref="EnsemblGenomes-Gn:SbBS512_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ACD06011"
FT                   /db_xref="GOA:B2TSF7"
FT                   /db_xref="InterPro:IPR000525"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2TSF7"
FT                   /protein_id="ACD06011.1"
FT                   /translation="MRMTTNKTSLSRLTKVRHRNELNSTLSTLPMAAKKVLFLAMCQIN
FT                   SKNEFDDDHIFYVTVADYIKWVQVKPDAAYLALRDGSNILDTTLLKLKHDEILELSSDL
FT                   GFKFTKSNVPDSMNLSLTVFSTYYRNEGRVGIKFTKEAKRFLCKLIGEEKRYTTQVLLS
FT                   VVRLTSVNAASLYQLIRKIYSNNSRANSFEMTIDELKDELNLYTIGAGGVKDYKYPDYP
FT                   AFKRDVLNKSVKEIMKHTEVKNLSFVVSEKIGRKVYKLKFSYTIGYEGDTREDSEFTNM
FT                   FDKMYPPEN"
FT   gene            10947..11282
FT                   /locus_tag="SbBS512_0016"
FT   CDS_pept        10947..11282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SbBS512_0016"
FT                   /product="probable addiction module killer protein"
FT                   /note="identified by match to protein family HMM PF05973;
FT                   match to protein family HMM TIGR02683"
FT                   /db_xref="EnsemblGenomes-Gn:SbBS512_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ACD06000"
FT                   /db_xref="InterPro:IPR009241"
FT                   /db_xref="InterPro:IPR014056"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:B2TSF8"
FT                   /protein_id="ACD06000.1"
FT                   /translation="MPYTAKRYQTENGEVPYTDWMKKLRRKDQTAALKVDSRIARAMGG
FT                   NFGDHKFERDGVWELRVDYGPGYRVYYSIEDGEIILLLIGGNKKTQTADLDKAVSYLQD
FT                   FKKRSKK"
FT   gene            11279..11629
FT                   /locus_tag="SbBS512_0017"
FT   CDS_pept        11279..11629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SbBS512_0017"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SbBS512_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ACD06023"
FT                   /db_xref="InterPro:IPR014057"
FT                   /db_xref="UniProtKB/TrEMBL:B2TSF9"
FT                   /protein_id="ACD06023.1"
FT                   /translation="MTATKNVKSQKNDYPASVDHNAAMIEELRADPDYANAYLANALEE
FT                   INEPGGLGGFLVALRQVIEARGGISEAARKSGLARQSIYRALSPNGNPTITTLAQLTSV
FT                   AGLQFTLSKSSH"
FT   gene            11906..12784
FT                   /locus_tag="SbBS512_0018"
FT   CDS_pept        11906..12784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SbBS512_0018"
FT                   /product="DnaJ domain protein"
FT                   /note="identified by match to protein family HMM PF00226"
FT                   /db_xref="EnsemblGenomes-Gn:SbBS512_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ACD06009"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:B2TSG0"
FT                   /protein_id="ACD06009.1"
FT                   /translation="MHQGGVNSLALALTAAFCGANQHNHGLLVSWALQGEGMACAPWYV
FT                   RQRLRRASGRCGSCAALVFSFAPSIRLRGLKNVITITYRVKKREKTCKYDLKVVLLFHR
FT                   KGNGPSHNSPAGQEIKKMNIQEALNVFGLSGELTEKDIKAAYRKAALKYHPDRNPLGAE
FT                   LMKAVNAAFDVLMANIDKINQFQSTDEHARYNYGDDLEKVLNVLSGLSGLVFEVIGNWV
FT                   WISGETITHKETLKEIGCKWAAKKKQWFYRPDEHKSYWNREEHTIEEIRAKYGTTGQRR
FT                   ATGWQRVETRA"
FT   gene            12757..12873
FT                   /locus_tag="SbBS512_0019"
FT   CDS_pept        12757..12873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SbBS512_0019"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SbBS512_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ACD05993"
FT                   /db_xref="UniProtKB/TrEMBL:B2TSG1"
FT                   /protein_id="ACD05993.1"
FT                   /translation="MATRGNQSVTRTGARSPRYYSQPVFWGIEPKKTGTAAT"
FT   gene            12889..13431
FT                   /locus_tag="SbBS512_0020"
FT   CDS_pept        12889..13431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SbBS512_0020"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SbBS512_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ACD06017"
FT                   /db_xref="UniProtKB/TrEMBL:B2TSG2"
FT                   /protein_id="ACD06017.1"
FT                   /translation="MNSFFEQYHPVFEVVCRILGNGWRVNKLDDCSSRIKLTSPQFKNY
FT                   SVHIRMEKDRFSVVGSVDSRSWRSPHHVCTLSRKRNPVDIAADIERKILVNASQEVLQA
FT                   IEYEKHQVEKKDEILILKGMLSQLVQLESWYGALTGFKAENGLNGKVTEQGDSYDLQIR
FT                   GLSIDQLVKITGYLKQL"
FT   gene            13428..13679
FT                   /locus_tag="SbBS512_0021"
FT   CDS_pept        13428..13679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SbBS512_0021"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SbBS512_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ACD06016"
FT                   /db_xref="UniProtKB/TrEMBL:B2TSG3"
FT                   /protein_id="ACD06016.1"
FT                   /translation="MRKNKGDVTYFLEKEGDNYRLTKRIKARTNVKIGNKTTKITLYDA
FT                   VLNENELQHIDFTCAGLREDDETPVKNLIKEFMLNETR"
FT   gene            13666..13893
FT                   /locus_tag="SbBS512_0022"
FT   CDS_pept        13666..13893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SbBS512_0022"
FT                   /product="YajA protein"
FT                   /db_xref="EnsemblGenomes-Gn:SbBS512_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ACD06036"
FT                   /db_xref="GOA:B2TSG4"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B2TSG4"
FT                   /protein_id="ACD06036.1"
FT                   /translation="MKPDNTPENVKKLRLKAGLTQKECSHIYGVGLRTWQKKEEVNTQN
FT                   SQSLSLVEFEFLLLLAGEHPEYVLCKRESK"
FT   gene            13986..14345
FT                   /locus_tag="SbBS512_0023"
FT   CDS_pept        13986..14345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SbBS512_0023"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SbBS512_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ACD06040"
FT                   /db_xref="UniProtKB/TrEMBL:B2TSG5"
FT                   /protein_id="ACD06040.1"
FT                   /translation="MHQGGVNSLALALTAAFCGANQHNHGLLVSWALQGEGMACAPWYV
FT                   RQRLRRASGRCGSCAALVFSFAPSIRLRGLKNVITITYRVKKREKTCKYDLKVVLLFHR
FT                   KGNGPSHNSPAGQEI"
FT   gene            14347..14646
FT                   /locus_tag="SbBS512_0024"
FT   CDS_pept        14347..14646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SbBS512_0024"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SbBS512_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ACD06033"
FT                   /db_xref="UniProtKB/TrEMBL:B2TSG6"
FT                   /protein_id="ACD06033.1"
FT                   /translation="MKCSSVFTSTTNHVFTFERVTLCTIILMHKDTGQQYVVIFTDNNK
FT                   IRDYKTGIVPQFGELKQSDVDLVLFYRDEYEKYFDSLKDGDECLSFKDFIECLR"
FT   gene            14656..15072
FT                   /locus_tag="SbBS512_0025"
FT   CDS_pept        14656..15072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SbBS512_0025"
FT                   /product="putative tail-associated lysozyme"
FT                   /db_xref="EnsemblGenomes-Gn:SbBS512_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ACD06037"
FT                   /db_xref="UniProtKB/TrEMBL:B2TSG7"
FT                   /protein_id="ACD06037.1"
FT                   /translation="MQGHPCIFLKGVDFMKSVYVVGKGLIVAGNKITIDGKEHVSVENS
FT                   ENIVVTDDCIKIGNKTVVFKGRSIKVEIHGNVNKIVTENADVSIHGNAGDVETVSGDVD
FT                   CHQVNGDITTVSGDVTCGDVSGDVTTVSGDINRK"
FT   gene            15069..15380
FT                   /locus_tag="SbBS512_0026"
FT   CDS_pept        15069..15380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SbBS512_0026"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SbBS512_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACD05991"
FT                   /db_xref="UniProtKB/TrEMBL:B2TSG8"
FT                   /protein_id="ACD05991.1"
FT                   /translation="MITESDMLTEAKKMAVEMMFWPACPVDDDYCFDAIMYTSVIDRKF
FT                   EDEHGVYLHQVYKELCSTPELKKLLKKKAIKLIAFKYDIDLDSANKILMKNMLRRIEN"
FT   gene            15463..15600
FT                   /locus_tag="SbBS512_0027"
FT   CDS_pept        15463..15600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SbBS512_0027"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SbBS512_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ACD05999"
FT                   /db_xref="UniProtKB/TrEMBL:B2TSG9"
FT                   /protein_id="ACD05999.1"
FT                   /translation="MSTRQIVQLADSLVKGWETRIPAMKFSEWDQFRWWLNYLQGYEMF
FT                   "
FT   gene            15685..15816
FT                   /locus_tag="SbBS512_0028"
FT   CDS_pept        15685..15816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SbBS512_0028"
FT                   /product="HicB family"
FT                   /note="identified by match to protein family HMM PF05534"
FT                   /db_xref="EnsemblGenomes-Gn:SbBS512_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ACD06013"
FT                   /db_xref="GOA:B2TSH0"
FT                   /db_xref="InterPro:IPR008651"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="UniProtKB/TrEMBL:B2TSH0"
FT                   /protein_id="ACD06013.1"
FT                   /translation="MEDGKEPDTPFKGVFNVRLDPELHRRVAEMAMEEEVSNHRAGA"
FT   gene            complement(15829..15954)
FT                   /locus_tag="SbBS512_0029"
FT   CDS_pept        complement(15829..15954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SbBS512_0029"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SbBS512_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ACD06002"
FT                   /db_xref="UniProtKB/TrEMBL:B2TSH1"
FT                   /protein_id="ACD06002.1"
FT                   /translation="MKEKTGLAGLGIVTAEAVTLFKSSLRCGASGAKRLPCPYRA"
FT   gene            16177..16680
FT                   /locus_tag="SbBS512_0030"
FT   CDS_pept        16177..16680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SbBS512_0030"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SbBS512_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ACD06035"
FT                   /db_xref="UniProtKB/TrEMBL:B2TSH2"
FT                   /protein_id="ACD06035.1"
FT                   /translation="MKMIAFRLSDDELKFAEHNAILSGFTSINAFAKHNVLNIETKPVN
FT                   IPVNNEPAKLVSVRLYPHEIELVKRNAALHGMSMSREIAIRVRQSLLKSEVCLYPDEVK
FT                   ELKKLSTAVDRVGRNIHFIIKGERFCTVNDPDFRKDVIEVIELCKRIDSKLETLTKSVV
FT                   NRFG"
FT   gene            16684..17913
FT                   /locus_tag="SbBS512_0031"
FT   CDS_pept        16684..17913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SbBS512_0031"
FT                   /product="nickase"
FT                   /note="identified by match to protein family HMM PF03432"
FT                   /db_xref="EnsemblGenomes-Gn:SbBS512_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ACD06024"
FT                   /db_xref="InterPro:IPR005094"
FT                   /db_xref="UniProtKB/TrEMBL:B2TSH3"
FT                   /protein_id="ACD06024.1"
FT                   /translation="MGVYVEQEYRIKRAKGTGRDPKSPKLSGRHIHASKSAFNHKVRHG
FT                   ADKKAYTWTPTKEVTFKITGSGKTAAGIKNGIDYITRNGELEAYCYDGKGSEQTGKGED
FT                   FNREFTSTLSKGNDYSRTYRGENIDHVKNMVFSPPPEAGVSREDALKATVEFLKETYPN
FT                   HAFVAVYHDDKEDHPHVHVNIKLRDEETGRRLRLTKSETRKFRNGFHRKLKGMGYDVTA
FT                   TWKKDPERKREIERLQAENPKRLRNVYKVVDFGETSYQNKAGEKRTPFLTYETLKGGKQ
FT                   VTIWGKDLKNHFESEKLQPGTLIKVKKLAPTLVHSPMFNDDGTVAGYRETHRNNWQIEN
FT                   IALERNRERQVHERETRQPEESDVKKQLSRKHEQGHNIGFALEYGFTKDSEEHKKLRIQ
FT                   QERNWKGLGF"
FT   gene            complement(18097..18222)
FT                   /locus_tag="SbBS512_0032"
FT   CDS_pept        complement(18097..18222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SbBS512_0032"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SbBS512_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ACD06028"
FT                   /db_xref="UniProtKB/TrEMBL:B2TSH4"
FT                   /protein_id="ACD06028.1"
FT                   /translation="MSTSVLIPANETPPSSALTESRYFLTVEGFSPLKSAISFRV"
FT   gene            18280..18495
FT                   /locus_tag="SbBS512_0033"
FT   CDS_pept        18280..18495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SbBS512_0033"
FT                   /product="Eex protein"
FT                   /db_xref="EnsemblGenomes-Gn:SbBS512_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ACD06001"
FT                   /db_xref="UniProtKB/TrEMBL:B2TSH5"
FT                   /protein_id="ACD06001.1"
FT                   /translation="MKKYLLFALPFFVVGCSEEVKSVDWWGQHLTEAKQKQAECEKSGS
FT                   DSQNCKNVKQALFIQSQKDAPVPTFD"
FT   gene            18673..18849
FT                   /locus_tag="SbBS512_0034"
FT   CDS_pept        18673..18849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SbBS512_0034"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SbBS512_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ACD06003"
FT                   /db_xref="UniProtKB/TrEMBL:B2TSH6"
FT                   /protein_id="ACD06003.1"
FT                   /translation="MKEKPDKSSEKGVYVTIKLDPRLNAFIEEKTKTSLLSKRKQIIYL
FT                   LMQSMRIDGYMER"
FT   gene            18852..19472
FT                   /locus_tag="SbBS512_0035"
FT   CDS_pept        18852..19472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SbBS512_0035"
FT                   /product="pilx1 protein"
FT                   /note="identified by match to protein family HMM PF01464"
FT                   /db_xref="EnsemblGenomes-Gn:SbBS512_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ACD06030"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:B2TSH7"
FT                   /protein_id="ACD06030.1"
FT                   /translation="MASLFPALLLCAASVHPDTINDIARVESGFNPYAVAEIIPERERG
FT                   SYGKSVISHMPKSKEEALTVIREIENRKRRYSVGLMQITSSNFSFYSTSAEKLLDSCEN
FT                   LSVFEKIIVDCYKRGRSLENALSCYYTGNFSNGKRKEKEFNNTSYVERIGYTGNEKKYV
FT                   VPGTRSNGGEQRKNRSHNASVIWPETILKSAFVDNSHPTKVIN"
FT   gene            19486..19812
FT                   /locus_tag="SbBS512_0036"
FT   CDS_pept        19486..19812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SbBS512_0036"
FT                   /product="type IV secretory pathway VirB2 component"
FT                   /note="identified by match to protein family HMM PF04956"
FT                   /db_xref="EnsemblGenomes-Gn:SbBS512_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ACD06012"
FT                   /db_xref="GOA:B2TSH8"
FT                   /db_xref="InterPro:IPR007039"
FT                   /db_xref="UniProtKB/TrEMBL:B2TSH8"
FT                   /protein_id="ACD06012.1"
FT                   /translation="MSFKKSVCNCISSSVTAVMQRKNKVVMAVAGATVASPAFADGFSK
FT                   AETLLQKVKTGLGGLSLVTVTIACLWVGYKVLFGGSTIRECSPIIIGAIVIASAAEVAS
FT                   MMVN"
FT   gene            19831..22578
FT                   /locus_tag="SbBS512_0037"
FT   CDS_pept        19831..22578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SbBS512_0037"
FT                   /product="triC protein"
FT                   /note="identified by match to protein family HMM PF03135;
FT                   match to protein family HMM PF05101; match to protein
FT                   family HMM TIGR00929"
FT                   /db_xref="EnsemblGenomes-Gn:SbBS512_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ACD05992"
FT                   /db_xref="GOA:B2TSH9"
FT                   /db_xref="InterPro:IPR004346"
FT                   /db_xref="InterPro:IPR007792"
FT                   /db_xref="InterPro:IPR018145"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2TSH9"
FT                   /protein_id="ACD05992.1"
FT                   /translation="MSTLYKAMTRPAMYVGVPVVPLTVVAGALFLAGVYISKLIWLAIP
FT                   VAVFILRMITKQDDHIFNLYFLKLKMLGNSVCNRFFGARAFLSGQYEAVEIDEFVNAMK
FT                   LNERITTGKYIPYSSHVDKNIVKTKNGDYVATWQLMGINFESISAEMLETIDSQVATLV
FT                   RSFSGLPVSFYNHSCRASFYDAFTTKSGNKYADIISDCYYGSMKKNKFKGNTLYFTLIY
FT                   RPDGRVEKLEKRKKSIKEKKDDIHIHVKRMNEMINTFSGALDKFTCKLLGMYEENGKVF
FT                   SSQLSFYNYLLTGKLQKIRVTDSPVYNVLGGVDVFFNHDTGQICRIDGNKFFRSIEIKD
FT                   FCSETASGVFDVLQYSDADYIITHSYTSMSKSEALSTIKRAEKQLKSTEDDAVTQLQEL
FT                   EKAKNDIVSGDISFGYYHFTIMVMADSIRELDESVSKITADFTDLGIIPALSTMSLPAA
FT                   YFAQLPAVFHLRPRLSPVSNVNFVELASFHNFYQGKRDKNCWTEAVAILKTPSKQAYYL
FT                   NLHNSVLFKDETGEKNLANTKVIGTAGSGKTMFLSYLACSLQKYNNPETFADSAKNKKL
FT                   TCVFLDKDRGAELCIRMLGGEYYTVKSGEPTGWNPFALEATKRNRIFVKQLMEILCTRN
FT                   GERLSTRERLLISESVDAVMDFPPGEMREYGITRMLEHLMQRDDRDEQENGIILRLSQW
FT                   ANSQAHGWVFDNAKDTFNIQHVNNFGIDGTEFLDDPMVCAPITFYLLYRITQLLDGRRL
FT                   VIFLDEFWKWLQDEAFSDFVYNKLKTIRKLNGLVIPATQSPDEILKNKISRAVVEVCST
FT                   SIYLANPDADYNDYVEGLKLTPEEFNIIKNLDPMSRQFLIKKSSLKKGDGKSFSALATL
FT                   DLSGLGGYLKILSASADNLEIFESIYHEGMEPDDWVPEYLERAI"
FT   gene            22590..23306
FT                   /locus_tag="SbBS512_0038"
FT   CDS_pept        22590..23306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SbBS512_0038"
FT                   /product="type IV secretion system VirB5 component"
FT                   /note="identified by match to protein family HMM PF07996"
FT                   /db_xref="EnsemblGenomes-Gn:SbBS512_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ACD06020"
FT                   /db_xref="InterPro:IPR014158"
FT                   /db_xref="InterPro:IPR023220"
FT                   /db_xref="UniProtKB/TrEMBL:B2TSI0"
FT                   /protein_id="ACD06020.1"
FT                   /translation="MKRVKTFMLISLLTASFYSSAGIPVAVDASPEWAVEAARWTERLK
FT                   QWSETAKHYQGQIQAYKDQLATATGIRNIAAFTNELSNLQSELTNIYKQGNSYISDFTS
FT                   NPEGALSSQAKNLFSKYGAFDMCNTGYERNDNLCKARIVSTAASIEQGNEINKQLSSAM
FT                   SQIQSLSSRIEASKDIKESQDLANALQAQSLKMQAIKMQYDVWNNKNKADHEMLLTHEQ
FT                   EAFIKQQKEAEPLTFD"
FT   gene            23318..24412
FT                   /locus_tag="SbBS512_0039"
FT   CDS_pept        23318..24412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SbBS512_0039"
FT                   /product="TriE protein"
FT                   /note="identified by match to protein family HMM PF04610"
FT                   /db_xref="EnsemblGenomes-Gn:SbBS512_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ACD06008"
FT                   /db_xref="GOA:B2TSI1"
FT                   /db_xref="InterPro:IPR007688"
FT                   /db_xref="UniProtKB/TrEMBL:B2TSI1"
FT                   /protein_id="ACD06008.1"
FT                   /translation="MAQGFFVKYNSTVMDSVDKISSSYQTQFANDIMSLVTVSVTLYVL
FT                   WKGYQILASKTQTPLQDLVWDLSKFAIIIMFITNADGYLTAATDALQGMKDGFSGGVSV
FT                   WQTLDNLWKSTQNLGAEIYSLDKSTYVKDQGVVGQFLIWTGSLILMAVSVVVFLTADVT
FT                   MKLLIITAPIFIFCLMFGFIRSMFNNWLQSLFSSILTVLFASLVIRIAMDFQGMILSHA
FT                   IRAAQTGNVNLVSTGAMGFMAGFLGALLVLIAKGFAVQLAGAGVEGAVQGAAMMGLGAA
FT                   GMATGKSLMLGGRAGLGFGLGMAGRTGMNSLSGKAGNLMGRGARTAAEWAGEKGYQALA
FT                   PTGALGMKARRLASLEKARARNAA"
FT   gene            24418..24588
FT                   /locus_tag="SbBS512_0040"
FT   CDS_pept        24418..24588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SbBS512_0040"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SbBS512_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ACD06022"
FT                   /db_xref="GOA:B2TSI2"
FT                   /db_xref="UniProtKB/TrEMBL:B2TSI2"
FT                   /protein_id="ACD06022.1"
FT                   /translation="MKRFFYVMSLNWILTFVDKHITSGWSRKRKLITQLIILITGITLF
FT                   KVLGGISQSWL"
FT   gene            24590..24793
FT                   /locus_tag="SbBS512_0041"
FT   CDS_pept        24590..24793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SbBS512_0041"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SbBS512_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ACD06025"
FT                   /db_xref="GOA:B2TSI3"
FT                   /db_xref="UniProtKB/TrEMBL:B2TSI3"
FT                   /protein_id="ACD06025.1"
FT                   /translation="MLHYFVMILYFVLILLLGVFTCFAGIRLGLGLAGKWRKGMDLRFL
FT                   LLIGGILFLHLGLYLFKVFVNA"
FT   gene            24806..24934
FT                   /locus_tag="SbBS512_0042"
FT   CDS_pept        24806..24934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SbBS512_0042"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SbBS512_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ACD06032"
FT                   /db_xref="UniProtKB/TrEMBL:B2TSI4"
FT                   /protein_id="ACD06032.1"
FT                   /translation="MRCVILLFFLFQISGCTTRNTLPSDVSGELEPINHSQVISYE"
FT   gene            24927..25613
FT                   /locus_tag="SbBS512_0043"
FT   CDS_pept        24927..25613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SbBS512_0043"
FT                   /product="TriG protein"
FT                   /note="identified by match to protein family HMM PF04335"
FT                   /db_xref="EnsemblGenomes-Gn:SbBS512_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ACD06029"
FT                   /db_xref="GOA:B2TSI5"
FT                   /db_xref="InterPro:IPR007430"
FT                   /db_xref="InterPro:IPR026264"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:B2TSI5"
FT                   /protein_id="ACD06029.1"
FT                   /translation="MSEKIEKKIETAKSFERQLYAENERSKKNAWRVAVAASLLSLCLG
FT                   AAICVLVPLKEKELAIVAVGEKTGRTELITQVKQEKILQSEALGRYFVNTYITLREGYN
FT                   YPSLQYDYETVQLYSSNTVKDDYLRLYNSDMAPDKIYHNNGSYVAVEVISNIISDATAP
FT                   DKLASVRFKKTTRNFTTGQVSVSYWTARVTYRFEPEKSVKSSSRELNPLGFTVTSYQTD
FT                   REARGE"
FT   gene            25613..26518
FT                   /gene="virB"
FT                   /locus_tag="SbBS512_0044"
FT   CDS_pept        25613..26518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="virB"
FT                   /locus_tag="SbBS512_0044"
FT                   /product="P-type conjugative transfer protein VirB9"
FT                   /note="identified by match to protein family HMM PF03524;
FT                   match to protein family HMM TIGR02781"
FT                   /db_xref="EnsemblGenomes-Gn:SbBS512_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACD05998"
FT                   /db_xref="InterPro:IPR010258"
FT                   /db_xref="InterPro:IPR014148"
FT                   /db_xref="InterPro:IPR033645"
FT                   /db_xref="InterPro:IPR038161"
FT                   /db_xref="UniProtKB/TrEMBL:B2TSI6"
FT                   /protein_id="ACD05998.1"
FT                   /translation="MKKLFIATCLLLPGLVYSAATPLPSGFDARMQTVSYNGANTTVIR
FT                   SKTGFLTSVVFDEGEAVISAKAGFPAGWEITTDDNVVYINPRPVVQEQEGDEGEKLKKV
FT                   FQPTEKEWDTNLFVRTTKRIYSLDLILLSEEKQAQPAYVVQFRYPSEIAKKNAEEVRLA
FT                   KEKQEKLRQKKLISESFEKADAPKNWNYFMRVNEKYDSRRIAPDFAYDNGIFTFLGFNS
FT                   GKAFPAPFAVRDGQEQTLAFNVETKGKYKIMVIHNVNDKFVLRYGNSVVGVVNKSFGKV
FT                   LTDQRNTSSPAVERVEVNND"
FT   gene            26511..27620
FT                   /locus_tag="SbBS512_0045"
FT   CDS_pept        26511..27620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SbBS512_0045"
FT                   /product="bacterial conjugation TrbI-like protein"
FT                   /note="identified by match to protein family HMM PF03743"
FT                   /db_xref="EnsemblGenomes-Gn:SbBS512_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ACD06038"
FT                   /db_xref="GOA:B2TSI7"
FT                   /db_xref="InterPro:IPR005498"
FT                   /db_xref="InterPro:IPR042217"
FT                   /db_xref="UniProtKB/TrEMBL:B2TSI7"
FT                   /protein_id="ACD06038.1"
FT                   /translation="MTDMKKTDDLVDDANQSKLESKPVHDIGDIRNKNNRMRSGFLFGL
FT                   MAVLVIGIFALKTYKNYFADDQQKASESTGDTSISQVSKIRTGLGQNFDPVENKAIINP
FT                   GASGSGNTVSDGHKEVPQEGFRKYLSIPVAGQGGSQTGASGSSRTSEPQEERKESKENV
FT                   PGKSGMKVTAINLDPDLYIEENRLIPCALTTRFVSDVAGRISCVFTEDVWSANHHTKLL
FT                   EQGTKAFGRYQTGTLNHGQGRMFVMWEQLRTPDNKRIDMVNTAAAGPLGEAGIDGWIDS
FT                   HFWERFGGSLMLSMVQDVAAAAADNAPGKDRNVDYTENSRQAMAEMAKVALENSINIPP
FT                   TMYKNQGDIITIMVGEDIDFSDIYELKVK"
FT   gene            27622..28650
FT                   /gene="virB"
FT                   /locus_tag="SbBS512_0046"
FT   CDS_pept        27622..28650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="virB"
FT                   /locus_tag="SbBS512_0046"
FT                   /product="P-type DNA transfer ATPase VirB11"
FT                   /note="identified by match to protein family HMM PF00437;
FT                   match to protein family HMM TIGR02788"
FT                   /db_xref="EnsemblGenomes-Gn:SbBS512_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ACD06015"
FT                   /db_xref="GOA:B2TSI8"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR014155"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2TSI8"
FT                   /protein_id="ACD06015.1"
FT                   /translation="MNGVIPVSISNKSLDFYKNQVFQSFLDIEGLTEIAVNRPGEIWTE
FT                   INGDWTFHNNDSVTFDFCKRFSQTLASFRGDEISDTKPLLSATLESGERVQVVFPPACE
FT                   RNTISITIRKPSTRQITHKEYVANGFYDYVQSGKKHRTYDDELLDLFRARNIAAFMELA
FT                   VAAGKTIVFAGATGSGKTTYMKSLIDFIPLNTRLITIEDAEEIKFFIHKNYVHLFYPSE
FT                   SGSDSGSIITAAKLIKSCLRMKPDRILLAEIKGGDAWDFVKVAGSGHSGSMTSIHAASA
FT                   KDAIIQMVTKCYQNRECQNLPFDVLRKIIMDSIDIVVHVGRDGVVRHMSDIYYKGAECE
FT                   NF"
FT   gene            28637..30499
FT                   /locus_tag="SbBS512_0047"
FT   CDS_pept        28637..30499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SbBS512_0047"
FT                   /product="TraG/TraD family protein"
FT                   /note="identified by match to protein family HMM PF02534"
FT                   /db_xref="EnsemblGenomes-Gn:SbBS512_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ACD06018"
FT                   /db_xref="GOA:B2TSI9"
FT                   /db_xref="InterPro:IPR003688"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2TSI9"
FT                   /protein_id="ACD06018.1"
FT                   /translation="MKTFNKSQSVFIFAVMLVAAWFAGSFIFFVLYFSQIKNLKPLKAV
FT                   FRSIDAYRMDIFTDSLTLSVVTTDIRVLAFVALGAGFVVSLIIPVAALIKLNEKKENIF
FT                   GDARFATINDIRESNSFTLDGDEKDGIIVGIKDKKIIRYVGAAFSAMGAGTRAGKGAGI
FT                   VITNLMKYWWSVIILDPKRECFNITSLIRKVILGHEVYKFDPFSPVTHRFNPLYYVSMG
FT                   TSEGFNQLENLSLIIYPYKTDGADAGSYLNKTAGGVFKSYAVALWFMIKNDKAGLKTLD
FT                   IEPVFSMSKINQLFERAEPEHLLSFMNDIRSELRGKDKTLADIGVAGLKAFIEMEDKTK
FT                   AQLKSNFLNGLSPFANPNVANATDGNDFDLRQVRKKRMTIYFCISGDNARLAEKITNIF
FT                   FQLGIQVNLEKMPTDDPEIKHDCLFLLDEFPSIGAVDYIKSKSGLIAGYKLKLLIVYQV
FT                   GSQLEEIYSYAGSKTLLASAPCKIVYSASDVKDARELSEAMGTRTVTIGSKSKSRSRGG
FT                   TSRSESENLIERPLVTTNELLTLKFSEEILAMKGENPIRCEKAFYYLHEYFFGDFVKVA
FT                   PELANIFPRKKGKLVMPPQKVFENEIVAKGYLAVKDVPDLDKAA"
FT   gene            30511..30930
FT                   /locus_tag="SbBS512_0048"
FT   CDS_pept        30511..30930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SbBS512_0048"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:SbBS512_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ACD06007"
FT                   /db_xref="InterPro:IPR025264"
FT                   /db_xref="UniProtKB/TrEMBL:B2TSJ0"
FT                   /protein_id="ACD06007.1"
FT                   /translation="MKKLVFLLISILAGCSSPPEPTPAQFEKANEVINPSLPYVPDFHG
FT                   VIKSEVSGKGWVYEITSLSGVQARTPTFYYALAHADRVVVTTHDAGLWFRIRDLLKMEG
FT                   ATAVVEWRNEKSFLPEQVKIVFIKAQNEVKNDWKK"
FT   gene            30932..31219
FT                   /locus_tag="SbBS512_0049"
FT   CDS_pept        30932..31219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SbBS512_0049"
FT                   /product="killer protein"
FT                   /db_xref="EnsemblGenomes-Gn:SbBS512_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ACD05989"
FT                   /db_xref="InterPro:IPR009989"
FT                   /db_xref="UniProtKB/TrEMBL:B2TSJ1"
FT                   /protein_id="ACD05989.1"
FT                   /translation="MVLPVFLALGLISTNANASDPCASVLCLYGKAVGQGGGSECRSAE
FT                   KDFFNILKKKKGSIRWSKTFDARKAFLNQCSTADPAAISKIMSKFGRVRG"
FT   gene            31274..31513
FT                   /locus_tag="SbBS512_0050"
FT   CDS_pept        31274..31513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SbBS512_0050"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SbBS512_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ACD06019"
FT                   /db_xref="UniProtKB/TrEMBL:B2TSJ2"
FT                   /protein_id="ACD06019.1"
FT                   /translation="MSEIRFVTLASDINNIKEVYSDDELKRLLEAVNQNCPARIVLGSV
FT                   EKGKEVPLKWCFRTIPERISVEEINEVKIYPELF"
FT   gene            31631..31924
FT                   /locus_tag="SbBS512_0051"
FT   CDS_pept        31631..31924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SbBS512_0051"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SbBS512_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ACD06021"
FT                   /db_xref="GOA:B2TSJ3"
FT                   /db_xref="UniProtKB/TrEMBL:B2TSJ3"
FT                   /protein_id="ACD06021.1"
FT                   /translation="MRVAGIEIIDSVKTVAFVFTETLLFMVWFSAIVYGLYRVVIVLWD
FT                   DPLKPQSLMEFLNFIVELYSYVLPSLAVIAVALIAVLSICKILSAIWEGRKQ"
FT   gene            31921..32415
FT                   /locus_tag="SbBS512_0052"
FT   CDS_pept        31921..32415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SbBS512_0052"
FT                   /product="protein ParB"
FT                   /note="identified by match to protein family HMM PF00565"
FT                   /db_xref="EnsemblGenomes-Gn:SbBS512_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ACD06006"
FT                   /db_xref="InterPro:IPR016071"
FT                   /db_xref="InterPro:IPR035437"
FT                   /db_xref="UniProtKB/TrEMBL:B2TSJ4"
FT                   /protein_id="ACD06006.1"
FT                   /translation="MRHFLKALSFVVSLLPATLCAAEIQGKVIRVLDGDTIEVKTLPAK
FT                   IVVYEVPIRVRLINIDAPEKKQPFGRWSTNQLKTLLAGQSVTVSYTQTDRYGRIIGRVF
FT                   TTNGTDASRFMVQSGAAWVYERYNEDESLPALQREAQEQKRGLWADANPVPPWEWRYKH
FT                   N"
FT   gene            32431..32835
FT                   /locus_tag="SbBS512_0053"
FT   CDS_pept        32431..32835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SbBS512_0053"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SbBS512_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ACD05996"
FT                   /db_xref="UniProtKB/TrEMBL:B2TSJ5"
FT                   /protein_id="ACD05996.1"
FT                   /translation="MALSPKEKKELQQRFEKQLLPDLDLSFELNGEVYKFNFDKNESGD
FT                   YIDSFTQAVWGGYQDAEEWEKYGKHQETELPECPEPVEGWCDCDKCKSMIFHKEKNIYV
FT                   CLSCHKQTEPFLPIDWNSNDYDWLPYEDEY"
XX
SQ   Sequence 33103 BP; 10151 A; 6185 C; 7507 G; 9260 T; 0 other;
     aattcttgat gaatatccgt gggtaagtgg ttggcttgat tcacaggaaa agtttttggt        60
     cgctcttgct gataagtctg gtatcgatat caacaaatca ggacttattt gagcacacta       120
     aagataaagg aaattactat gtatatacat attgttccta aactttatca tctcatggct       180
     aataaatgta gccttaaatc tatttccata cctgagcttg attttataat tgatagtgaa       240
     tcattgtctg taggcagacc gtggcctaat aaatgtttat gggttggaat gcgaaaagga       300
     aggaagtcag ttaatggcct cgttttgcaa acagataaaa aattaagatg gtttactact       360
     atatacacct gggatattga agatatgggg ttaatttacc atcaagtcaa tacctatata       420
     gaagatgatg attttgatat ggtttcacag gaaattcttt taaatggttc ttttgataag       480
     tggagtaaca gggttcattc agcttatgaa aataagcctc cagccagaat ccagcccaaa       540
     atggagtcct tattaaataa acctggtgaa aacagtcatg atgtgtggga agagttcgaa       600
     tggggtgact tccttctgtc cagagaagaa agccttttac ttcacactat tcagtctgaa       660
     cgattgagta cagattgctc tttattcaaa agacaaccgt ctattgaaag tgcattagtt       720
     atttaaagga taataagatg agacttttta tcgcagaaaa acccgcagta gcaaatgata       780
     ttgttaaggc acttggtggc aattttaccc gccatgatgg ctggtttgaa agtgataacg       840
     ccattgtgac taactgtttt ggtcatatta tcgaatcaca accgccggaa aactataatc       900
     ctgaatacaa agcctggaag gttgaaacgc ttcctttacg tctttatccc gtgaagtatc       960
     agcctgttga aagtgccgca aaacaggtta aaacgattct cgaacttatc agacgtggag      1020
     acgtgactga aattgttcac gctggcgatc ctgatgatga gggacagtta cttgttgatg      1080
     aagtcctgga atatgcaggc aacacaaaac ccgtaaagcg cgttctgatt aacgacaaca      1140
     cgcttccggc agtgaaaaag gcactggcaa atcttaaaga taatcgtgat ttcaaagggc      1200
     tttaccttaa ggcgctggcg cgttcagttg ctgatgccgt ctatggcttc tccatgacgc      1260
     gtgcttacac cattcctgca aaagccagag gatatcaggg cgttctgtct gtcgggcgcg      1320
     tccagactcc cgttcttggc ctgattgtga atcgtacccg tgctaaccag aaccataaat      1380
     ccagttttta ctacaccatg accggagtct ttcagcgtgg tgctgatgtt atcagggcga      1440
     actggaagcc aggggaattt gctccgctga cagaccgtaa attacttgat aaagcgtggg      1500
     cagacggaac ggcagcctcc cttgcaggaa aaccggctac agttgaagcg gcagcaactg      1560
     atgataaaaa aacggctgca ccgttgccct ttaacctggt acgactccag caatacatga      1620
     acaaaaagtt caaaatgacg gcacaaaaaa cgctggatat tacgcaacaa ttacgtgaaa      1680
     aatataaagc gattacttat aaccgctctg attgctcata tttatctgat gaacaattca      1740
     gcgaagcgcc gcaggttatc gatgccctga aatcagtctt tcctcagtcg ctggatattg      1800
     attcttcacg taaaagcaaa gcgtttaaca gtgcaaaggt gactgcgcat actgctataa      1860
     tcccgaccgc cagtgtgcct gatgttaacg cactcagcac cgacgagcgc aatgtttacc      1920
     tggcgatcgc acaacactat cttgttcagt tcatgcctga aaaagcatac caggaagtat      1980
     cggttgccat tcagtgtggt gatgagtcgt tctatgcccg tgccagaaaa acaactgaca      2040
     gcggatttga ggcgtttctt ggcgcggaaa ccacagacga aggtgaatca gaagataatg      2100
     atgattccgc ttttgaactg ctctgtaaaa ttcgcacagg agaaacactg acgacaaaag      2160
     aagttattgt taatgagaag aaaacaacac cgccgccgtt attcaccgaa gcctccttgc      2220
     ttgctgcgct tgttcgtgtc gcggattttg tcactgaccc aacgattaaa aaattgttga      2280
     aggataagga taaagacaaa aaagatgaac atggtggcat tggtacgcca gctacccgcg      2340
     cagccattct ggaaacgctg aagaaaagaa actatatcac gctggaaaaa gggaaactta      2400
     ttcctactga taccggatat gcgcttattg atgccctgcc tggtatagcg gttaatcctg      2460
     atatgacagc attatggtct gaaaagcagg ctgccataga aaatggcgat ctgacggttg      2520
     aacagtttat taatgatctg tacggtgaac tgacaggcat gatttctgat gttgacctgg      2580
     gcgagatgaa gattgaaccc gctgcgccag cagggcagtt tcaacgcctg gactctccct      2640
     gcccttcctg tggtaaacat attgttatca ggccgaaagg ttatttctgt accggatgtg      2700
     aatttaaaat ctggagtgag ttttatggta agaaaatcac ccaagcacag gccgaaaaac      2760
     tggttaaatc agggaaaacc gatttgatta agggatttaa aaagaaaagt ggtggaacgt      2820
     atgatacagt tcttgtcctt gaggataaga aaacagggaa actgggtttt ccggcaaggg      2880
     ctaagaagtg aaaacaaagc aggaatggct ttttcagtta agaaaatgta catcaagaga      2940
     tactcttgaa aaagttattg agattaaccg ttacaaactg cctttatcag aatcagaggc      3000
     attttattct gccgcagatc atcgccgagc agaactggtg atgaataaac tttatgataa      3060
     ggtgccttcc ggcgtctgga agtacgtaca ctaaataaga ggattaatta tatgagcgaa      3120
     ctgactaaag aagatgaata cggcattatc agccgtacta tgatgaatat tcgttcattg      3180
     cgtgtttttg cccgtgaagt tgattttgag caattgctcg aaatgcagga taaactgaac      3240
     gttgttgttg aagaacgtcg tgaagaggct gaacgtgaag cggttgaacg ccaggaactt      3300
     gaagccaaac gtcagcaggc cattgaatac atcatatctt taggtcttga tcccgaatca      3360
     ctccttgctc ctgtaacagc agatacagta aaaaccaggc ggaaagccaa aggcggagta      3420
     agaaaggcta aataccgctt taaggatgaa aatggcgaga tcagagaatg gtctggtaat      3480
     ggcaagcgtc cgcttgcttt acagaagctg cttgatgagg gccatttcat ggaagatttc      3540
     ctcattgaca aactgcaacc tgggcaggtt gaataaaata atcgtgatgc cgtcgcaaac      3600
     aagtttgcga cggcaaatgg aggggacaga acagccagcg gcgctggcaa gaaattttat      3660
     cgtttgataa agagggaaaa tgatgatcaa atcaaaaaaa gtagtggtta tttttgttgc      3720
     tttgagttca ttcttgctgg cagggtgtga ttcaccaaaa gatgctaata agcaaaactt      3780
     tgaaaaagct attaatactc gactagagaa ggaatgcatt actattagtc cgctgggaat      3840
     gtttgatagt aagccttatc cggttcaggt agctgtggct caggctaatc gatatacatc      3900
     tcaggaacgg gcagatgaaa taaattctcg acagttttct gcgctggatg tactggtcaa      3960
     agccgattta ttaacagtaa aagataccct ggttgatgac gttattggtt ttactaagac      4020
     gggtaagaaa gtgccaggcc gtgaatatgc tctgacagat gaggggaaaa aatatctgaa      4080
     gtctccggaa cggcctgatt tttgcgttgg tcattataag gtggatgaga tagttgattt      4140
     taccgaacct ggtgatgcta tgggaatgaa gatcacgcag gtgaattaca cattcagtcc      4200
     caccagtatc gctgaatggg cgaaacgcga tgatgttcgg acagcatttt taggacttga      4260
     gtctgatttg aaagagaaac aaacaaaacg tattacactg gttttgaaaa atgatggatg      4320
     gtctgctgaa cggtaggctg taatggtgtt gctacgtgaa aaatccccca cgtatatccc      4380
     ctactttttc acggatttca cgtagcgcac cgccgttaat gactctatca aaaatactca      4440
     ccgatatttt tcacaccgca aacaacctaa cttactgtaa aacaacaaat cagctttgcg      4500
     ccggtgacgc atcgatcgcg ctgaccagcg cgatcctcag ctgcgaccgc tacagtattt      4560
     ttgaacaaga ttacccttgc tccggtttaa ttcgccaggc agttagacat acaggtgatt      4620
     ctgtccagat ttcattagtt acaacattca catgtcccgt tcctttatcc ggtgccctgt      4680
     tccagtctat gtgcccatat cctgggttat tcaggataac cgcttccttt tcgccctgcc      4740
     ctgtcgttca tatcccccta gacaaaaatg cattatcgga aaaaatgtcc aaaaattttt      4800
     ttggtgatcg gaatttttgt tgtcggacgc acctctgctt caggtcataa ttgctggcac      4860
     gtccaaaaaa acaggtgcgg agattaaaaa attgagtcat ttacccgcca gcattttcca      4920
     gatttcacgt agcgacgctt ggaatttaac cctctctccc gatgcagccc gtaatatgcg      4980
     ggatcttgca gcacagattg gcgcaggaat gccgaaatat ctgatagcac cggaagtctc      5040
     actgcttctc tcctacatcg atgatctgaa catccgtatg tattttgaga cgctctggaa      5100
     taccggagca cgactgaacg aagctctggc actgaaacct gccgatttta tgctgactcc      5160
     gacgcggcag tacccgcaac ccgtggtgat cctgaaaaca ctcaagcaac gtctaaaaga      5220
     agcagaaaga agaccaggac gcccgaccac caggcatcca ccattacatc ctgatccgcg      5280
     atacagaaaa ccacaggagc ctgctgtaag gctggttcct gttctggatg ccggatacgc      5340
     attgcgtatg cgggaatacc tggcgacctg gaaaaagcgg atcaaacatc agcctgtgtg      5400
     ggacataaca tcgagacaga caccgctgaa ctggataaac accgcagtgg cacgggcaga      5460
     gcgtgacggc gtaacatttt cggttccggt cacgcctcac acgtttcgcc acagttacgc      5520
     catgcacctg acaatgagtg gcgttcctcc gcgcgtcctg caatccctgc tgggacaccg      5580
     ttatgcaaga agcaccgaga tttacacccg cgttttttcg ctggacgtcc tgacaggaag      5640
     tggcctgtcc tttacctgcg atccacggcg agcaaaacag cttctcggat accctgaacg      5700
     cattaatgat gagtaataat acacatcatt aaactgttgc cagcacgcaa tagtacggtt      5760
     atactttcac cacaaaagat tgtgtattaa tacacactat ttaaccggga gggttttgtg      5820
     atgggaaaaa tcattacagt tgcagggcat aaaggcggca taggcaaaag caccgtgctt      5880
     tgttccttat gtgtctgtgc catcaggaaa gggaaaacag cctgtttcct ggaaacagac      5940
     tcgcagggaa gcatcaagga cttcattgag gaacgtaaaa ccaacgagcg gctgtctgaa      6000
     ataccgtatt tcgagtgcta cacagatatt ccggcgatgg cacgaaaact ggctgcccgc      6060
     tttgattatg tgtttgttga tacgccagga atgaaatctc cggccttcgt taaggcactg      6120
     agttgtgctg acattctgtt cacattcatt gagccaggag caggcatcga gatcaacacg      6180
     ctgggacggc tggttttcga cattaaaaca gcacaggccg gagtcaatcc atcaatgaaa      6240
     gcatggattg tcctgaataa gtgttcaact aatccgtcag acagtgaagc gtcagaactg      6300
     cgccgacaac tcaatgatga tcctgactgg cttccggttc cccgccagcg tatctatatg      6360
     cgtactgcgc ataaaaaagc ctataacagt ggtatgggcg tacacgaata cgatgataaa      6420
     cggggaaaca aagcccgtgg agagattgaa ttactgttaa aagaaacgga tgttctgtaa      6480
     tgtgtattat tacacactat aagcgatgat atactcacac ccttaatagt gtgtataatt      6540
     acacacctta ctaaaaacag gataccgaat ctaatggcaa agctcccaaa gaaaattgat      6600
     caggaaatta aaccgctgga tttacgccag tttgtaagtt ctgctgcaca aaaaccagca      6660
     tcggcatccg cagtaacgcg tataaatctg accatgacag atgatgatct ggatacagcg      6720
     caggtgttcc agaacaagta cggcgcaagc cgtgctgaag ttatcagagc agcactggca      6780
     gcgctacgtc tggtatcagc agaagaacgc cggaggctgt ttgatgatat aaggaaaaac      6840
     agcccgaaag caggaagacc aaccgtgaat aaatagtgtg ttttattaca caccattaaa      6900
     ggagtacaaa tatgcttatg aaggccatta aatctgtatt caatttttac atgctcaatt      6960
     tgcagccttt tattggagtg gttcttgcgg gttatggtgt atggaaattt tcaggtgaca      7020
     gtatctcagc attactggaa ccagcatcgt actttgtcat tggaactgtt gttttgtttg      7080
     tatggtatat agcatggcaa aaagaacgtt ctaaagaaga agagtttaaa tcaagtataa      7140
     aaccagaaga ttttgtgaag tgaggatacg gaataatgcc agcttataac cagacattag      7200
     ggcactttag gggattttca atctatggaa cactgcatcg ttgatttagg cattataaac      7260
     tatcatcctg tcattacatg gacagtacct gttgcatttt tctttttagt agtgctggct      7320
     ggtatagtat tcaatattgg caggaaaagt aatctaatcg ttttcatcct ggcaatgttg      7380
     ctcccagtaa caacggtttt catttttatg ttactgggcg gtaagatcga tatgtgctga      7440
     tcaattaaaa gaggattata caatgataaa ttcaatcgcg tttagtctta tagcgttatg      7500
     tataatatat atatcatcac tacttaaaaa aagtaacttc agaatatttt atataaccgt      7560
     atctacgtgc tctttattat tatcatgtgt accaaacaag tacggtatga ttggcatagc      7620
     agcattggta tttacaacca tgttaggacc atcattaatt attttagagg ataacagaca      7680
     ataaattatg acaatgcgtt tgttaagccc gcaaatatgt gggcttattt ttaatttcta      7740
     atatttttac tcttcatcat cccgcaggaa ctgacaaaaa tcttcgctcc ccatcatatc      7800
     gacagtgttt ttaaattcga aaaaagaaat tcctgtcata gcacacacgc gctggataat      7860
     cagttttttc ttttgctgtc tgacggttgc ggtttcacca aactggataa cagccaggac      7920
     tgtttcatca tatgatttca ggacaaaatc acaggttata ttctgcactt cacggattaa      7980
     atcttttaca gcttcctcac taccatgagg acgaacaaat tcaatgagcc gtattttggg      8040
     aaaaacggaa taatcaggta taatattacg tgaaagaatg cctaaaaact ctgattcatt      8100
     atttgagagt aagggtactt tagtaaaaca atcaacctcc ccaatggctg taaaagcatt      8160
     ggttgtcaaa gctggattgt tcttaataaa atcagagaat acattttcag ctgatggcaa      8220
     aacaacagca gaattatgtt gttcatctcg ttttttatta cggttaaata tcatttcata      8280
     ttccttttaa aagagcctgc ggcaggcaca ggcaaaaaca tcgtttttgg acaatctgat      8340
     tcaaatgtta acatttgaca tcggattgtc tatcctgcat tgttctttac tgtctgtaag      8400
     atcggcgctc attcttccgg cgttctcccg ataccaaaaa gacggaacgc aaaacggctt      8460
     tcgatccacc attcaaaaat ctgctctgcg caaccacaaa cagttaaggc gatccatgca      8520
     gcaagaacaa cgtaactact gacatctgca cccatgtacc aggcgatagt taaacccatc      8580
     actgcgatac cgcctaaaaa ctgcaacaag aaacgaaatc ccgcaagaat ccccaatgga      8640
     ataacaacaa ccagataaag ggaagcagcc agaaggtatc tgacaggtgt cagcagataa      8700
     aagaacctgg atattttctt tttgtcagaa taaacggcat catttgcaac atcggttgaa      8760
     tgatcattca tgctgtccct gattctttga aaatctacga tattatcctt catattgtta      8820
     tgacctcaat tttcaggtgg gtacatttta tcaaacatat tagtaaactc tgagtcttcc      8880
     ctggtatcgc cctcataacc aattgtataa gagaatttta atttataaac ttttctccca      8940
     attttttctg aaactacgaa acttaagttc tttacttccg tatgtttcat gatttctttt      9000
     actgatttat taagaacatc tcttttaaaa gcaggataat ctggatactt ataatccttc      9060
     accccccccg cccctattgt ataaagattc aattcatctt taagttcatc tattgtcatt      9120
     tcaaaactat tcgcgcgaga attattacta tatattttac gaatgagttg atatagtgat      9180
     gcagcattaa cacttgtcag tcgaacaaca gataataaaa cttgcgttgt ataacgtttt      9240
     tcttcaccaa taagtttaca taaaaatctt ttcgcttctt ttgtaaactt gatccccact      9300
     ctaccttcat tcctgtaata agtagaaaaa acagtcagac tcaaattcat tgaatcaggt      9360
     acattacttt tagtgaactt aaatcccaaa tcactactca gttctaatat ttcatcatgt      9420
     ttcagcttaa gaagcgtcgt atctaatata ttagagccat ccctcaaagc aagataagcc      9480
     gcatcaggct taacctgaac ccatttaatg taatcggcaa ctgtcacata aaatatgtga      9540
     tcatcatcga attcattttt agagtttatc tggcacatgg ctaaaaataa gactttttta      9600
     gcagccatag gcaatgttga cagcgttgaa ttcaattcat ttcgatgtct cacttttgtt      9660
     aagcgagaaa gggaagtctt atttgtcgtc attctcattg ttccaacact cttgataatc      9720
     agactttaac accagaaaca tgatattaca acacaatcaa tatcatgttt aaccgagtat      9780
     cttctcatgt ttcatatctg tgatttatct cacaaaggta atccatgctc aaaatccaca      9840
     ctggattcaa ggcagattaa caacagattc aaaatagatt caccagaaag aacaacgaat      9900
     tagtattctt atgacacatt ttgtggatat caccgaggaa gctctcatgt ttaaccgagg      9960
     aagttatcat gtttaaccga ggaagctctc atgtttaacc gaggaagctc tcatgtttaa     10020
     ccgaggaagt tatcatgttt aaccgaggaa gctctcatgt ttagacaaaa aacacgctta     10080
     aaatcaataa attagagcta ctctaagttt ttaagttttt aagaaaaaca agaaaagata     10140
     aggcttttaa tgcgtgcgaa tattcaggaa ctgtggataa ctcaacgaaa ccagcaacga     10200
     tgatggttcc ttaccataaa tctgtccccc gatgattatt acccgcaagc taaaacaaac     10260
     atcatcaatc attaaaactc ataactttca ataacttaaa atcatcaaaa aaatatttga     10320
     tgccttatga atctcaattt tcaagaccat aaatttgtcc ctcgttaact ttaacttatt     10380
     gaaataaata taatattcgt gcgtactgat cctaatgtca catcgcaaaa attccgcttc     10440
     ctcgctcact cagtcgctac gctcctgccg ttcggctgcg gcgagcggta tctcctttct     10500
     caaaaccaga gagattcaga tcatatgatc cgttatttga tcctttttgg atcttccact     10560
     aagaagccct gaatcgcgct ctgccgcttc gttcgataca accatgagga aaaccatgcg     10620
     aaatgaaaaa atcgcttaaa acgcgataca gcgcgtttta aggggtattc acaaaacaca     10680
     cgttgccttg aagaaatttt gatcaagatt taactactat ccggatcatg acaacagatc     10740
     acagcaacaa ggctgctaaa aagcgttgag aggcgttaaa cgctgttaag actagggcta     10800
     agtacaatga aacggaaaaa atgctcagaa tgcgttacag aaccttccag aaagctaagg     10860
     tttgtcactt taaagagaca tttttcttga tctagtgtca cttataagag acaatgtaca     10920
     caggttaagg gaatgagggc ggcaagatgc cttacacggc gaaacgatat cagacagaaa     10980
     acggtgaggt tccgtacacc gactggatga aaaaattaag acgtaaagac cagaccgcag     11040
     cgttaaaggt ggattccaga attgcccgcg ctatgggcgg aaattttgga gatcataaat     11100
     tcgaaaggga cggtgtatgg gaattacggg ttgattacgg tcctggttac agggtttatt     11160
     attcaatcga agatggcgaa ataattcttc tgctcattgg agggaataaa aaaactcaga     11220
     cagccgattt agataaagcc gttagttatc tgcaagattt taaaaagagg tcaaaaaaat     11280
     gacagccacc aaaaatgtga agtcgcagaa aaatgattat ccggcatccg ttgatcacaa     11340
     tgccgccatg attgaagaat tgcgcgcaga tcctgattat gcaaacgctt atcttgctaa     11400
     tgccctggaa gaaataaacg agcctggtgg tttaggtggt tttcttgttg cgctacgtca     11460
     ggtaatcgag gcgcgagggg ggatttccga agctgccagg aaatctggcc ttgcccgtca     11520
     gagtatttac cgcgcattat cccccaacgg taacccgacc atcacaacgc ttgcacaact     11580
     tacatcggta gccggattac agttcactct cagtaaatcc agccactaat ctctccagtt     11640
     ccccctaagc gggggaattt ccatgccatc aaaaccgcag ttatcccgcc cgacgttcac     11700
     cggtatttaa tcggcaaatc gtacaattgc gtactggcaa tagtttaacg gtgtgtatta     11760
     atacacattt aaagacgatg tgatagatgc gtgtgttaat gctaatgtat gcatacatta     11820
     gcattaacat agagcagatt ctggcgcgtt gcgcccgtag ttcgctgacg ctcacacgcg     11880
     cagtacagcg ccccgccatg ctgcaatgca ccagggcggg gtaaactcgc tggcgctcgc     11940
     gctaactgcg gcattctgcg gcgcaaatca gcataatcat ggcctgctgg tcagttgggc     12000
     tttgcagggt gaagggatgg cctgtgcacc ctggtacgtt cgtcagcggc tgcgccgcgc     12060
     ttcggggcga tgtggctcct gtgctgccct ggtattttcg ttcgcccctt ccatccgctt     12120
     acgcggatta aaaaacgtga taacaatcac ttatcgagta aaaaaacggg agaaaacttg     12180
     caaatacgac ttaaaagtcg tattattatt tcatcgaaag gggaatggcc cctctcacaa     12240
     tagcccagca gggcaggaga ttaaaaaaat gaatatccag gaagcattaa acgtttttgg     12300
     attatccggc gaattaactg aaaaagatat caaagcagca tacagaaaag ccgctttaaa     12360
     atatcatcca gatcgtaacc cgttaggggc tgaactgatg aaagcggtaa atgcagcttt     12420
     tgatgtattg atggcaaata ttgataaaat aaatcagttc cagagcactg atgaacatgc     12480
     acgatataat tacggtgatg acctggaaaa agtattaaac gttctttctg gtttatctgg     12540
     tctggtattt gaagtgatag gtaactgggt ctggattagt ggagaaacca ttacacataa     12600
     ggaaacttta aaagaaatcg ggtgtaaatg ggcggcaaag aaaaaacaat ggttttatcg     12660
     tccagacgaa cataaaagtt actggaatcg tgaagaacac acgatagaag aaatccgcgc     12720
     aaaatacggt acaaccggac agcgcagggc gacagggtgg caacgcgtgg aaaccagagc     12780
     gtaaccagaa cgggggcgag aagcccccga tattatagcc agcccgtctt ttggggcatc     12840
     gaacccaaaa agacgggaac agcagctacg tagcaaaaag ggaaacagat gaactctttt     12900
     tttgaacaat atcaccctgt ctttgaagtt gtctgccgta tcctggggaa cggctggcgc     12960
     gtgaacaaac ttgatgattg ttcgtctcgt ataaaactga cgtcaccgca gtttaaaaat     13020
     tactctgtgc atattcggat ggaaaaagac cggttttctg ttgtggggag tgtggatagt     13080
     cgctcctggc gtagtccgca tcatgtttgc acgttatcca gaaaacggaa tcccgttgat     13140
     attgcagccg atatcgagcg aaaaattctg gtaaatgctt cgcaggaggt gttacaggcg     13200
     attgagtatg agaaacacca ggtggaaaaa aaggacgaaa ttctgatcct gaaaggtatg     13260
     ttatcgcaac ttgtccagct tgaaagctgg tatggggcat tgacaggctt taaagctgaa     13320
     aacggattga acggtaaagt caccgaacag ggcgacagtt atgatttaca gattcggggc     13380
     ttgagtatag atcaacttgt taaaattaca gggtatttga aacagttatg agaaaaaata     13440
     aaggtgatgt gacttatttt cttgaaaaag aaggtgacaa ttacaggctt acaaaaagga     13500
     taaaagccag aacaaatgtt aaaatcggga acaaaactac gaaaattaca ttgtatgatg     13560
     ccgtactgaa tgagaatgaa ttacaacata ttgattttac gtgtgccgga ttaagggaag     13620
     acgatgagac gccagttaag aatttaatta aggagtttat gttaaatgaa acccgataat     13680
     acacctgaaa atgtaaaaaa attacgttta aaagcaggat taacacaaaa ggaatgcagt     13740
     catatttatg gtgttgggct aagaacctgg cagaaaaaag aggaagttaa tactcaaaac     13800
     agtcaaagtc tgtcactggt tgagtttgag tttcttttgt tacttgcagg agaacatcct     13860
     gaatacgtgc tctgcaaaag ggagtcaaaa taaaatgacc tgtgatggtt ttatattagt     13920
     acctggagtt gcgcccgtag ttcgctgacg ctcacacgcg cagtacagcg ccccgccatg     13980
     ctgcaatgca ccagggcggg gtaaactcgc tggcgctcgc gctaactgcg gcattctgcg     14040
     gcgcaaatca gcataatcat ggcctgctgg tcagttgggc tttgcagggt gaagggatgg     14100
     cctgtgcacc ctggtacgtt cgtcagcggc tgcgccgcgc ttcggggcga tgtggctcct     14160
     gtgctgccct ggtattttcg ttcgcccctt ccatccgctt acgcggatta aaaaacgtga     14220
     taacaatcac ttatcgagta aaaaaacggg agaaaacttg caaatacgac ttaaaagtcg     14280
     tattattatt tcatcgaaag gggaatggcc cctctcacaa tagcccagca gggcaggaga     14340
     tttaaaatga aatgctcatc tgtttttact tcaaccacta atcatgtttt cacgttcgaa     14400
     cgagtaacgc tttgcactat tatccttatg cataaggata cgggacaaca gtatgttgtc     14460
     atatttactg ataacaataa aattcgtgac tataaaaccg gaattgttcc tcagtttggc     14520
     gaacttaagc agagtgatgt tgatttagtc cttttctaca gggacgaata tgaaaaatat     14580
     tttgattcgt taaaagatgg cgatgaatgc ttaagtttta aagattttat tgagtgcctt     14640
     cgttaagcat tatgaatgca ggggcatccc tgcattttcc tgaaaggagt tgattttatg     14700
     aaaagtgttt atgttgttgg caaaggttta atcgttgccg gtaataaaat taccatcgat     14760
     ggaaaagagc atgtctcggt agaaaatagt gaaaacattg ttgtcactga tgattgtatt     14820
     aaaattggta ataaaacagt ggtttttaaa ggcaggagta ttaaggtaga aatacatggg     14880
     aatgtaaata aaatagtaac cgaaaatgct gatgtcagta ttcatgggaa tgctggggat     14940
     gttgaaaccg tgagtggtga tgttgattgt catcaggtta atggcgatat aaccactgta     15000
     agcggtgatg ttacttgtgg agatgtttct ggtgacgtaa ccactgtcag cggagatata     15060
     aacagaaaat gatcacggaa tcggatatgc ttactgaagc taaaaaaatg gcagtagaga     15120
     tgatgttctg gcctgcttgt cctgtagatg atgattattg tttcgacgct ataatgtata     15180
     catcagttat tgacaggaag tttgaagatg aacatggggt atatcttcat caggtttaca     15240
     aagaactatg ctcaacacct gaattaaaaa agcttctaaa aaagaaagca ataaaattga     15300
     ttgcttttaa gtacgatatt gatcttgatt cagctaacaa gattttaatg aaaaatatgc     15360
     taaggaggat tgaaaactga aaaactgaaa aagtgaaagt gatcaggttg ctggaacaac     15420
     ctgatcacgt tatcgacaat caaaactgaa tgaggttttt aaatgtcaac gcggcagatc     15480
     gtacagcttg ctgactccct tgtcaaaggc tgggaaacca gaattccggc aatgaaattt     15540
     agcgaatggg atcaattccg gtggtggtta aactacctgc aagggtatga aatgttttaa     15600
     ataaaaaagg ggctttctgc ccctttgtaa gcagaactgg aacaggagtt taaaacatcg     15660
     gttgatctgt atttacagtc ttgtgtggag gatggaaagg aacctgatac cccgtttaaa     15720
     ggcgtgttta acgtcaggct tgatccagaa ctgcatcgtc gggtagcaga aatggcgatg     15780
     gaagaagaag tcagtaatca tcgcgcaggg gcttaattgc ccttgttttt atgccctgta     15840
     agggcatggg aggcgctttg cgccggaagc cccgcagcgt agcgaggact taaaaagcgt     15900
     tacggcttca gccgtaacaa ttcccagccc tgccaggcct gttttttctt tcacaaatct     15960
     ttcagctata cgtttgccag atggtcgaag acgaaagaac ctttcagcaa cgaaatctgg     16020
     acatatgcag cgacgatttt atagctaggc acagtgctac atatggtaca atcaatgcag     16080
     gatagacaat ccgatgtcaa atgttaacat ttgaatcaga ttgtccaaaa acgatgtttt     16140
     tgcctgtgcc tgccgcaggc tctgttgggg tgacttatga agatgatagc gttcaggcta     16200
     agtgatgatg agttaaaatt tgcagaacat aacgctattt taagtggatt taccagtatc     16260
     aatgcttttg ctaagcataa cgtgcttaat attgaaacca agcctgttaa catcccagtt     16320
     aataatgaac cagcaaagct ggtatcagtg cgtctttacc ctcatgaaat agaacttgtt     16380
     aaacgtaatg ctgctcttca cggcatgagc atgagcagag aaattgctat tcgtgtgcgt     16440
     cagtctttgt taaagagtga agtctgtctt taccctgatg aagttaagga acttaaaaaa     16500
     ctatcaactg ctgtagatcg tgttggtcgc aacattcatt ttatcataaa aggtgaaaga     16560
     ttctgtacgg ttaacgatcc agatttcaga aaagacgtta ttgaagtgat tgaactgtgt     16620
     aagcgaattg attcaaaact tgaaacgtta accaagagtg ttgttaacag atttgggtga     16680
     tttatgggtg tgtatgtaga acaggaatac cgtattaaac gcgctaaagg gactgggcgt     16740
     gatccgaaat ctcctaagtt atcgggaaga catatacatg ccagtaaatc ggcttttaat     16800
     cataaagtca gacatggtgc ggacaagaaa gcatatacct ggacacctac aaaagaagtc     16860
     acttttaaaa tcactggctc aggtaaaaca gccgcaggta tcaaaaacgg tattgattac     16920
     attacccgta atggtgaact tgaggcttac tgttatgatg gaaaaggttc agagcaaaca     16980
     gggaaaggag aagactttaa cagggagttt acttcaactt tatctaaagg aaatgattac     17040
     tccaggacat atcgtggaga aaacatcgat catgtgaaaa acatggtctt ttcaccacca     17100
     ccagaagctg gagtaagcag ggaagacgct ctgaaagcta cggtagaatt tcttaaagag     17160
     acttatccaa accatgcttt cgttgccgta taccatgatg ataaagaaga tcatcctcat     17220
     gtacatgtta atattaaact tcgtgatgaa gaaacaggaa gaagattaag acttaccaaa     17280
     tctgaaacca ggaagttcag aaacggtttt catagaaaac tgaaaggtat gggatatgat     17340
     gttactgcta cctggaaaaa agatcccgaa cgtaaacggg agattgagcg attacaggct     17400
     gaaaatccga aaagactccg gaatgtttac aaggttgtgg attttgggga gacttcatat     17460
     cagaataagg caggggaaaa acgaacacct ttcctcactt atgaaacttt aaaaggtgga     17520
     aaacaggtta cgatttgggg taaagacctg aaaaatcatt tcgagtctga aaagctccag     17580
     ccaggaacgc ttatcaaagt taaaaaactg gctcccacgc ttgtacatag cccgatgttt     17640
     aatgatgatg gaactgttgc aggctacagg gaaacgcatc gcaataactg gcagattgaa     17700
     aatattgccc ttgagcggaa cagagaacgt caggttcatg agcgtgaaac caggcaaccg     17760
     gaagagagcg acgttaaaaa acagctatcc agaaaacatg agcaaggtca caatatcggt     17820
     tttgctcttg aatacgggtt tacaaaggat tcagaagaac ataaaaaact aagaatacag     17880
     caagagagga actggaaagg cctgggattt taatttgatt tcggcgcagg tgaacaaagc     17940
     ggctactttg ctcacctgct gatcacaaca acctacgagg gaggttatca tgactgagca     18000
     tgatgctatc tgcatttctg cacttcatca aatttttagt gatgaagaac atttgagtga     18060
     gcaacaaaaa gacattattc tgatgtacgc ttatggctat accctgaatg aaattgctga     18120
     tttcaaagga ctaaagcctt caactgtcag aaaatatctc gattctgtaa gagctgaact     18180
     gggaggtgtc tcgttggcag ggatcagaac actggtactc attcggacta atgcccttct     18240
     cgtgtcaagt ctttccagga tcagtgagag gggaaattta tgaaaaaata tctgcttttt     18300
     gctttgccgt tcttcgttgt tggttgtagt gaagaagtaa aaagtgtgga ttggtggggg     18360
     cagcatctta cggaagctaa acaaaagcag gcagagtgtg agaagtctgg ctctgattct     18420
     cagaactgta agaatgttaa acaagcattg tttattcagt ctcagaagga tgctccagtc     18480
     cctacattcg attaactaat gtttaaatca tactaaagcg cccatatggg cgcttttttt     18540
     ttgcatgatc acacgaatca taatatgacc attttgtcaa tgttatttga tcgtattgtt     18600
     gagaattgtt attttgcgaa tcatgttcgc atctaaaaca aatccaaaac acacttatag     18660
     tggattgatt aaatgaagga gaaaccagat aagtcatcgg aaaaaggggt ttatgtcacg     18720
     ataaaactcg atcccaggtt gaatgcattt atcgaagaga aaacgaaaac atctttgctt     18780
     agtaagagga agcaaattat ttacttatta atgcagagta tgcgtattga tggatatatg     18840
     gagcgttagc tatggcgtct ttattcccag ccttgttgct gtgtgcggcg tcagttcatc     18900
     cggatacgat aaatgatatt gcacgggtcg agagtggctt caatccttat gctgtggctg     18960
     aaattattcc tgaaagggaa cgcggtagct atggcaaaag tgttatcagt catatgccca     19020
     aaagtaagga ggaagctcta acagttatca gagaaattga aaacagaaaa agacgttatt     19080
     ctgtcggatt gatgcagatt accagcagta atttttcttt ttattccacg tccgcagaaa     19140
     aactccttga ttcgtgtgaa aacttgtctg ttttcgaaaa gattatcgtg gattgttata     19200
     aacgagggag gagcctggag aatgcgctta gttgttacta tacaggaaat tttagtaacg     19260
     gtaagcgaaa agaaaaagaa tttaataata caagttatgt tgagcgaatt ggttatacag     19320
     ggaacgaaaa aaaatatgtt gtaccaggta caagaagcaa cggaggagaa cagcgaaaaa     19380
     atcgttcaca caatgcgtca gttatctggc ccgaaaccat tctgaaatct gcttttgttg     19440
     ataactcaca tccaacaaaa gttattaatt aacaggactt ataaaatgtc atttaagaaa     19500
     tcagtatgta attgtatcag ttcatctgtc actgctgtaa tgcagcgtaa aaataaggta     19560
     gttatggcag tcgccggggc aacagtcgca tcaccggcct ttgcggatgg attttcaaaa     19620
     gcggaaacac tgctgcaaaa ggtcaaaaca gggcttggtg gcctttcact ggtaacggtg     19680
     actattgcct gtctgtgggt cggctacaag gttctgtttg gtggaagcac gattcgtgaa     19740
     tgctcaccta tcatcatcgg ggcaattgtt atcgccagtg cggctgaagt tgcatcaatg     19800
     atggttaact aataaagcgg ggacgatagt atgtctacac tttataaagc gatgacacgc     19860
     cctgctatgt atgtgggtgt tcctgtcgtc cctcttactg tggttgcagg ggcgttattt     19920
     ctggcggggg tttatatcag caagctgatc tggctggcta ttcctgtcgc agtttttatt     19980
     ctcagaatga taactaagca ggacgaccac atttttaatc tttactttct taagctgaaa     20040
     atgctcggaa actcagtgtg taatcgtttt tttggcgcac gagcgttcct ctccggacaa     20100
     tatgaagctg ttgaaattga tgagtttgtt aatgccatga aactgaatga gcgaatcact     20160
     actggtaaat atatacccta ttcaagccat gttgataaaa atattgtcaa aacaaagaac     20220
     ggtgattatg tagcgacatg gcaactgatg gggattaact ttgagtcaat ctctgcggag     20280
     atgttagaaa ctattgactc acaggttgcc actcttgttc gttcattttc cggactgccc     20340
     gtttcatttt ataaccattc atgcagggcg agtttttatg atgcctttac cacaaaatca     20400
     ggtaataaat atgctgatat aatatcagat tgttattatg gttcgatgaa gaaaaataaa     20460
     ttcaagggga acactcttta ctttacgctg atctacagac cagacgggcg tgtagaaaaa     20520
     ctggaaaaac gcaaaaaaag tattaaagaa aagaaagatg atattcacat tcatgtgaag     20580
     agaatgaatg aaatgattaa tacattctct ggcgctcttg ataaatttac ctgtaaactt     20640
     cttggtatgt atgaggagaa cggaaaggta ttttcttctc aactgtcatt ctataattat     20700
     cttctgacag ggaagttgca aaaaatcaga gtcactgatt ctccggtgta taacgttctt     20760
     ggtggagtgg atgtattttt taatcatgat accggacaga tatgccgcat tgatggaaat     20820
     aaattctttc gttctattga aattaaagat ttctgtagtg agactgcatc cggtgttttt     20880
     gatgtgctcc agtattctga tgctgactat attattacgc attcatatac atccatgagc     20940
     aaatcagaag cattgagtac cattaaacgt gcggaaaaac agttaaagag tacagaagat     21000
     gatgcggtca ctcaattgca ggaactggaa aaggcaaaaa atgatattgt gtccggtgat     21060
     atatcctttg gttactacca tttcacgata atggtaatgg cggacagtat cagggagctt     21120
     gacgaatctg taagtaaaat tacggcagac tttactgacc tgggcattat tccggcattg     21180
     tcaaccatgt cattgccagc ggcatatttt gcccaacttc cggcggtttt tcatttaagg     21240
     ccgcgtttat ctccggtatc gaatgtaaat tttgtcgaac tggcatcatt ccataatttc     21300
     taccagggga aacgcgataa aaactgctgg acagaagcgg ttgctattct caaaacacca     21360
     agcaaacagg cgtattatct gaatttacat aactcagtac tgtttaaaga tgaaacaggt     21420
     gaaaagaatc ttgctaatac taaagttata ggaacggcgg gttcaggtaa gacaatgttt     21480
     ctgtcatatc ttgcctgttc attacagaaa tacaataacc ccgaaacttt tgctgattct     21540
     gcaaaaaata agaagttaac gtgtgtcttt cttgataagg acagaggggc tgaattatgt     21600
     atccgaatgc ttggggggga atattacacc gtaaaaagcg gtgagccgac aggatggaat     21660
     ccttttgctc tggaggcaac aaaacgtaac cgtatttttg tgaagcaact gatggagatt     21720
     ctgtgtacca gaaatggtga aagattatcg acaagagaaa gattgcttat tagcgaaagt     21780
     gttgatgctg tgatggattt tcctcctggc gaaatgcggg aatatggcat taccagaatg     21840
     cttgagcatc ttatgcagag agatgatcgg gatgagcagg agaacgggat tatccttcgt     21900
     ttgtcccaat gggctaatag tcaggctcat ggctgggttt ttgataatgc taaagacaca     21960
     ttcaatattc agcatgtcaa taattttggc attgatggca ccgagtttct tgatgatccg     22020
     atggtatgtg caccaattac tttctatctg ctgtatcgca ttacgcagct tctggacggt     22080
     cggcgtcttg ttattttcct ggatgagttc tggaaatggc tacaggatga agcattcagc     22140
     gattttgtct ataacaagct gaaaacaatt cgtaagctga acgggctggt tattccggca     22200
     actcagtctc cggatgaaat actgaagaat aagatttcac gggctgtggt tgaagtatgc     22260
     agcaccagta tttatctggc taaccctgat gccgattaca atgattatgt ggaagggctt     22320
     aagctgacac cagaagaatt taatattatt aaaaatcttg atccaatgtc gagacagttc     22380
     ctgattaaaa aaagcagtct taaaaagggg gatggtaaat cattttcagc acttgcgaca     22440
     ctcgatttat cgggacttgg tggatatctg aaaatattgt ctgccagtgc agataatctg     22500
     gaaatttttg aaagtattta tcatgaagga atggagcctg atgactgggt tcctgaatat     22560
     ctcgaacggg caatctgaca ggtgaattta tgaaacgtgt aaaaacattt atgctgatat     22620
     cattattgac ggcttcattt tatagcagcg caggtattcc ggttgctgta gatgccagtc     22680
     cggaatgggc tgttgaagcc gcaagatgga cagaacgact caaacaatgg tccgaaactg     22740
     cgaaacatta tcagggtcag attcaggcat ataaagacca gttagccacg gcaacaggta     22800
     taaggaatat tgcggcattc acaaatgaac taagtaatct gcaatcagaa ctgacaaata     22860
     tttataagca ggggaacagt tatatttctg attttaccag taatcccgaa ggtgcattaa     22920
     gcagccaggc taaaaatctg ttcagcaagt atggagcctt tgatatgtgt aatacgggct     22980
     atgaacgtaa tgataatctc tgtaaagcac ggattgtgtc aacggctgcc agtattgaac     23040
     agggaaatga gatcaataag cagttatcaa gtgcaatgtc tcagattcag agtttaagta     23100
     gccgaattga ggcttcaaag gatatcaaag aatcccagga tttggctaac gcattacagg     23160
     cgcagtcgtt aaaaatgcag gcgataaaaa tgcagtatga tgtctggaat aataaaaata     23220
     aagcagatca tgagatgttg ctcacacatg aacaagaggc ctttattaaa cagcagaaag     23280
     aagctgaacc attaactttt gattaaaagg tggatatatg gctcagggtt ttttcgttaa     23340
     atataattct accgttatgg attcggtaga taaaatcagc tccagttatc aaacacaatt     23400
     tgctaatgat attatgtcgt tagtgacggt atcggttacg ttatatgtac tatggaaagg     23460
     atatcaaata cttgccagta aaactcagac gcccttgcag gatttagtat gggatctatc     23520
     aaaatttgca atcataatca tgtttataac taatgcggat gggtatttaa ctgcggctac     23580
     tgatgcgttg caaggcatga aagatggttt ttctggaggg gtgagtgtct ggcaaacttt     23640
     agataactta tggaaaagta cgcaaaatct tggtgcggaa atatactctt tagataaatc     23700
     aacatatgtt aaagatcaag gtgtagttgg acagttttta atatggactg gctcgcttat     23760
     tttaatggct gttagtgtgg ttgttttttt aacagcagat gtaacgatga aactcctgat     23820
     tattacagca ccgatattta tcttttgtct catgtttggt tttattcgga gcatgtttaa     23880
     taattggtta caatcgttat tctccagtat tctgacagtt ctatttgcca gtttagtgat     23940
     tcggatagca atggattttc aagggatgat cctttcccat gctattcgtg ctgcacaaac     24000
     agggaatgta aatcttgtat ctacaggtgc tatgggcttt atggctggtt ttttgggggc     24060
     tttattggtt cttatagcta aaggttttgc tgtccagtta gcaggtgcag gtgttgaagg     24120
     tgctgttcag ggcgcagcca tgatggggct gggtgctgcg ggtatggcta ctggtaagtc     24180
     tctgatgctt ggcggtcgtg ctggtttagg ttttggctta gggatggccg gaagaacggg     24240
     catgaattct ttatcaggga aagcagggaa tctgatgggg cgtggtgcga gaacagccgc     24300
     tgaatgggcg ggtgaaaagg gatatcaggc gctggctccg acaggtgctt tggggatgaa     24360
     ggcgagaaga cttgcatccc tggaaaaagc acgagcgagg aatgccgcat gaatataatg     24420
     aaacgttttt tttatgtgat gtccctgaac tggatactga cgtttgttga taaacatatc     24480
     acctccggat ggagcaggaa gagaaagcta ataacccagc ttattatttt aatcacggga     24540
     attaccttat ttaaggtctt aggtggaatc agtcagagct ggttgtgaca tgcttcatta     24600
     ttttgtcatg atactttatt ttgtcctaat ccttctttta ggagtgttta cctgcttcgc     24660
     aggaataaga cttggtttag ggcttgcggg gaaatggaga aagggtatgg atcttcgctt     24720
     tttgcttctt attggtggga ttctttttct tcatcttggc ctttatctct tcaaggtgtt     24780
     cgtgaacgct taataaggtg aatttatgcg atgtgtgatt cttttgtttt tcctgtttca     24840
     gatttccgga tgtaccacaa ggaataccct tccttctgat gtttccggcg aactggaacc     24900
     cattaaccac agccaggtaa tcagttatga gtgaaaaaat cgaaaagaag attgagacag     24960
     ctaaatcctt cgaaagacaa ctctatgcag aaaatgaacg gtctaagaaa aatgcatggc     25020
     gtgttgcagt ggcagcatca ttactgtcct tatgtcttgg ggctgcaatt tgtgttcttg     25080
     tgccattaaa agaaaaagag cttgctattg tggctgttgg cgaaaaaaca ggccgtacag     25140
     aactgattac tcaggttaaa caggaaaaga tcctgcaatc tgaagcacta gggcggtatt     25200
     ttgtaaacac gtatattacc ttacgtgaag gttataatta tccgtctctt cagtatgatt     25260
     atgagactgt acagctatat agttcgaata cagtaaagga cgattatctt cgtctgtata     25320
     acagcgatat ggctcctgat aaaatttatc ataataatgg ttcttacgtt gcggttgagg     25380
     tcatctccaa tattatttct gacgcaaccg cgccagataa actggcctct gtgcgcttta     25440
     aaaaaacgac gagaaacttc acgaccggac aggtttcagt ttcatactgg acggctcgtg     25500
     tgacatatcg ttttgaacca gaaaagtcgg ttaaaagttc cagtcgtgag cttaatcctc     25560
     tcggttttac tgtaaccagt taccagacag atcgggaagc caggggggaa tgatgaagaa     25620
     attatttatt gctacatgtt tattgcttcc tgggcttgtg tattcagcag cgactccgtt     25680
     accttctgga tttgatgcaa ggatgcagac tgtgagttat aacggtgcga atacgaccgt     25740
     tatccggtca aagacaggat ttctcacatc agttgttttc gatgaaggtg aggctgttat     25800
     cagtgcaaag gctggttttc ctgccggatg ggaaatcaca actgatgata atgttgttta     25860
     catcaatccg cgtcccgttg ttcaggaaca ggaaggcgat gaaggcgaaa aactgaaaaa     25920
     ggttttccag ccaacagaaa aggaatggga tacgaatctt tttgtcagaa caacaaagcg     25980
     gatttacagt ctggatctaa tccttctgtc agaagaaaaa caagcgcaac ctgcttatgt     26040
     tgtacaattc cgctatccat cagaaatagc gaaaaagaat gcagaagaag taaggctggc     26100
     aaaagaaaaa caggaaaaac tcagacagaa gaaactgatt tctgaaagtt ttgaaaaagc     26160
     cgatgcgcct aaaaactgga attatttcat gcgagtcaat gaaaaatatg acagccgtcg     26220
     tatcgcccct gattttgctt atgataatgg tatatttacc tttttaggtt ttaactcagg     26280
     gaaagcattc ccagctccat ttgctgtaag agatggtcag gaacagacac ttgcttttaa     26340
     tgtggaaaca aaaggcaagt ataaaattat ggttatccac aacgttaatg ataaatttgt     26400
     tttacgctat ggaaacagcg ttgttggtgt tgtgaataaa tctttcggaa aagtattaac     26460
     cgaccagagg aatacatctt ctcctgcggt agaacgtgtt gaggtgaata atgactgata     26520
     tgaaaaaaac agatgattta gttgatgatg cgaatcagtc aaagctggaa agtaaacccg     26580
     ttcatgatat cggtgatatc aggaacaaaa ataatcgtat gcgttctggc tttctgtttg     26640
     gtctgatggc tgtattagtt attggtattt ttgcgctgaa aacatataaa aattattttg     26700
     cagatgacca gcagaaagca tcagaatcaa caggcgatac cagcatttct caggtaagta     26760
     aaatccgtac tggtcttggt cagaattttg accctgttga gaacaaagca attatcaatc     26820
     caggcgcttc tggttctggt aatactgttt ctgacggtca taaagaagtg ccacaggagg     26880
     ggttcaggaa atatttgtca atacctgttg ctggtcaggg agggagtcag actggcgcga     26940
     gtggcagcag caggacatca gagccacagg aagaaaggaa agaatcaaaa gaaaatgtgc     27000
     ctggtaaatc aggaatgaaa gtgactgcga ttaatctcga tcctgatctc tatattgagg     27060
     aaaacaggct tataccgtgt gctttaacca cacgctttgt ttctgatgtt gcaggtcgta     27120
     tcagttgtgt ttttacagaa gatgtatgga gtgctaatca ccacacaaaa ttactggaac     27180
     agggaactaa ggcttttggt cgttaccaga ccggaacgct gaatcatgga cagggcagaa     27240
     tgttcgttat gtgggagcag ttgcggacgc ctgataataa acgaatcgat atggtaaata     27300
     cagcagcggc tggccccctg ggagaagcgg gcattgatgg atggatcgat tctcacttct     27360
     gggagcgttt tggtggttct cttatgctca gtatggttca ggatgtagcg gctgcggcgg     27420
     cggataatgc acctggtaaa gatcgtaatg tggattatac cgaaaactca cgacaggcaa     27480
     tggctgaaat ggctaaagtc gcacttgaga attcgataaa tattcctcca acaatgtata     27540
     aaaaccaggg tgacataatc actattatgg tcggggaaga cattgatttt tctgatatct     27600
     atgagttaaa ggtaaaatag tatgaatggc gttattcctg tcagcattag caataaatcg     27660
     ctcgattttt ataaaaatca agtattccag tcttttcttg atattgaagg gctaacagaa     27720
     attgctgtca accgtcctgg tgaaatctgg acggaaatta atggtgactg gacattccat     27780
     aataatgaca gtgtgacctt tgatttttgt aaacgttttt ctcagacgct ggcatcattt     27840
     cggggagatg aaatcagcga taccaagcca ttactttcag caacactgga atcaggagaa     27900
     cgtgtacagg tcgtttttcc tcctgcatgt gagagaaata ctatttcaat caccatacgt     27960
     aaaccatcga cacggcagat aacgcataaa gaatatgtgg cgaacggttt ttatgattat     28020
     gtccagtcag gaaaaaaaca caggacatac gatgatgagc ttcttgattt attcagagcg     28080
     agaaatatcg ctgcttttat ggagcttgcc gtagcagcag ggaaaaccat tgtatttgcc     28140
     ggagcaacgg gttccggtaa aacaacatat atgaagagtc ttatcgattt cataccattg     28200
     aatacacggc tgattacgat tgaagatgca gaggaaatca aattttttat ccataaaaat     28260
     tatgtgcatc ttttttaccc ttcggaatcc ggcagtgatt ccggctctat cataacagca     28320
     gcgaaattaa tcaaatcctg tttgaggatg aaacctgaca gaattttact ggcggaaatt     28380
     aaaggtggcg atgcctggga ttttgtgaaa gttgctggtt ctggtcacag tggaagcatg     28440
     acgtccattc acgcggcctc ggcaaaagat gccatcattc agatggtgac aaaatgttat     28500
     cagaacagag aatgtcagaa tcttcctttt gatgttcttc gtaaaatcat tatggacagt     28560
     attgatattg ttgttcatgt aggcagggat ggtgttgtca ggcatatgag cgacatctat     28620
     tacaaagggg ctgaatgtga aaacttttaa taagtcgcaa tctgttttta tattcgctgt     28680
     tatgcttgtt gcggcatggt ttgcaggttc atttattttc tttgtgcttt acttcagcca     28740
     gataaagaat ctgaaaccat tgaaggctgt gttcagatcc attgatgcgt acaggatgga     28800
     tatttttaca gacagcctta ctttatctgt tgtgactacg gatatcagag ttttagcctt     28860
     tgttgcactt ggagcaggat ttgtcgtgtc tcttatcatc cctgttgcgg cgttgataaa     28920
     actgaacgag aagaaagaaa atattttcgg tgatgcgcga tttgcaacaa ttaatgatat     28980
     tcgtgagtct aacagtttca cgcttgacgg tgacgaaaaa gacgggatta tcgttggtat     29040
     aaaagacaag aaaataatac gctatgtggg agcagcattc agtgctatgg gagccggaac     29100
     aagggctggt aaaggtgctg gtatagtcat cactaatctt atgaagtact ggtggagtgt     29160
     tattattctc gatccaaaaa gggagtgttt taatatcacc agtcttatca ggaaggtgat     29220
     tttaggtcat gaggtttata aatttgatcc ctttagtccg gtaacgcacc gctttaaccc     29280
     tttgtattat gtcagcatgg gaacgagtga aggttttaac cagcttgaaa atctttcgtt     29340
     gattatttac ccctataaga cagatggtgc ggatgctggt agctatctta ataagacggc     29400
     gggtggtgtt tttaaatctt atgctgtcgc tttatggttt atgattaaga atgataaggc     29460
     tggactaaaa acgcttgata ttgagcctgt cttctcaatg tctaaaatta atcagctttt     29520
     tgagcgtgca gaacccgaac atcttctttc attcatgaat gatattcgtt cagaattaag     29580
     ggggaaagac aaaacgcttg ctgatattgg tgtcgctggc cttaaggcat tcattgagat     29640
     ggaggataaa acaaaagcac aactcaaaag caactttctt aatggattat caccgtttgc     29700
     taaccccaat gtggcgaatg ctactgatgg aaatgatttt gatttgcggc aggtgcggaa     29760
     aaaacggatg acaatttatt tctgtatttc tggtgataat gccaggttgg ctgaaaaaat     29820
     aacaaatatt ttctttcagc ttggtataca ggtgaatctt gaaaagatgc caacggatga     29880
     tccggaaata aagcatgact gcctttttct actggatgaa ttcccgtcaa ttggtgctgt     29940
     agattacatc aagagtaaat ctggtcttat tgctggttac aagctgaaat tgttgattgt     30000
     ttaccaggtc ggctctcagc ttgaggaaat ctacagttat gcaggcagta aaacattact     30060
     ggcaagtgca ccctgcaaaa tcgtttattc tgcttctgat gttaaagatg cacgggagtt     30120
     atcagaggcg atgggaacac gaacagtaac tatcggttcg aaaagcaaaa gtcgtagtcg     30180
     tggaggaaca tcgagatctg aatcagaaaa ccttattgag cgtccactgg taacaacaaa     30240
     tgaactactg acactgaaat ttagtgaaga aatcctggca atgaagggag aaaacccgat     30300
     tcgttgtgaa aaggcattct actatctcca tgagtatttc tttggtgatt ttgtgaaggt     30360
     tgctccggaa cttgcaaata ttttccccag gaagaaagga aagctggtta tgcctccaca     30420
     gaaagtattt gaaaatgaaa tcgtcgcaaa agggtatctg gcagtaaaag atgttcctga     30480
     tctcgataaa gcggcataaa ggagaacatg atgaagaagt tagtgttttt attgatttct     30540
     atccttgctg gttgttcatc accgccagag ccaacacccg cgcagtttga aaaggcaaat     30600
     gaagtgatca atccctcatt gccgtatgtc cccgattttc acggcgtcat aaagtcagaa     30660
     gttagcggta aaggatgggt ttatgagatc acttccttat ccggtgtaca ggccagaacg     30720
     ccgacgttct attacgctct ggctcatgcg gacagggtgg tagtgacaac acatgatgct     30780
     gggctgtggt ttcgaatcag agatctgttg aagatggaag gggcaacagc agtcgtggaa     30840
     tggcgaaacg agaaaagttt tttacctgaa caggtaaaaa tagttttcat taaagcacaa     30900
     aatgaggtga aaaatgactg gaaaaaatag agtggtttta cctgtctttc tggcgttagg     30960
     attaatatca acaaatgcta atgcatctga cccttgcgct tcggtacttt gcttatatgg     31020
     aaaagcagtc gggcaaggtg gagggagtga gtgcagaagt gctgaaaagg atttttttaa     31080
     tattctgaaa aagaaaaaag gaagcattcg ctggagtaaa acttttgatg cccgtaaagc     31140
     atttctgaat cagtgttcaa cggctgatcc tgctgctata tcgaaaatca tgagtaagtt     31200
     tggtcgtgtc agaggttaat taaaacctga tacccgcgcc aacgggtatc aagggatata     31260
     caggagaaaa attatgagcg aaatccgatt tgtaactctg gcatccgaca ttaacaatat     31320
     taaagaagtt tattctgatg atgagttaaa acgtttgctg gaagctgtta atcagaattg     31380
     cccagccaga attgtgttgg gtagtgtgga gaaggggaaa gaagtaccac tcaagtggtg     31440
     ttttaggaca ataccagagc gtatttcagt tgaagaaatc aatgaggtta aaatttatcc     31500
     agagttattc tgaacggaga taacggcaaa cgccgcagat tccggatttt aatccgggat     31560
     ttgcggggtt gaacaaccga agggcgttag tttcctcgta atccatgagg tgtatatgaa     31620
     agcaagaagt gtgagagttg ccggaattga aattatcgat agtgttaaaa cggtcgcttt     31680
     tgtttttact gaaaccttac tgtttatggt ctggttttcg gcaattgtct atgggcttta     31740
     tcgtgttgtt atcgttttat gggatgatcc tttaaagccg caatcgctca tggaatttct     31800
     taatttcata gttgagttgt atagctatgt acttccttcg ttggctgtta tcgcagtggc     31860
     tttaatcgcc gttttatcca tttgtaaaat actctcagca atatgggagg gaagaaagca     31920
     atgagacatt ttcttaaggc tctttccttt gttgtttccc tgttaccagc tacattgtgt     31980
     gcggctgaaa tccaggggaa agttattcgc gttctcgatg gcgacaccat agaagttaaa     32040
     acactacccg caaaaattgt tgtgtatgaa gttccgattc gagtccgatt gataaatatt     32100
     gatgcccctg aaaagaaaca accttttgga cgctggtcaa caaatcaact taaaaccctg     32160
     ctcgcaggcc aatccgttac cgtctcttat acgcagacag accgctacgg acgcattatc     32220
     ggtcgtgtgt tcacgacgaa cggcacggat gccagccgct ttatggttca gtctggcgct     32280
     gcatgggtat atgaacgtta caacgaggat gagtcattac cggctctgca acgggaagcg     32340
     caggaacaaa aacgcggttt gtgggccgac gcaaatccag ttccaccgtg ggagtggcga     32400
     tacaaacata actaactgat agaggttttt atggctttat cccccaaaga aaagaaagag     32460
     ttacaacaac gcttcgaaaa gcaattacta cctgaccttg atctgtcatt tgaactaaat     32520
     ggcgaagtat ataaatttaa ttttgataaa aatgagtcag gtgactatat cgacagtttt     32580
     acacaagcag tatggggagg ttatcaggat gccgaggaat gggaaaagta tggtaaacat     32640
     caggagacag aattacctga atgccctgaa ccagtcgagg gttggtgcga ctgtgataaa     32700
     tgtaagtcga tgatttttca taaagagaaa aatatttatg tttgcctctc ctgccataaa     32760
     caaacagagc catttcttcc aattgactgg aactcaaacg attacgattg gctaccttat     32820
     gaagatgaat actaatgctg aatacttcac agtcataatg gatgaaatgg cggcataaaa     32880
     ttaaggaggc ttaaatgaat atccatttat tttcagaagt attgttctgc gtatgggtta     32940
     tagctttgat tgtgatttta tttatagttg ttaaatatta caggcgtgtc cattacagac     33000
     tcaattcact gtctgaaacg ataaagcgca cacagggcgg tgttaataag cgaatatctg     33060
     aaaacagaga actgcttgaa cttataaaga atcaacatcc tga                       33103
//

If you have problems or comments...

PBIL Back to PBIL home page