(data stored in SCRATCH3701 zone)

EMBL: CP001068

ID   CP001068; SV 1; circular; genomic DNA; STD; PRO; 3942557 BP.
XX
AC   CP001068; AAWK01000000-AAWK01000028;
XX
PR   Project:PRJNA17631;
XX
DT   08-MAY-2008 (Rel. 95, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 4)
XX
DE   Ralstonia pickettii 12J chromosome 1, complete sequence.
XX
KW   .
XX
OS   Ralstonia pickettii 12J
OC   Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales;
OC   Burkholderiaceae; Ralstonia.
XX
RN   [1]
RP   1-3942557
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Meincke L., Brettin T., Detter J.C.,
RA   Han C., Kuske C.R., Schmutz J., Larimer F., Land M., Hauser L.,
RA   Kyrpides N., Mikhailova N., Marsh T., Richardson P.;
RT   "Complete sequence of chromosome1 of Ralstonia pickettii 12J";
RL   Unpublished.
XX
RN   [2]
RP   1-3942557
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Meincke L., Brettin T., Detter J.C.,
RA   Han C., Kuske C.R., Schmutz J., Larimer F., Land M., Hauser L.,
RA   Kyrpides N., Mikhailova N., Marsh T., Richardson P.;
RT   ;
RL   Submitted (01-MAY-2008) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 5de830287413ebba215776b21aac4ba4.
DR   BioSample; SAMN02598396.
DR   EnsemblGenomes-Gn; EBG00001117818.
DR   EnsemblGenomes-Gn; EBG00001117819.
DR   EnsemblGenomes-Gn; EBG00001117820.
DR   EnsemblGenomes-Gn; EBG00001117821.
DR   EnsemblGenomes-Gn; EBG00001117822.
DR   EnsemblGenomes-Gn; EBG00001117823.
DR   EnsemblGenomes-Gn; EBG00001117824.
DR   EnsemblGenomes-Gn; EBG00001117825.
DR   EnsemblGenomes-Gn; EBG00001117826.
DR   EnsemblGenomes-Gn; EBG00001117827.
DR   EnsemblGenomes-Gn; EBG00001117828.
DR   EnsemblGenomes-Gn; EBG00001117829.
DR   EnsemblGenomes-Gn; EBG00001117830.
DR   EnsemblGenomes-Gn; EBG00001117831.
DR   EnsemblGenomes-Gn; EBG00001117832.
DR   EnsemblGenomes-Gn; EBG00001117833.
DR   EnsemblGenomes-Gn; EBG00001117834.
DR   EnsemblGenomes-Gn; EBG00001117835.
DR   EnsemblGenomes-Gn; EBG00001117836.
DR   EnsemblGenomes-Gn; EBG00001117837.
DR   EnsemblGenomes-Gn; EBG00001117838.
DR   EnsemblGenomes-Gn; EBG00001117839.
DR   EnsemblGenomes-Gn; EBG00001117840.
DR   EnsemblGenomes-Gn; EBG00001117841.
DR   EnsemblGenomes-Gn; EBG00001117842.
DR   EnsemblGenomes-Gn; EBG00001117843.
DR   EnsemblGenomes-Gn; EBG00001117844.
DR   EnsemblGenomes-Gn; EBG00001117845.
DR   EnsemblGenomes-Gn; EBG00001117846.
DR   EnsemblGenomes-Gn; EBG00001117847.
DR   EnsemblGenomes-Gn; EBG00001117848.
DR   EnsemblGenomes-Gn; EBG00001117849.
DR   EnsemblGenomes-Gn; EBG00001117850.
DR   EnsemblGenomes-Gn; EBG00001117851.
DR   EnsemblGenomes-Gn; EBG00001117852.
DR   EnsemblGenomes-Gn; EBG00001117853.
DR   EnsemblGenomes-Gn; EBG00001117854.
DR   EnsemblGenomes-Gn; EBG00001117855.
DR   EnsemblGenomes-Gn; EBG00001117856.
DR   EnsemblGenomes-Gn; EBG00001117857.
DR   EnsemblGenomes-Gn; EBG00001117858.
DR   EnsemblGenomes-Gn; EBG00001117859.
DR   EnsemblGenomes-Gn; EBG00001117860.
DR   EnsemblGenomes-Gn; EBG00001117861.
DR   EnsemblGenomes-Gn; EBG00001117862.
DR   EnsemblGenomes-Gn; EBG00001117863.
DR   EnsemblGenomes-Gn; EBG00001117864.
DR   EnsemblGenomes-Gn; EBG00001117865.
DR   EnsemblGenomes-Gn; EBG00001117866.
DR   EnsemblGenomes-Gn; EBG00001117867.
DR   EnsemblGenomes-Gn; EBG00001117868.
DR   EnsemblGenomes-Gn; EBG00001117869.
DR   EnsemblGenomes-Gn; EBG00001117870.
DR   EnsemblGenomes-Gn; EBG00001117871.
DR   EnsemblGenomes-Gn; EBG00001117872.
DR   EnsemblGenomes-Gn; EBG00001117873.
DR   EnsemblGenomes-Gn; EBG00001117874.
DR   EnsemblGenomes-Gn; EBG00001117875.
DR   EnsemblGenomes-Gn; EBG00001117876.
DR   EnsemblGenomes-Gn; EBG00001117877.
DR   EnsemblGenomes-Gn; EBG00001117878.
DR   EnsemblGenomes-Gn; EBG00001117879.
DR   EnsemblGenomes-Gn; EBG00001117880.
DR   EnsemblGenomes-Gn; EBG00001117881.
DR   EnsemblGenomes-Gn; EBG00001117882.
DR   EnsemblGenomes-Gn; EBG00001117883.
DR   EnsemblGenomes-Gn; EBG00001117884.
DR   EnsemblGenomes-Gn; EBG00001117885.
DR   EnsemblGenomes-Gn; EBG00001117886.
DR   EnsemblGenomes-Gn; EBG00001117887.
DR   EnsemblGenomes-Gn; EBG00001117888.
DR   EnsemblGenomes-Gn; EBG00001117889.
DR   EnsemblGenomes-Gn; EBG00001117890.
DR   EnsemblGenomes-Gn; EBG00001117891.
DR   EnsemblGenomes-Gn; EBG00001117892.
DR   EnsemblGenomes-Gn; EBG00001117893.
DR   EnsemblGenomes-Gn; Rpic_R0001.
DR   EnsemblGenomes-Gn; Rpic_R0002.
DR   EnsemblGenomes-Gn; Rpic_R0003.
DR   EnsemblGenomes-Gn; Rpic_R0004.
DR   EnsemblGenomes-Gn; Rpic_R0005.
DR   EnsemblGenomes-Gn; Rpic_R0006.
DR   EnsemblGenomes-Gn; Rpic_R0007.
DR   EnsemblGenomes-Gn; Rpic_R0008.
DR   EnsemblGenomes-Gn; Rpic_R0009.
DR   EnsemblGenomes-Gn; Rpic_R0010.
DR   EnsemblGenomes-Gn; Rpic_R0011.
DR   EnsemblGenomes-Gn; Rpic_R0012.
DR   EnsemblGenomes-Gn; Rpic_R0013.
DR   EnsemblGenomes-Gn; Rpic_R0014.
DR   EnsemblGenomes-Gn; Rpic_R0015.
DR   EnsemblGenomes-Gn; Rpic_R0016.
DR   EnsemblGenomes-Gn; Rpic_R0017.
DR   EnsemblGenomes-Gn; Rpic_R0018.
DR   EnsemblGenomes-Gn; Rpic_R0019.
DR   EnsemblGenomes-Gn; Rpic_R0020.
DR   EnsemblGenomes-Gn; Rpic_R0021.
DR   EnsemblGenomes-Gn; Rpic_R0022.
DR   EnsemblGenomes-Gn; Rpic_R0023.
DR   EnsemblGenomes-Gn; Rpic_R0024.
DR   EnsemblGenomes-Gn; Rpic_R0025.
DR   EnsemblGenomes-Gn; Rpic_R0026.
DR   EnsemblGenomes-Gn; Rpic_R0027.
DR   EnsemblGenomes-Gn; Rpic_R0028.
DR   EnsemblGenomes-Gn; Rpic_R0029.
DR   EnsemblGenomes-Gn; Rpic_R0030.
DR   EnsemblGenomes-Gn; Rpic_R0031.
DR   EnsemblGenomes-Gn; Rpic_R0032.
DR   EnsemblGenomes-Gn; Rpic_R0033.
DR   EnsemblGenomes-Gn; Rpic_R0034.
DR   EnsemblGenomes-Gn; Rpic_R0035.
DR   EnsemblGenomes-Gn; Rpic_R0036.
DR   EnsemblGenomes-Gn; Rpic_R0037.
DR   EnsemblGenomes-Gn; Rpic_R0039.
DR   EnsemblGenomes-Gn; Rpic_R0040.
DR   EnsemblGenomes-Gn; Rpic_R0041.
DR   EnsemblGenomes-Gn; Rpic_R0042.
DR   EnsemblGenomes-Gn; Rpic_R0043.
DR   EnsemblGenomes-Gn; Rpic_R0044.
DR   EnsemblGenomes-Gn; Rpic_R0045.
DR   EnsemblGenomes-Gn; Rpic_R0046.
DR   EnsemblGenomes-Gn; Rpic_R0047.
DR   EnsemblGenomes-Gn; Rpic_R0048.
DR   EnsemblGenomes-Gn; Rpic_R0049.
DR   EnsemblGenomes-Gn; Rpic_R0050.
DR   EnsemblGenomes-Gn; Rpic_R0051.
DR   EnsemblGenomes-Gn; Rpic_R0052.
DR   EnsemblGenomes-Gn; Rpic_R0053.
DR   EnsemblGenomes-Gn; Rpic_R0054.
DR   EnsemblGenomes-Gn; Rpic_R0055.
DR   EnsemblGenomes-Gn; Rpic_R0056.
DR   EnsemblGenomes-Gn; Rpic_R0057.
DR   EnsemblGenomes-Gn; Rpic_R0058.
DR   EnsemblGenomes-Gn; Rpic_R0066.
DR   EnsemblGenomes-Gn; Rpic_R0067.
DR   EnsemblGenomes-Gn; Rpic_R0068.
DR   EnsemblGenomes-Tr; EBT00001708395.
DR   EnsemblGenomes-Tr; EBT00001708396.
DR   EnsemblGenomes-Tr; EBT00001708397.
DR   EnsemblGenomes-Tr; EBT00001708398.
DR   EnsemblGenomes-Tr; EBT00001708399.
DR   EnsemblGenomes-Tr; EBT00001708400.
DR   EnsemblGenomes-Tr; EBT00001708401.
DR   EnsemblGenomes-Tr; EBT00001708402.
DR   EnsemblGenomes-Tr; EBT00001708403.
DR   EnsemblGenomes-Tr; EBT00001708404.
DR   EnsemblGenomes-Tr; EBT00001708405.
DR   EnsemblGenomes-Tr; EBT00001708406.
DR   EnsemblGenomes-Tr; EBT00001708407.
DR   EnsemblGenomes-Tr; EBT00001708408.
DR   EnsemblGenomes-Tr; EBT00001708409.
DR   EnsemblGenomes-Tr; EBT00001708410.
DR   EnsemblGenomes-Tr; EBT00001708411.
DR   EnsemblGenomes-Tr; EBT00001708412.
DR   EnsemblGenomes-Tr; EBT00001708413.
DR   EnsemblGenomes-Tr; EBT00001708414.
DR   EnsemblGenomes-Tr; EBT00001708415.
DR   EnsemblGenomes-Tr; EBT00001708416.
DR   EnsemblGenomes-Tr; EBT00001708417.
DR   EnsemblGenomes-Tr; EBT00001708418.
DR   EnsemblGenomes-Tr; EBT00001708419.
DR   EnsemblGenomes-Tr; EBT00001708420.
DR   EnsemblGenomes-Tr; EBT00001708421.
DR   EnsemblGenomes-Tr; EBT00001708422.
DR   EnsemblGenomes-Tr; EBT00001708423.
DR   EnsemblGenomes-Tr; EBT00001708424.
DR   EnsemblGenomes-Tr; EBT00001708425.
DR   EnsemblGenomes-Tr; EBT00001708426.
DR   EnsemblGenomes-Tr; EBT00001708427.
DR   EnsemblGenomes-Tr; EBT00001708428.
DR   EnsemblGenomes-Tr; EBT00001708429.
DR   EnsemblGenomes-Tr; EBT00001708430.
DR   EnsemblGenomes-Tr; EBT00001708431.
DR   EnsemblGenomes-Tr; EBT00001708432.
DR   EnsemblGenomes-Tr; EBT00001708433.
DR   EnsemblGenomes-Tr; EBT00001708434.
DR   EnsemblGenomes-Tr; EBT00001708435.
DR   EnsemblGenomes-Tr; EBT00001708436.
DR   EnsemblGenomes-Tr; EBT00001708437.
DR   EnsemblGenomes-Tr; EBT00001708438.
DR   EnsemblGenomes-Tr; EBT00001708439.
DR   EnsemblGenomes-Tr; EBT00001708440.
DR   EnsemblGenomes-Tr; EBT00001708441.
DR   EnsemblGenomes-Tr; EBT00001708442.
DR   EnsemblGenomes-Tr; EBT00001708443.
DR   EnsemblGenomes-Tr; EBT00001708444.
DR   EnsemblGenomes-Tr; EBT00001708445.
DR   EnsemblGenomes-Tr; EBT00001708446.
DR   EnsemblGenomes-Tr; EBT00001708447.
DR   EnsemblGenomes-Tr; EBT00001708448.
DR   EnsemblGenomes-Tr; EBT00001708449.
DR   EnsemblGenomes-Tr; EBT00001708450.
DR   EnsemblGenomes-Tr; EBT00001708451.
DR   EnsemblGenomes-Tr; EBT00001708452.
DR   EnsemblGenomes-Tr; EBT00001708453.
DR   EnsemblGenomes-Tr; EBT00001708454.
DR   EnsemblGenomes-Tr; EBT00001708455.
DR   EnsemblGenomes-Tr; EBT00001708456.
DR   EnsemblGenomes-Tr; EBT00001708457.
DR   EnsemblGenomes-Tr; EBT00001708458.
DR   EnsemblGenomes-Tr; EBT00001708459.
DR   EnsemblGenomes-Tr; EBT00001708460.
DR   EnsemblGenomes-Tr; EBT00001708461.
DR   EnsemblGenomes-Tr; EBT00001708462.
DR   EnsemblGenomes-Tr; EBT00001708463.
DR   EnsemblGenomes-Tr; EBT00001708464.
DR   EnsemblGenomes-Tr; EBT00001708465.
DR   EnsemblGenomes-Tr; EBT00001708466.
DR   EnsemblGenomes-Tr; EBT00001708467.
DR   EnsemblGenomes-Tr; EBT00001708468.
DR   EnsemblGenomes-Tr; EBT00001708469.
DR   EnsemblGenomes-Tr; EBT00001708470.
DR   EnsemblGenomes-Tr; Rpic_R0001-1.
DR   EnsemblGenomes-Tr; Rpic_R0002-1.
DR   EnsemblGenomes-Tr; Rpic_R0003-1.
DR   EnsemblGenomes-Tr; Rpic_R0004-1.
DR   EnsemblGenomes-Tr; Rpic_R0005-1.
DR   EnsemblGenomes-Tr; Rpic_R0006-1.
DR   EnsemblGenomes-Tr; Rpic_R0007-1.
DR   EnsemblGenomes-Tr; Rpic_R0008-1.
DR   EnsemblGenomes-Tr; Rpic_R0009-1.
DR   EnsemblGenomes-Tr; Rpic_R0010-1.
DR   EnsemblGenomes-Tr; Rpic_R0011-1.
DR   EnsemblGenomes-Tr; Rpic_R0012-1.
DR   EnsemblGenomes-Tr; Rpic_R0013-1.
DR   EnsemblGenomes-Tr; Rpic_R0014-1.
DR   EnsemblGenomes-Tr; Rpic_R0015-1.
DR   EnsemblGenomes-Tr; Rpic_R0016-1.
DR   EnsemblGenomes-Tr; Rpic_R0017-1.
DR   EnsemblGenomes-Tr; Rpic_R0018-1.
DR   EnsemblGenomes-Tr; Rpic_R0019-1.
DR   EnsemblGenomes-Tr; Rpic_R0020-1.
DR   EnsemblGenomes-Tr; Rpic_R0021-1.
DR   EnsemblGenomes-Tr; Rpic_R0022-1.
DR   EnsemblGenomes-Tr; Rpic_R0023-1.
DR   EnsemblGenomes-Tr; Rpic_R0024-1.
DR   EnsemblGenomes-Tr; Rpic_R0025-1.
DR   EnsemblGenomes-Tr; Rpic_R0026-1.
DR   EnsemblGenomes-Tr; Rpic_R0027-1.
DR   EnsemblGenomes-Tr; Rpic_R0028-1.
DR   EnsemblGenomes-Tr; Rpic_R0029-1.
DR   EnsemblGenomes-Tr; Rpic_R0030-1.
DR   EnsemblGenomes-Tr; Rpic_R0031-1.
DR   EnsemblGenomes-Tr; Rpic_R0032-1.
DR   EnsemblGenomes-Tr; Rpic_R0033-1.
DR   EnsemblGenomes-Tr; Rpic_R0034-1.
DR   EnsemblGenomes-Tr; Rpic_R0035-1.
DR   EnsemblGenomes-Tr; Rpic_R0036-1.
DR   EnsemblGenomes-Tr; Rpic_R0037-1.
DR   EnsemblGenomes-Tr; Rpic_R0039-1.
DR   EnsemblGenomes-Tr; Rpic_R0040-1.
DR   EnsemblGenomes-Tr; Rpic_R0041-1.
DR   EnsemblGenomes-Tr; Rpic_R0042-1.
DR   EnsemblGenomes-Tr; Rpic_R0043-1.
DR   EnsemblGenomes-Tr; Rpic_R0044-1.
DR   EnsemblGenomes-Tr; Rpic_R0045-1.
DR   EnsemblGenomes-Tr; Rpic_R0046-1.
DR   EnsemblGenomes-Tr; Rpic_R0047-1.
DR   EnsemblGenomes-Tr; Rpic_R0048-1.
DR   EnsemblGenomes-Tr; Rpic_R0049-1.
DR   EnsemblGenomes-Tr; Rpic_R0050-1.
DR   EnsemblGenomes-Tr; Rpic_R0051-1.
DR   EnsemblGenomes-Tr; Rpic_R0052-1.
DR   EnsemblGenomes-Tr; Rpic_R0053-1.
DR   EnsemblGenomes-Tr; Rpic_R0054-1.
DR   EnsemblGenomes-Tr; Rpic_R0055-1.
DR   EnsemblGenomes-Tr; Rpic_R0056-1.
DR   EnsemblGenomes-Tr; Rpic_R0057-1.
DR   EnsemblGenomes-Tr; Rpic_R0058-1.
DR   EnsemblGenomes-Tr; Rpic_R0066-1.
DR   EnsemblGenomes-Tr; Rpic_R0067-1.
DR   EnsemblGenomes-Tr; Rpic_R0068-1.
DR   EuropePMC; PMC2789088; 19941653.
DR   EuropePMC; PMC5470458; 28065387.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00140; Alpha_RBS.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF01057; SAH_riboswitch.
DR   RFAM; RF01070; sucA.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01497; ALIL.
DR   RFAM; RF01695; C4.
DR   RFAM; RF01750; pfl.
DR   RFAM; RF01757; sbcD.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01850; beta_tmRNA.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02012; group-II-D1D4-7.
DR   RFAM; RF02278; Betaproteobacteria_toxic_sRNA.
DR   SILVA-LSU; CP001068.
DR   SILVA-SSU; CP001068.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4003028
CC   Source DNA and bacteria available from Terry Marsh (MARSHT@msu.edu)
CC   Contacts: Terry Marsh (MARSHT@msu.edu)
CC             David Bruce (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3942557
FT                   /organism="Ralstonia pickettii 12J"
FT                   /chromosome="1"
FT                   /strain="12J"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:402626"
FT   gene            328..1917
FT                   /locus_tag="Rpic_0001"
FT   CDS_pept        328..1917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="KEGG: rso:RSc3442 chromosomal replication initiation
FT                   protein; TIGRFAM: chromosomal replication initiator protein
FT                   DnaA; PFAM: Chromosomal replication initiator DnaA domain;
FT                   Chromosomal replication initiator DnaA; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25168"
FT                   /db_xref="GOA:B2UCF1"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2UCF1"
FT                   /protein_id="ACD25168.1"
FT                   /translation="MQDFWHAASAQLESELTPQQFKTWIKPLTPLSFDEQACTLRIAAP
FT                   NRFKLDWVKSQFSGRIQSLACDYWEATVDVQFVLDPSAGQRQAALQPALAPVPMQPLGA
FT                   QAGQPRQAMPAGNGVSHDAATLRPAPSVYRETALATASHAAADIDVPVMDAAEVSARSY
FT                   RMPPQAPAVVATLAAPPQAHVDDSVHERSRLNQILTFDNFVTGKANQLARAAAIQVANN
FT                   PGKSYNPLYLYGGVGLGKTHLIHAIGNFMLMENPRARIRYIHAEQYVSDVVKAYQRKAF
FT                   DDFKRYYHSLDLLLIDDIQFFSGKNRTQEEFFYAFEALIANRAQVIITSDTYPKEITGI
FT                   DDRLISRFDSGLTVAIEPPELEMRVAILMKKAQAENVTVPEEVAFFVAKHLRSNVRELE
FT                   GALRKILAYSNFHGKEITIEVTREALKDLLTVQNRQISVENIQKTCADFYNIKVADMYS
FT                   KKRPANIARPRQIAMYLAKELTQKSLPEIGELFGGRDHTTVLHAVRKIADERTKDAQLN
FT                   HELHVLEQTLKG"
FT   gene            2194..3309
FT                   /locus_tag="Rpic_0002"
FT   CDS_pept        2194..3309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: rso:RSc3441 DNA polymerase III subunit beta;
FT                   TIGRFAM: DNA polymerase III, beta subunit; PFAM: DNA
FT                   polymerase III beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25169"
FT                   /db_xref="GOA:B2UCF2"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:B2UCF2"
FT                   /protein_id="ACD25169.1"
FT                   /translation="MQLVKTSRDNLLRPLQIVSGIVERRHTLPILANLLITKQGERVSF
FT                   LSTDIEIQITTHADCGAGAGDVATTVAARKLVDILRAMPDGEVALTLNDKRMTVQSGKS
FT                   RFALQTLAAEEFPTVAEATDFGARITLPQKTLKHLLAMVHFAMAQQDIRYYLNGMLLVV
FT                   DGKQVMAVATDGHRLAYCGVETGEQPAGAGGRQEVIIPRKTILELQRLLEDVDDPVSVQ
FT                   LASNQVKFTFGNIELISKLVEGKFPDFQRVIPKGYRNSFTIDRAFLQQALQRTAILTTD
FT                   KFKGVRCMLDTNVLKISSTNADQEEAQEELEIDYQGDALDIGFNVTYLLDVLANLKAEK
FT                   VQVSLGDSNSSALITLPDDDTFKYVVMPMRI"
FT   gene            3438..5966
FT                   /locus_tag="Rpic_0003"
FT   CDS_pept        3438..5966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0003"
FT                   /product="DNA gyrase, B subunit"
FT                   /note="KEGG: rso:RSc3440 DNA gyrase subunit B; TIGRFAM: DNA
FT                   gyrase, B subunit; PFAM: DNA gyrase subunit B domain
FT                   protein; ATP-binding region ATPase domain protein; TOPRIM
FT                   domain protein; DNA topoisomerase type IIA subunit B region
FT                   2 domain protein; SMART: DNA topoisomerase II"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25170"
FT                   /db_xref="GOA:B2UCF3"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/TrEMBL:B2UCF3"
FT                   /protein_id="ACD25170.1"
FT                   /translation="MTEEQKPQSTPAEANSYDAASIQILEGLEAVRKRPGMYIGDTSDG
FT                   TGLHHLVFEVLDNSIDEALAGHCTEIQVTIHTDNSISVIDNGRGIPTGIKFDDKHEPKR
FT                   SATEIAMTELHAGGKFNQNSYKVSGGLHGVGVSCVNGLSKWMKVTVRQGGKVHYIEFAQ
FT                   GVPQNRLIETVQGPDGQMVEVSPLRVLGTTDKRGTEVHFLADEEIFTNVEYHYEILSKR
FT                   IRELSFLNNGVHIRLTDQRTGKEEDFAFSGGVKGFVEYINKNKTVLHPTIFFAAGEKDG
FT                   VAVEVSMQWNDAYNEQVLCFTNNIPQRDGGTHLTGLRAAMTRVINKYIADNEIAKKAKV
FT                   DTSGDDMREGLTCVLSVKVPEPKFSSQTKDKLVSSEVRLPVEEVVAKALSDFLLETPVD
FT                   AKIICGKIVEAARAREAARKAREMTRRKGVLDGMGLPGKLADCQEKDPALSELFIVEGD
FT                   SAGGSAKQGRDRKFQAILPLKGKILNVERARFDKMLSSQEVLTLITAMGTGIGKDDYNL
FT                   DKLRYHRIIIMTDADVDGSHIRTLLLTFFYRQMPEIIERGHVYIAQPPLYKIKHGKEER
FT                   YIKDDVEMAAYLVRQALDTAVLVRPDGTEIAGDALAELARQYQLSRGVIERLSRVIDAD
FT                   ALRAIAEGVSLDLSNEAAAEASARTLKARLLEMQGNASSANGGATADAFMQYDEKTEKY
FT                   RIMVVRRQHGNQRLSHIDADFVAGADYTALSSTAATFQGLIGDGAKVRRGTGDKVREQN
FT                   VADFHAAMTWLLSEAERGVSRQRYKGLGEMNPEQLWETTMDVTQRRLLRVQIEDAIAAD
FT                   QIFTTLMGDDVEPRRNFIESNALVARNIDV"
FT   gene            6281..8413
FT                   /locus_tag="Rpic_0004"
FT   CDS_pept        6281..8413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0004"
FT                   /product="N-6 DNA methylase"
FT                   /note="PFAM: N-6 DNA methylase; KEGG: eca:ECA0584
FT                   restriction enzyme alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25171"
FT                   /db_xref="GOA:B2UCF4"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B2UCF4"
FT                   /protein_id="ACD25171.1"
FT                   /translation="MATGKRARSQLKPLVAASPQSEVEAYHFIRENLKEVGWVVKNPSR
FT                   YSEGQVWTQNQCFEHPVLKSALKLMRPENIVKLSETKVWVIEAKSRKAALGQALKEAEN
FT                   DYAAPINKGRGIKAVLISGVAGNDESGYEVRTKMLVRGRYESVTINGVEATGLLDPRTV
FT                   ETLLISGSPDIADYQVNEELFLRAAEQINATLHNGGINKNDRSRVMAALLLALVETASL
FT                   DLEGDLPVLIGDINNRTDSALRRHGKREFHPFVKIEPPTNPDSHVKYKAAIVRTIQQLL
FT                   DLNIKSAMNSGTDVLGKFYEVFLRYGNGAKEIGIVLTPRHITRFAVDAVGVSPSDLVFD
FT                   PACGTGGFLVAAFDHVRAKTKGAPLERFKRFGLFGIEQESSVAALAIVNMIFRGDGKNN
FT                   IVEADCFNRFLTRSTNDGHATAQYVKAKPKLGEEPITRVFMNPPFALKKSDEHEWRFVE
FT                   TALKSMADGALLLAIVPMSVVSEGGSAGAWRRPLLEHHSVVAVVSLPEELFYPVAVQAV
FT                   AIILRKGVPHRAEQPVLWARVVNDGYRKSKGKRLPVPGVNDLDALKPKLRAFIADPDEP
FT                   IEGEPARIKISPLDLSDPILELAPEAYLDSQVPTSKELQSRLDVQVRENIAALVSLDLK
FT                   STSVGSGGIVDAAVGLSPISEEFPKRYSKFGEYSLNSLFELEAGDYHNLNSLEGGYSRG
FT                   LVRGWEQWNCRFLRNS"
FT   gene            8418..8852
FT                   /locus_tag="Rpic_0005"
FT   CDS_pept        8418..8852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0005"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25172"
FT                   /db_xref="UniProtKB/TrEMBL:B2UCF5"
FT                   /protein_id="ACD25172.1"
FT                   /translation="MAYANAITIAFNGSPLTTKLHPYEFGAKDDVAVAVAREQGGAPLP
FT                   VEALIFIQAQLNSERWRFSYYRKCFRAKLGRTLVELPEKRPGVPDIQFMVAAVRAQPYW
FT                   WFLAPRLKNWVTRAPRHHSPDMALENGDGGSVRKTVKRAI"
FT   gene            complement(9044..9454)
FT                   /locus_tag="Rpic_0006"
FT   CDS_pept        complement(9044..9454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0006"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_4685 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25173"
FT                   /db_xref="UniProtKB/TrEMBL:B2UCF6"
FT                   /protein_id="ACD25173.1"
FT                   /translation="MSQNLILKLAGLIDLSIEQRMTITKMGDKSEAFCRKAVEVLGNNP
FT                   GVLSVNYSLAEVKRDLAAFDALRPRVVRVEKLLEKMHDSQMALGSDLMTASLEGYAYLK
FT                   VAGKGEALDTARAALSVRFSRGARKKVEVATE"
FT   gene            10376..10744
FT                   /locus_tag="Rpic_0007"
FT   CDS_pept        10376..10744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0007"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rso:RSc3434 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25174"
FT                   /db_xref="UniProtKB/TrEMBL:B2UCF7"
FT                   /protein_id="ACD25174.1"
FT                   /translation="MPSNQSGHRPASYPSPPEPPTHAPTSSDTGTLTKNRTYLNGAIAA
FT                   QAYLKRTRSAMRSHGQCRPGMLREQLQHLSAHAFPPAFIKGFVDAIDAYVSMSLGGRDV
FT                   DPQAWDVLAAIERRGYSQ"
FT   gene            complement(10906..11763)
FT                   /locus_tag="Rpic_0008"
FT   CDS_pept        complement(10906..11763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0008"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG:
FT                   rme:Rmet_6067 integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25175"
FT                   /db_xref="GOA:B2UCF8"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B2UCF8"
FT                   /protein_id="ACD25175.1"
FT                   /translation="MLQVASSAYRRHAARLRDPSRRSDRARRDERLMPQVQRVWQENHR
FT                   VYGADKVWRQLNREGVTVARCTVERLMRAQGLQGVRRGKRLRTTIADDAASRPVDRVNR
FT                   QFRADRPNQLWVSDFTYVSTWQGWLYVAFVVDVYARRIVGWRVSKSMTTDFVLDALEQA
FT                   LYARQPGNDGSLTHHSDRGSQYVSIRYSERLAEAGIEPSVGSRGDSYDNALAETINGLY
FT                   KAELIHRRAPWKTRESVELATLEWVAWFNHKRLHSSIGYIPPAEAEANYYNQLGKTADE
FT                   AVLL"
FT   gene            complement(11817..12146)
FT                   /locus_tag="Rpic_0009"
FT   CDS_pept        complement(11817..12146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0009"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein; KEGG:
FT                   rme:Rmet_6068 transposase IS3/IS911"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25176"
FT                   /db_xref="GOA:B2UCF9"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B2UCF9"
FT                   /protein_id="ACD25176.1"
FT                   /translation="MSKNNANKFSPEVRERAVRLVQESRGEYPSLWVAVESIAPKIGCS
FT                   AQTLLTWVKRHEVDSGQREGVTTSERERIKELERENRELRRANDILRTASAFFAQAELD
FT                   RKLKS"
FT   gene            12674..13633
FT                   /locus_tag="Rpic_0010"
FT   CDS_pept        12674..13633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0010"
FT                   /product="Fimbrial protein"
FT                   /note="PFAM: Fimbrial protein; KEGG: pae:PA5284
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25177"
FT                   /db_xref="GOA:B2UCG0"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:B2UCG0"
FT                   /protein_id="ACD25177.1"
FT                   /translation="MKMHRLDLKAMRVVERAVAASLGLTAATSAFGADFRPFPTALSLP
FT                   RGVAANTVVARAYLTPQTLCGEGTCRLVNFRPISHVNVASGDVPGFVSNGPTVITEIKG
FT                   LRMQVLVNGEPQTRLDENQPSIKFSSPIEIQLLRDASPELGNGTTADSIQFWFFTKTTS
FT                   GTNRIDNYIRLNTRLTRIEGSCSVPSRTVELQPARVGRLTGVGATAGERSFQINIDDCP
FT                   KGYNKILYRLKPVGDTVGTSAGVLPLSAESTAKGVRIRVTDSAGAPVAFDTSNRIDAYS
FT                   KDTGGSFSIPMRVSYVQTEAKVTPGTVNGAMSVLMEYQ"
FT   sig_peptide     12674..12772
FT                   /locus_tag="Rpic_0010"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 33"
FT   gene            complement(13662..14021)
FT                   /locus_tag="Rpic_0011"
FT   CDS_pept        complement(13662..14021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0011"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bch:Bcen2424_2530 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25178"
FT                   /db_xref="UniProtKB/TrEMBL:B2UCG1"
FT                   /protein_id="ACD25178.1"
FT                   /translation="MKRVIALLTILTAAWAHASDSVKPVSPGTKSGTSTSGNKSGGGGD
FT                   SGGRTSGGGTDSGGKAHDPATRVDISGNRPERPGGYNSKGESLERPKDNAGPIRSGGGG
FT                   GPALGPKPKETKDGS"
FT   sig_peptide     complement(13965..14021)
FT                   /locus_tag="Rpic_0011"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.764 at
FT                   residue 19"
FT   gene            14642..24747
FT                   /pseudo
FT                   /locus_tag="Rpic_0012"
FT   gene            25869..27560
FT                   /locus_tag="Rpic_0014"
FT   CDS_pept        25869..27560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0014"
FT                   /product="Polypeptide-transport-associated domain protein
FT                   ShlB-type"
FT                   /note="PFAM: Hemolysin activator HlyB domain protein;
FT                   Polypeptide-transport-associated domain protein ShlB-type;
FT                   KEGG: rso:RSc1779 probable activation/secretion signal
FT                   peptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25179"
FT                   /db_xref="GOA:B2UCG2"
FT                   /db_xref="InterPro:IPR005565"
FT                   /db_xref="InterPro:IPR013686"
FT                   /db_xref="InterPro:IPR027282"
FT                   /db_xref="InterPro:IPR035251"
FT                   /db_xref="UniProtKB/TrEMBL:B2UCG2"
FT                   /protein_id="ACD25179.1"
FT                   /translation="MRTTFLLRTLLASGMTSSVFAQVAPAPLTGPGPDVQRLQEQQAEQ
FT                   ARERANARPDVFTPPAPAQVISLSALPKETPCFQINGITLEDNVFWWLPDLLKPVNGQC
FT                   VGKQGLEAIELQANNALIERGYVTSRVLIPKQNLAGGTLQLKVLAGRIGAIRNASDNNI
FT                   GWARMVLLAGPGDLLNQRDLDQALESIRRLPGQSQTSFDIVPGERVGESDIVLKPGTDK
FT                   RWHASLSADNTGLKSTGKYQMSGSLVIDSPLHLYDQLSISASSNTDRGSTAAGTRSYSI
FT                   NWSVPVGYATLFVGANRSRYNQTVAGFEEPIVYSGNSSEVNAGISGVLHRDATSRTGAQ
FT                   FKLFRKINRNYLEDTEIAVQRRDVVGYEASMSHRHYLGPVVLDGGFAWRETLPDHSNVP
FT                   GVVVGDPGYGGRSQVETANASLYWPFKLANQMFEYTSNWSIQHARTRVLPSDYFTIGNR
FT                   YTVRGFDGQLTLAAEDGWFWRNELAWRVAGQAIYAGVDMGKVHGPSAEFLLGDKLVGAV
FT                   VGVRGRVPSGPYMAFNYDVSFGWPLYRPAGFRSQQPAVMAQVGVEF"
FT   sig_peptide     25869..25934
FT                   /locus_tag="Rpic_0014"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.937 at
FT                   residue 22"
FT   gene            complement(27822..28013)
FT                   /locus_tag="Rpic_0015"
FT   CDS_pept        complement(27822..28013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0015"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25180"
FT                   /db_xref="UniProtKB/TrEMBL:B2UCG3"
FT                   /protein_id="ACD25180.1"
FT                   /translation="MATTPTFYPYSPEPHRGIAQSTPVAQDVIKLAIDADEAEAWFSET
FT                   HACQRLRELFPAAIAFFV"
FT   gene            28338..29102
FT                   /locus_tag="Rpic_0016"
FT   CDS_pept        28338..29102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0016"
FT                   /product="GntR domain protein"
FT                   /note="PFAM: regulatory protein GntR HTH; GntR domain
FT                   protein; KEGG: rso:RSc2102 probable transcription regulator
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25181"
FT                   /db_xref="GOA:B2UCG4"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2UCG4"
FT                   /protein_id="ACD25181.1"
FT                   /translation="MHSIPSSVAQALQQRILSGEYPSGSRLPPQRELAESLGVSRASLR
FT                   EALTVLETLGLVDILPSRGVVVRGQKFGAEGASAERMHRPFATPALGTLSPRQLIELRL
FT                   VLEPGWTALAAARMHAAGLRHLQWLQQQLAHALERNDLLSAAEADLHFHLLLAQLSGNP
FT                   GLMAMAGQLEHAIGHSLRLPFARNGADDHPAHEHDAIVQAIAAGDVAASAEAMRAHLLS
FT                   AARRSGIDLTAPPATPEPMQHEPASFRLASIS"
FT   gene            29130..29957
FT                   /locus_tag="Rpic_0017"
FT   CDS_pept        29130..29957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0017"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="PFAM: extracellular solute-binding protein family 3;
FT                   SMART: ionotropic glutamate receptor; KEGG: rso:RSc2103
FT                   probable amino-acid-binding periplasmic (PBP) ABC
FT                   transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25182"
FT                   /db_xref="GOA:B2UCG5"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:B2UCG5"
FT                   /protein_id="ACD25182.1"
FT                   /translation="MTRITARHASRPTSRRFFLHAVMAASAVAALLPGRPAHADALANI
FT                   QKAGVIRVAIPNDFPPFGSLGPDLKLQGYDIDMAGLIAKELGVKAELVPVTSTNRIPFL
FT                   TTGKVDVVISSLGKNAERAKVIDFTQAYAPFPKSVYGPKDVSIKGPADLAGKTIGVTRG
FT                   STEDLALSAVAPASATIKRYEDNNATAQSYLIGQVQLVTVGNIVANAVNERTKLRQLDL
FT                   KFPVEDTPCYVGVAKGEPALLDKVNTVITKLKTDGRLNDLSQRWIKMPLPAKL"
FT   sig_peptide     29130..29249
FT                   /locus_tag="Rpic_0017"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 40"
FT   gene            30115..30849
FT                   /locus_tag="Rpic_0018"
FT   CDS_pept        30115..30849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0018"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: rso:RSc2104
FT                   probable amino-acid transmembrane ABC transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25183"
FT                   /db_xref="GOA:B2UCG6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B2UCG6"
FT                   /protein_id="ACD25183.1"
FT                   /translation="MAYQFDFGAVFSYSGQLAQGAAFTLALTAAGAVAGGAIGIAGGVC
FT                   RAWRIAPFNALFKVYVEGIRNTPFLVQLMFVFFGLPSLGVQINEWQAALLTAVVNLGAY
FT                   ITEIVRAGIQETPRGQLEAANALAMSRWAVFRHVVLRPALQKVWPALSSQIVIVMLGTS
FT                   VVSQIAAQDLTFAANFIQSRNFRAFETYLVVTALYFALALLLRQLLAWIGQRFVVGRRA
FT                   PAASAAPLAATATAAASVGDAA"
FT   gene            30846..31499
FT                   /locus_tag="Rpic_0019"
FT   CDS_pept        30846..31499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0019"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: rso:RSc2105
FT                   probable amino-acid transmembrane ABC transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25184"
FT                   /db_xref="GOA:B2UCG7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B2UCG7"
FT                   /protein_id="ACD25184.1"
FT                   /translation="MIADIPLLPILLKLGEGLLATLMLSLMAFALGGTAGLVVLFARVG
FT                   RNATLQRVSKAYIQLFQNTPLLMQMFIVFFGASMAGFEMSPWTAAAIGLTLYTSAYLAE
FT                   VWRGCVEAIPRGQWEASSSLAMGYFQQMRHVVLPQAVRLSIAPTVGFSVQIVKGTAVAS
FT                   IIGFEDLSKLGSVLANATFQPFLIYGLVAIGYFALCWPLSLYASHLEKKLYAAR"
FT   sig_peptide     30846..30944
FT                   /locus_tag="Rpic_0019"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.830) with cleavage site probability 0.441 at
FT                   residue 33"
FT   gene            31486..32223
FT                   /locus_tag="Rpic_0020"
FT   CDS_pept        31486..32223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0020"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: rso:RSc2106 probable amino-acid ATP-binding ABC
FT                   transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25185"
FT                   /db_xref="GOA:B2UCG8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:B2UCG8"
FT                   /protein_id="ACD25185.1"
FT                   /translation="MPLVDLCAVHKHYGNNHVLKGVDLRVEAGQVVAIIGRSGSGKSTL
FT                   LRSINGLEAIDDGQIVVDNAVLQGSQATPARLRALRLNVGMVFQQFNLFPHLTAGQNVA
FT                   LSPVVVKGMKKADANDLARQMLVKVGLAEKFDAYPDQLSGGQQQRVAIARALAMQPKVL
FT                   LCDEITSALDPELVNEVLAVVKQLAAEGMTLIMVTHEMRFARDVGDQLVFMHQGLIHES
FT                   GPAKEVFASPKTAELAAFIGAVQ"
FT   gene            32307..33263
FT                   /locus_tag="Rpic_0021"
FT   CDS_pept        32307..33263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0021"
FT                   /product="protein of unknown function UPF0187"
FT                   /note="PFAM: protein of unknown function UPF0187; KEGG:
FT                   rso:RSc3414 probable transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25186"
FT                   /db_xref="GOA:B2UCG9"
FT                   /db_xref="InterPro:IPR021134"
FT                   /db_xref="UniProtKB/TrEMBL:B2UCG9"
FT                   /protein_id="ACD25186.1"
FT                   /translation="MVVRPHLHWFRMLLAWRGSVLPQLLPRLFLIFFVSLVAIAVHAHL
FT                   LPVSVNLSTTPFSLVGIALAVFLGFRNNASYDRYWEARKLWGQLLNTARSLTRQALTLP
FT                   RGDGTNGPNGPNSGVTDADVREFAQVLGALPHALRHQLRHTDAREDLATRLPAALLERV
FT                   MAARYRPIVIVQWMGEWVQRRAQAGALDGYAALAFDRNLNELSNSIGGCERIAGTPLPF
FT                   AYSVMIHRTVYFFCAALPFGLVESIGSFTPVFAVFVAYTFMAHEAIASQLEDPFGTEDN
FT                   DLALNALSNTIEDAVLDILGEPSPLPRAGVRRGVIFD"
FT   sig_peptide     32307..32438
FT                   /locus_tag="Rpic_0021"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.715) with cleavage site probability 0.709 at
FT                   residue 44"
FT   gene            complement(33286..33957)
FT                   /locus_tag="Rpic_0022"
FT   CDS_pept        complement(33286..33957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0022"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: reu:Reut_B4310 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25187"
FT                   /db_xref="UniProtKB/TrEMBL:B2UCH0"
FT                   /protein_id="ACD25187.1"
FT                   /translation="MPLISRAHVRLSRLRFPFAVRVQSEQGTVCLRDANGRREVRPGNP
FT                   FVVPAFAHFGCEIPGTVWQPCAITFKAVPDAGCPRMAAIQHDKPWARAFATLVFEHPVQ
FT                   AWNAALLSHCWQACPRQVRARLFAEGEALHALVREQRAAWALYRLAHTCGNDEPEAEAL
FT                   HALARRAGLRNARTLNETCASLFGVELAALLAGNADSVSGLVHGSTAPLERWAQPLAMA
FT                   L"
FT   gene            complement(34060..34758)
FT                   /locus_tag="Rpic_0023"
FT   CDS_pept        complement(34060..34758)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0023"
FT                   /product="transcriptional regulator, Crp/Fnr family"
FT                   /note="PFAM: cyclic nucleotide-binding; regulatory protein
FT                   Crp; KEGG: reh:H16_B1147 cNMP regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25188"
FT                   /db_xref="GOA:B2UCH1"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2UCH1"
FT                   /protein_id="ACD25188.1"
FT                   /translation="MTTPRAPTPATQLQGHAWYTALAPEHQALAGRETLLQAFEPGAFI
FT                   ARRGEPSRYWIGVDTGLIKLAVYTSDGRGCTFSGVPAGGWCGEGSVIKREDRRYDVIAI
FT                   RASHVLLVPEPVFNTLLAQSLPFASFVVRQLNERMGQFIATVQNDRLLSADARVAQAIA
FT                   QLFHPALYPRTSTVLELSQEEIGLLTGLSRQRVNRALQRLAEGGMIALSYQTIRVTDLE
FT                   RLRLFGLSEL"
FT   gene            34952..36586
FT                   /locus_tag="Rpic_0024"
FT   CDS_pept        34952..36586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0024"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   reh:H16_B1148 acyl-CoA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25189"
FT                   /db_xref="GOA:B2UCH2"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B2UCH2"
FT                   /protein_id="ACD25189.1"
FT                   /translation="MPTDFDSGLARNAANFVPLTPIEFLARAADVYGDRLAIVHGPVRQ
FT                   NWRDTYERARRLASALSLAGVGRGDTVAALLPNTPAMVEAHFGVPMAGGVLNALNIRLD
FT                   AANLVFMLRHGEARVLLADTEFADLARQMALEIPGLKVIAVNDALGPQAEPFGDTDYET
FT                   FLASGDPHYAWQLPADEWDAIALNYTSGTTGDPKGVVYHHRGAAINAVSNILEWDLPKH
FT                   PVYLWTLPMFHCNGWCFPWTIAARAGVNVCLRKFEPKLVFDLMRDEGVTHYCAAPIVHT
FT                   ALVNAPPSWREGLRGPVRGMVAGAPPPAAVLAQMEAMGFELTHVYGLTEVYGPAAVCAE
FT                   QDEWRTLPEHDRATMKARQGVRYHLQSQVAVLNPETMQPVPADGETIGEIMFRGNICMK
FT                   GYLKNEKATREAFAGGWFHTGDLGVCMPDGYIKIKDRSKDIIISGGENISSVEVEDALY
FT                   RHPAVLAAAVVAQPDAKWGETPCAFVELKDGATATAEDLIAHCKTLLAGFKVPKAVFFG
FT                   PLPKTSTGKIQKYELRRKVKSTSAIDV"
FT   gene            complement(36686..38254)
FT                   /locus_tag="Rpic_0025"
FT   CDS_pept        complement(36686..38254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0025"
FT                   /product="40-residue YVTN family beta-propeller repeat
FT                   protein"
FT                   /note="TIGRFAM: 40-residue YVTN family beta-propeller
FT                   repeat protein; KEGG: rso:RSc0127 putative
FT                   hemagglutinin-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25190"
FT                   /db_xref="InterPro:IPR011048"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR019405"
FT                   /db_xref="UniProtKB/TrEMBL:B2UCH3"
FT                   /protein_id="ACD25190.1"
FT                   /translation="MAELLIAKAQRSSSAYTQPTPAPIPPDAPRHARGMHGAALVMAAA
FT                   LSLGLSACGGGEDAGTTTPPTNNNTPAPTPSPAPTPAPKPTPSPSPAPTPTPAPTPAPA
FT                   PATYSVGGTVSGLTSGKSVTLLDNGGDAVVVNANGSFNFPTKLAQGKPYAATVGTRPSG
FT                   ENCTVTNGSGTVGTSNVTTIAVACTPKPLFGYAVNSNDGTISAFTLDATTGMPTAVGTA
FT                   VAVGAGPLSLTIDPAGKFVYVANANANTVTTLSINADTGLLTVVGSATPTGVQPYSIAR
FT                   TPNGKFAYTTNYGDNTLSAFSVNTGTGALTALAPITAGANPYTVAINSAGTFAYVVNAN
FT                   SGATPGTAMAFAVNNTTGALTQVGTTVNTGNTPQFIAVNSAGTYAYVTNAADNTINVYS
FT                   ISNTGALTASGTPVAAGTNPYYIAIAPSGGFMYVTNVLANTVSVFSINPSNGALTLVDT
FT                   TPTGNAPVTVLVNPAGTFAYVVNAVDNSVSAYSINSTTGKLTAVASGSAATGNIPRGMA
FT                   IVAVP"
FT   gene            38470..39015
FT                   /locus_tag="Rpic_0026"
FT   CDS_pept        38470..39015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0026"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   bte:BTH_II0494 acetyltransferase, GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25191"
FT                   /db_xref="GOA:B2UD12"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B2UD12"
FT                   /protein_id="ACD25191.1"
FT                   /translation="MSNANPNSNNTVLIRQLSSVDAADVADYRAIRLAALKDSPDAFGS
FT                   TYEAEVGLSTEAFAERLATTIVLGAYAGTGSDARIVGMVGFKQQTIAKLAHKGFVWGFY
FT                   VAPAARGRGVGVALVERIVAAATGLVQQLTLSVVRGNDAALALYERCGFETYGVEPRAL
FT                   KSTTGYADEVLMVRFLHG"
FT   gene            complement(39109..39582)
FT                   /locus_tag="Rpic_0027"
FT   CDS_pept        complement(39109..39582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0027"
FT                   /product="alkylhydroperoxidase like protein, AhpD family"
FT                   /note="TIGRFAM: alkylhydroperoxidase like protein, AhpD
FT                   family; PFAM: Carboxymuconolactone decarboxylase; KEGG:
FT                   bte:BTH_I0996 carboxymuconolactone decarboxylase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25192"
FT                   /db_xref="GOA:B2UD13"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:B2UD13"
FT                   /protein_id="ACD25192.1"
FT                   /translation="MSQAPRIAYFQLAPKAFNNLLNLSNGLRRDLLGARLVDLVLLRVS
FT                   QINGCAFCIDMHWADLIKMGEDPRHLNAVAGWREAPFFTERERGAALRWAELVTNTPHS
FT                   DASDEEFARLREHFSDEEIAELSFVIVTINSWNLLNVSLRNPVPLKAPHVAAA"
FT   gene            complement(39715..40623)
FT                   /locus_tag="Rpic_0028"
FT   CDS_pept        complement(39715..40623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0028"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; RNA polymerase sigma-70 factor; PFAM: sigma-70
FT                   region 2 domain protein; sigma-70 region 4 domain protein;
FT                   Sigma-70 region 4 type 2; KEGG: bte:BTH_I0997 RNA
FT                   polymerase sigma-70 factor, ECF family"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25193"
FT                   /db_xref="GOA:B2UD14"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014303"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B2UD14"
FT                   /protein_id="ACD25193.1"
FT                   /translation="MTKPSPDRTTRTDSEDTTFTAVRPRLFAIAYRMLGSRADAEDVLQ
FT                   DAWMRWHQTDQTALQSAEAWLVTVVTRLSIDRLRAAKTEREAYVGWWLPEPLVEPESHA
FT                   PTPETAVELAGDVSMALLWVLERLSPEERAAFLMRQVFDQDYSEIAALLGKTEAACRQM
FT                   VHRASDRVQQERPRFDVAPDAHRDLLERFAQASRTGQRDAIRALLADDAQLVGDGGGKV
FT                   PSFTRIIQDAGQITKIYCELVRAMGDVRYVHARVNGEPGLLRYVDGKLESAQSFVIENG
FT                   QIVAIYVVRNPDKLAHIGIGA"
FT   gene            complement(40695..42893)
FT                   /locus_tag="Rpic_0029"
FT   CDS_pept        complement(40695..42893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0029"
FT                   /product="PAS/PAC sensor hybrid histidine kinase"
FT                   /note="TIGRFAM: PAS sensor protein; PFAM: response
FT                   regulator receiver; ATP-binding region ATPase domain
FT                   protein; histidine kinase A domain protein; KEGG:
FT                   bvi:Bcep1808_3441 PAS/PAC sensor hybrid histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25194"
FT                   /db_xref="GOA:B2UD15"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B2UD15"
FT                   /protein_id="ACD25194.1"
FT                   /translation="MPFLAHHHDCLGWNGEMAQRVLAFDWASTELGPIQDWSPSLRAAV
FT                   HMVLACPVPLVMLWGRHGYMVYNDAYAVFAGGRHPYLLGCPVELGWPEVADFNRHVMDV
FT                   CLGGGTLSYRDKELVLLRNGRPEDVWMDLYYSPLPDDTGRPAGVLAIVVETTERVQTER
FT                   ERQAAEQALRQLTETLEQRVADALSARAEVEAQLRQAQKMEAIGNLTGGVAHDFNNVLQ
FT                   VIAGNLQMLSVEAPNNTRVQHRIAAATRAVQRGATLAAQLLAFARRQQLSPAVVNPTRL
FT                   VQGMSEMLHRALGEAIKVETHLAADLWNVQADRNQLENALLNLAINARDAMRGGGMLTI
FT                   AANNVTLDNTQADVRDQLTPGDYLVFSVTDTGVGMPPEVVEHAFEPFFTTKPDGHGTGL
FT                   GLSMVFGFVKQSGGHIAIDSTVGQGTTVQLYFPRCTEAAPDDAVELRDTIVTPMGGRET
FT                   ILVVEDDTDVRLTAVDMLTQLGYRVLTAANGQAALDLMNSGTSIDLLFTDVIMPGPIKG
FT                   SELSIRAAQRVPPLPVLLVSGYPRDEVQHDGRLPPGVTLLGKPYRRDDLARMVRNVLTA
FT                   SRTAQAQAQSASPSAGPAVATDASQPPAVLLVEDDTASREAMQEVLTTFGLQCVAAVNA
FT                   EDALALARTRSVQVLLTDLTLPGQSGANLARTLLRMQPQLQVLLMSGYGTEAEIGEPIA
FT                   GARLLGKPIDLMTLQQALAPWLGATVRAADTQNVTNAA"
FT   gene            43133..43747
FT                   /locus_tag="Rpic_0030"
FT   CDS_pept        43133..43747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0030"
FT                   /product="Glutathione S-transferase domain"
FT                   /note="PFAM: Glutathione S-transferase domain; KEGG:
FT                   rso:RSc0129 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25195"
FT                   /db_xref="GOA:B2UD16"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:B2UD16"
FT                   /protein_id="ACD25195.1"
FT                   /translation="MKLIGMLDSPYVRRTAISLKLLGLPFEHAAVSVFRHFDQFSAINP
FT                   VVKAPTLVCDDGTVLIDSTLIIDYAETLAGRSLMPAAIAERQHALRVIGLALAACEKAV
FT                   QIVYEHNLRPSEKVHGPWVERVHSQLLAAVEALEAEWKDAPLPVEENELTQAGVTVAVA
FT                   WAFIQLMVADRVPAADYPRLVAYSVAAEQLGAFRELPMDAV"
FT   gene            complement(43755..44903)
FT                   /locus_tag="Rpic_0031"
FT   CDS_pept        complement(43755..44903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0031"
FT                   /product="CBS domain containing membrane protein"
FT                   /note="PFAM: CBS domain containing protein; HPP family
FT                   protein?; KEGG: rso:RSc0130 probable transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25196"
FT                   /db_xref="GOA:B2UD17"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR007065"
FT                   /db_xref="UniProtKB/TrEMBL:B2UD17"
FT                   /protein_id="ACD25196.1"
FT                   /translation="MSSSSLHPALRRWLHSFIPAPVTVRWSERVRSAVGALVGILFTGT
FT                   MMKMVPGASTLIPLLVAPMGASAVLLFAVPASPLAQPWSIIGGNLVAATVGVTFALLVN
FT                   DPVIASALAISAAIAGMFALRCVHPPSGAVALTAVIGGPAVHALGYRFVLEPILIQSAL
FT                   LLVGALVYHAATGHRYPHAQRLPAAERPPTAAGFTRADIVAALRRQSELLDIDPEDIEA
FT                   VLREMQLQAYTRTFQALTCADIMTTPVVTVLAGTSIPRALELLRQHGFKALPVVDEGRR
FT                   VVGIVTRVDLLGLAPADMRQTLRRWFSIGALTPPRVADHMKTRVQTIAANAPMSDLVPM
FT                   FASAGHHHIPVLDADGRLAGIVTESDLVGGLYRQANIEPQAA"
FT   gene            45136..45333
FT                   /locus_tag="Rpic_0032"
FT   CDS_pept        45136..45333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0032"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rso:RSc0131 probable lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25197"
FT                   /db_xref="UniProtKB/TrEMBL:B2UD18"
FT                   /protein_id="ACD25197.1"
FT                   /translation="MAFTARPAFSRPRLCSSLVALFGALALTACGGDDTTSSTPAATTQ
FT                   AIPAPPADPGFVDTAAVPGA"
FT   sig_peptide     45136..45231
FT                   /locus_tag="Rpic_0032"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.807 at
FT                   residue 32"
FT   gene            45347..46393
FT                   /locus_tag="Rpic_0033"
FT   CDS_pept        45347..46393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0033"
FT                   /product="autotransporter-associated beta strand repeat
FT                   protein"
FT                   /note="TIGRFAM: autotransporter-associated beta strand
FT                   repeat protein; KEGG: rso:RSc0131 probable lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25198"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR013425"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:B2UD19"
FT                   /protein_id="ACD25198.1"
FT                   /translation="MLARGQELGENRILAGMHSPLDVMSGRMIGIAAAAANLVDPANAA
FT                   LKAAAFTQAHTALMAQTGTDATTFPALAQSGTPATDRFADYATNQANFTRRMTFGFSQI
FT                   SATTLAPVVPKGAEVLLETRFPYLSADQRRVVLKTTELASGYPVLDDAEGWGRLNLFAA
FT                   ADDYGAFNGNVIVSMDATQGGFNAADTWRNAISGAGKLTLQGTGRLRLAGANTYTGGTQ
FT                   VASGVLEADSANAFGTGDVYVGAGTLAVNAPAAVAIAGKFTQLQGTTLDLAIGPNGQGK
FT                   LSVAGLTTIAGGTLHLKFVNGYTPKVGDTIAVVDGAGSNRQFSTVVVDGFQATAIYTAT
FT                   GIQVHLDA"
FT   gene            complement(46398..47237)
FT                   /locus_tag="Rpic_0034"
FT   CDS_pept        complement(46398..47237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0034"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; transcription activator effector binding; KEGG:
FT                   rso:RSc0132 probable transcription regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25199"
FT                   /db_xref="GOA:B2UD20"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010499"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR029442"
FT                   /db_xref="UniProtKB/TrEMBL:B2UD20"
FT                   /protein_id="ACD25199.1"
FT                   /translation="MLAHIDAHLEDTLDVDGLAGVAAFSRHHFHRQFSLLFGMNVGRYV
FT                   QLLRLKRAAHQLAYRDDARITDIALACGYEGPEAFARAFRRQAGQSPSAFRAAPQWTPW
FT                   ATDLQALRALRSQHMPAQPQTQSVEIVEREAVAVAAIEHRGDPARLSETLRTFIVWRRE
FT                   HRLHPSVSATYNVVYDNPDDVPPEAFRMDICAATRAPIAPNAAGVAGKTLAGGRYAVLR
FT                   HTGSDDTLGQSVAYLYADWLPASGEELRDAPLLFQRVRFYPDVPEHEAVTDVLLPLR"
FT   gene            47549..47842
FT                   /locus_tag="Rpic_0035"
FT   CDS_pept        47549..47842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0035"
FT                   /product="GYD family protein"
FT                   /note="PFAM: GYD family protein; KEGG: rso:RSc0133
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25200"
FT                   /db_xref="InterPro:IPR014845"
FT                   /db_xref="UniProtKB/TrEMBL:B2UD21"
FT                   /protein_id="ACD25200.1"
FT                   /translation="MATFLALLNFTDQGIRSVKDTTKRAAAARELAKAAGIDMKAIYWT
FT                   LGQYDLAVICEGPDDAAMTAFGLALAAAGNVRSQTLRAFSADEMNGILSKMP"
FT   gene            complement(47913..49103)
FT                   /locus_tag="Rpic_0036"
FT   CDS_pept        complement(47913..49103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0036"
FT                   /product="Methionine adenosyltransferase"
FT                   /EC_number="2.5.1.6"
FT                   /note="PFAM: S-adenosylmethionine synthetase; KEGG:
FT                   rso:RSc0134 S-adenosylmethionine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25201"
FT                   /db_xref="GOA:B2UD22"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2UD22"
FT                   /protein_id="ACD25201.1"
FT                   /translation="MSNDFLFTSESVSEGHPDKVADQISDAILDAILAQDKYARVAAET
FT                   LCNTGLVVLAGEITTTANVDYIHVARETIKRIGYDNTEYGIDYKGCAVLVAYDKQSPDI
FT                   AQGVDRASDDYLNQGAGDQGLMFGYACDETPELMPFPIYYAHRLVERQSQLRRDGRLPW
FT                   LRPDAKSQVTVRYVDGKPHSVDTVVLSTQHAPEMSQEAIREAVIEEIIKPVLPSHMLAE
FT                   TKYLVNPTGRFVIGGPQGDCGLTGRKIIVDTYGGAAPHGGGAFSGKDPSKVDRSAAYAA
FT                   RYVAKNVVAAGLARQCQVQVSYAIGVARPINITVYTEGTGVIPDEQIAKLVQEHFDLRP
FT                   KGIVQMLDLLRPVYEKTAAYGHFGREEPEFSWEATDKVLLLREAAGLAGEPAKAFA"
FT   gene            49343..50191
FT                   /locus_tag="Rpic_0037"
FT   CDS_pept        49343..50191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0037"
FT                   /product="lipid A biosynthesis acyltransferase"
FT                   /note="PFAM: lipid A biosynthesis acyltransferase; KEGG:
FT                   rso:RSc0135 lipid A biosynthesis lauroyl acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25202"
FT                   /db_xref="GOA:B2UD23"
FT                   /db_xref="InterPro:IPR004960"
FT                   /db_xref="UniProtKB/TrEMBL:B2UD23"
FT                   /protein_id="ACD25202.1"
FT                   /translation="MTFLFWLFSRLPLSALQALGGWLGALAAKVPGRYHDRLIANFRHA
FT                   YPDVTPAMLKEAGRSAGRMVFEMPYFWVRKNGADVAPHLFDVCRTVVERALADGRGLIF
FT                   LTPHLGCFEVLPQAYAREHPVTSLFKPPRKASLRGWIETMRAGPNMQMAPADPRGVRML
FT                   VRALKRGEAVGILPDQTPTAGEGVWAPFFGKPAYTMTLVHRLHRLTGAPVVALFAERLP
FT                   RGAGYRLHLEEIGDLPEDATQAATRINAAVERLIAVAPTQYLWGYNRYKHPKGADAPPA
FT                   A"
FT   sig_peptide     49343..49426
FT                   /locus_tag="Rpic_0037"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.975) with cleavage site probability 0.800 at
FT                   residue 28"
FT   gene            50205..51098
FT                   /locus_tag="Rpic_0038"
FT   CDS_pept        50205..51098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0038"
FT                   /product="lipid A biosynthesis acyltransferase"
FT                   /note="PFAM: lipid A biosynthesis acyltransferase; KEGG:
FT                   rso:RSc0136 lipid A biosynthesis lauroyl acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25203"
FT                   /db_xref="GOA:B2UD24"
FT                   /db_xref="InterPro:IPR004960"
FT                   /db_xref="UniProtKB/TrEMBL:B2UD24"
FT                   /protein_id="ACD25203.1"
FT                   /translation="MERLSAKLGLGFLWLLSFLPYGFVARFGEGLGGLLYRIPNGRRRV
FT                   VLANLRACFPEKSEAEREAMAHEVFRKVFRSFAERSFAWFASEKRLMRVVKIDDQANLP
FT                   ALHGQPHILVTLHLSGVEIGALALTDYLRKHVGNAGCSLYTRMANPVLDDAIKALRSRF
FT                   GATMVSRNENIRQIMRTIKRGEALQLISDMDFGERDSEFVPFFGVPALTLNAIPRMASM
FT                   TGAKVVPMYTEILPNYEGYALRILPAWENYPTGDLTADTRRMNAFFEDAIRPRITEYYW
FT                   VHKRFKHRPEGMPGIY"
FT   gene            51188..52066
FT                   /locus_tag="Rpic_0039"
FT   CDS_pept        51188..52066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0039"
FT                   /product="Diaminopimelate epimerase"
FT                   /EC_number="5.1.1.7"
FT                   /note="PFAM: diaminopimelate epimerase; KEGG: rso:RSc0137
FT                   diaminopimelate epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25204"
FT                   /db_xref="GOA:B2UD25"
FT                   /db_xref="InterPro:IPR001653"
FT                   /db_xref="InterPro:IPR018510"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2UD25"
FT                   /protein_id="ACD25204.1"
FT                   /translation="MKLHFTKMHGAGNDFVVLDGIQTPIDFTPEQWAAIADRHFGVGAD
FT                   QLLLVERSTRPDVDFRYRIFNHDGGEVEHCGNGARCFVKFVTDRGLTDKRTVRVEVMNG
FT                   IATLTMQDDGQVTVDMGAPVFEAARLPFLPEGLPTRTQGDDTQHALQINGRTEWLSTVS
FT                   MGNPHAVQIVDDTEAFPVLEDGPLIESHAVFPRRVNAGFMQIVDRHSVRLRVYERGAGE
FT                   TLACGTGACAAVVAGIRRGLLDSPVKVATHGGDLTIAWAGDGQPVMMTGPATTVFEGTL
FT                   DLDALKLTAAH"
FT   gene            52114..52941
FT                   /locus_tag="Rpic_0040"
FT   CDS_pept        52114..52941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0040"
FT                   /product="protein of unknown function DUF344"
FT                   /note="PFAM: protein of unknown function DUF344; KEGG:
FT                   rso:RSc0138 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25205"
FT                   /db_xref="GOA:B2UD26"
FT                   /db_xref="InterPro:IPR016898"
FT                   /db_xref="InterPro:IPR022300"
FT                   /db_xref="InterPro:IPR022488"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2UD26"
FT                   /protein_id="ACD25205.1"
FT                   /translation="MASNGKNPIDDWYFDGSSKFKIAKFDPAAKPCTTGSKAGDLARLA
FT                   ELSARIEALQDIFYAEHRRKLLVVLQGMDTAGKDGTVRTVFRALDPLGLRVVGFKVPTP
FT                   LELAHDFLWRIHAEVPAAGEIVIFNRSHYEDVLVTRVHGDIDAAESKRRYAHINAFEQM
FT                   LTETDTTIVKCFLHISKEEQRDRLQMRIDDPQKHWKLGMADIEERKFWEDYMAAYEDAI
FT                   NATATPHAPWHIIPANSKSHRSLMVAEILLQVMERLQPEYPVGNPAFLGLKIE"
FT   gene            complement(53067..53744)
FT                   /locus_tag="Rpic_0041"
FT   CDS_pept        complement(53067..53744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0041"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.10"
FT                   /note="KEGG: rso:RSc0139 orotate phosphoribosyltransferase;
FT                   TIGRFAM: orotate phosphoribosyltransferase; PFAM:
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25206"
FT                   /db_xref="GOA:B2UD27"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2UD27"
FT                   /protein_id="ACD25206.1"
FT                   /translation="MSQNSELRQSFIRFAVEAGVLSFGEFVTKAGRTSPYFFNAGKFAD
FT                   GALLGQVAQFYAKTLLDSGVEFDMLFGPAYKGITLASATAVALAGLGRNVGFAYNRKEA
FT                   KDHGEGGSLVGAKLQGRVVIVDDVISAGTSVRESVELIRAAGATPAAVLILMDRMERSG
FT                   NAVDIGERSAVQDVQAQYGMPVVSIANLDDLLGYLDNAGDPALAGYREKAAAYRDKYGV
FT                   SAI"
FT   gene            53778..54563
FT                   /locus_tag="Rpic_0042"
FT   CDS_pept        53778..54563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0042"
FT                   /product="exodeoxyribonuclease III Xth"
FT                   /EC_number="4.2.99.18"
FT                   /note="KEGG: rso:RSc0140 putative exodeoxyribonuclease III
FT                   protein; TIGRFAM: exodeoxyribonuclease III;
FT                   exodeoxyribonuclease III Xth; PFAM:
FT                   Endonuclease/exonuclease/phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25207"
FT                   /db_xref="GOA:B2UD28"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR020847"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:B2UD28"
FT                   /protein_id="ACD25207.1"
FT                   /translation="MLRIISANLNGVRSAASKGFFDWMGKQDADFVCVQELKCAQDDMT
FT                   PEFLAPHGYHGVFQHAVKKGYSGAGLYTRHKPDEVIVGFDNGEFDAEGRYVEARYGKLS
FT                   VISVYVPSGSSGEERQQAKFRFMDLFMEHLKDLRHEKGREVVLCGDVNIVHKEIDIKNW
FT                   KGNQKNSGCLPEERAWLTKLFDEVGYVDVFRTLDQRPEQYTWWSNRGQAYAKNVGWRID
FT                   YQIATPGIAATARRASIFKDIKFSDHAPLTIDYDTKPHW"
FT   gene            54691..55704
FT                   /locus_tag="Rpic_0043"
FT   CDS_pept        54691..55704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0043"
FT                   /product="N-acetyl-gamma-glutamyl-phosphate reductase"
FT                   /EC_number="1.2.1.38"
FT                   /note="KEGG: rso:RSc0142 N-acetyl-gamma-glutamyl-phosphate
FT                   reductase; TIGRFAM: N-acetyl-gamma-glutamyl-phosphate
FT                   reductase; PFAM: Semialdehyde dehydrogenase NAD - binding"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25208"
FT                   /db_xref="GOA:B2UD29"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR010136"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2UD29"
FT                   /protein_id="ACD25208.1"
FT                   /translation="MAFKVFVDGQEGTTGLRLLDYLSQRDDIELLRIAEDKRKDSAERA
FT                   KFLNAADVAFLCLPDVASREAVSLVNNPNTCIIDASTAFRTSDDWVYGLPELAQGQRER
FT                   LRNTKRIAVPGCHASAFVLLMRPLVDAGIVPADYPVTAFSLTGYSGGGKQMIADYLAAN
FT                   NPKLDSPRPYALALAHKHLPEMRVQSKLSLAPIFTPVVGNFLKGLAVTIGLHPQHLARK
FT                   ASPADIARVLADYYQGEQFIRVAPADNVATLDNGFFDVQGANDTNRADLFVFGSDERMV
FT                   VTARLDNLGKGAAGAAVQCMNVHLGVDEATSLHVEAPVPAAGAEHTVREAAPGFAS"
FT   gene            complement(55777..56685)
FT                   /locus_tag="Rpic_0044"
FT   CDS_pept        complement(55777..56685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0044"
FT                   /product="band 7 protein"
FT                   /note="PFAM: band 7 protein; KEGG: rso:RSc0145 putative
FT                   transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25209"
FT                   /db_xref="GOA:B2UD30"
FT                   /db_xref="InterPro:IPR000163"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:B2UD30"
FT                   /protein_id="ACD25209.1"
FT                   /translation="MPEVTASKLPVKLLALVFGAVAALVIGRTFLLNWQIIPPGYTGIK
FT                   INRLVDRGITHENVVTGFVFYNPVQTAIIQYPTYVQRVIWTQDVNEGRALNEELTFNTK
FT                   DAVPVNVDVAVSYQLDREKVPAFYTNFRADRIETFTHGYLRDTARNVIVAMGSEYNFDD
FT                   VNGGKKEEFVARLTKELDTRLAPLGVSIKQFGIVGSLRPPRALLDAVSAKTKAIQDAIR
FT                   TENEVRSAQAEAKKKVAIAEGEAAANHALASSLDDRLLAWERLKLERAAIEKWNGVTPS
FT                   VMAGGNGGGMFFNIPAGAQSK"
FT   gene            complement(56994..57794)
FT                   /locus_tag="Rpic_0045"
FT   CDS_pept        complement(56994..57794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0045"
FT                   /product="protein of unknown function DUF218"
FT                   /note="PFAM: protein of unknown function DUF218; KEGG:
FT                   rso:RSc0146 probable lipoprotein transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25210"
FT                   /db_xref="GOA:B2UD31"
FT                   /db_xref="InterPro:IPR003848"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:B2UD31"
FT                   /protein_id="ACD25210.1"
FT                   /translation="MGAHLRVCGANLEEPVSLTILCVLVIVATVCAARGRRRAARGLAV
FT                   FSGVLVIAIGCGPVPAWLLDSLEKPFENEPHVQWGARNAIVLLGAGTFRVGDSVEPGLF
FT                   SYPRLVETTQLYQACRKSDGDCKILVSGGDARHHGSPEATVYQRELVRLGVAKDDVLIE
FT                   PQSMNTWQNAQFSRTVLAQYGADRTVLVSSAIHLRRSLLYFTHFGMAPVPVRADDLQAA
FT                   ASPLPMAYNFALTDFALHEWIGIARYHMYNALGWNPGRINPGDA"
FT   gene            complement(58107..59051)
FT                   /locus_tag="Rpic_0046"
FT   CDS_pept        complement(58107..59051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0046"
FT                   /product="peptidase M48 Ste24p"
FT                   /note="PFAM: peptidase M48 Ste24p; KEGG: rso:RSc0153
FT                   hypothetical signal peptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25211"
FT                   /db_xref="GOA:B2UD32"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:B2UD32"
FT                   /protein_id="ACD25211.1"
FT                   /translation="MPRVTRSLLTAIGLALSAWATAMDGPLPVPADGVKLEAPTTTSPN
FT                   IRLVIPAEEIDKRALAEYQGIIDNAAHEGALAPDNVPDLIRIRGIVKRLTPQAPRWNPD
FT                   ATHWQWDVNLIGSSQVNAFCMPGGKIAVFSGLLEQFKLTDDELAMALGHEIAHALREHA
FT                   RARAGQREITNLGANVISQLFGFGNRGDTDLGEGAKMHLLAFSRAEETEADLVGMDIAS
FT                   RAGYDPRAALTLWQKMGSIGGTEQKQFLSTHPSGRTRMAVLSRHLPETLTLFADARHMT
FT                   MAKLPEYRSNMQYLGAAPVDNGDEAPMRPMRRR"
FT   sig_peptide     complement(58989..59051)
FT                   /locus_tag="Rpic_0046"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.536 at
FT                   residue 21"
FT   gene            59149..60438
FT                   /locus_tag="Rpic_0047"
FT   CDS_pept        59149..60438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0047"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   rso:RSc0154 muropeptide transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25212"
FT                   /db_xref="GOA:B2UD33"
FT                   /db_xref="InterPro:IPR004752"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2UD33"
FT                   /protein_id="ACD25212.1"
FT                   /translation="MTFHDYLDIFRNRRIGAMLLLGFASGLPLALTSGTLQAWMTVEGL
FT                   DIRTIGLFSLVGQAYIFKFLWAPLMDRFTPPLMGRRRGWLVLTQAGLVASIAAMAFTPP
FT                   HAALWALAGLAVLVAFLSASQDIVFDAYSTDVLHTSERGVGAAVKVLGYRLAMLVSGGL
FT                   ALYLADRVMGWSNMYLLMAGLMALGIITTLWSPEPEVSARPPRSLQEAVVGPLRDFFSR
FT                   RGAWALLGLIVLYKLGDAFAGSLSTTFLIRGVGFSAGEVGIVNKTLGLAATIVGALYGG
FT                   TLMVRLGLVRALLLFGVLQAVSNLGYWVLAVTPQHLWTMAVAIGIENICGGMGTAAFVA
FT                   LLMALCNRSFSATQYALLSALASIGRVYVGPTSGYLVEAYGWPAFYLMTVVFAFPGLAL
FT                   LWWMRGTIGRYEAEQNERALEAKAAKAASA"
FT   sig_peptide     59149..59265
FT                   /locus_tag="Rpic_0047"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.991) with cleavage site probability 0.786 at
FT                   residue 39"
FT   gene            complement(60443..61636)
FT                   /locus_tag="Rpic_0048"
FT   CDS_pept        complement(60443..61636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0048"
FT                   /product="protein of unknown function DUF185"
FT                   /note="PFAM: protein of unknown function DUF185; KEGG:
FT                   rso:RSc0155 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25213"
FT                   /db_xref="InterPro:IPR003788"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038375"
FT                   /db_xref="UniProtKB/TrEMBL:B2UD34"
FT                   /protein_id="ACD25213.1"
FT                   /translation="MSKTVSLPLPNEAAQAQSAHLFAVIADAIAAAGGWLSFDRYMELA
FT                   LYAPGLGYYSGGAAKFGRRVEDGGDFITAPELTPFFGRTVAHQLAQVLQALPEGQRHVL
FT                   EFGAGTGKLAADILIELDALSVRPDSYGIVELSGELRQRQQERLTALGPDLGALAQWHD
FT                   TLPAPFTGVMIGNEVLDAMPVSLWARRGGMWHQRGVMLDAEHGLQWEDRLVDPSEVPAK
FT                   LAALPGTDDFVTESHEAAEGFIRSTGAALERGLLLLIDYGFPAAEYYHAHRANGTLMCH
FT                   YRQHAHDDPFWLPGLQDITAHVDFSGIAQAGQEAGLELLGYTSQARFLLSAGVGELLMT
FT                   LDPSDPMQFLPAANAVQKLLSEAEMGELFKAIALGKGIDAALPLTGFADADRSNRLG"
FT   gene            61653..62471
FT                   /locus_tag="Rpic_0049"
FT   CDS_pept        61653..62471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0049"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   rso:RSc0156 short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25214"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2UD35"
FT                   /protein_id="ACD25214.1"
FT                   /translation="MAQTLNQSTAESTAESATQQRIALVTGAGRRVGRVIALALARHGW
FT                   DVAVHCHRSRTEADAVAAEITAMGRRAAVLQADLSDEAAAGRLIADCSAALGTPTCLVN
FT                   NASLFQYDVATSFSYASLDTHMRTNVAAPLLLSRELHRALTADGAEHRGVVINLLDQKL
FT                   DNLNPDFLSYTLSKAALSTATMQLAQALAPALRVVGVAPGITMVSGDQSQGGFARAHQM
FT                   TPLGQSSTPEDIAEAVCYLATARAVTGTTLFVDGGQHLMPLARDVMFLTE"
FT   gene            62496..62894
FT                   /locus_tag="Rpic_0050"
FT   CDS_pept        62496..62894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0050"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RSc0157 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25215"
FT                   /db_xref="GOA:B2UD36"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="UniProtKB/TrEMBL:B2UD36"
FT                   /protein_id="ACD25215.1"
FT                   /translation="MLSLLSHPRLSHCRRMFLRNYEVQINIGVHEFEKKGEQRVLINIE
FT                   LYVPLEHSSPTEDKLHEVVDYDFMRETVARRMAQGHIHLQETLCDDVLAAMLKHPHVLA
FT                   ARVSTEKPDVYPDCESVGVEVFRIKEQA"
FT   gene            complement(63193..64122)
FT                   /locus_tag="Rpic_0051"
FT   CDS_pept        complement(63193..64122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0051"
FT                   /product="Arginase/agmatinase/formiminoglutamase"
FT                   /note="PFAM: Arginase/agmatinase/formiminoglutamase; KEGG:
FT                   rso:RSc0158 probable arginase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25216"
FT                   /db_xref="GOA:B2UD37"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR014033"
FT                   /db_xref="InterPro:IPR020855"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:B2UD37"
FT                   /protein_id="ACD25216.1"
FT                   /translation="MTIIDLIGAAIGCGAQDDGCKDGPRALLEAGALGRLQTRDTHAAL
FT                   VHDIELAMSAGHSRSARLAALPGVAGFSRALGDATAHSVHQGHVPVVIGGDHSCAIGTW
FT                   SGVANALRPRGPLGLIWIDAHLDSHTPQTSDSGAIHGMPLAALLGHGAAALTQIRDAAP
FT                   KLLPEHVVVIGARSYEPAERALLDLLGVRVIDAAEVARNGLRAVMADAIRQVKSDTAAF
FT                   GVTLDLDAFDPAVAPGVGTPETDGLTAQGMAQALAACARDARFAAFELVEYNPRHDKGG
FT                   ITAHLALDLLASVAGALHAQRREYATAA"
FT   gene            complement(64147..65373)
FT                   /locus_tag="Rpic_0052"
FT   CDS_pept        complement(64147..65373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0052"
FT                   /product="ornithine aminotransferase"
FT                   /note="TIGRFAM: ornithine aminotransferase; PFAM:
FT                   aminotransferase class-III; KEGG: rso:RSc0159 probable
FT                   acetylornithine aminotransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25217"
FT                   /db_xref="GOA:B2UD38"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR010164"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR034757"
FT                   /db_xref="UniProtKB/TrEMBL:B2UD38"
FT                   /protein_id="ACD25217.1"
FT                   /translation="MTTAMQHPSYALEDRYGARNYAPLPVMLERGEGVWLFDTDGRRYL
FT                   DMMSAYSAVSFGHSHPKLVAALTEQAGRLTLTSRAFHNTELGPFLADVCRITRMDRALP
FT                   MNTGAEAVETAIKAARKWARDVKGLPPEAAEIIVFDNNFHGRTTTIVGFSSHDQYRYGF
FT                   GPFAAGFRRIPFGDADALRAAIGPNTGAILMEPVQGEGGIVEPPAGYLKLARELATRHN
FT                   VLLVCDEVQTGLGRTGDVLASWHEGVDADLVVLGKALGGGMVPVSAIAGREAVIGVFHP
FT                   GDHGSTFGGNPLAAHIGRAALALLMEEQLPQRAARVGAAFINELKTLVGHGVRQVRGRG
FT                   LMIGLQLDADIDAHDFAFALAERGVLTKDTYGNVVRLTPPLVIGEAELALALDAIRQTL
FT                   AGWPRRKVA"
FT   gene            65492..66415
FT                   /locus_tag="Rpic_0053"
FT   CDS_pept        65492..66415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0053"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: rso:RSc0160 probable transcription
FT                   regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25218"
FT                   /db_xref="GOA:B2UD39"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2UD39"
FT                   /protein_id="ACD25218.1"
FT                   /translation="MSHSPLRYLHSFLTVANEGSFVRAADRLAVSQPALSYQMRQLEQW
FT                   LGVPLFERSGRKLVLTRAGTSVRAWCRDAFAGLDELRAALHSGEMERVSLKLASGSSFG
FT                   RYVLMPALLTPSPESEAPLLDDVRLELVFGSDEEVFSHVESGRADLGFVYTPRTSRLFE
FT                   HHAVYTEEFVLACSARVLREHAAPRTLADCAALPFVTYDESDAVYGLWFKALFRRMPET
FT                   TVSAHHVSDLEEVSTLVEAGMGWSVLPLHAVQEAVERGRLQVVRPIATRRCLNTVFAVR
FT                   RTSSFPSEAQDRLLVRLAQLDAAARV"
FT   gene            66502..67254
FT                   /locus_tag="Rpic_0054"
FT   CDS_pept        66502..67254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0054"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: rso:RSc0162
FT                   probable transcription regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25219"
FT                   /db_xref="GOA:B2UD40"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:B2UD40"
FT                   /protein_id="ACD25219.1"
FT                   /translation="MATFEPTSRGPGRPRRQDGVTQDGLRDRLLDIAVTLFARDGVGPT
FT                   TLAAIAREAGVTAPMVHYHFKSRDQLLDAVVEGRIRPLVDQVTRPALAIIADDAHLPDL
FT                   AQTLAGVAQRMVTVATATPWFPTLWIREIASEGGQLRERVFARIALERATLLVDRIARA
FT                   QAAGAVNAALQPPLVMVSVIGLAMLPLATRALWGRLPLADQVSDEAIGQHVAALLLHGI
FT                   GPVAAPEEAGGKQAKPKRKPKPKSKGRK"
FT   gene            67303..68277
FT                   /locus_tag="Rpic_0055"
FT   CDS_pept        67303..68277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0055"
FT                   /product="secretion protein HlyD family protein"
FT                   /note="PFAM: secretion protein HlyD family protein; KEGG:
FT                   rso:RSc0163 probable lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25220"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:B2UD41"
FT                   /protein_id="ACD25220.1"
FT                   /translation="MRQALCMGRAGCLAAALAAAIVLAGCAKHDDRTYQGYVEGEFVYV
FT                   ASPVGGRLDYLGVQRGQTVNAGAPLFVLESVDETAARQQAAAQLQGAEAQLADLNVGKR
FT                   VPEVDAVRAQLAQAVAADKLSSTQLARDEAQFRAGGIAQSQLDASRSSAQTNAQRVREL
FT                   TNQLRIAQLPARNDQIRAQSAQVEAARAAVAQAQWRLDQKAQKATQGGLVFDTLYREGE
FT                   WVGAGSPVVRMLPPANVKVRFFVPQGVVGALKPGQAARLHCDGCAADINATVTYIATEA
FT                   EYTPPVIYSNTTRDKLVFMVEARPAAADGPKLRPGQPVEVTLP"
FT   sig_peptide     67303..67377
FT                   /locus_tag="Rpic_0055"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.991) with cleavage site probability 0.253 at
FT                   residue 25"
FT   gene            68274..69254
FT                   /locus_tag="Rpic_0056"
FT   CDS_pept        68274..69254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0056"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: rso:RSc0164 probable ATP-binding ABC transporter
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25221"
FT                   /db_xref="GOA:B2UD42"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2UD42"
FT                   /protein_id="ACD25221.1"
FT                   /translation="MSTARPDSPDSRHHTGNGGYAIDVHSLNKHFGDKHVVKDLSMQVA
FT                   RGEIFGFLGPNGSGKTTSIRMMCGLLTPDSGSGSCLGYDILKQSAQIKRRVGYMTQRFS
FT                   YWDDLSIRENLDFVARLYEMPNRREAVDHALEHLGLASRAKQLAGSLSGGWKQRLALAA
FT                   CMLHKPELLLLDEPTAGVDPKARRDFWEELHRLAAEGISVLVSTHYMDEAERCHKLAYI
FT                   AYGELLAQGTADEVIAAQHLSTWSVSGGNLVELGRKLEGQPGVDQTVAFGSVLHVTGAD
FT                   AQALEGTLRKLAGESGMRAEPIDTGLEDVFIHMMRRSSDNYGTQP"
FT   gene            69251..70414
FT                   /locus_tag="Rpic_0057"
FT   CDS_pept        69251..70414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0057"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: rso:RSc0165
FT                   probable transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25222"
FT                   /db_xref="GOA:B2UD43"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="UniProtKB/TrEMBL:B2UD43"
FT                   /protein_id="ACD25222.1"
FT                   /translation="MKPEGNRFSLVRWWSVVLKEFLQLRRDRVTFAMMIGIPIMQLILF
FT                   GFAINADPRHLLTGVIAADQSEFTRSFLASMRNSDYFDLATTLTDETAGREALSKGQLQ
FT                   FVVSIPPDFTRKLVRGEKPSLLVEADATDPAATGLAVASLSQLVQGVVSKDMKGALSSL
FT                   AGGAGTNGAAPPFDVRIHKLYNPEGITQYNIIPGLMGTILTMTMVMMTGLAMTRERERG
FT                   TMENLLATPVHPLEVMTGKIVPYISIGLVQVTIILLMAFFVFHVPFVGSVWMVYVSALL
FT                   FIVASLTVGITLSSLAQNQLQATQLTFFYFLPNILLSGFMFPFVGMPKWAQVIGNLLPM
FT                   TYFNRLTRGILLKGNGWFELWPSIWPLMVFTVVVLGVALRFYRKTLD"
FT   gene            70422..72161
FT                   /locus_tag="Rpic_0058"
FT   CDS_pept        70422..72161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0058"
FT                   /product="RND efflux system, outer membrane lipoprotein,
FT                   NodT family"
FT                   /note="TIGRFAM: RND efflux system, outer membrane
FT                   lipoprotein, NodT family; PFAM: outer membrane efflux
FT                   protein; KEGG: rso:RSc0166 probable outer membrane channel
FT                   lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25223"
FT                   /db_xref="GOA:B2UD44"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:B2UD44"
FT                   /protein_id="ACD25223.1"
FT                   /translation="MWTLWIRRADGGGASLVSSPAGADLLSLSCQRKVSKERRARDGDF
FT                   PLNLCNRAETGKTRSAQTVPRLFSARLQKFKAPSRAGYGQTVGGHLLALGRALRCGERA
FT                   AGAVLIAALAVSGCAVGPDFKAPAGPAATGYSAQPVSRETASAPVVGGEAQHLVDANVP
FT                   ADWWHLFRSPALDALVDEALRASPSVAQAEARLRQAQAEAQAQFGYALPSVDGTVSAVR
FT                   QQINPEAFGFNTPKPGPFTLYSASLSVSYALDIFGGVRRALEASRAQVDTQRYELEAAR
FT                   LSLAGNVVTTAVRIAALDAQIATTQRLAAEQRKQLEITERRLSVGGVAQVDAFSQRTLV
FT                   AQTDATLPPLAQQAAQQRHRLSVLLGREPGAGLPDLPSLDALHLPDPLPVSLPSTLAQR
FT                   RPDIRAAEAMWHEASANVGVATANLFPRITLSAGLGSEATSFRNLLGAGSSIWNLGAGL
FT                   TQPLFHGGTLRAKKREAEAAYDAAGAAYKQAVLQGLQEVADTLHAVNNDAQTLQARALA
FT                   TDQAQQTLRAAQARHAAGGISTLTLLDAQRQVDQATLQQVQSQADRLLDSAALMQALGG
FT                   GWQ"
FT   sig_peptide     70422..70493
FT                   /locus_tag="Rpic_0058"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.743) with cleavage site probability 0.740 at
FT                   residue 24"
FT   gene            complement(72444..73409)
FT                   /locus_tag="Rpic_0059"
FT   CDS_pept        complement(72444..73409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0059"
FT                   /product="2-dehydropantoate 2-reductase"
FT                   /EC_number="1.1.1.169"
FT                   /note="KEGG: rso:RSc0174 2-dehydropantoate 2-reductase;
FT                   TIGRFAM: 2-dehydropantoate 2-reductase; PFAM: Ketopantoate
FT                   reductase ApbA/PanE domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25224"
FT                   /db_xref="GOA:B2UD45"
FT                   /db_xref="InterPro:IPR003710"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR013332"
FT                   /db_xref="InterPro:IPR013752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2UD45"
FT                   /protein_id="ACD25224.1"
FT                   /translation="MTTAMRILVLGAGGTGGYFGGRLAQAGADVTFLVRPARAARLRQH
FT                   GLVIRSPHGDAQLPVQTITADQATAWGRADLVLLSCKAYDLEDAITAIRPVVGERTVVL
FT                   PVLNGLAHLERLDAAFGESRVLGGLCHISATSAPDGAVLHLSNGQGPAVHSITFGERTP
FT                   HAPRERTEAIRDVFATANFDSVLAENVMQDMWEKFTFLTSLAAMTCLMRATVGEIVATD
FT                   EGAALNEAMFNACERVAAASGYPNRQAARERGLNVLTQAGSPLTASMLRDLENGARVEA
FT                   DHIVGDMLRRGRALGTDVSLLRVAFAHLQAYQQRLLRAAV"
FT   sig_peptide     complement(73329..73409)
FT                   /locus_tag="Rpic_0059"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.950) with cleavage site probability 0.759 at
FT                   residue 27"
FT   gene            73564..74511
FT                   /locus_tag="Rpic_0060"
FT   CDS_pept        73564..74511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0060"
FT                   /product="PP-loop domain protein"
FT                   /note="PFAM: PP-loop domain protein; KEGG: rso:RSc0175
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25225"
FT                   /db_xref="GOA:B2UD46"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012089"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035107"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2UD46"
FT                   /protein_id="ACD25225.1"
FT                   /translation="MTFSNNFHRLETRLQSQVGRAIGDFNMIEDGDTILVCLSGGKDSY
FT                   TMLSVLMALQKRAPVDFKLIAMNLDQKQPGFPEEVLPNYLKKLGVEYVIVEADTYSIVK
FT                   EKVPEGKTTCSLCSRLRRGVIYRTAKELGANKIALGHHRDDIVNTFFLNMFFGGKMKSM
FT                   PPKLATDNGDHIVIRPLAYCAEKDIASYARAMEFPIIPCNLCGSQENLQRKKVKEMLLE
FT                   WERQTPGRIDNIFASLRNVVPSHLADTDLFDFNGLTTGLAKIGEDALFGQTAYDQAPLV
FT                   FAGSHDDRIEFVRFERKPGDKSAEQAVPGEAAAN"
FT   gene            74849..76216
FT                   /locus_tag="Rpic_0061"
FT   CDS_pept        74849..76216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0061"
FT                   /product="UDP-N-acetylglucosamine pyrophosphorylase"
FT                   /note="TIGRFAM: UDP-N-acetylglucosamine pyrophosphorylase;
FT                   PFAM: 4-diphosphocytidyl-2C-methyl-D-erythritol synthase;
FT                   transferase hexapeptide repeat containing protein;
FT                   Nucleotidyl transferase; KEGG: rso:RSc0177 probable
FT                   UDP-N-acetylglucosamine pyrophosphorylase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25226"
FT                   /db_xref="GOA:B2UD47"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2UD47"
FT                   /protein_id="ACD25226.1"
FT                   /translation="MNIVILAAGMGKRMRSALPKVLHPLTGKPLLAHVIETARTMSPTR
FT                   LVVVVGHGGDRVREMVGAPDIAFATQDKQLGTGHAVMQAVDQLDESVPTLVLYGDVPLT
FT                   RAETLSALVGAAGNDHLGVLTVHLGDPTGYGRIVRDAAGRITRIVEQKDANETQLAIHE
FT                   VNTGILVCPTAKLKSWLATLSNDNAQGEYYLTDVIERAASEGVPITSAHPLAEWETLGV
FT                   NSKVQLAELERIHQRNLAQQLLEDGVTLIDPARIDVRGKLTCGRDVVIDVNCIFEGDVT
FT                   LADGVRIGAHTVIRDAAIEAGAEILPFCHIERAKVGADSRIGPYARLRPGTELAEDVHI
FT                   GNFVEVKNSQIAAHSKANHLAYVGDATVGSRVNIGAGTITCNYDGANKFRTVIEDDAFI
FT                   GSDTQLVAPVRVGKGATLGAGTTLTKDAPEGKLTVSRARQVTIDSWQRPVKQKKEG"
FT   gene            76334..78172
FT                   /locus_tag="Rpic_0062"
FT   CDS_pept        76334..78172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0062"
FT                   /product="glucosamine/fructose-6-phosphate
FT                   aminotransferase, isomerizing"
FT                   /note="TIGRFAM: glucosamine/fructose-6-phosphate
FT                   aminotransferase, isomerizing; PFAM: glutamine
FT                   amidotransferase class-II; sugar isomerase (SIS); KEGG:
FT                   rso:RSc0178 D-fructose-6-phosphate amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25227"
FT                   /db_xref="GOA:B2UD48"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:B2UD48"
FT                   /protein_id="ACD25227.1"
FT                   /translation="MCGIVGAVSTRNIVPVLIEGLRRLEYRGYDSCGVAIQRDGQLERA
FT                   RTVSRVADLDAQAQTSHLDGAIGIAHTRWATHGRPDTVNAHPHFSGDTIALVHNGIIEN
FT                   YEALREELKAVGYGFESQTDTEVVAHLIHQAYTYPSSKTRGDLFASVRASVKRLHGAYA
FT                   IAVFARDNPDVVVGARAGSPLVVAIGENESFLASDALAVAGTASRMAYLEEGDVVELTR
FT                   DGFTVADANDKIVAREVKEVGTYAAAVELGPFRHFMQKEIFEQPRALGDTLEGVQGFAP
FT                   DLFGPEAAQVLPKVDSVLILACGTSYYSGCTAKYWLESIAKIPTQVEVASEYRYRETVP
FT                   NPNALVVVISQSGETADTLAALRHARELGHTHTLAICNVATSAMVRETQLKFLTRAGTE
FT                   IGVASTKAFTTQLAALYMLALTFAKLRGHLNAEQEEDALRHLRHLPSALNAVLALEPQI
FT                   IAWSEEFARRENALFLGRGLHYPIALEGALKLKEISYIHAEAYPAGELKHGPLALVTEQ
FT                   MPVVTVAPNDALLEKLKSNIQEVRARGGKLYVFADADTHIQSSDGIQVIRMPEHYGQLS
FT                   PILHVVPLQLLAYHTALARGTDVDKPRNLAKSVTVE"
FT   gene            78297..78602
FT                   /locus_tag="Rpic_0063"
FT   CDS_pept        78297..78602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0063"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: scl:sce2246 putative monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25228"
FT                   /db_xref="UniProtKB/TrEMBL:B2UD49"
FT                   /protein_id="ACD25228.1"
FT                   /translation="MNYAGGSWGWSPHSTFATTSVKDTRCSAAASPISTWTPPWANRVR
FT                   RADARYAGTWALPVVGTVPAPSAVLVRLGGHVAWVGDGPTEGLQAALLRWFGSVTA"
FT   gene            78730..79002
FT                   /locus_tag="Rpic_0064"
FT   CDS_pept        78730..79002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0064"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25229"
FT                   /db_xref="GOA:B2UD50"
FT                   /db_xref="UniProtKB/TrEMBL:B2UD50"
FT                   /protein_id="ACD25229.1"
FT                   /translation="MFNVLSKIVLLAVYGLALLSYATPLPLSTDAIGWLRIGALVLLAA
FT                   HLLEVVLCFRKVALHKGPLFDSVLLTLLFGFLHWKPLADAARQAR"
FT   sig_peptide     78730..78798
FT                   /locus_tag="Rpic_0064"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.987) with cleavage site probability 0.936 at
FT                   residue 23"
FT   gene            79111..80031
FT                   /locus_tag="Rpic_0065"
FT   CDS_pept        79111..80031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0065"
FT                   /product="Patatin"
FT                   /note="PFAM: Patatin; KEGG: rso:RSc0221 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25230"
FT                   /db_xref="GOA:B2UD51"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:B2UD51"
FT                   /protein_id="ACD25230.1"
FT                   /translation="MDRVERTAFVFAGGGSLGAIEAGMLRELVASGVVPDMVVGASAGA
FT                   INAAFFACNPHAAGTAQLEALWRGVRRADVMPWSWRAMFSMLGILGGRREHLVDASGLQ
FT                   RLLTRHFAQTLLEAATLPLHVVATDMRTGAEVVLSSGAIVPAVLASAAIPGVFPPVRIG
FT                   DRLLIDGGVANNTPISAAIRLGATRVVVLPAGFACADRRAPRSAIEHALNALSLLVARQ
FT                   LVQDLERWAGQVPIAVVPPLCPLDVSPYDYARCGELIDRAAAATAAWLAADGLAGTGIP
FT                   GALRAHDHNEDHPNCSADLHGMPTA"
FT   gene            80154..81167
FT                   /locus_tag="Rpic_0066"
FT   CDS_pept        80154..81167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0066"
FT                   /product="zinc-binding alcohol dehydrogenase family
FT                   protein"
FT                   /note="TIGRFAM: zinc-binding alcohol dehydrogenase family
FT                   protein; PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   bte:BTH_II1160 alcohol dehydrogenase, zinc-containing"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25231"
FT                   /db_xref="GOA:B2UD52"
FT                   /db_xref="InterPro:IPR002364"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014182"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2UD52"
FT                   /protein_id="ACD25231.1"
FT                   /translation="MKAVAYYQSLPIDRPEALVDLTLPEPTPGPRDLLVEVRAISVNPV
FT                   DVKVRLGMPPVDGQPRVLGWDAAGVVRAVGAEVSLFKPGDAVWYAGALQRPGTNSELHV
FT                   VDERVVGAMPATLGFAQAAALPLTAITAWELLFDRLQVPESAAPSGKTVLIVGAAGGVG
FT                   SVLVQLARRLTGLTVIGTASRPETAAWVRELGAHHVINHAQPLAAELHRIGVPAVDYVA
FT                   SLNQTEHHFEQIVEALKPQGRLALIDDPAQLDVRKLKAKSLSLHWEFMYTRSMFGTDDQ
FT                   IEQHRLLNRVAALIDEGALRSTMNEHFGTINAANLKRAQAFIESNQARGKIVLEGF"
FT   gene            complement(81169..82083)
FT                   /locus_tag="Rpic_0067"
FT   CDS_pept        complement(81169..82083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0067"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bte:BTH_II1158 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25232"
FT                   /db_xref="GOA:B2UD53"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2UD53"
FT                   /protein_id="ACD25232.1"
FT                   /translation="MIRFDDLTILVLAVDNGSLSAAARVLNIAPAAASAAVKRLEAELG
FT                   VRLLARSTRSLALTQEGERYLQHARRALADLQAGQDALALGRQAIGGDVSLSIPSDLGR
FT                   NVLTGWLDDFLTEHPAVALQVRIGDRLVDMFRQRVDAAVRYGEPEDSSLVALPLAPDNR
FT                   RVLCAAPAYFARHGVPKTPDDLRRHNCLLLALSDTTHDQWTFHGASDDGQAHVVRVTGN
FT                   RIADDGELVRRWAVAGHGIAYKSRLDVLADLRAGRLQAALTDWRGEAAPLHLICTHRLA
FT                   LSPTLMRLRDFLQERIAGYLADA"
FT   gene            complement(82250..84040)
FT                   /locus_tag="Rpic_0068"
FT   CDS_pept        complement(82250..84040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0068"
FT                   /product="thiamine pyrophosphate protein TPP binding domain
FT                   protein"
FT                   /note="PFAM: thiamine pyrophosphate protein domain protein
FT                   TPP-binding; thiamine pyrophosphate protein central region;
FT                   thiamine pyrophosphate protein TPP binding domain protein;
FT                   KEGG: bch:Bcen2424_6540 pyruvate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25233"
FT                   /db_xref="GOA:B2UD54"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:B2UD54"
FT                   /protein_id="ACD25233.1"
FT                   /translation="MQATVCDFLVARLYEWGVRRIFGYPGDGINGMFGALQRAGGKIEF
FT                   VQVRHEEMAAFMASAHAKFTGELGVCMATSGPGAAHLITGLYDARLDHMPVLAITGQQA
FT                   RTAVGGHYQQEVDLAAMFRDVAGAFVHQASMPAQVRHLLDRAVRIAIGQRRVTALVLPN
FT                   DLQEMPYTEPPRAHGTVHSGVGYSAPSVIPQAADLERAADILNSGRRVAMLVGAGALGA
FT                   SAEVAAVAETLGAGVAKALLGKAVLPDDLPYVTGAIGLLGTEPSWELMNHCDTLLMVGS
FT                   GFPYAEFLPKEGQARGVQIDLDPGMLGLRYPMEVNLVGDSAQTLRALLPLLQRKTDPYW
FT                   PDRIARWNESWWKTLEDRALQPAYPVNPQHVFWELSPKLPDDVIVTSDSGTCANWYARD
FT                   LKFKPGMMGSLSGGLASMGAAVPYAIAAKFAHPERPVIALVGDGAMQMNNMAELITVSK
FT                   YWKRWKSSKWICMVLNNQDLNEVTWEQRVMEGDPKFPAAQDIPNVPYHRFAELIGLKGI
FT                   YVDNPDQLAGAWDEALNADRPVVLEVKTDPDVPPLPPHVTLQQARNFATALAYGDPDAS
FT                   GVLRGTARQVLSALFPVHKE"
FT   gene            complement(84093..84569)
FT                   /locus_tag="Rpic_0069"
FT   CDS_pept        complement(84093..84569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0069"
FT                   /product="Hemerythrin HHE cation binding domain protein"
FT                   /note="PFAM: Hemerythrin HHE cation binding domain protein;
FT                   KEGG: azo:azo0331 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25234"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="UniProtKB/TrEMBL:B2UD55"
FT                   /protein_id="ACD25234.1"
FT                   /translation="MNKAEIPVAQRAVLSMLLDDHREVKKLFKTFQQEKDEATREQIVR
FT                   EACEKLTVHTQLEEEVFYPYVRDNGGEAFKDLVDEAVVEHATAKDLIQQLNGMHAGDDL
FT                   FAAKFTVLAEYVSHHVEEEETELFPKLVRQHVDLTPLQETMAARKEALLAETAS"
FT   gene            84766..85236
FT                   /locus_tag="Rpic_0070"
FT   CDS_pept        84766..85236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0070"
FT                   /product="PRC-barrel domain protein"
FT                   /note="PFAM: PRC-barrel domain protein; KEGG:
FT                   bvi:Bcep1808_5723 PRC-barrel domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25235"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="UniProtKB/TrEMBL:B2UD56"
FT                   /protein_id="ACD25235.1"
FT                   /translation="MQTTTTGTALGTGTGTGVGTTAGVRMRIIGRADSDSAGPGPELMA
FT                   ADTLEGDRVVNLNGEDLGKITDIMLDVQRGRIAYAVMSVGGFLGIGDKLFAVPWSAMSL
FT                   DVDRKCFVLDANKDRLEAAPGFDKDSWPTMADPTWAQSVHEYYGSRPYWEEY"
FT   gene            85298..85486
FT                   /locus_tag="Rpic_0071"
FT   CDS_pept        85298..85486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0071"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B1328 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25236"
FT                   /db_xref="UniProtKB/TrEMBL:B2UD57"
FT                   /protein_id="ACD25236.1"
FT                   /translation="MEKGKKEKHPHAHKREELVEKAVEDTFPASDPPATGGITRVVDKD
FT                   KDADAHQDKRTHSGKHR"
FT   gene            complement(85554..85907)
FT                   /locus_tag="Rpic_0072"
FT   CDS_pept        complement(85554..85907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0072"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: sme:SMc01667 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25237"
FT                   /db_xref="GOA:B2UD58"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B2UD58"
FT                   /protein_id="ACD25237.1"
FT                   /translation="MAVRRIAPNLHAADPARARAFYAELLDLEAVMDHGWIVTFADTAA
FT                   TMTPQVSIASEGGNGTPVPALSVEVDDVDAVHTRAVSLGLEIVYPLVDEPWDVRRFYVR
FT                   DPFGNVVNILAHR"
FT   gene            86034..87242
FT                   /locus_tag="Rpic_0073"
FT   CDS_pept        86034..87242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0073"
FT                   /product="putative transcriptional regulator, GntR family"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   rso:RSc0229 putative amino transferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25238"
FT                   /db_xref="GOA:B2UD59"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B2UD59"
FT                   /protein_id="ACD25238.1"
FT                   /translation="MEFLQSLLAPRLQNVETSAIRELFKVLGKPGLISFAGGFPDAALF
FT                   DVEGLKAAADSALTTDAARALQYGATEGFEPLREAIVTLMKARGANVANTDILVTTGSQ
FT                   QGLDLLGKVLIGEGDTVLTEAPTFLAAIQAFKLYGAKVAGVPTDGDGLDVDALEKVLST
FT                   ARPKFLYVIPNFGNPSGALMSLERRKRLLDVAVRHNLLIVEDDPYGDLYFDAPPPPSLY
FT                   ALSQQTDGAQGRVIYLGSLSKVVAPGLRVGWMIASQPVLGNAVMVKQFADAHTSTFAQA
FT                   TAAAYLRSNRLETVLPRTRAAYAERAHAMANGLRALLPDTELTFNRPRGGMFLWCTLPG
FT                   RNAGDVAKMAIERGVAFVPGAAFYPVDPDRSTLRLSYATSSLAQVEEGVRKLAHAIGEF
FT                   KLG"
FT   gene            87263..87769
FT                   /locus_tag="Rpic_0074"
FT   CDS_pept        87263..87769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0074"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; KEGG: bxe:Bxe_A1506 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25239"
FT                   /db_xref="GOA:B2UD60"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:B2UD60"
FT                   /protein_id="ACD25239.1"
FT                   /translation="MAQAHTDAQQDPALLRRLLRAKDRMDAASHEAWPVKRLAEVSGVS
FT                   AAHFARSFKQAFGIPPHRYLLTRRIEQATTLLRDTDLPIIEIAYATGWESLGTFGRIFR
FT                   DITGQSPSALRRHAQATASLQQLDRVPACVLKAAQRPDLVTAVSEKRRQLAEGTNPSPT
FT                   NNKER"
FT   gene            87769..88185
FT                   /locus_tag="Rpic_0075"
FT   CDS_pept        87769..88185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0075"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: bxe:Bxe_A1507 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25240"
FT                   /db_xref="GOA:B2UD61"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B2UD61"
FT                   /protein_id="ACD25240.1"
FT                   /translation="MSQGINVVGLYVDDQDAALAFYVDKLGFRVHTDVRNGPYRWLTVQ
FT                   HPEQPSFQLGLFQPGPPIHDEATAQTLRAMVAKGAMPPLVLTVADCRAAYAQLRERGVE
FT                   FTQEPIDRFGSVDAGFRDPAGNGWKMIQAAGGAQ"
FT   gene            88182..88436
FT                   /locus_tag="Rpic_0076"
FT   CDS_pept        88182..88436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0076"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mes:Meso_0629 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25241"
FT                   /db_xref="GOA:B2UD62"
FT                   /db_xref="UniProtKB/TrEMBL:B2UD62"
FT                   /protein_id="ACD25241.1"
FT                   /translation="MSAPNAIRQFHRWVSMAFTLTVIANFVAMGVGKGAQPPAWITYAP
FT                   LLPLALLLFTGLYLFALPYLDRRGARRSTGDRGAPTAAI"
FT   sig_peptide     88182..88274
FT                   /locus_tag="Rpic_0076"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.710) with cleavage site probability 0.667 at
FT                   residue 31"
FT   gene            complement(88744..89940)
FT                   /locus_tag="Rpic_0077"
FT   CDS_pept        complement(88744..89940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0077"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bja:blr7376 putative integral membrane transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25242"
FT                   /db_xref="GOA:B2UD63"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2UD63"
FT                   /protein_id="ACD25242.1"
FT                   /translation="MPASLWWLCLGAFAIGTEGFMIAGLLPVLAADLGVSVPAAGQLVT
FT                   VFAVTYAVGSPVMATLLGNVDRRRVLIGALAIFAAGNLLAATAHGFGQLMAARVLLALA
FT                   AGVFLPTANAVATSLVPASRSGSALAIITGGGTVAVALGVPLGAWIAAQGDWRSTFIAC
FT                   GVLSALATAGLAFGLPRALPHSVTTLAQRLSVARRTGMLGALAVSALWAAGGFTFYTYV
FT                   APFFVQGLGFAPQHVGIVLFLVGSFAALGTGLGGHLTDRAGVARVLAVSSAGIVLAFSV
FT                   LSLSAQVLHGTVAGAVAIGAVVLWGMAGWGFGPAQATRLIRLAPDVSPITLSLHASAVY
FT                   AGIALGSSVGALALAHGGPGMLGWAAAACHVVAVVLWRMGGRHEAALADEPAATSVAH"
FT   sig_peptide     complement(89848..89940)
FT                   /locus_tag="Rpic_0077"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.797) with cleavage site probability 0.790 at
FT                   residue 31"
FT   gene            complement(90003..90710)
FT                   /locus_tag="Rpic_0078"
FT   CDS_pept        complement(90003..90710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0078"
FT                   /product="Glutathione S-transferase domain"
FT                   /note="PFAM: Glutathione S-transferase domain; KEGG:
FT                   bpe:BP1300 putative glutathione transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25243"
FT                   /db_xref="GOA:B2UD64"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:B2UD64"
FT                   /protein_id="ACD25243.1"
FT                   /translation="MIDLYYCATPNGLKMALFFAETGLPHRVIPVDISRGDQFKPEFLA
FT                   ISPNNKIPAMVDHDPAEGSDPVVLFESGAMLLYLAEKTGQLTPADLHGRMEVLKWLFWQ
FT                   VGGLGPMAGQIGHFNVYAPERVHYAIERYTKETNRLYGVLDRRLADRPYIAGNDYTIAD
FT                   IAAYPWIVPHAGHGQDLNDFPNLQRWFEAVGARPATQRAYAGVERAYSRRREDISDDER
FT                   NVLLGQTASSTAR"
FT   gene            complement(90805..91998)
FT                   /locus_tag="Rpic_0079"
FT   CDS_pept        complement(90805..91998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0079"
FT                   /product="low temperature requirement A"
FT                   /note="PFAM: low temperature requirement A; KEGG:
FT                   rso:RSc0230 probable transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25244"
FT                   /db_xref="GOA:B2UD65"
FT                   /db_xref="InterPro:IPR010640"
FT                   /db_xref="UniProtKB/TrEMBL:B2UD65"
FT                   /protein_id="ACD25244.1"
FT                   /translation="MPRSYLRPSPEGAHGHHRVTNIELFFDLVFVFAVTQLSHLLISNF
FT                   TLQGGAQALLLMLAVWWVWIFTSWVTNWLDPDKLAIRMLMLVLMTGGLLLSASLPQAFG
FT                   SRGLAFALAYVFMQFGRTVFFMWAVRGESLPMRRNFQRIATWLGISAVLWLAGGLSDGS
FT                   ARWACWIFALVIEWLGPSMGFYTPGLGRSTTNDWNVEGGHMAERCSLFIIIALGESVLV
FT                   TGSTFAGLAWTAENIAAMALSFIGSLAMWWLYFDRIAERGARTMSHSADPGRLARLAYT
FT                   YIHVVLVAGIIVGAVADEFVLAHPVGRAHEGTTLAVLGSAALYLLGNLLFKWAIFGRLR
FT                   PAHAVGLVVLGGAWLPAGELPALAVSALATGVLCGTAAWEWYARSCETAEPEAAHNP"
FT   gene            complement(92033..92680)
FT                   /locus_tag="Rpic_0080"
FT   CDS_pept        complement(92033..92680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0080"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   rso:RSc0231 putative (homoserine/homoserine lactone) efflux
FT                   transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25245"
FT                   /db_xref="GOA:B2UD66"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:B2UD66"
FT                   /protein_id="ACD25245.1"
FT                   /translation="MTLQTWLAFIGASIIILLIPGPTILLVIGDSLANRGRSAWSTVAG
FT                   VAAGDTTAMAVSLAGAGALLAASAAAFTALKLIGGSYLVYLGIKSILSARRLQDDVQAD
FT                   APEATIPVQQKSAGRRFLSAWTVTALNPKSIVFFVAFVPQFMSAEQTFLSQSVILLPTF
FT                   VILAAANASMYALAAKLLAKRLTSVAAQRRFGYTGGAVMVGAGTLTLGMQSA"
FT   gene            complement(93079..93321)
FT                   /locus_tag="Rpic_0081"
FT   CDS_pept        complement(93079..93321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0081"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25246"
FT                   /db_xref="UniProtKB/TrEMBL:B2UD67"
FT                   /protein_id="ACD25246.1"
FT                   /translation="MGRVFLCVFWTWWSIPLSFPAGTDLLFFVLPKKSKQKKGAPEMAT
FT                   PSLDLCRGEGKEPNSLRSDKAPSFFLPATKIQGAI"
FT   gene            complement(93314..94294)
FT                   /locus_tag="Rpic_0082"
FT   CDS_pept        complement(93314..94294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0082"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: rso:RSc0233 putative integral membrane
FT                   transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25247"
FT                   /db_xref="GOA:B2UD68"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B2UD68"
FT                   /protein_id="ACD25247.1"
FT                   /translation="MAVGDTSTATQLHHGQHDARRDHLTGIGYGVAAGALWGVIFVAPK
FT                   MLPQFSPLALSAARYVLYGVLSLALALPVWRTLWRKTTGREWAALLLLSLPGNILYYLC
FT                   VAGGVQRAGVAPVSLIVGLLPVTVTLAGAAERGSLPLRQLALPLLMAVAGVVCIYLDAP
FT                   DVHSSAGGRTYLFGLLMAAGALACWTVYAVCNARYLRARPQFTSREWSLLTGVATGVLS
FT                   LALAVPAFLLPGMATASAQPPSAWGMFWLVNIGVALGASVLGNSLWNAASRKLPLTLSG
FT                   QLIVFETVFALLYGFIYEARWPHGLEVAAAVLLVSGVGLAARRHG"
FT   gene            complement(94401..95123)
FT                   /locus_tag="Rpic_0083"
FT   CDS_pept        complement(94401..95123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0083"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; KEGG: rso:RSc0234 probable transcription
FT                   regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25248"
FT                   /db_xref="GOA:B2UD69"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:B2UD69"
FT                   /protein_id="ACD25248.1"
FT                   /translation="MLDFRTYGLAAPPHSHDFMQVVMPARGILEMDVDGRGGRVDTHHA
FT                   ALIPAGATHAFEATGANRFIVFDIPGQTVDAPSLGGLADRVFFPLTPGLRALTTWLQDA
FT                   PIVDAVLANAWSSLALATLAAHPVNQAAQIRARPDARAERAWHAIEHRYAEPLTVDALA
FT                   AEAGVSARRLATLFRATYGTTLHAHLAQVRLRHALTLLETTALPIAEIAARTGYYDQSA
FT                   LTRHLKAAHGVTPAAVRR"
FT   gene            complement(95357..98572)
FT                   /locus_tag="Rpic_0084"
FT   CDS_pept        complement(95357..98572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0084"
FT                   /product="transcriptional activator domain"
FT                   /note="PFAM: transcriptional activator domain; KEGG:
FT                   gur:Gura_0766 tetratricopeptide TPR_4"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25249"
FT                   /db_xref="GOA:B2UD70"
FT                   /db_xref="InterPro:IPR005158"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B2UD70"
FT                   /protein_id="ACD25249.1"
FT                   /translation="MNSAPTLSKINRPQSGGIVLRPRVLNRIGRGFAASPIVWVASPAG
FT                   SGKTKLAISYLEASGLPAIWYEVDAGDMDPASFFRTFGQACAAHLGADSATQPPLFSPD
FT                   HLFDLAAFARRYFRALFSGLPEATLLVLENVHAAEAEPSFKGILQAALAEASEHVRILV
FT                   LSRSAPPPELARLQANQQLALVDWQHLRLTEEETGAILAGHPAALATLEQRPDAERELA
FT                   GGLHARSGGWVAAVVLLLDQIGRVGSYDVDRLDSREVLFPYFAQEMIVAASPELRRFLL
FT                   CTAILPNFDLAEARQLTGSTDVDHFVTSAHCQQYFIDQFGSGAGASYQYHALFREFLLS
FT                   RLPDAFSADERQQLTANAAALLEARGELAGAGELLADAGLMPQLAALALRHAPMVLQQG
FT                   RYRTLSDLLGQLPTAVLNADPWLLFWAGTSRMALDPGNARLYFEPALTLFQAHDNAAGC
FT                   YLAWSSIVDCIYFESRDYRPLTHWLEMLDTLRARYPAFPDAQIEARVLASVLAALAFHA
FT                   MGHADSRHWTDRALVFIGTVDVQTQASLGFMLTVYHLWTGDLERARVVLQLMRAAVASP
FT                   QTSDLLRTTILTTEAMGYWFFAENDACIAVVEQTEALMHASDIYLWKHALLNHGLAAAI
FT                   SAGNVMEAESFRAKLAQDIHMGRPLDQAMHHFERGWLALQQDRLREAELMVEFGRNGFR
FT                   SLNFRFGVAFTLATSAYIAHLLGQAEQADTFVEEAEALSRDVDSKVALCHTLMVRAVMA
FT                   LDRGAPTSPWLPEALALGRRFGITNFPGWHDPMVARLAAHALATGIETNYVTALVRKRR
FT                   LQAPTARVKHWPWEIELRVLGAFSVSCSGEPLAQSGKGNRRTLDTLKAIVAYGGREVAI
FT                   DHLSAALWPDADGDSAKGAFDVAIHRLRKLLGNADAIVVSNGKVGLNMHLCGLDLWTFQ
FT                   AHRQIALDLAKTPDPDSDTLLTAALDMLAAYTGDFLADEAEQPWLLPQRERLRAELVRT
FT                   VLTVGEKLEALNAPTSATTVYQRALRLHPTAEGICRHLLECLRAEGRSAEASAFFAEWQ
FT                   HTLKVVYGAAPSPSLVAMLDWIR"
FT   gene            98936..100576
FT                   /locus_tag="Rpic_0085"
FT   CDS_pept        98936..100576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0085"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: reu:Reut_A0370 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25250"
FT                   /db_xref="UniProtKB/TrEMBL:B2UD71"
FT                   /protein_id="ACD25250.1"
FT                   /translation="MKLTPIAISAAVLVLTACGGGGDAPPQLTTQQSQTISGVAATGAA
FT                   LPGATVNVTCSAGSGTATTRADGSYSAPITGASLPCVVTATSSDGKTVLHSLVAGSGSI
FT                   GSTATANITPLTELLLAQLAGQDPAKYVAGFSSTTTVNASDVTAAQAALIKVLQSAGFD
FT                   ASGIGDFLGGTLSAGSGQGYDGVLDTLQSKLAGAGVTLTDLSTAVASTSGSSSGSAGST
FT                   VGTVLAPANSACPALKSGDHRLIKFSDGSAQVVTIDAAKLTVAVGGSSYQLTQGATACD
FT                   YTLNDTGSTRVLVAKSGMAVWTNGSGGTGVLSLSLPKQIVDPTAINGNYIYALLSGAGQ
FT                   GTFGTNNYAKGVVTAATNCAVNAPCAPDLNSPYGHMVATSDGGVDWVDDGASAGTVNAH
FT                   AYGFRNAQGNTVFVVALTGGGVGIFAPQTTLSMPAVGTTNAFWQSNVKSTGLSAVTEDS
FT                   NTITAVNGSTVTRTFADTHTDQIIYNDPFAGLRHRPGTKVCTNTSGVAVTCNETWQLPL
FT                   SGLTLALSGSPSVTPSTYQVNFSVNKPGN"
FT   sig_peptide     98936..98995
FT                   /locus_tag="Rpic_0085"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.966) with cleavage site probability 0.451 at
FT                   residue 20"
FT   gene            complement(100821..101177)
FT                   /locus_tag="Rpic_0086"
FT   CDS_pept        complement(100821..101177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0086"
FT                   /product="protein of unknown function DUF427"
FT                   /note="PFAM: protein of unknown function DUF427; KEGG:
FT                   rso:RSc0235 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25251"
FT                   /db_xref="InterPro:IPR007361"
FT                   /db_xref="InterPro:IPR038694"
FT                   /db_xref="UniProtKB/TrEMBL:B2UD72"
FT                   /protein_id="ACD25251.1"
FT                   /translation="MPEIDPNHPITVESNPRRVTVTLNGFTIASTHLARTLREASYPPV
FT                   QYIPRDDVQMNLLERTQHHTHCPYKGDASYYTIVAGDVRADNAVWTYEQPKPVAREVAG
FT                   YLAFYPNKVTIQEE"
FT   gene            complement(101262..102464)
FT                   /locus_tag="Rpic_0087"
FT   CDS_pept        complement(101262..102464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0087"
FT                   /product="Rh family protein/ammonium transporter"
FT                   /note="PFAM: Rh family protein/ammonium transporter; KEGG:
FT                   rme:Rmet_4750 Rh-like protein/ammonium transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25252"
FT                   /db_xref="GOA:B2UD73"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:B2UD73"
FT                   /protein_id="ACD25252.1"
FT                   /translation="MNSIKTGGDALFILLGAIMVLAMHAGFAFLELGTVRKKNQVNALV
FT                   KILVDFAVSTIAYFFIGYSVAYGVNFFTGADVLAQQNGYELVKFFFLLTFAAAIPAIIS
FT                   GGIAERSRFEPQLAATFVLVGFVYPFFEGIAWNERFGIQHWLQSVTGAEFHDFAGSVVV
FT                   HAVGGWIALPAVLLLGARHGRYKDDGRIAAHPPSNIPFLAAGAWVLAVGWFGFNVMSAQ
FT                   TLDKMSGLVAINSLMAMVGGTLTAWWMGKNDPGFSYNGPLAGLVAVCAGSDVMHPLGAL
FT                   AVGGIAGVLFVWMFTRVQNVWRIDDVLGVWPLHGLCGAWGGIAAGIFGLKALGGLGGVS
FT                   FWAQVAGTAGGIVIALVGGTVVYGTLRKLVGLRLDREAEFMGADLAIHRVSSTPESETH
FT                   W"
FT   sig_peptide     complement(102378..102464)
FT                   /locus_tag="Rpic_0087"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.959) with cleavage site probability 0.545 at
FT                   residue 29"
FT   gene            complement(102724..103749)
FT                   /locus_tag="Rpic_0088"
FT   CDS_pept        complement(102724..103749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0088"
FT                   /product="conserved hypothetical/unknown signal peptide
FT                   protein"
FT                   /note="KEGG: rso:RSc0236 hypothetical/unknown signal
FT                   peptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25253"
FT                   /db_xref="UniProtKB/TrEMBL:B2UD74"
FT                   /protein_id="ACD25253.1"
FT                   /translation="MPSRATMRWCLTALLAWSGHALAWDYTPGAIPGLISVLGFLTVQS
FT                   QALDRAIQRFPGQREELIRARTQFDNTFPQALARTRRLIAGIPLSDDERQLLIERALDL
FT                   HQPSVGVATQTAETAHSLAERVVARAQGSQDRATLQTLLAVVYDDRPADELGSRFTQAV
FT                   TLSDWPNARGASLALRLPFSWERVPPTAPRKPDPARVAIGAWANQGGSGLSRIELIVRP
FT                   TEGDPETVPDSREPRWMRDAVKQAVAAPCRLLGWGTQSFGGRIGVWASYIGESPGPNIP
FT                   RAPGNTLVGRVFMVPTDGALLMLHMQSLATSPEQASAVRLRYEPLWDAVAASFSVSGAK
FT                   P"
FT   sig_peptide     complement(103678..103749)
FT                   /locus_tag="Rpic_0088"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 24"
FT   gene            104095..107382
FT                   /locus_tag="Rpic_0089"
FT   CDS_pept        104095..107382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0089"
FT                   /product="methylmalonyl-CoA mutase, large subunit"
FT                   /EC_number="5.4.99.2"
FT                   /note="KEGG: rso:RSc0237 putative methylmalonyl-CoA mutase
FT                   protein; TIGRFAM: methylmalonyl-CoA mutase, large subunit;
FT                   PFAM: ArgK protein; methylmalonyl-CoA mutase; cobalamin
FT                   B12-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25254"
FT                   /db_xref="GOA:B2UD75"
FT                   /db_xref="InterPro:IPR006098"
FT                   /db_xref="InterPro:IPR006099"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006159"
FT                   /db_xref="InterPro:IPR016176"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033669"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="UniProtKB/TrEMBL:B2UD75"
FT                   /protein_id="ACD25254.1"
FT                   /translation="MTDLSAARAADPTPASEPGPARNKVRFVTAASLFDGHDASINIMR
FT                   RILQSMGCEVIHLGHNRSVDEVVNAALQEDVQGIAVSSYQGGHVEYFKYMIDALRARGG
FT                   EHIQVFGGGGGVIVPAEIRELQDYGVARIYSPEDGQRMGLAGMIADMVQRCDIDLSIHA
FT                   PATLDPVANGDRRALAQLITALESGRIDPPLREAVHAAAAATPTPVLGITGTGGAGKSS
FT                   LTDELIRRFRLDQQDTLRIAVISIDPSRRKSGGALLGDRIRMNAINHPNIFVRSLATRE
FT                   ASREISDALPDVIAACRAAGFDFIIVETSGIGQGDAAIVPHVDLSLYVMTPEFGAASQL
FT                   EKIDMLDFADLVAINKFDRKGAQDAWRDVAKQVQRNREQWHARPEDMPVFGTQASHFND
FT                   DGVTALYHALADRLNERGMALAERTLPRPAGKCSTSHDAIVPPARVRYLAELADTVRGY
FT                   HRRVDAQSRLARERQQLRASHRMLEQAGATVQTLSALDKQAAERDAQLGAAERKLLAMW
FT                   PDLRRAYSGDEYVVKIRDKEIRTQLTHTTLSGTTIRKVVLPPYEDDGEVLRWLMRENVP
FT                   GSFPYTAGVFAFKRENEDPTRMFAGEGDAFRTNRRFKLVSEGMEAKRLSTAFDSVTLYG
FT                   EDPALRPDIYGKVGNSGVSIATLDDMEVLYDGFDLTSPATSVSMTINGPAPTILAMFMN
FT                   TAIDQNLARFRADNQREPTQDEEAKIRAWVLQNVRGTVQADILKEDQGQNTCIFSTEFS
FT                   LKVMGDIQEYFVHHQVRNFYSVSISGYHIAEAGANPISQLAFTLANGFTYVEAYLARGM
FT                   HIDDFAPNLSFFFSNGMDPEYSVLGRVARRIWAVTLRDKYGANERSQKLKYHVQTSGRS
FT                   LHAQEIAFNDIRTTLQALIAIYDNCNSLHTNAYDEAITTPTAESVRRALAIQLIINREW
FT                   GLAKCENPNQGSFVIDELTDLVEEAVLREFERIAERGGVLGAMETGYQRGRIQEESMLY
FT                   EQRKHDGSLPIIGVNTFRNPDADSVVPPHIELARSSEEEKQSQLARLQDFHARHAGEAP
FT                   AMLQRLQRAVIDDQNVFAVLMDAVRVCSLGQITHALFEVGGQYRRNM"
FT   gene            107696..108550
FT                   /locus_tag="Rpic_0090"
FT   CDS_pept        107696..108550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0090"
FT                   /product="3-hydroxybutyryl-CoA dehydrogenase"
FT                   /EC_number="1.1.1.157"
FT                   /note="PFAM: 3-hydroxyacyl-CoA dehydrogenase domain
FT                   protein; 3-hydroxyacyl-CoA dehydrogenase NAD-binding; KEGG:
FT                   rso:RSc0244 3-hydroxybutyryl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25255"
FT                   /db_xref="GOA:B2UD76"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR006180"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR022694"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2UD76"
FT                   /protein_id="ACD25255.1"
FT                   /translation="MAIQVVGIVGAGTMGNGIAQACAVVGLDVVMVDISDAAVQKGIAT
FT                   VAGSLDRLIKKEKLTEADKAAALARIQGSTSYDDLKRADLVIEAATENFDLKVKILKQL
FT                   EAAAAPHAIVASNTSSISITKLAAVLQDASRFIGMHFFNPVPMMALVEVIRGLQTSDAT
FT                   HAAVEALAKQLGKTPITVKNSPGFVVNRILCPMINEAFCVLGEGLASPEEIDEGMKLGC
FT                   NHPIGPLALADMIGLDTMLAVMEVLYTEFGDPKYRPAMLMREMVAAGYLGRKTGRGVYD
FT                   YRK"
FT   sig_peptide     107696..107761
FT                   /locus_tag="Rpic_0090"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.774) with cleavage site probability 0.737 at
FT                   residue 22"
FT   gene            108707..109564
FT                   /locus_tag="Rpic_0091"
FT   CDS_pept        108707..109564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0091"
FT                   /product="phenazine biosynthesis protein PhzF family"
FT                   /note="TIGRFAM: phenazine biosynthesis protein PhzF family;
FT                   PFAM: Phenazine biosynthesis PhzC/PhzF protein; KEGG:
FT                   rso:RSc0253 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25256"
FT                   /db_xref="GOA:B2UD77"
FT                   /db_xref="InterPro:IPR003719"
FT                   /db_xref="UniProtKB/TrEMBL:B2UD77"
FT                   /protein_id="ACD25256.1"
FT                   /translation="MSRYAFRLLNVFAESTFGGNQLAVFEDGHGLDDATMQAIGRQFNL
FT                   SEITFIFPDEADGATARFRIFTPDYEMPFAGHPSLGTAQVVRELYGPGNELTLRCQSGI
FT                   VSLTAQDEGWSLVPPRSGALNTREADPAVAKMLGLDADALAGPPLWVDAGIEQLMVPVK
FT                   TRADVERARPDPSAFDVWPRSRNDGRNAYVFTMPAPGSNDPVVSRFFFEYGTGLWEDPG
FT                   TGSACANLGGWLRATGHALPATYRIEQGAAVGRPCHLTLRVDADGTIHVGGRVIEIGRG
FT                   TLTI"
FT   gene            complement(109582..110130)
FT                   /locus_tag="Rpic_0092"
FT   CDS_pept        complement(109582..110130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0092"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   bpl:BURPS1106A_3175 acetyltransferase, GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25257"
FT                   /db_xref="GOA:B2UD78"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B2UD78"
FT                   /protein_id="ACD25257.1"
FT                   /translation="MIDTLTIRRVGANEASACIDALADVLIDCVEGGASVSFMAPLSQD
FT                   KARAFWRNVAEGVARGERALLIAEDEAGAIHGTVQLVLAQPENQPHRADVAKMLVHRRA
FT                   RRQGVAQRLMAAIEDEARAEGKTVLVLDTVTGGDAERLYARAGWQRVGVVPNYALMPDG
FT                   AFCGTTFFCKQLCAPDSAA"
FT   gene            complement(110130..110258)
FT                   /pseudo
FT                   /locus_tag="Rpic_0093"
FT   gene            110307..110390
FT                   /pseudo
FT                   /locus_tag="Rpic_0094"
FT   gene            complement(110413..111888)
FT                   /locus_tag="Rpic_0095"
FT   CDS_pept        complement(110413..111888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0095"
FT                   /product="protein of unknown function DUF1254"
FT                   /note="PFAM: protein of unknown function DUF1214; protein
FT                   of unknown function DUF1254; KEGG: rso:RSc0254 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25258"
FT                   /db_xref="InterPro:IPR010621"
FT                   /db_xref="InterPro:IPR010679"
FT                   /db_xref="InterPro:IPR023289"
FT                   /db_xref="InterPro:IPR037049"
FT                   /db_xref="InterPro:IPR037050"
FT                   /db_xref="UniProtKB/TrEMBL:B2UD79"
FT                   /protein_id="ACD25258.1"
FT                   /translation="MTHCPAPVRLLTKRAAVALSVVASALTLGLAGCSTQNAAATAPIE
FT                   QRLPKPNEALVRSAYVYAFPLMMTDALLQTTSALAPAGTFMHQRTLEDEALPTGVRARV
FT                   DVLASSAFVDLRNGPVVLSLPDAGRRHLWVALHDGWNDVFESLGNRTTGARAAHYAITP
FT                   PGWEGTLPTGVKQIAAPTSLVWVVARTQVAGPRDLTAARRVQDRYRITPLDAFGKTSLR
FT                   DAEAETKVNTDKATDLDVSMDAARRRVTALDANSYFTRFAELLKDNPPHAADSTMLQSL
FT                   RDLGIVPGAPFDAKAVTAANLKAMDGGVAAARETLSLAVKQPPITQNGWFIPRMVGAYG
FT                   LDYAQRAIVAWNGGGTDLPQDMLIATAKTDTNGIALDSTHRYVLHFERNQLPPENAGWA
FT                   IAALSPGGQPRSTAERPGLRNMLSEADHPRLNRDGSLDILIQRAPPKGMRNNWLPPPTG
FT                   PFLLRLQLTWPKEAALDASWLPPAVQRRDAATP"
FT   sig_peptide     complement(111772..111888)
FT                   /locus_tag="Rpic_0095"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.435 at
FT                   residue 39"
FT   gene            complement(112098..113081)
FT                   /locus_tag="Rpic_0096"
FT   CDS_pept        complement(112098..113081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0096"
FT                   /product="2-nitropropane dioxygenase NPD"
FT                   /note="PFAM: 2-nitropropane dioxygenase NPD; KEGG:
FT                   rso:RSc0255 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25259"
FT                   /db_xref="GOA:B2UD80"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B2UD80"
FT                   /protein_id="ACD25259.1"
FT                   /translation="MPAAKHLPPVLQHLTLPVIGSPMFIVSYPELVLAQCKAGIVGAFP
FT                   ALNARPAEVLDAWLTQMNEDLAAYRAAHPDAVVGPIAVNQIVHHSNARLEQDVATCVKH
FT                   KVPIFITSLRAPVKEILDAVHSYGGIVLHDVINLRHAEKALEAGVDGLILVAAGAGGHA
FT                   GTLSPFALVGEVRRIFDGPIALSGAIATGDAILAAQAMGADFAYIGTRFIASQEAHAAE
FT                   SYKQAILRAAASDIVYTNLFTGVHGNYIRESIELAGLDPAALPEADKSKMNFGDGSSRA
FT                   KAWKDIWGAGQGVGQIADLPPAAEIVARMKAEYDAAKLRLALHLRL"
FT   gene            complement(113183..113731)
FT                   /locus_tag="Rpic_0097"
FT   CDS_pept        complement(113183..113731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0097"
FT                   /product="intracellular protease, PfpI family"
FT                   /note="TIGRFAM: intracellular protease, PfpI family; PFAM:
FT                   ThiJ/PfpI domain protein; KEGG: bxe:Bxe_B1164 peptidase
FT                   C56, PfpI"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25260"
FT                   /db_xref="GOA:B2UD81"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR006286"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B2UD81"
FT                   /protein_id="ACD25260.1"
FT                   /translation="MTPLHDMRIAILVDDLFEQAELASPKQALEGAGATVSIIAPKGPS
FT                   VTGLHHATKGDTFKVNLTLDQAKADDFDGLVLPGGVFNADALRVVPAAQAFVKAFERAQ
FT                   KPIAVICHGPWLMVSAGLVRGRTLTSWPTLQDDIRNAGGMWVDREVVTDRNWVSSRKPD
FT                   DLPAFNRTFIELLAQHAHV"
FT   gene            113869..114795
FT                   /locus_tag="Rpic_0098"
FT   CDS_pept        113869..114795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0098"
FT                   /product="alpha/beta hydrolase fold"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: rso:RSc0256
FT                   hypothetical haloacetate dehalogenase H-1 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25261"
FT                   /db_xref="GOA:B2UD82"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B2UD82"
FT                   /protein_id="ACD25261.1"
FT                   /translation="MTTPLSIDAATAAADAALFPGFRPFRQMANGVEIAGVIGGSGPPL
FT                   LLLHGHPQSHMIWHKVARELAHDYTVVATDLRGYGASSKPAGSARHAEYSKRTMAQDQV
FT                   EVMRALGFGRFRLCAHDRGARVAHRLCVDHPLHVERAMLLDIAPTLAMYEHTDMAFASA
FT                   YWHWFFLIQPSPFPETLINATPDFYIGKLMGLRHAGLEPFAPEAMATYAAAMREPACVH
FT                   AMCEDYRAAATIDLEHDRADRDAGKRVSVPLRVLWGEHGVIQRCFKPLELWKAVADNVS
FT                   GGTVPCGHYVPEEAPEALLEEMRAYFA"
FT   gene            complement(114805..115488)
FT                   /locus_tag="Rpic_0099"
FT   CDS_pept        complement(114805..115488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0099"
FT                   /product="2OG-Fe(II) oxygenase"
FT                   /note="PFAM: 2OG-Fe(II) oxygenase; SMART: Prolyl
FT                   4-hydroxylase alpha subunit; KEGG: bpm:BURPS1710b_A0200
FT                   putative hydroxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25262"
FT                   /db_xref="GOA:B2UD83"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR006620"
FT                   /db_xref="InterPro:IPR023550"
FT                   /db_xref="InterPro:IPR041097"
FT                   /db_xref="UniProtKB/TrEMBL:B2UD83"
FT                   /protein_id="ACD25262.1"
FT                   /translation="MLLKISAVLTKEQVAQCRATIDAAEWVDGKVTAGAQSGQVKHNMQ
FT                   LPEGSLAARQVGTLIQDALSANTLFFSAALPLKVFPPLFNRYAGGQTFGNHVDNAVRHL
FT                   RGTAFRIRSDLSCTLFLTEPEDYDGGELVIDDTFGEHRVKLAAGDMVLYPSSSLHRVTP
FT                   VVRGARVCSFFWLQSMVRSDAHRTLLFQMDTELQRLMGLLGQDDPSVIALTGTYHNLLR
FT                   EWADA"
FT   gene            complement(115479..116249)
FT                   /locus_tag="Rpic_0100"
FT   CDS_pept        complement(115479..116249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0100"
FT                   /product="Sel1 domain protein repeat-containing protein"
FT                   /note="PFAM: Sel1 domain protein repeat-containing protein;
FT                   KEGG: bxe:Bxe_B0793 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25263"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:B2UD84"
FT                   /protein_id="ACD25263.1"
FT                   /translation="MPADAATAAAAGATAADPAVVDAIHAVLTGPADRAARWLAAAARR
FT                   GHTEAQAIFGQWLLDGRGVERNPAEALFWFKTAALSGHAMAANMLGRCYEHGWGAPACD
FT                   KTATHWYARAADAGLDWGQYNYATRLQLGRGIPADRARAFALFQAAAAQGHAKSINVLG
FT                   GFYEDGWEVEADTAMALRCYLRAAAGGDFRGQFNAARLLALANHADDALGWMQAVPRTA
FT                   TPTFLAKAHDFLAGHPDVRLRALADVLKTPSLCC"
FT   sig_peptide     complement(116199..116249)
FT                   /locus_tag="Rpic_0100"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.621) with cleavage site probability 0.402 at
FT                   residue 17"
FT   gene            complement(116249..118528)
FT                   /locus_tag="Rpic_0101"
FT   CDS_pept        complement(116249..118528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0101"
FT                   /product="TonB-dependent siderophore receptor"
FT                   /note="TIGRFAM: TonB-dependent siderophore receptor; PFAM:
FT                   TonB-dependent receptor; TonB-dependent receptor plug;
FT                   KEGG: bxe:Bxe_B0794 TonB-dependent siderophore receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25264"
FT                   /db_xref="GOA:B2UD85"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR030148"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:B2UD85"
FT                   /protein_id="ACD25264.1"
FT                   /translation="MSAAQIERKRTEHSVVGYLTGAMSFAVVSAPALADTKKDAVSATL
FT                   PEQTVTGTNGFKADAASGGKFTAPLLDTPKSVTVIPAEVLQGTGSVTLTEALRTVPGIA
FT                   FGAGEGGNPVGDRPFIRGYDAQASTFLDGLRDIGAQSREMFNVESVEVIKGPSGAYEGR
FT                   GAAGGAVNILTKTPKLEHFTEGTLSVGNAAYKRATADGNYQIGEHAAFRLNAMAHDAAV
FT                   AGRDVTSFSRWGIAPSIAVGLGTPTRATLSYYHLQSNDTPDTGIPYNNGTFNRRTDGRP
FT                   QLFGPGDGAPVNVDRNVYYGLSRDFRRDRVDMGTFTLEHDVSSALKLRNTMRIARTSQD
FT                   TIWTQPDDSQGNIYYGMVWRRTNSRSSVANTVANQTEATGKFDTGGLKHSYAAGLEFSR
FT                   ERSSNDTYAVATGSNRCPNGIGAAGGYNCADLFNPNPNDPWAGGIRLNNNPAETTVRTQ
FT                   SAYVFDTVELSPRWQVNGGLRFDRYSASATTSANAQGVRSSFSRDDNLLNYQLGLVFKP
FT                   AQNGSIYLAYGTSSTPSGSVAGQGADTSALTPDRSSNRGDVLAPEKNRAYELGTKWNVL
FT                   DSKLALTAAIFRIETTNARIVQQDGTAAMAGNKRVDGFELGWSGALTNRWQVFGGYTYL
FT                   KSELRNNGGAGAAFGGTNGTAFPNTPKNSFSLWTTYQPMPKLTLGGGAYYVSKVWGSAN
FT                   PANPKWVPAYWRFDAMAAYRIDKHTTLQLNVQNVFDKVYFNQAYASHYASLAPGRTAIL
FT                   TLGIRY"
FT   sig_peptide     complement(118424..118528)
FT                   /locus_tag="Rpic_0101"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.982) with cleavage site probability 0.967 at
FT                   residue 35"
FT   gene            118803..119582
FT                   /locus_tag="Rpic_0102"
FT   CDS_pept        118803..119582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0102"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   reh:H16_B0987 enoyl-CoA hydratase/isomerase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25265"
FT                   /db_xref="GOA:B2UD86"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:B2UD86"
FT                   /protein_id="ACD25265.1"
FT                   /translation="MSTDPELLIERRGQALWLTIQREDRRNAINAAVLEALTAALVDAG
FT                   RDAAVRAVVLTGTGTRAFCAGADLQTGQSFRFDYSQPYQALADLFRQARRCTVPLIARV
FT                   NGACMAGGMGLLAMCDLAVASHSATFGLPEVKVGVFPAQVLAVLQHQLPRRVLNELCLT
FT                   GEPMNADRALAAGLVNEVTEPEALDGAVDALLARLVDKSPSAIRRGLYTLKHVESLSFE
FT                   QAMAFTESQIGLFALTEDAQEGQAAFREKRAPNWRGR"
FT   gene            119584..121356
FT                   /locus_tag="Rpic_0103"
FT   CDS_pept        119584..121356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0103"
FT                   /product="protein of unknown function DUF1446"
FT                   /note="PFAM: protein of unknown function DUF1446; KEGG:
FT                   reh:H16_B0988 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25266"
FT                   /db_xref="InterPro:IPR010839"
FT                   /db_xref="UniProtKB/TrEMBL:B2UD87"
FT                   /protein_id="ACD25266.1"
FT                   /translation="MRNDTVSIGGASGFWGDSVTGPLQLVASGRLDFLVFDYLAELTMS
FT                   LLASARMKNAELGYATDFVSVAMRAVLKDALAQNIRIIANAGGVNPRGCAAALQALAAE
FT                   LGVSVRIAVVEGDDVMALLPALRGEGVRELQSARPLPDKVVSANAYLGALPIKAALDAG
FT                   AQVVITGRCVDSAVTLGALMHAFEWRADDYDRLAAGSLAGHILECGCQGAGGLHTDWEA
FT                   VPDWAHSGYPIAECRADGSFIVTKPDGTGGLVTTATVGEQLLYEIGDPARYVLPDVVCD
FT                   FTHVTMTLAGEHRVEVRGARGRAPTPDYKVSATYADGYRATGQLTIVGIDADRKARHTA
FT                   EAILERTRGLFRQLGLPDYSATHIETLGSAYLFGPHQPNVPRFESVMWLAVTHPNKQAL
FT                   DLFAREIAPAGTSWAPGTTGAGGRPSVVPAIKQYAFLIDKARVQARVTLLGEEGFDIAV
FT                   PTGGAALEPSAAAQGSLALPPGPTREVSLIELAYARSGDKGDTSNIGVIARRPEDLPLL
FT                   RAQLTEDAVAAYLAHVVKGRVTRYDLPGIHALNFVCEQALGGGGMASLRNDPLGKGMAQ
FT                   VLLTMPVRVPVNHP"
FT   gene            121371..122525
FT                   /locus_tag="Rpic_0104"
FT   CDS_pept        121371..122525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0104"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase type 2 domain; KEGG: reu:Reut_B5206
FT                   acyl-CoA dehydrogenase, C-terminal:acyl-CoA dehydrogenase,
FT                   central region:acyl-CoA dehydrogenase, N-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25267"
FT                   /db_xref="GOA:B2UD88"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B2UD88"
FT                   /protein_id="ACD25267.1"
FT                   /translation="MLSGLLPSARFDADHDTFRETVRRFVDKAVLPHIDAWEEAETFPR
FT                   ALYREAADLGLLGIGFPEEYGGTPGDLFLELAMIEELTRAASGGLLASLFSHTIGAPPI
FT                   VAGGSAELKARVLPAILSGEKISALAITEPSGGSDVASLTTRAVRDGDHYVVSGSKIFI
FT                   TSGMRADYITVAVRTGEAGAGGISVLLVEGDTPGLSRTPLKKMGWWCSDTAQLHFDNCR
FT                   VPVGNLLGAENRGFELVMRNFNHERLALAMQAYGLARTCLIEAVEWATQRETFGKRLVQ
FT                   HQVARQKLVAMATRIEATRALLEDLMRRMQAGDSPVAQLCMLKNFATQSLQFCADTAVQ
FT                   LLGGMGFMRGTKSERIYREVKVYMIGGGAEEVLSDLAARQLGWT"
FT   gene            122547..123434
FT                   /locus_tag="Rpic_0105"
FT   CDS_pept        122547..123434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0105"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: rfr:Rfer_3507 short-chain
FT                   dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25268"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2UD89"
FT                   /protein_id="ACD25268.1"
FT                   /translation="MYRSVFRPGLFQGQVAVVTGGGSGIGRCTAHELASLGAAVALVGR
FT                   NAEKLAAVRTEIVEAGGTAHAYVCNIRDEAAVQATVAQIYGEHGRIDALVNNAGGQFPS
FT                   PLKDISAKGWEAVVQTNLTGGFLMARECLNQAMQQRGGAIVNIVADMWGGMPNMGHSGA
FT                   ARAGMVNFTETAAFEWAQYGVRVNAVAPGYVASSGMDAYPPWMAETIRSMPSTVPLGRF
FT                   ATEAEVSSAIVYLLSEAAAFITGTTLRVDGGRPNVRPGSPMPAPRHGAEPFNGFHLAVT
FT                   PKVLQGEEDRHAGA"
FT   gene            123421..125040
FT                   /locus_tag="Rpic_0106"
FT   CDS_pept        123421..125040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0106"
FT                   /product="carboxyl transferase"
FT                   /note="PFAM: carboxyl transferase; KEGG: bps:BPSS2031
FT                   acetyl-CoA carboxylase carboxyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25269"
FT                   /db_xref="GOA:B2UD90"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:B2UD90"
FT                   /protein_id="ACD25269.1"
FT                   /translation="MPALESRIVPQSDAYRQNHAALTELVGRLRTLEDRTRDKSEASRA
FT                   RFEQRGQLLPRDRLGRLLDAGAPFLELSTLAGFCLDHADPARSIPGGGFIAGIGWVSGV
FT                   RAMIIVDDAGIDAGAVQPMGIEKFQRAQAIALEQKLPFIHLVESAGANLLTYRVETFIH
FT                   GGSGFYWLARLSAAGIPVISVVHGSSTAGGAYMPGLSDYVVMVRDRARAFLAGPPLLKA
FT                   ATGEIATEEELGGAEMHATTSGLAEYLAEDDADALRIARELVAALDWNRDVPAPDRPYA
FT                   PPRFDAEELLGIALTDHRKPLDMREVIARFADGSDFLEFKPDYGPGTITGHAAICGMRV
FT                   GVITNNGPLDPAGATKVVHFIQVCCQSDTPLLYLQNTTGFIVGKASEQAGMIKHGSKTI
FT                   QAMANATVPRITVHCGASFGAGNYGMSGRGFFPDFCFSWPNAKTAVMGAEQAAGTMATV
FT                   MAASMQRKTQTVDHDAIEAMRAKVIDTFERQSDAFTVSGRLLDDGVIDPRDTRKVLACV
FT                   LGVCDEARRRTLHPIQFGVARP"
FT   gene            125090..126247
FT                   /locus_tag="Rpic_0107"
FT   CDS_pept        125090..126247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0107"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase type 2 domain; KEGG: vei:Veis_1896
FT                   acyl-CoA dehydrogenase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25270"
FT                   /db_xref="GOA:B2UD91"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B2UD91"
FT                   /protein_id="ACD25270.1"
FT                   /translation="MHFTHEHQELQRNLKRFIDSDINPYVDEWEAAEMFPAKQLFKKMG
FT                   ELGFLGIAKPTEFGGLGLDYSYAMAMAETLGHIHCGGVPMAIGVQTDMATPALARFGSD
FT                   ELRAQFLAPAISGDAVACVGVSEPSAGSDVASIKTTARKDGDDYIINGSKMWITNSLQA
FT                   DWMCLLANTSDDPAHRNKSLIIVPMNTKGVSVGKKIRKIGMNSSDTGLIYFDDVRVPQR
FT                   YRIGEEGKGFTYQMLQFQEERLWAAASSLATMTMCIETTAEYARERKLFGASLLDNQWV
FT                   HFKLAELKTEVEALRALTYRACDLYIQGQDVTELASMAKLKAGRLARIVPDACLQFWGG
FT                   MGFTWDNPVSRYYRDGRLGSIGGGADEVMLGIICKYMNTLPGKKG"
FT   gene            126251..128245
FT                   /locus_tag="Rpic_0108"
FT   CDS_pept        126251..128245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0108"
FT                   /product="Carbamoyl-phosphate synthase L chain ATP-binding"
FT                   /note="PFAM: biotin/lipoyl attachment domain-containing
FT                   protein; ATP-dependent carboxylate-amine ligase domain
FT                   protein ATP-grasp; Carbamoyl-phosphate synthase L chain
FT                   ATP-binding; Carbamoyl-phosphate synthetase large chain
FT                   domain protein; biotin carboxylase domain protein; KEGG:
FT                   reu:Reut_B4460 biotin/lipoyl attachment:carbamoyl-phosphate
FT                   synthase L chain, ATP-binding:carbamoyl-phosphate
FT                   synthetase large chain, N-terminal:biotin carboxylase,
FT                   C-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25271"
FT                   /db_xref="GOA:B2UD92"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:B2UD92"
FT                   /protein_id="ACD25271.1"
FT                   /translation="MTAPHAAFRSILIANRGEIALRIMRTARRLGMPTVAVYSDADRDA
FT                   PHCRAADLALPIGASQPQASYLNVAALLEAARKSGAQAVHPGYGFLAESDAFAGACADA
FT                   GLVFIGPPAGAIRAMGNKAGAKRLMEAAGVPCVPGYQGEDQSATRMADEAARIGYPVMI
FT                   KAAAGGGGRGMRRVDRPEAFAAALQSARSEAENAFGSGELILEKAIVEPRHIEIQVFAD
FT                   AHGNVVHLGERDCSVQRRHQKVIEESPSPAVSPELRARMGAVSVAAARAIGYVGAGTLE
FT                   FLLAPDGAFYFMEMNTRLQVEHAVTEAIVGVDLVEWQLRVALGEPLPLAQDAIDARRAQ
FT                   GGHAIEVRLCAEDPQQNFLPQSGTVARWRAPGDVRTDHALADGLVVSPYYDSMLAKIVA
FT                   HGTDRADACRRLAHALDDCLLLGLPTNRAFLRDCVAHPAFLSGDVSTAFIDRHFPAAMR
FT                   QAAVPDAAVCQAAAVLLTYLRQDTARRYPAELHGWASSRTYPTLCRFTLDGEAIDMRVR
FT                   ALGAQQWELAWDGGATQVAVVSAGDGRVTLALGDAFHAVDYAVTASACHFVLNGIEHTA
FT                   IDTTYAKAERSGAQTGSGRISAPMNGRVVAVHVAEGEAVCAGQVLLVVEAMKMEHSIAA
FT                   PLAGEVRGLFTQVGAQVAPGGLLMEIAAA"
FT   gene            128330..129916
FT                   /locus_tag="Rpic_0109"
FT   CDS_pept        128330..129916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0109"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   rpe:RPE_2253 AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25272"
FT                   /db_xref="GOA:B2UD93"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B2UD93"
FT                   /protein_id="ACD25272.1"
FT                   /translation="MSEATPDTALEANLLNRVTLGDTLHRSARKFGAKVALVDGARRMT
FT                   HGELNADSNRYAHALLASSLKPGDKVAMVCGNSAQFLVAAYGILKAGLVWVPINAMLGP
FT                   EDVRYILEHAEARHVVIDAALYPALRDTLATLGLPAHQCFGEPVADGPQPVEQALQGHA
FT                   DTLPAVVIDDRDLALIMYTSGTTGRPKGAMHSHRSVHAALMSNVAGLNLNETDVFSCLL
FT                   PMFHCAQFATAASAMMVGATLVIQRGFDPAALLDVIANERITQLFGLPLMYAALLHHPL
FT                   RAQRDLSSLRLCLYAMAPMARPLLERLIAEVCPNFALGSGQTEIFPMTMYFAPDQQLQR
FT                   TGNYWGQPCMVNEAAVMDDQGNLLGPNQLGEIVHRGPNVMLGYYKDPQATANARRFGWH
FT                   HTGDLGMWDADGQLQFKDRIKDMIKTGGENVPSVKVEEVLLRHPAVANAAVVGLPHAHW
FT                   VEAVAAFVCLKPDAHADAAALQAHCRAHLGSFEVPKHIAVVDKLPMTATGKIQKHVLRS
FT                   ANQTLFEGEAR"
FT   gene            complement(129923..130600)
FT                   /locus_tag="Rpic_0110"
FT   CDS_pept        complement(129923..130600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0110"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG:
FT                   bpd:BURPS668_A2924 transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25273"
FT                   /db_xref="GOA:B2UD94"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041490"
FT                   /db_xref="UniProtKB/TrEMBL:B2UD94"
FT                   /protein_id="ACD25273.1"
FT                   /translation="MPKPATSNPPESATEAAPEAEAPRRKRGRPAQDANEGLRRALIEQ
FT                   SARLFREKGYGNTTVRDIAAATGVHAGSWFYYFKTKQDILQAVIEHGLTVALADIEAID
FT                   IEDLPPREAMRQLVRAHLHTILAPHQDFIPVMLYEWRSLDAQAQERIIALKDRYEDIWT
FT                   RVIDRLRASGEWAHPTPVDRLLMFGALNWTAQWYQAGAGISIDALADQAVLFILRTPPQ
FT                   PAA"
FT   gene            complement(130662..131615)
FT                   /locus_tag="Rpic_0111"
FT   CDS_pept        complement(130662..131615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0111"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   rso:RSc0258 putative beta lactamase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25274"
FT                   /db_xref="GOA:B2UD95"
FT                   /db_xref="InterPro:IPR001018"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:B2UD95"
FT                   /protein_id="ACD25274.1"
FT                   /translation="MAEHDVVTLPNSMRVFERGWLSSNNILFFDDEAHGGCALVDSGYL
FT                   THAPQTVALVQHALRGRPLRRLLNTHLHSDHCGGNAALQALYGSHTRVPAAQIDDVRRW
FT                   DTDALSYGPTGQECARFALPDSDADAGLSDGMTARLGGFDWQVISAPGHDPHAVILFSP
FT                   DTRVLISADALWERGFGVIFPELEGESGFAEQQAILERIVQLDALVVIPGHGRPFTNVN
FT                   AAIDASLGRLAYLRADPERNALHAIRVLVKFKLLEQQALSHEALFAWFTQTTLMPRLHA
FT                   RFFAAQSMETLLDAAIAALVKAGAATVEHGRILNRD"
FT   gene            complement(131628..131894)
FT                   /locus_tag="Rpic_0112"
FT   CDS_pept        complement(131628..131894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0112"
FT                   /product="protein of unknown function DUF1289"
FT                   /note="PFAM: protein of unknown function DUF1289; KEGG:
FT                   rso:RSc0259 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25275"
FT                   /db_xref="InterPro:IPR010710"
FT                   /db_xref="UniProtKB/TrEMBL:B2UD96"
FT                   /protein_id="ACD25275.1"
FT                   /translation="MDACTRAQLKRSLGKLRNSQPQAERAQPVASPCISVCKMDEARGL
FT                   CIGCMRTIDEIASWSTMNDAARLAVWKTLPERACAWLNDAPCA"
FT   gene            complement(131903..132403)
FT                   /locus_tag="Rpic_0113"
FT   CDS_pept        complement(131903..132403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0113"
FT                   /product="YbaK/prolyl-tRNA synthetase associated region"
FT                   /note="PFAM: YbaK/prolyl-tRNA synthetase associated region;
FT                   KEGG: rso:RSc0260 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25276"
FT                   /db_xref="GOA:B2UD97"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:B2UD97"
FT                   /protein_id="ACD25276.1"
FT                   /translation="MTATDTKAPLPESAQRVADHLRTLGYEKNIVMLPATGKTSAEAAA
FT                   GLGCSVAEIAKSIIFRRAEDDVPVLVIASGTNRVDEAKVSAHVGALAKADAKFVREKTG
FT                   YAIGGVCPVGHAVKPVMLLDQDLFQYDSLWAAAGHPHAVFNLTPAELEAMTGAPVADIA
FT                   QRD"
FT   gene            complement(132426..133355)
FT                   /locus_tag="Rpic_0114"
FT   CDS_pept        complement(132426..133355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0114"
FT                   /product="pyruvate carboxyltransferase"
FT                   /note="PFAM: pyruvate carboxyltransferase; KEGG:
FT                   rso:RSc0261 hydroxymethylglutaryl-CoA lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25277"
FT                   /db_xref="GOA:B2UD98"
FT                   /db_xref="InterPro:IPR000138"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B2UD98"
FT                   /protein_id="ACD25277.1"
FT                   /translation="MSIPNFVKVVEVGPRDGLQNEKSPVSTDTKVELVNRLSEAGFVNV
FT                   EAASFVSPKWVPAMADGADVMARIQRRPGTLYSVLTPNMKGFEGAAAAGADEIVIFSAA
FT                   SEAFAQKNINCTIAESIERFVPVAKAAKDAGIRVRGSISCSLGCPYQGEVPVSSVVDVI
FT                   KRMADLGCDEIDIADTIGVGTAGRVKTVMEAAAATFPIDRLSGHFHDTYGQALANILAS
FT                   LEVGIAIFHASVAGLGGCPYAKGATGNVATEDVLYLLHGLGIRTGIDLDKVVLAGDFIS
FT                   QAIGRPTASRAGRALLLKLQDQIAQACI"
FT   gene            complement(133357..134298)
FT                   /locus_tag="Rpic_0115"
FT   CDS_pept        complement(133357..134298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0115"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding"
FT                   /note="PFAM: D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding; KEGG: rso:RSc0262 putative 2-hydroxyacid
FT                   dehydrogenase oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25278"
FT                   /db_xref="GOA:B2UD99"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2UD99"
FT                   /protein_id="ACD25278.1"
FT                   /translation="MHIQIYTPDGKPQPWLDGFAQALPEARLSVWEQGAVQDADYAVVW
FT                   QPPADMLRDRRDLRAVFNLGAGVDAILGLRAQAPDAIPEGLPIVRLDDAGMAAQMGEYV
FT                   THAVLRFFRRLDEYERQQQAKMWRFLKPFNRDEFVVGVLGLGVLGTHIARTLAGFGFPV
FT                   RGWSRSAKHVEGVDCRSGSDALPGFLAGTRVLVNVLPLTADTENVIDAKLLAQLAPGAF
FT                   VVNVARGKHVVEDDLLAAVRSGHIAGAALDVFRTEPLPADHPFWTEPRIHITPHISALT
FT                   LREVSIAQIARKIRALEAGEPIAGIVDLQRGY"
FT   gene            complement(134385..136409)
FT                   /locus_tag="Rpic_0116"
FT   CDS_pept        complement(134385..136409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0116"
FT                   /product="Carbamoyl-phosphate synthase L chain ATP-binding"
FT                   /note="PFAM: biotin/lipoyl attachment domain-containing
FT                   protein; phosphoribosylglycinamide synthetase;
FT                   ATP-dependent carboxylate-amine ligase domain protein
FT                   ATP-grasp; Carbamoyl-phosphate synthase L chain
FT                   ATP-binding; Carbamoyl-phosphate synthetase large chain
FT                   domain protein; biotin carboxylase domain protein; KEGG:
FT                   rso:RSc0265 probable acyl-CoA carboxylase alpha chain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25279"
FT                   /db_xref="GOA:B2UDA0"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:B2UDA0"
FT                   /protein_id="ACD25279.1"
FT                   /translation="MITKLLIANRGEIACRVAATCRKLGIRTVAVYSDADANARHVAAC
FT                   DEAIHIGEPAARDSYLRADRILEAARATGAQAVHPGYGFLSENEAFAKACADAGIIFVG
FT                   PPASAIEAMGSKSAAKALMETAGVPLVPGYHGDNQDAAFLRTQADRIGYPVLIKASAGG
FT                   GGKGMRVVESGDAFEASLASVKREASSSFGDDRVLIEKYLTRPRHIEIQVFADSFGDAV
FT                   YLFERDCSVQRRHQKVLEEAPAPGMTLDRRRAMGEAAVAAARAVGYVGAGTVEFIVDED
FT                   GTFYFMEMNTRLQVEHPVTEMITGEDLVEWQLRVASGEPLPRTQDELHIHGHALEARIY
FT                   AENPDRDFLPSIGTLKVLRTPAAVEFTVGAQANGEPAAVRIDAGVREGDAISPYYDPMI
FT                   AKLIVWGRDREEALARMLQALGSFHLVGLSSNVAFLRRLVASKPFATADLDTGLIARNH
FT                   DTLFPAAPDVPLDAIALAVAALLAREARSLRTDTRDPHSPWARGSGWRLNGAAERTLRF
FT                   THGDQSIDATLIYGRYGSRLKVGGSEAPFTSQRHAETFTVTLGTHKATGQVHADGDTFH
FT                   VFTGGAHWTLERHDPLAHAGEADDEGGKLTAPMPGKVIAVLAAPGQTVTKGAPLVVMEA
FT                   MKMEHTLTAPANGVVESVLYGVGDQVTEGVQLLAFKPAE"
FT   gene            complement(137071..138150)
FT                   /locus_tag="Rpic_0117"
FT   CDS_pept        complement(137071..138150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0117"
FT                   /product="biotin synthase"
FT                   /EC_number="2.8.1.6"
FT                   /note="KEGG: rso:RSc0266 probable biotin synthase protein;
FT                   TIGRFAM: biotin synthase; PFAM: Radical SAM domain protein;
FT                   biotin and thiamin synthesis associated; SMART: Elongator
FT                   protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25280"
FT                   /db_xref="GOA:B2UDA1"
FT                   /db_xref="InterPro:IPR002684"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024177"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2UDA1"
FT                   /protein_id="ACD25280.1"
FT                   /translation="MQSTPLNFVPNAAKAPVTPGQAPDARWSREAIEALFALPFNDLLF
FT                   QAQQVHRANFDANAVQLSTLLSIKTGGCPEDCSYCPQSARYDTGVEAEKLMPIDAVLEA
FT                   ASRAKQNGASRFCMGAAWRNPKPHQLDAVADMVRGVKAMGLETCVTLGMLKQEQAAQLK
FT                   EAGLDYYNHNLDTAPEFYGEIITTRTYQDRLDTLEHVRDAGINVCCGGIVGLGESVHER
FT                   AGLIAELANMEPYPDSVPINNLVKVEGTPLAGNEELDPFDFVRTIAVARITMPKAMVRL
FT                   SAGREAMDDALQALCFMAGANSIFYGEKLLTTDNPEADADRKLLARLGMRVEVQDHMHH
FT                   ESHVGAQSSHCHIDITPAD"
FT   gene            complement(138194..138988)
FT                   /locus_tag="Rpic_0118"
FT   CDS_pept        complement(138194..138988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0118"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   rso:RSc0267 enoyl-CoA hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25281"
FT                   /db_xref="GOA:B2UDA2"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:B2UDA2"
FT                   /protein_id="ACD25281.1"
FT                   /translation="MNTFETLAFAQNGAVATLTLNRPDVRNAFNETVIAELTGAFRALA
FT                   DEPGVRAIVLTGNGPAFCAGADLNWMKKMAGYSDDENRADALRLAEMLRAIYTCPKPVI
FT                   ARVQGDTYAGGVGLVAACDIVVAVDTANFCLSEAKLGLIPATISPYVIRALGEQASRRY
FT                   FITAERFSAAEAHRLGLVHELVSADALDAKVADITAALVANSPNAVRESKRLVREVSGA
FT                   AVNDALLADTAERIAAIRASEEGREGVQSFLGKRKPNWLLPA"
FT   gene            complement(138985..139923)
FT                   /locus_tag="Rpic_0119"
FT   CDS_pept        complement(138985..139923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0119"
FT                   /product="conserved hypothetical signal peptide protein"
FT                   /note="KEGG: rso:RSc0268 hypothetical signal peptide
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25282"
FT                   /db_xref="GOA:B2UDA3"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B2UDA3"
FT                   /protein_id="ACD25282.1"
FT                   /translation="MNSNTARTWRSALAAVGCALLLAAAHASETAQSGISEIIVEVPKS
FT                   AGIFTLKLETTVYKPAGDGPFPLIVLNHGKARGKAAFQARARYSEQAAALVARGYVVAI
FT                   PMRQGFAKSGGAYIGSGCNVEANGIIQAEDVVATLDYMTAQPYVDRNRIVVMGQSHGGL
FT                   TTLAFGTIAYPGVRGLVNFAGGLRNDTCVDWEGNLVRAFETYGRQSRYPSLWFYGDNDS
FT                   YWPKPMPDRMFAAYTSAGGKGRLVDFGTFKSDSHGMFASHAGLGIWLPQVDAFLRELGL
FT                   PAGPVQAVAPGSNAEASGADDPKSDTNKDPE"
FT   sig_peptide     complement(139840..139923)
FT                   /locus_tag="Rpic_0119"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.979 at
FT                   residue 28"
FT   gene            complement(139955..141562)
FT                   /locus_tag="Rpic_0120"
FT   CDS_pept        complement(139955..141562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0120"
FT                   /product="Propionyl-CoA carboxylase"
FT                   /EC_number="6.4.1.3"
FT                   /note="PFAM: carboxyl transferase; KEGG: rso:RSc0269
FT                   putative propionyl-CoA carboxylase (beta subunit) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25283"
FT                   /db_xref="GOA:B2UDA4"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:B2UDA4"
FT                   /protein_id="ACD25283.1"
FT                   /translation="MPTLETKLNPRAEDFKANADAMRALVADLRDKVARIAQGGGDDAR
FT                   AKHLARGKLLPRDRVQQLLDPGTPFLEFSQLAAYGMYDNAAPGAGIITGIGRISGQECV
FT                   IVCNDATVKGGTYYPMTVKKHLRAQEIAEQNHLPCVYLVDSGGANLPNQDDVFPDRDHF
FT                   GRIFYNQANLSSKGIPQIAVVMGSCTAGGAYVPAMSDESIIVKEQGTIFLAGPPLVKAA
FT                   TGEVVSAEDLGGADVHTRLSGVADYFANNDSHALAQARSIVAHLNRRKPEQVQIHAPVE
FT                   PRFPAEELYGVIPTDTRKPFDVREVIARIVDDSAFDEFKARYGTTLVCGFARIWGYPVG
FT                   IIANNGILFSEAALKGAHFIELCCQRKIPLVFLQNITGFMVGRKYENEGIAKNGAKMVT
FT                   AVATAQVPKFTVIIGGSFGAGNYGMCGRAYSPRFLWMWPNARISVMGGEQAASVLATVR
FT                   RDGIEAKGGQWSADEEAAFKAPIRDQYERQGHPYYASARLWDDGVIDPADTRSVLGLGL
FT                   SASLNAPIGDMNFGVFRM"
FT   gene            complement(141591..142031)
FT                   /locus_tag="Rpic_0121"
FT   CDS_pept        complement(141591..142031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0121"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RSc0270 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25284"
FT                   /db_xref="InterPro:IPR023006"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:B2UDA5"
FT                   /protein_id="ACD25284.1"
FT                   /translation="MPAAQTQPIGPADACPCGNGAYARCCGPFHAGEAVAATAEQLMRS
FT                   RYSAYVLGDTAYLRRTWHPSTCPVDLETSEADAAATRWLGLDVRRHTPQDATHATVEFV
FT                   ARYKVGGRAHRLHETSRFVRLDASGAESAEGRWLYVDGTFPD"
FT   gene            complement(142031..142720)
FT                   /locus_tag="Rpic_0122"
FT   CDS_pept        complement(142031..142720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0122"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   3"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 3; HAD-superfamily hydrolase, subfamily IA, variant
FT                   1; PFAM: Haloacid dehalogenase domain protein hydrolase;
FT                   KEGG: rso:RSc0271 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25285"
FT                   /db_xref="GOA:B2UDA6"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:B2UDA6"
FT                   /protein_id="ACD25285.1"
FT                   /translation="MTAVTSSVSNHPRFDAILFDCDGVLVDSEPIVNRLIWEMLIELGI
FT                   DISLEDSIQRFLGKAIREELDAIAEMRGAPLPPNWLSTFQARRNVLLEAEVEAVPHIGH
FT                   AIDVLSRLGLPMAVASGADRMKVELQLNRTGLIEHFQPTDVRIFSATEVARSKPAPDVY
FT                   LLAASSLGVSPSRCLVIEDSPTGVTAGHAAGMTVLAYAGRNAPGPLIAAGATRTFTDMR
FT                   ELPELLA"
FT   gene            complement(142784..143389)
FT                   /locus_tag="Rpic_0123"
FT   CDS_pept        complement(142784..143389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0123"
FT                   /product="DSBA oxidoreductase"
FT                   /note="PFAM: DSBA oxidoreductase; KEGG: rso:RSc0273
FT                   putative 2-hydroxychromene-2-carboxylate isomerase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25286"
FT                   /db_xref="GOA:B2UDA7"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR014440"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B2UDA7"
FT                   /protein_id="ACD25286.1"
FT                   /translation="MNGAIDFYFDFSSPYGYFASTRVEELAQRYNRATAWHPILLGVVF
FT                   KTTGGSPLPQVPLKGDYAWRDFERTARFNGIEYRKPTHFPLPTQYAARATLWVHDHHGG
FT                   DRAIDFARAVYRALFVDDINIGEPTEVMKIADAMGIDGAALNAGASSQQIKDQLKAEID
FT                   LAMSRGVFGSPYVIVDGEAFWGFDRFDQIEALLRDGRI"
FT   gene            complement(143431..144561)
FT                   /locus_tag="Rpic_0124"
FT   CDS_pept        complement(143431..144561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0124"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase type 2 domain; KEGG: rso:RSc0274
FT                   putative acyl CoA dehydrogenase oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25287"
FT                   /db_xref="GOA:B2UDA8"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B2UDA8"
FT                   /protein_id="ACD25287.1"
FT                   /translation="MLLTQEQEMIRDAIRTFVREAIAPHAAAWDRDATFPKDVHRQLGE
FT                   LGAYGVAVPEELGGAGLDYLSLALILEEIAAGDGGTSTVISVNNCPVCSMLMAFANDAQ
FT                   KQQWLVPLARGEMLGAFCLTEPHVGSDASALRTTAVRDGDHWVLNGVKQFITSGKHADV
FT                   AIVMAVTDKTAGKRGISAFLVPTNTPGYIVARLEDKLGQHSSDTAQIVFEDCRIPADCL
FT                   LGEEGAGYKMALSGLEGGRIGIAAQSVGMARAAFEAALAYAKERESFGQPLFAHQAVQF
FT                   RLAEMATRVDVARQMVWHAASLKDAGLPCLKEAAMAKLNASEMAERVCSDAIQVFGGYG
FT                   YVSDFPVERIYRDVRVCQIYEGTSDIQKILIARALA"
FT   gene            complement(144572..145285)
FT                   /locus_tag="Rpic_0125"
FT   CDS_pept        complement(144572..145285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0125"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   rso:RSc0275 short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25288"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2UDA9"
FT                   /protein_id="ACD25288.1"
FT                   /translation="MTNATSRRTRTALILGASRGIGLETVKQYRADGWRVIATVRTQEA
FT                   AHALQALGAETHVLDLTDANAVAGLAWKLDGEALDVAIYVAGIYGPRTQGATPVSQADF
FT                   DAVMHTNVWAPMGVLPAVLPMVEAGRNGADEPGGVLAVISSRMGSIGDMAGNGGWLYRA
FT                   SKAAVNAVLRGVSIDAKNATCLTFHPGWVQTDMGGADAAITPQESVAGIRRVIAGATRA
FT                   DNGGFRNYDGSVIEW"
FT   gene            complement(145295..146476)
FT                   /locus_tag="Rpic_0126"
FT   CDS_pept        complement(145295..146476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0126"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.9"
FT                   /note="KEGG: rso:RSc0276 acetyl-CoA acetyltransferase;
FT                   TIGRFAM: acetyl-CoA acetyltransferase; PFAM: Thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25289"
FT                   /db_xref="GOA:B2UDU9"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:B2UDU9"
FT                   /protein_id="ACD25289.1"
FT                   /translation="MSDRIVIASAARTPMGAFQGELASLTAPQLGAAAIRAAVERAGLK
FT                   PEQIEEVIMGCVLPAGQGQAPARQAALGAGLPLSVGCTTVNKMCGSGMRAAMNAYDALL
FT                   AGSVDVVVAGGMESMTNAPYLIPKGRGGYRIGHGMIYDHMMLDGLEDAYDKGRAMGTFG
FT                   EDCAEKYGFTREAQDHFAMTSVRRAQEATESGAFRWEITPVTVSSKAGDTVIDTDEGPR
FT                   RIKVDKIPSLKPAFKKDGTVTAASSSSINDGAAALVMMRESTAKQLGITPLAVMLGHTT
FT                   HAQAPGWFTTAPVTAIDKLFKKLDWNSGNVDLFEINEAFAVVPMAAMHDLHIPHEKVNV
FT                   NGGACALGHPIGASGARVIATLLGALQHRGGKRGVASLCIGGGEATAVGIELY"
FT   gene            complement(147143..147823)
FT                   /locus_tag="Rpic_0127"
FT   CDS_pept        complement(147143..147823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0127"
FT                   /product="Carbonate dehydratase"
FT                   /EC_number="4.2.1.1"
FT                   /note="PFAM: carbonic anhydrase; KEGG: rso:RSc0277 probable
FT                   carbonic anhydrase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25290"
FT                   /db_xref="GOA:B2UDV0"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR015892"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:B2UDV0"
FT                   /protein_id="ACD25290.1"
FT                   /translation="MPQRIKELFENNRKWVERVNAEDPAFFSNLANQQNPEYLWIGCSD
FT                   SRVPANQIIGLPPGEVFVHRNIANVVVHSDLNCLSVLQFAVEVLKIRHITVVGHYGCSG
FT                   VKAALTKQRFGLADNWIRHVRDVAEQHETYLGTVVREQDQHDRLCELNVIHQVNNVCLT
FT                   TIVQDAWDRGQPLTVHGWIYGVKDGMLRNLGMAANSNEELHAQLADAWLNYGKEGSVPS
FT                   PVGF"
FT   gene            complement(147847..149682)
FT                   /locus_tag="Rpic_0128"
FT   CDS_pept        complement(147847..149682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0128"
FT                   /product="(Isocitrate dehydrogenase (NADP(+))) kinase"
FT                   /EC_number="2.7.11.5"
FT                   /note="PFAM: Isocitrate dehydrogenase kinasephosphatase;
FT                   KEGG: rso:RSc0278 bifunctional isocitrate dehydrogenase
FT                   kinase/phosphatase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25291"
FT                   /db_xref="GOA:B2UDV1"
FT                   /db_xref="InterPro:IPR010452"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2UDV1"
FT                   /protein_id="ACD25291.1"
FT                   /translation="MSHFPKLLSSQIAFDVARTMLDGFDKHYRLFREVSVQAKTAFETG
FT                   DWAGLQQLQRDRIAYYDERVREASVILEDEYDAENIDDEIWRQIKLHFIGLLTNHHQPE
FT                   CAETFFNSVCTRILHRSYFNNDFIFVRPAISTEYIENEESPTKPTYRAYYPGTRDGLGA
FT                   CFERIVHNFQLNAPFEDLERDIGYVVRAVGEHFGDFRIAPNFQIHVLSSLFFRNKAAYI
FT                   IGRVINGDKTFPLAVPILRNAAGQLSLDTVLLRQEQLLILFSFTHSYFMVDMEIPSAYV
FT                   TFLRDLMPRKPRAEIYTSLGLQKQGKNLFYRDFLHHLQHSSDKFIIAPGIKGLVMLVFT
FT                   LPSYPYVFKVIKDYFPPPKETTRELIKSKYQLVKRHDRVGRMADTLEYSDVAFPLSRFD
FT                   DDLIKELEKHAPSMVEYQRSEDGGEEIVIRHVYIERRMTPLNIWLHEGTDAQVEHGIIE
FT                   YGNAIKELIAANIFPGDMLYKNFGVTRHGRVVFYDYDEIEYLTDCNIRTVPEPRTEEEE
FT                   MSGEVWYNVGPHDIFPETYRTFLLGDPRVREAFLKHHADFFEASMWQGYKERLLSGQMH
FT                   DFYAYDAAERFVNRYGASAPDNAAQDNTTLQRAAA"
FT   gene            complement(149838..151019)
FT                   /locus_tag="Rpic_0129"
FT   CDS_pept        complement(149838..151019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0129"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase type 2 domain; KEGG: rso:RSc0279
FT                   probable acyl-CoA dehydrogenase oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25292"
FT                   /db_xref="GOA:B2UDV2"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR034183"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B2UDV2"
FT                   /protein_id="ACD25292.1"
FT                   /translation="MIDLPGLKFDLGEDIEMLRSAVRDWAQGELAPRAGEIDRTDQFPM
FT                   DAWRKMGELGVLGITVAEEYGGANMGYLAHMIAMEEISRASASVGLSYGAHSNLCVNQI
FT                   HRNGTAAQKAKYLPKLVSGEWVGALAMSEPNAGSDVVSMKLRAELKGDRYVLNGTKMWI
FT                   TNGPDCDVLVVYAKTEPELGARGMTAFIVEKGMKGFSVAQKLDKLGMRGSHTGELVFEN
FT                   VEVPVENILGQENGGTKVLMSGLDYERAVLSGGPIGIMQACMDVVTPYIHDRKQFGQSI
FT                   GEFQLIQGKMADMYTTLQACRAYLYTVGKNLDSLGRDHVRQVRKDCAGVILYTAEKATW
FT                   MAGEAIQILGGNGYINEFPVGRLWRDAKLYEIGAGTSEIRRMLIGRELYAETM"
FT   gene            complement(151197..151694)
FT                   /locus_tag="Rpic_0130"
FT   CDS_pept        complement(151197..151694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0130"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="PFAM: regulatory protein MerR; Transcription
FT                   regulator MerR DNA binding; KEGG: rso:RSc0280 putative
FT                   transcription regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25293"
FT                   /db_xref="GOA:B2UDV3"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:B2UDV3"
FT                   /protein_id="ACD25293.1"
FT                   /translation="MSASTPSAAAALAADLESGDAGALADASFTITDLAREFDITPRAI
FT                   RFYEDQGLLAPDRQGPGGRRRVYSAGERTRLKLTLRGKRLGLSLGEIKEILDLYESPRD
FT                   TVPQLERFLASLAQHRAVLTQQLEDLNAQLAEIDQHERQCRRLLEDAQAGTVKPTKRRK
FT                   AA"
FT   gene            151879..152958
FT                   /locus_tag="Rpic_0131"
FT   CDS_pept        151879..152958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0131"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   rso:RSc0281 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25294"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:B2UDV4"
FT                   /protein_id="ACD25294.1"
FT                   /translation="MNALEHQLDYPFGDTLPEGGTRFEVAPGVYWLRMPLPFALDHINL
FT                   WLLRDRQDGQDGWTIIDCGINHEAIRGYWETIFANHLDGLPVLRVLVTHCHPDHVGLSN
FT                   WLCEGGDEKRWNVRLWMSLGDYAFARMLVGGTGASNAGGEFAARHFERHGLTDPTSIEG
FT                   IRNRKDYYSTLVPGVPSQYRRLMDGNVVTIGAHTWRVITGFGHAPEHVALYSEEANVLI
FT                   SGDMVLPRISTNVSVFDLEPEADSLTLYLDSLGKYEPLPADVLILPSHGRPFRGLHTRI
FT                   RQLRDHHADRLAETLAACKAAPQSARDIVNVIFKRQFDVHQMTFAMGEALAHLHALWHQ
FT                   GELVRETDADGIVRFHAAA"
FT   gene            152993..153379
FT                   /locus_tag="Rpic_0132"
FT   CDS_pept        152993..153379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0132"
FT                   /product="Antibiotic biosynthesis monooxygenase"
FT                   /note="PFAM: Antibiotic biosynthesis monooxygenase; KEGG:
FT                   rso:RSc0282 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25295"
FT                   /db_xref="GOA:B2UDV5"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:B2UDV5"
FT                   /protein_id="ACD25295.1"
FT                   /translation="MADQHDVLDDSAVVLPFPAQTPTAPYYAVIFSSTRTDGDNGYGAM
FT                   ADRMVELGRSMPGFLGIESVRDELAGDQGRPGITVSYWSSLEAIREWKNQSDHLAAQKL
FT                   GREQWYASYHLRIAKVEYDYGFER"
FT   gene            complement(153445..154290)
FT                   /locus_tag="Rpic_0133"
FT   CDS_pept        complement(153445..154290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0133"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RSc0283 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25296"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:B2UDV6"
FT                   /protein_id="ACD25296.1"
FT                   /translation="MTYTDAAGLAHAPVDTTPRIASLVPSITDLLFSLDLGDQLVARTG
FT                   FCIHPREAVRNVPKVGGTKTVKLDKLRELAPTHVIVNIDENTRPTVDKLREFIPHIIVT
FT                   HPCSPEDNLALYELLGGIFRREAQAQKLSDALTQELEALRGRHFLPHRVLYAIWQDPWM
FT                   TVSRDTYISRMLKLVNCHTWPDDPAPVECGTNKSGDCARPNRPDTRYPTFRWSNDVVRN
FT                   IDCVLLSTEPYSFTEEHVDALEKQIGKPVYLVDGEMVSWYGSRAIDGVRYLGQFAKTLR
FT                   "
FT   gene            complement(154287..155087)
FT                   /locus_tag="Rpic_0134"
FT   CDS_pept        complement(154287..155087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0134"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: rso:RSc0284 short chain
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25297"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2UDV7"
FT                   /protein_id="ACD25297.1"
FT                   /translation="MSEIVFITGASSGIGQALARQYAAQGAMIGLVARRVDVLHEFVQT
FT                   LPAGIQSRCHCYAADVRSAESMRDVANAFIATVGLPDVVIANAGISVGTDLREPGDLKA
FT                   FAVVMDTNWMGVLNTFQPFVGPMLARAKPGQPGGTLVGIASVAGVRGLPGAAAYSASKS
FT                   AVIKLMESLRVEFGPLGLRVVTIAPGYIRTPMTEHNPYPMPFLMPVDRFALKAVNAIHR
FT                   GVRFTVLPWPMGMVAKLLHVLPRGLYDFAFARAGRKPRNPEISS"
FT   sig_peptide     complement(155028..155087)
FT                   /locus_tag="Rpic_0134"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.753) with cleavage site probability 0.743 at
FT                   residue 20"
FT   gene            complement(155200..155856)
FT                   /locus_tag="Rpic_0135"
FT   CDS_pept        complement(155200..155856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0135"
FT                   /product="DSBA oxidoreductase"
FT                   /note="PFAM: DSBA oxidoreductase; KEGG: rso:RSc0285
FT                   probable thiol:disulfide interchange signal peptide
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25298"
FT                   /db_xref="GOA:B2UDV8"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR023205"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B2UDV8"
FT                   /protein_id="ACD25298.1"
FT                   /translation="MKKLAAFLIALATGAGFLMTAPANAAPTAGKEYKVLQTPQPVPAG
FT                   KIEVTEFFWYGCPHCYDFENTWTAWVAKQGKDVVIKRVPVAFNAKLEPHTRIYYTLEAL
FT                   GKLDAKDASGKTLHDRVFDQLHKNYRSMSELDDIAKFMAANGVDEKQFRDTYNSFSVNA
FT                   NTKRAAQLADQYKIEGVPTVVVQGKYTTSPADAGSNVGAAQTLDYLVDQVRNRKM"
FT   sig_peptide     complement(155779..155856)
FT                   /locus_tag="Rpic_0135"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 26"
FT   gene            complement(156017..156727)
FT                   /locus_tag="Rpic_0136"
FT   CDS_pept        complement(156017..156727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0136"
FT                   /product="Sporulation domain protein"
FT                   /note="PFAM: Sporulation domain protein; KEGG: rso:RSc0286
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25299"
FT                   /db_xref="GOA:B2UDV9"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:B2UDV9"
FT                   /protein_id="ACD25299.1"
FT                   /translation="MARNTQFSRARSQRGGTFLGLVLGLIVGLAIAVVVAVYITKAPVP
FT                   FVSRGGAQPKPSEAGNVVNTLPTPVQPAPQASAPQAADPNAPLWSRVPAKPVDQAAEQN
FT                   NPPPGITIHPAQPGSVPQVASAPAVKPPKPPVTASNEKPVTDPIAEIARQDAAKTGYFL
FT                   QVGAYKSPEDAERQKGNLAMQGFEAKVTQREVNGTTMYRVRLGPFNSLDEMTAVRGRLQ
FT                   STGVESSVIRFARQ"
FT   sig_peptide     complement(156629..156727)
FT                   /locus_tag="Rpic_0136"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.983) with cleavage site probability 0.795 at
FT                   residue 33"
FT   gene            complement(156788..158578)
FT                   /locus_tag="Rpic_0137"
FT   CDS_pept        complement(156788..158578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0137"
FT                   /product="arginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.19"
FT                   /note="KEGG: rso:RSc0287 arginyl-tRNA synthetase; TIGRFAM:
FT                   arginyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25300"
FT                   /db_xref="GOA:B2UDW0"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2UDW0"
FT                   /protein_id="ACD25300.1"
FT                   /translation="MLPSHKQTIAQLLSDAVGSLLPEGQARPEIVLERPKQAAHGDIAC
FT                   NVALQLAKPLGTNPRELAGKIADAIRADARGQRLVAAVEIAGPGFINLRLSAAARADVI
FT                   AAVFAEGDRYGAANTHDGAPVLVEFVSANPTGPLHVGHGRQAALGDALASLLDWQGHKV
FT                   HREFYYNDAGVQIHNLAVSVQARARGYKPGDANWPEAAYNGDYIADIAADYLAGKTVRA
FT                   SDGEPVTGERDVENIEAIRRFAVTYLRNEQDIDLQAFGVKFDRYYLESSLYTEGKVQQT
FT                   VDALVAAGKTYEQEGALWLRTTDDGDDKDRVMRKSDGAYTYFVPDVAYHTTKWGRGFTQ
FT                   VINVQGSDHHGTIARVRAGLQGLNIGIPKGYPDYVLHKMVTVMKDGAEVKISKRAGSYV
FT                   TVRDLIEWSNGDAESEAGVDTIRACVEAGEPNWPARFTRGRDAVRFFLLSRKADTEFVF
FT                   DVDLALKQSDENPVYYVQYAHARICSVFERAGVDAASLTSADLAAVTGPDVSPQATALV
FT                   QRLAAFPDMLADAARELAPHAVAFYLRDLAGDFHAFYNADRVLVDDEAVKRARLALLAA
FT                   TRQVLRNGLAVIGVSAPQKM"
FT   gene            158753..159076
FT                   /locus_tag="Rpic_0138"
FT   CDS_pept        158753..159076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0138"
FT                   /product="Domain of unknown function DUF1840"
FT                   /note="PFAM: Domain of unknown function DUF1840; KEGG:
FT                   rso:RSc0288 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25301"
FT                   /db_xref="InterPro:IPR014991"
FT                   /db_xref="UniProtKB/TrEMBL:B2UDW1"
FT                   /protein_id="ACD25301.1"
FT                   /translation="MITFTSHASQKFSMQKDLAMVLLGVIGKTLGERGVITPEEMPHAI
FT                   DRLKRAIKDDTHQAHIKVAELSAAELDENGEEEPPHLGQRAYPLLHMLEESLVEQSSVL
FT                   WGV"
FT   gene            complement(159205..159762)
FT                   /locus_tag="Rpic_0139"
FT   CDS_pept        complement(159205..159762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0139"
FT                   /product="Ferritin Dps family protein"
FT                   /note="PFAM: Rubrerythrin; Ferritin Dps family protein;
FT                   KEGG: reu:Reut_A2901 rubrerythrin:ferritin and Dps"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25302"
FT                   /db_xref="GOA:B2UDW2"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR014490"
FT                   /db_xref="UniProtKB/TrEMBL:B2UDW2"
FT                   /protein_id="ACD25302.1"
FT                   /translation="MSRTNVAAPSESSFLTDIKTLRERARKHIEEGAVTEDYKADRETV
FT                   LRLLNEALATELICVLRYRRHHFMAKGINAEPIAAEFLVHANEEQAHADSIATRIVQLG
FT                   GEPNFNPEGLSTRSHSEYVEADGLVDMIKENLVAERIAIDSYLEMIRYIGDRDPTTRRV
FT                   LEQILAVEEEHADELSDMLHDQ"
FT   gene            complement(159796..160224)
FT                   /locus_tag="Rpic_0140"
FT   CDS_pept        complement(159796..160224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0140"
FT                   /product="protein of unknown function DUF883, ElaB"
FT                   /note="KEGG: reu:Reut_A0125 protein of unknown function
FT                   DUF883, ElaB"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25303"
FT                   /db_xref="GOA:B2UDW3"
FT                   /db_xref="InterPro:IPR010279"
FT                   /db_xref="UniProtKB/TrEMBL:B2UDW3"
FT                   /protein_id="ACD25303.1"
FT                   /translation="MSLFASHRVRSRIDDVNDRAHRAMNSASDAVDHARYAARPAVEDV
FT                   QSLLRSLENAIHTLTDEGSAEADRASRTLHARADQLRRAANERAHQARERMDWALDRTE
FT                   ETITAAPFKSVGVAVAIGAAIGLVVALAGGSSRRDASE"
FT   gene            complement(160369..160542)
FT                   /locus_tag="Rpic_0141"
FT   CDS_pept        complement(160369..160542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0141"
FT                   /product="protein of unknown function DUF1328"
FT                   /note="PFAM: protein of unknown function DUF1328; KEGG:
FT                   cak:Caul_4145 protein of unknown function DUF1328"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25304"
FT                   /db_xref="GOA:B2UDW4"
FT                   /db_xref="InterPro:IPR009760"
FT                   /db_xref="UniProtKB/TrEMBL:B2UDW4"
FT                   /protein_id="ACD25304.1"
FT                   /translation="MLKWALIFAIISLVAGVLGFTGIAAGAASIAKVLFFIFVVLFVLF
FT                   LVLGVTVFKAVD"
FT   sig_peptide     complement(160462..160542)
FT                   /locus_tag="Rpic_0141"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.583 at
FT                   residue 27"
FT   gene            160751..162208
FT                   /locus_tag="Rpic_0142"
FT   CDS_pept        160751..162208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0142"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   CHASE3 domain protein; histidine kinase dimerisation and
FT                   phosphoacceptor region; KEGG: rso:RSc0289 transmembrane
FT                   sensor kinase VsrA transcription regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25305"
FT                   /db_xref="GOA:B2UDW5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR007891"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B2UDW5"
FT                   /protein_id="ACD25305.1"
FT                   /translation="MGLHAMRSSLRSTLLLAGGILLTLGVLIASETGNIRLSQGYRQVI
FT                   QSQQAETAINELLAELVNAEAGQRGFLLTGKDEYLDPYNKAIPHIHALMAEIRDHYAND
FT                   PDALKLFSETALQVSRKLTEMELTLIYGKRDLEVALDLVRTDFGKASMEAVRQGLDRLR
FT                   QREIATVARSLEHAERDLALSRYGIALITAVNIILLVVLGMQHAKRLAVTERERDMAEE
FT                   ESQKLDRMVRERTRQLSDLAAHLQRVTEDEKTRLARELHDELGAILTATKMDLHWLRSR
FT                   IHANEPAVSEKITRVMAHVDQGIQIKRRLIEDLRPTILLNLGLVEALSQLTEDVGTRNG
FT                   WHTEVSLPDDMPKLTDDAAIALYRIVQESLTNASKYAHATTVSVALDVGEEGVRLRVRD
FT                   NGRGFPADIERRRMVGHHGLLGMEQRAIALGGTLVIDSMPGGGVTIIVELPPSDAVFDR
FT                   GAANEPSGMQALTGGIAPAPGRGGATV"
FT   sig_peptide     160751..160840
FT                   /locus_tag="Rpic_0142"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.985) with cleavage site probability 0.945 at
FT                   residue 30"
FT   gene            complement(162293..162433)
FT                   /locus_tag="Rpic_0143"
FT   CDS_pept        complement(162293..162433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0143"
FT                   /product="Entericidin EcnAB"
FT                   /note="PFAM: Entericidin EcnAB; KEGG: rso:RSc0290 probable
FT                   entericidin precursor lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25306"
FT                   /db_xref="GOA:B2UDW6"
FT                   /db_xref="InterPro:IPR012556"
FT                   /db_xref="UniProtKB/TrEMBL:B2UDW6"
FT                   /protein_id="ACD25306.1"
FT                   /translation="MKTLCAALAVTCMFLAGCNTMAGAGKDIQTGGQKLENSADNAKQK
FT                   M"
FT   sig_peptide     complement(162365..162433)
FT                   /locus_tag="Rpic_0143"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.890 at
FT                   residue 23"
FT   gene            complement(162504..162944)
FT                   /locus_tag="Rpic_0144"
FT   CDS_pept        complement(162504..162944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0144"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG: rso:RSc0291
FT                   putative transcription regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25307"
FT                   /db_xref="GOA:B2UDW7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B2UDW7"
FT                   /protein_id="ACD25307.1"
FT                   /translation="MLDQAVTLSARGLRVLLIEDSPVLRGMVLEYLKASAFVATVEWAD
FT                   TEDLALGLLGQGHYDVVIVDLQLRQGNGFKVLQTLRDQASPSVRIVYTNHAQVPTYRQR
FT                   CFEAGANYFFDKSLELDKVFEVIEERAGVGRPRPQPAQHFHP"
FT   gene            complement(163047..163679)
FT                   /locus_tag="Rpic_0145"
FT   CDS_pept        complement(163047..163679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0145"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: regulatory protein LuxR; response regulator
FT                   receiver; KEGG: rso:RSc0292 response regulator
FT                   transcription regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25308"
FT                   /db_xref="GOA:B2UDW8"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:B2UDW8"
FT                   /protein_id="ACD25308.1"
FT                   /translation="MIRVLIADDHEIVRAGLRQFLSEERDIEVAGEAASGEEVMEQLRT
FT                   GAFDVVVLDISMPDRNGIDTLKLARQRHPDLPVLILSTFPEDQYAINLIRAGASGYLTK
FT                   ESAPDELVKAIRTVSQGRRYVSPTVAELLIGGLEKPTDQPLHQTLSKREFQIFCKLARG
FT                   QSVSIIAEELFLSVKTVSTYRTRILEKMGMKSNADLTYYAIKNGLVE"
FT   gene            complement(163990..164403)
FT                   /locus_tag="Rpic_0146"
FT   CDS_pept        complement(163990..164403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0146"
FT                   /product="conserved hypothetical signal peptide protein"
FT                   /note="KEGG: rso:RSc0293 hypothetical signal peptide
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25309"
FT                   /db_xref="UniProtKB/TrEMBL:B2UDW9"
FT                   /protein_id="ACD25309.1"
FT                   /translation="MNKLLISLSAIAIAAASAYANAQTPSAGVSLQSNGTAAVAPAQGN
FT                   AGVGLKADTGAKLDTESAKSQLNTKAEHGAKAAHEHKAKTEAGVDKTADKVGKSVSKTE
FT                   KSAEKSGKAAKADTGAGLSADAGANAAATTQTK"
FT   sig_peptide     complement(164335..164403)
FT                   /locus_tag="Rpic_0146"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.916 at
FT                   residue 23"
FT   gene            complement(164645..167362)
FT                   /locus_tag="Rpic_0147"
FT   CDS_pept        complement(164645..167362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0147"
FT                   /product="methionine synthase"
FT                   /EC_number="2.1.1.13"
FT                   /note="KEGG: rso:RSc0294 probable
FT                   5-methyltetrahydrofolate--homocysteine methyltransferase
FT                   (methionine synthase, vitamin-B12 dependent isozyme)
FT                   protein; TIGRFAM: methionine synthase; PFAM:
FT                   dihydropteroate synthase DHPS; Methionine synthase
FT                   B12-binding module cap domain protein; Vitamin B12
FT                   dependent methionine synthase activation region; cobalamin
FT                   B12-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25310"
FT                   /db_xref="GOA:B2UDX0"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR003759"
FT                   /db_xref="InterPro:IPR004223"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR011822"
FT                   /db_xref="InterPro:IPR033706"
FT                   /db_xref="InterPro:IPR036594"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="InterPro:IPR037010"
FT                   /db_xref="UniProtKB/TrEMBL:B2UDX0"
FT                   /protein_id="ACD25310.1"
FT                   /translation="MTDHPMRLSGLEPFNIGESTLFVNVGERTNVTGSKAFARMILNSQ
FT                   FDEALAVARQQVENGAQVIDINMDEAMLDSKAAMVRFLNLIASEPDIARVPIMIDSSKW
FT                   DVIEAGLKCVQGKAIVNSISLKEGEEQFAHHAKLIKRYGAAAVVMAFDEQGQADTYARK
FT                   TEICKRSYDFLVNKVGFAPEDIIFDPNIFAVATGIEEHNNYAVDFIEATRWIKQNLPYA
FT                   KVSGGVSNVSFSFRGNDVVREAIHTVFLYYAIQAGMDMGIVNAGQLGVYENLDPELRDR
FT                   VEDVVLNRRPDATDRLLEIADRYKGGGTKREENLAWRQEPVEKRLAHALVHGITDYVVE
FT                   DTEEVRQKIFAAGGRPIQVIEGPLMDGMNIVGDLFGAGKMFLPQVVKSARVMKQAVAHL
FT                   IPFIEEEKRKIAAAGGDVRSRGKIVIATVKGDVHDIGKNIVTVVLQCNNFEVVNMGVMV
FT                   PCNDILAKAKVEGADIIGLSGLITPSLEEMAYVASEMQRDEYFRVKKIPLLIGGATTSR
FT                   VHTAVKIAPNYEGPVVYVPDASRSVSVASSLLSDEGAARYVEELHADYDRIRTQHANKK
FT                   ATPMVSLAAARANKTKIDWSNYTPPKPKFIGRRVFRNYDLNELAQYIDWGPFFQTWDLA
FT                   GKFPDILNDEIVGESARRVFSDGKSMLARLIAGRWLTANGVIALLPANTVNDDDIEIYT
FT                   DESRSEVALTWRNIRQQSERPIIDGVMRPNRCLADFIAPKDTGIADYIGLFAVTGGIGV
FT                   EKREKQFEADNDDYSAIMLKALADRFAEAFAECLHARVRRDLWGYAPDETLDNDALIRE
FT                   EYKGIRPAPGYPACPEHTVKRDMFRVLDAQEIGMDLTEALAMTPAASVSGFYLSHPDST
FT                   YFTLGKIGQDQVDDMIARSGEDRAFVERALAPNL"
FT   gene            complement(167380..167733)
FT                   /locus_tag="Rpic_0148"
FT   CDS_pept        complement(167380..167733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0148"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: aav:Aave_3654
FT                   glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25311"
FT                   /db_xref="GOA:B2UDX1"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B2UDX1"
FT                   /protein_id="ACD25311.1"
FT                   /translation="MKARIDSTIPVLASLDLQESARFYTERLGFTQALIADDYLIVQRD
FT                   GTEIHFWLCDDRRIAEHTSCYLRVPSTQALFEEFTARGLELAPPAVRPWGMKELYVIDP
FT                   HGNLLKLGEYAPA"
FT   gene            complement(167735..168775)
FT                   /locus_tag="Rpic_0149"
FT   CDS_pept        complement(167735..168775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0149"
FT                   /product="homocysteine S-methyltransferase"
FT                   /note="PFAM: homocysteine S-methyltransferase; KEGG:
FT                   rso:RSc0295 probable 5-methyltetrahydrofolate--homocysteine
FT                   methyltransferase (methionine synthase, vitamin-B12
FT                   dependent isozyme) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25312"
FT                   /db_xref="GOA:B2UDX2"
FT                   /db_xref="InterPro:IPR003726"
FT                   /db_xref="InterPro:IPR017226"
FT                   /db_xref="InterPro:IPR036589"
FT                   /db_xref="UniProtKB/TrEMBL:B2UDX2"
FT                   /protein_id="ACD25312.1"
FT                   /translation="MTAPLPYTRAANLPALLRERILILDGAMGTMIQRYKLNEAQYRGE
FT                   RFANHPIDVKGNNELLLLTRPDVIREIHEQYLAAGADLIETNTFGATTIAQEDYKMAEL
FT                   AYEMNVVAARLAREACDKYSTPDKPRFVAGAFGPTPKTASISPDVNDPGARNVSFDQLR
FT                   DAYYEQGKALLEGGADVFLVETIFDTLNAKAALFAIDQLFEDTGERVPVMISGTVTDAS
FT                   GRILSGQTVEAFWNSLRHAKPITFGLNCALGAALMRPYIAELAKICDTAVSCYPNAGLP
FT                   NPMSETGFDETPEVTSSLVDEFASAGLVNLVGGCCGTTPEHIKAIADRVANRKPRAWPG
FT                   QYLEAA"
FT   gene            168927..169319
FT                   /locus_tag="Rpic_0150"
FT   CDS_pept        168927..169319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0150"
FT                   /product="Rhodanese domain protein"
FT                   /note="PFAM: Rhodanese domain protein; KEGG: rso:RSc0296
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25313"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:B2UDX3"
FT                   /protein_id="ACD25313.1"
FT                   /translation="MQLLDPPDAHAFLERTPAALFVDCRSEMEHLFVGHPAGAHHVSWN
FT                   DGPHWEVNPEFVPTVRKLTGHGIERPVVLICRSGNRSAAAAHALEEAGFRDVYVVRHGF
FT                   EGDLDSTRHRNTLNGWRHAGLPWEQC"
FT   gene            complement(169433..169690)
FT                   /locus_tag="Rpic_0151"
FT   CDS_pept        complement(169433..169690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0151"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RSc0297 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25314"
FT                   /db_xref="InterPro:IPR021951"
FT                   /db_xref="UniProtKB/TrEMBL:B2UDX4"
FT                   /protein_id="ACD25314.1"
FT                   /translation="MQMIYNSDNYCVVEFGVDGQHAMLSAGGYEIVDKNLKREIFLGGE
FT                   LAEHFREDVKKLIASEPTVEEVDDFLGKFDTVMTQPVTMH"
FT   gene            complement(170010..170849)
FT                   /locus_tag="Rpic_0152"
FT   CDS_pept        complement(170010..170849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0152"
FT                   /product="alpha/beta hydrolase fold"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: rso:RSc0298
FT                   probable B-ketoadipate enol-lactone hydrolase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25315"
FT                   /db_xref="GOA:B2UDX5"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR026968"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B2UDX5"
FT                   /protein_id="ACD25315.1"
FT                   /translation="MDTNALSDSGTVHANHIDIHHRTEGADGPWVVLAHALGVDHQLWD
FT                   SAARRLASRYRVLRYDARGHGKTSAPHGPYTLFQMADDVAGLLDALSIGQVHFVGLSMG
FT                   GMVGQVLGVRHAQRLLSLTLCDTVCYTPASAHVMWDERIGQVEAHGMSGIVEPTIQRWL
FT                   TTPFREAHPDVVERIRGLLRATQPHGYVGTCLAIKALDTRSALARIACPTLVMTGDQDT
FT                   GAPVEAAREIATHIPDARLKVIPHAAHLAPIEQEEGFLADLDEFLGHAGCGSQCDTP"
FT   gene            complement(170851..171933)
FT                   /locus_tag="Rpic_0153"
FT   CDS_pept        complement(170851..171933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0153"
FT                   /product="putative proline-rich signal peptide protein"
FT                   /note="KEGG: rso:RSc0299 putative proline-rich signal
FT                   peptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25316"
FT                   /db_xref="InterPro:IPR021457"
FT                   /db_xref="UniProtKB/TrEMBL:B2UDX6"
FT                   /protein_id="ACD25316.1"
FT                   /translation="MQPRRRRFYRLGRFGLVLLAVLVLHVVAVVWIARSRQVTWPPAPE
FT                   QIIPALLLHPEPVQPPPPPAAPKLRPAPPRPRSQTPPAPAPTPTSPAPDLASMDPSEFT
FT                   SAGAQASGDTGVVKDLSGEGPGGPPAPPGDAFSLPPSTTLRYATYVNGVRNEDGVIRWA
FT                   TDGKSYTLAVEIPLPLFFGKLAFRSAGTVGPYGLTPARYEEERGRRQPDVTTFHYATDS
FT                   IPASGAQSAPTVTFTRSPAVLPLPEGTQDRFSVFLQLTGLARGGPARIASPGLTLEFPI
FT                   ADTDSVEVARVQHVGEETIDTPNGTIRAQHFIRLPRRADDKRRVEIWLSPDRGWLPVRL
FT                   RQTEPNGMQFDLVYQSQEGG"
FT   sig_peptide     complement(171847..171933)
FT                   /locus_tag="Rpic_0153"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.980) with cleavage site probability 0.885 at
FT                   residue 29"
FT   gene            complement(171953..172831)
FT                   /locus_tag="Rpic_0154"
FT   CDS_pept        complement(171953..172831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0154"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="PFAM: regulatory protein IclR; Transcriptional
FT                   regulator IclR; KEGG: rso:RSc0300 probable transcription
FT                   regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25317"
FT                   /db_xref="GOA:B2UDX7"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2UDX7"
FT                   /protein_id="ACD25317.1"
FT                   /translation="MTMPPLPADTDLDLEPDADGELDAPARSGIQSIEVGFRLLEVLTH
FT                   TTGPMMLRDLARAAPMNPAKAHRYLVSFARLGLVTQTPEGRYDLGPFALEMGLVSLNRQ
FT                   DPMRRARPAAAALRDEIDHTVGLAVWGNQGPAIVHWEEASHPVTVSLRLGDVMPMLNSA
FT                   TGRVFGAYLPRAQTRSFIQRELDRIAAQGESADSENPELPQTLEAYDAICADVRLRGVS
FT                   RIHGGVLPGINAMSLPVFDANGQLCLVLIALGAQSTFDTTWSSPLERRLRLAAQQLSAD
FT                   LGYVAPNAPQC"
FT   gene            172908..173900
FT                   /locus_tag="Rpic_0155"
FT   CDS_pept        172908..173900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0155"
FT                   /product="fumarylacetoacetate (FAA) hydrolase"
FT                   /note="PFAM: fumarylacetoacetate (FAA) hydrolase; KEGG:
FT                   rso:RSc0301 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25318"
FT                   /db_xref="GOA:B2UDX8"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="InterPro:IPR041072"
FT                   /db_xref="UniProtKB/TrEMBL:B2UDX8"
FT                   /protein_id="ACD25318.1"
FT                   /translation="MKLATLKDGSRDGQLAVVSRDLKTAHFATHIAGTLQRALDDWAFH
FT                   APQLQDLYDQLNAGRARHPFAFDAANCMAPLPRAYQWADGSAYLNHVELVRKARGAEMP
FT                   PEFWTDPLMYQGGSDDLAGAHDPIVCRSEAFGIDFEAEVAVITGDVPMGTEAAAAAEGI
FT                   RLIVLANDVSLRNLIPAELGKGFGFFQSKPATSFSPVAVTPDELGDAWRERKVHLPMTV
FT                   RWNNKKVGQPECGTDMVFDFGQLIAHICKTRNVRAGSIVGSGTISNVDRSKGYACIAEK
FT                   RMLETIESGAPITEYMRYGDTVKIEMFDANGVSIFGAIDQEVVAPGTQA"
FT   gene            complement(173909..174817)
FT                   /locus_tag="Rpic_0156"
FT   CDS_pept        complement(173909..174817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0156"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="PFAM: regulatory protein IclR; Transcriptional
FT                   regulator IclR; KEGG: rso:RSc0302 probable transcription
FT                   regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25319"
FT                   /db_xref="GOA:B2UDX9"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2UDX9"
FT                   /protein_id="ACD25319.1"
FT                   /translation="MPIDAPLPPVTSPHELAAEDATPERTSAGIQSAEIALSVLSAMAH
FT                   AGGAHAVSELGRQLGMPRAKVHRYLVSLERMGFVEQDPASARYRLGAQALQVGLSALSD
FT                   VDFVREGSNLLPKLAERLNESVFLSIWTARGPVIVRWEDSGRPVAVNVRVGSVMPLLNS
FT                   ATGQACAAWVPEIQIVSLIDRELRGPGAGKAGLTDWLNCRARWQAVRQEGVARIGGTLV
FT                   HGIDSVAVPVLDSQGKLAGAITALGLSSVFDSSLEGPAARLLREAGRTLSLRLGYHGQA
FT                   LMAGAAAPKRGRRPRTTPESA"
FT   gene            174921..175925
FT                   /locus_tag="Rpic_0157"
FT   CDS_pept        174921..175925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0157"
FT                   /product="Luciferase-like monooxygenase"
FT                   /note="PFAM: Luciferase-like monooxygenase; KEGG:
FT                   sso:SSO1532 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25320"
FT                   /db_xref="GOA:B2UDY0"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:B2UDY0"
FT                   /protein_id="ACD25320.1"
FT                   /translation="MKLSIFSVQDHYPDRPRSLPQLYADVIAQARHAEALGYDTFWVAE
FT                   HHFHEYGAVPNPAVFLSHLAAQTQRLRLGTAISILTFHHPATVAENYAMVDALSGGRLS
FT                   LGVGSGYLKHEFEGYDVDPAIKRERFDEALMLVERLLAGERVHHAGQFHTLRDVRLNVL
FT                   PVQARVPIHVAILRREAAYHIGRQGRRMLFVPYASVESFEDIRTLMDEYRRGLAEAGIA
FT                   DTRGMAAVALHTHVGPTEAAVRATAADAFDLYVATRLYARRQTYDDVLASGLSLFGTPD
FT                   AVAEKLAQLSDMGVDHVMALHNFGLMPQSAVLESMRALVEDALPRAGITALAA"
FT   gene            176010..177173
FT                   /locus_tag="Rpic_0158"
FT   CDS_pept        176010..177173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0158"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   bxe:Bxe_A4234 ABC branched chain amino acid family
FT                   transporter, periplasmic ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25321"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B2UDY1"
FT                   /protein_id="ACD25321.1"
FT                   /translation="MQRPKWRHAGVLAGLALLSSAALADIRVGVTVSATGPQASLGQPE
FT                   KNATTLWPSEIGGEKVDVIVLDDASDTTRAVTNTRKLMSESNVDVIVGSSTTPNTLAMI
FT                   DAAAEGKTPVISLASSARLIEPMDAKRRWIFKTPHSDSHMASLIAEHAAAHGVKTIAYI
FT                   GFANALGEAFLTEVQRFADLKHIRVTDTERFSPTDNSVTAQVLHLLANKPDAVVIGGSG
FT                   TPAALPARALAERGYTGKIYFNHGVSNNDFVRLCGKDCEGAYVPTGPVMVAAELPDTNP
FT                   AKRQALDFARRYEATFGRGSVSIFAAYTGDIGLLLQRAVPVALKRAKPGTPAFREALRD
FT                   ALEQVHDLPTSTGVVNMSPQDHVGLDQRARVMAQIRRGQWHLADAAK"
FT   sig_peptide     176010..176084
FT                   /locus_tag="Rpic_0158"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 25"
FT   gene            177254..178072
FT                   /locus_tag="Rpic_0159"
FT   CDS_pept        177254..178072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0159"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   rso:RSc0304 enoyl-CoA hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25322"
FT                   /db_xref="GOA:B2UDY2"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:B2UDY2"
FT                   /protein_id="ACD25322.1"
FT                   /translation="MTSLAPRFARYQALTLIQHGPILEIVMGAAQSANRKLSTADAGLH
FT                   RELAEIWRDVSAEPSVRVALIRGEGKGFSAGGDLHLVEQMADDFDVRTRVWHEARDLVY
FT                   NVINCDKPIVSAMHGPAVGAGLVAGLLADISIAAKDARIVDGHTRLGVAAGDHAAIVWP
FT                   LLCGMAKAKYYLLLCESMTGEEAERIGLISLAVPESELVNRAFEVAERLAAGSQTAIRW
FT                   TKYALNNWLRLAGPSFDTSLALEFMGFAGPDVREGIASLRQKRPPTFDGA"
FT   gene            178129..179022
FT                   /locus_tag="Rpic_0160"
FT   CDS_pept        178129..179022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0160"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RSc0305 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25323"
FT                   /db_xref="UniProtKB/TrEMBL:B2UDY3"
FT                   /protein_id="ACD25323.1"
FT                   /translation="MFTQMPNFAEGGFDFLRKLWGGGFSGMAGGGMPNMASFAAPPMDL
FT                   EEIDKRIHDLRAVESWLQLNASLLRTAIQGLEVQRATLVALQTFGSALSPEAMKSAFDG
FT                   LTPSASSSSSSSSSGEESKPAWPHTAATAKPDDEPPPEDEDEAEEDTDDDQAEARAEAA
FT                   HAQAQAAAQAQAAARAAAAALDPSPWWNMLQQQFNQIASSAAAAMPMPQNLMPGFPGGF
FT                   PGFGGAPGAEGLDAAPEDIEEPTAPAKPKRAAAKAMPKPAAKASAGRTAKPATKKTAAK
FT                   KAPAKSVPRKPTNDTP"
FT   gene            179053..180210
FT                   /locus_tag="Rpic_0161"
FT   CDS_pept        179053..180210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0161"
FT                   /product="Patatin"
FT                   /note="PFAM: Patatin; KEGG: rso:RSc0306 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25324"
FT                   /db_xref="GOA:B2UDY4"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:B2UDY4"
FT                   /protein_id="ACD25324.1"
FT                   /translation="MMGGGARAAYQVGVLRGIAGLAREYAPGVARTPFDVICGTSAGAI
FT                   NSLGLARGAQDFTLATEALTQLWGTLHADRVYRTDVGRVGSSGARWLTALAFGWMTGHT
FT                   PRALFDNTPLRELLESQHDGEQVQAAFDAGALRALAITALSYTTGRHVTFYQSPHVVLP
FT                   WRRSQRIAVSDEIGVSHMLASSSIPFVFPAEPVPLEGNDEWFGDGTMRQMSPLSPAIHL
FT                   GANRILVVGAASRSQPGWYDTVPASGYPSLAQIAGQALASIFLDGLSADIERLQHVNAM
FT                   VARNPEIADARDGWRKIEVLVMAPSERIELIASRHVQRLPGTVRALLKPLGGTEARGAA
FT                   FASYLLFEPEFTQELIDLGERDVQARRDELAAFLYGAIPDTMRAA"
FT   gene            complement(180211..180906)
FT                   /locus_tag="Rpic_0162"
FT   CDS_pept        complement(180211..180906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0162"
FT                   /product="glutathione peroxidase"
FT                   /note="PFAM: glutathione peroxidase; KEGG: rso:RSc0307
FT                   putative glutathione peroxidase transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25325"
FT                   /db_xref="GOA:B2UDY5"
FT                   /db_xref="InterPro:IPR000889"
FT                   /db_xref="InterPro:IPR029759"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B2UDY5"
FT                   /protein_id="ACD25325.1"
FT                   /translation="MLFPATVSMRRPRLQLHASGVLRRHHLLMIAIAIAIAVIALLLPR
FT                   TGHAVTAGVAPAAQTPTTPGACPASLNFRVKRLQDDAPQDLCQYAGRVVLVVNTASYCG
FT                   YTHQYEGLEALYAKYRDKGLTVLGFPSNDFQQEPGNSKQIADFCYNTYGVKFPMFSKTA
FT                   VVGAGASPLYAWLATQTGQPPKWNFHKYLLDRTGRVAAVFPSSVEPSDPALIKRIDALL
FT                   AEPSTRSSR"
FT   sig_peptide     complement(180757..180906)
FT                   /locus_tag="Rpic_0162"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.952) with cleavage site probability 0.908 at
FT                   residue 50"
FT   gene            181310..182164
FT                   /locus_tag="Rpic_0163"
FT   CDS_pept        181310..182164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0163"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RSc0308 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25326"
FT                   /db_xref="GOA:B2UDY6"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="UniProtKB/TrEMBL:B2UDY6"
FT                   /protein_id="ACD25326.1"
FT                   /translation="MLYPELFKSLEAVRWNMEKDIPWDTFDASLLTDAQAQTIKMNAIT
FT                   EWSALPATEMFLRDNRHDSDFSAFMSVWFFEEQKHSLVLMEYLRRFRPELVPTEEELHN
FT                   VRFEFDPAPPLETLMLHFCGEIRLNHWYRRASEWHTEPVIKAIYKHLSQDEARHGGAYL
FT                   RYMKKYLGQFGDSARSAFAKIGVLMASARRTEKPLHPTNLHVNKALFPQDTVQSRLPNP
FT                   DWLEHWLDEQIKFDAGWEKKVIERILHNMGLLFERTFETVQDLNRYRKELNARLLGSAE
FT                   QAA"
FT   gene            182200..182736
FT                   /locus_tag="Rpic_0164"
FT   CDS_pept        182200..182736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0164"
FT                   /product="rfaE bifunctional protein"
FT                   /note="TIGRFAM: cytidyltransferase-related domain protein;
FT                   rfaE bifunctional protein; PFAM: cytidylyltransferase;
FT                   KEGG: rso:RSc0309 putative transferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25327"
FT                   /db_xref="GOA:B2UDY7"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR011914"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:B2UDY7"
FT                   /protein_id="ACD25327.1"
FT                   /translation="MGRFVFHPDFGSTMTARQPAPAFEQKICDSADVQARVRALPRPLV
FT                   FTNGVFDILHRGHATYLAQARALGASLVVGVNTDASVRMLGKGDDRPLNTQDDRLAVLA
FT                   ALEAVSLVVLFAERTPVELIQRVRPDIYVKGGDYDIDALEETRVVRSWGGTALAIPFEH
FT                   DRSTTALLKRVRATS"
FT   gene            complement(182741..183526)
FT                   /locus_tag="Rpic_0165"
FT   CDS_pept        complement(182741..183526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0165"
FT                   /product="Sporulation domain protein"
FT                   /note="PFAM: Sporulation domain protein; KEGG: rso:RSc0310
FT                   putative signal peptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25328"
FT                   /db_xref="GOA:B2UDY8"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:B2UDY8"
FT                   /protein_id="ACD25328.1"
FT                   /translation="MTLRLALLILLLVNGVLLAANTGVFGPEVSKAWFESEREPDRMRR
FT                   QIRTEEIRILEPAPAAAPAAGVPKSAPGSSPAGSAPAASGSQANIEPAALTTAAIAESG
FT                   GSCTELGGLTEAQATRGIDQLKQLAGVQVERITRQEDNRWWVHMPARDTRDDAERKVAE
FT                   LKRRNVADSAIVQEANTFVVSLGLFRDKERAQQRLDELRAKDVRTAVVTQTRRLGSQTS
FT                   LRVSATADAASGVAAQLAALKKTLGAEDLHACAAVTASR"
FT   sig_peptide     complement(183467..183526)
FT                   /locus_tag="Rpic_0165"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.989 at
FT                   residue 20"
FT   gene            complement(183629..184510)
FT                   /locus_tag="Rpic_0166"
FT   CDS_pept        complement(183629..184510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0166"
FT                   /product="putative transcriptional acitvator, Baf family"
FT                   /note="TIGRFAM: transcriptional activator, Baf family;
FT                   PFAM: Bvg accessory factor; KEGG: rso:RSc0311 pantothenate
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25329"
FT                   /db_xref="GOA:B2UDY9"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/TrEMBL:B2UDY9"
FT                   /protein_id="ACD25329.1"
FT                   /translation="MTRLKVSAAHAAPARPLLLIDAGNTRIKWAWIAGGADAEPALPEE
FT                   PGGTPWQHAGARAHDRLAELVEDWRDCHASGVAPPEVWISAVAGPALRDALTARIARVF
FT                   DGARVCIAASEDATAGLRNGYRDPTQLGTDRWIGAVGARHLWPDTALLLVTAGTATTLD
FT                   IVTPDGLFAGGLILPGLTLMMHALSRNTAQLPEVDVGYLSAGDVVAPPWADNTQDAIAL
FT                   GCVIAQAGAIAQTWQALQKQYPGPARCVLSGGARAALGPHLRMPFQMHDNLVLLGLQVL
FT                   ARARREGAATLA"
FT   gene            complement(184507..185388)
FT                   /locus_tag="Rpic_0167"
FT   CDS_pept        complement(184507..185388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0167"
FT                   /product="biotin/acetyl-CoA-carboxylase ligase"
FT                   /note="TIGRFAM: biotin/acetyl-CoA-carboxylase ligase; PFAM:
FT                   biotin protein ligase domain protein; biotin/lipoate A/B
FT                   protein ligase; KEGG: rso:RSc0312 biotin--protein ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25330"
FT                   /db_xref="GOA:B2UDZ0"
FT                   /db_xref="InterPro:IPR003142"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="UniProtKB/TrEMBL:B2UDZ0"
FT                   /protein_id="ACD25330.1"
FT                   /translation="MSLAEPSAGWRLARERIQPSGPAAGWPVDVVEATGSTNADLMAAV
FT                   RDATWPAYTATPAHAGNAPLVGARVLAAQRQTAGRGRQGRPWDGDHGLTFSIACAFAGE
FT                   PAQLGGLSLAVGVAVVEAVAGYAEARGGSGQALSLKWPNDVQIAGRKLAGILVETVRTA
FT                   PGRTWTVIGIGLNLERPHVLETTLGRGLSGVEELVDAPEANAVFSALLTSLGEHLQRFG
FT                   LQGLAPFVAPFAARDAFAGERVRLWQDGSVVLEGVAHGIDAQGRLAIESGGRVQWIHSG
FT                   EVSLRSADAEQP"
FT   gene            185574..186698
FT                   /locus_tag="Rpic_0168"
FT   CDS_pept        185574..186698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0168"
FT                   /product="protein of unknown function DUF140"
FT                   /note="PFAM: protein of unknown function DUF140; KEGG:
FT                   rso:RSc0313 probable transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25331"
FT                   /db_xref="GOA:B2UDZ1"
FT                   /db_xref="InterPro:IPR003453"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:B2UDZ1"
FT                   /protein_id="ACD25331.1"
FT                   /translation="MITFRTPQLEVRVVDGRSVAFLSGDWTTLALAERAGVRSARQQIR
FT                   AGLDNANAWCLTEVGRIDHFGAQLLWRAWGNQWPEHLDARPDQRRMLDRVAKLDPGGWK
FT                   QRLAPRMNPVAILGEGMLDFFDHAGNGIAMVGQLVFDLGRFVRAPHRGPWREISANIYS
FT                   TGYKALGITALVGFLIGIVLSYLSANQLRVFGASIFIVNILGMAIIRELGPVLAAILVA
FT                   GRSGSAITAQIGVMRVTEELDAMRVMGISHGFRLILPKVIALAIAMPLLVAWTDLLALA
FT                   GGILAAKFQLDISPTYFITSLPDAVPVANLWLGIGKGVVFGMLIALVACHFGLRIQPNT
FT                   QSLGEGTTTSVVVSITIVILADAVFAILFKDVGI"
FT   gene            186695..187573
FT                   /locus_tag="Rpic_0169"
FT   CDS_pept        186695..187573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0169"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: rso:RSc0314 probable ATP-binding ABC transporter
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25332"
FT                   /db_xref="GOA:B2UDZ2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2UDZ2"
FT                   /protein_id="ACD25332.1"
FT                   /translation="MTRPRHPHIKHAAEPAAITPARERVIEMRNVTKRYGKVTVLDNID
FT                   LDVFRGEVLSIVGGSGSGKTTLLRQVVGLEKPSSGTIHIFGEELTCQVGNDLQSMRNRW
FT                   GMQFQHGALFSALSVIDNVALPMRELRTLPDAFIQRVAMLKLQMVGLKSTDADKMPSDL
FT                   SGGMIKRVALARALSLEPELVFLDEPTAGLDPRASDDYVALIRELRQELGLTVVMVTHD
FT                   LDTLVALSDRIAVLADRKVVAAKPLDQIIQIDHPFIKEYFLGERGKRALLALGSQMTEA
FT                   VAAASLSTQED"
FT   gene            187573..188541
FT                   /locus_tag="Rpic_0170"
FT   CDS_pept        187573..188541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0170"
FT                   /product="Mammalian cell entry related domain protein"
FT                   /note="PFAM: Mammalian cell entry related domain protein;
FT                   KEGG: rso:RSc0315 probable signal peptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25333"
FT                   /db_xref="GOA:B2UDZ3"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="UniProtKB/TrEMBL:B2UDZ3"
FT                   /protein_id="ACD25333.1"
FT                   /translation="MENKAHAFLAGLFTIGLIIFIGLAVMWFNRDQTVRLPYDVVTRST
FT                   VNGLNPQASVKYRGLDVGKVDSIRFDDKVPGQIVVRVLVDKDAPITTTTYGRLAYQGVT
FT                   GLAYVQLDDRGFDNSKRAPSPVRLATSDKDPARIRMEAGFLDELDKRGDQMLSKLDQTL
FT                   NSLSIMFDDEHRQQVTASLQSFQKTMDAYSTLAQQAEPTMRRLPQIADNLDSTLVATRK
FT                   LTQSLSDPKGPLMSTLSGAGTDLTAATQSMQSAANVLTYETLPQLNGFAREARQAVRGF
FT                   DHAVTDFNARPQSVLFGPAPGAPDPGETGFTAPAARASAQP"
FT   gene            188551..189216
FT                   /locus_tag="Rpic_0171"
FT   CDS_pept        188551..189216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0171"
FT                   /product="putative lipoprotein"
FT                   /note="KEGG: rso:RSc0316 probable lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25334"
FT                   /db_xref="InterPro:IPR005586"
FT                   /db_xref="UniProtKB/TrEMBL:B2UDZ4"
FT                   /protein_id="ACD25334.1"
FT                   /translation="MPMLSAVFRRACALPALMALSLLAACSSAPVAPAALYDFGLAPAA
FT                   SAGARLPTALRVADVAGPGWMDGNAIYYRLAYAQGQRTDAYANSRWVESPVSLFDARLR
FT                   NAAAGRGQVIGYPTPDVPSLRVELVDFSQVFDRPDASRGVVRLRATVSLARGVIDQRVV
FT                   QADAPAPSPDAAGGVAALTQASDKAIGEVLDWVAGLPLAASASSTPATPGAALGTRRR"
FT   sig_peptide     188551..188637
FT                   /locus_tag="Rpic_0171"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.485 at
FT                   residue 29"
FT   gene            189255..190520
FT                   /locus_tag="Rpic_0172"
FT   CDS_pept        189255..190520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0172"
FT                   /product="VanZ family protein"
FT                   /note="PFAM: VanZ family protein; KEGG: rso:RSc0317
FT                   probable transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25335"
FT                   /db_xref="GOA:B2UDZ5"
FT                   /db_xref="InterPro:IPR006976"
FT                   /db_xref="UniProtKB/TrEMBL:B2UDZ5"
FT                   /protein_id="ACD25335.1"
FT                   /translation="MRGIGRYDGRLFPATSAPLSSSLLPVTDFHSQPAAPTQHRHSPLA
FT                   RAGLGWFVLLVVYASLYPFAGWTDTGVSPFAFLSAPLPRYNTAFDMLTNVWGYMPLGML
FT                   TVLALHPRITGWRAVLLALLAGLLLSGAMEAIQTYLPTRVSSNVDLATNTLGALLGGLV
FT                   MLPFAARLIDRGGLRRLRRRWFEPHATFAILLMLVWPFAQIFPQEFLFSMGGVIRSILL
FT                   DPSPDAFVVNLVNGWFPELFDWQDKLTAHPEALQRQELLEALITACSWIGTGLLASVAM
FT                   RSGAPMLRLLAALLAGALLVKAGATVLQFPLGGAWDWLSSGARFGLIVGSLVLVLLVRL
FT                   PRWLRGALAMTLLIALIILSNVLPPSPYSWVSAQSWRLGRFVHFNSLSQWIGWLWPFLG
FT                   LGYLAWRAEQTQLQRRAGRHAR"
FT   gene            complement(190508..191752)
FT                   /locus_tag="Rpic_0173"
FT   CDS_pept        complement(190508..191752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0173"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   reu:Reut_B3681 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25336"
FT                   /db_xref="GOA:B2UDZ6"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2UDZ6"
FT                   /protein_id="ACD25336.1"
FT                   /translation="MSPATPVDAWREAIRWLLVIQALSMGAMEMTGPFWPLFLRELSPV
FT                   PHVPFAWVASAAYFAPMAATLVTAPWWGRLADRVGPKPMILRALIALAASQLWSVHADS
FT                   AASVLLARTVQGGLAGFLAAAQIYAMRVAPADMRRRVFADLQTVTACGSFMAPPVGAWL
FT                   VSWMGFRMANTAGAVVILACVPLAMFCLPGIGPAPRSASKSTSDMLQSRHAPLSGLVIG
FT                   LLLGTVAVQAARVMPQGFLAPYITETLHGSVILAGLAYSATAATLALSARWWAKRFAGL
FT                   PVHVTLGRVCALTAVCGVTALWQGLAQGEVGFIAARLAWGLCLGGLLPVLNSLVAETSP
FT                   EDRQGFALGLCSSAAKGGALVGLGVAAWSTGVFGWRAGFVAMAAMYLAALAALIAVRRA
FT                   ASPHPASAAAGTQRA"
FT   gene            complement(191749..193716)
FT                   /locus_tag="Rpic_0174"
FT   CDS_pept        complement(191749..193716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0174"
FT                   /product="IucA/IucC family protein"
FT                   /note="PFAM: IucA/IucC family protein; KEGG: bbt:BBta_0635
FT                   putative siderophore biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25337"
FT                   /db_xref="GOA:B2UDZ7"
FT                   /db_xref="InterPro:IPR007310"
FT                   /db_xref="InterPro:IPR022770"
FT                   /db_xref="InterPro:IPR037455"
FT                   /db_xref="UniProtKB/TrEMBL:B2UDZ7"
FT                   /protein_id="ACD25337.1"
FT                   /translation="MQRRSDTAAHTETASAAAAAGNLRLESIPALRDAGVQTEHWSAAQ
FT                   QLARCRVLSRLLQALFREALLSADRLIADTRADVTLLPIWQQRVLLRFTGLRPGALGSW
FT                   TLTGDVAVLAHDRPPTPIERPSALLHWLAPMLDMGDAAEAHRLAAIDRLAAELDNSQDN
FT                   DTLCQAYRLAWGARLAAEHRTAAWQDALALLCGDGTPHALARTEQWGTGGHPWHPAYKT
FT                   RLGLAPDQVIALSPEFEAQVPLGVVAVAAHRLQVTTMDGVQPYANWFAAAFPQTMAAFR
FT                   KALLARQLAPEAWLPLPVHPWQRDTTLGETFAAEFAAGELIRLPDINIAARPTMSFRTV
FT                   AATDAPGGAMLKLPVSMRLTSVERTVSPKSAVMGPRVSALLERILANDAALASVLSIVP
FT                   ERHGIHLAGTDDERARHLSMIVRDNPTTRIAGNARLLPVGALFTPDFTADMTHAAAPLL
FT                   LDTVLARQADGTRAERAARFFDAYLHVAIPAIVGLYLRYGIALEAHQQNTFVVIDEAGM
FT                   PVRLVVRDFGDVKIALPTLQAQGFSIEPFRAGHTTYPDRDIPRKKLIHAFLLCHIGELA
FT                   LALFPEHGSAVGLRQWHDAMQAVFEANRTALDADTWKQERHALLEAPWSFKTFVRMRLR
FT                   DQSDDMHAALPNPLADAVRT"
FT   gene            194325..196427
FT                   /locus_tag="Rpic_0175"
FT   CDS_pept        194325..196427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0175"
FT                   /product="phospholipase C, phosphocholine-specific"
FT                   /EC_number="3.1.4.3"
FT                   /note="KEGG: rso:RSc0319 probable non-hemolytic
FT                   phospholipase C (phosphatidylcholine
FT                   cholinephosphohydrolase) signal peptide protein; TIGRFAM:
FT                   phospholipase C, phosphocholine-specific; PFAM:
FT                   phosphoesterase; protein of unknown function DUF756"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25338"
FT                   /db_xref="GOA:B2UDZ8"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR007312"
FT                   /db_xref="InterPro:IPR008475"
FT                   /db_xref="InterPro:IPR017767"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:B2UDZ8"
FT                   /protein_id="ACD25338.1"
FT                   /translation="MTSNSRRGFLRSAAQLAAASAAMGAVPEGIRQALAIPAHNAHRNI
FT                   EDVQHIVILMQENRSFDHYFGTLRGVRGYGDTRTVTLPSGKSVWHQPVAGGAGEVLPFR
FT                   PSAPDLGLQFLQDLPHGWNDTHLAVNGGRYDGWVPHKGTTTMAYLTRQDIPFHYALADA
FT                   FTICDAYHCATPTSTDPNRYYMWTGYVGNDNVGGGPVIDNAEAGYGWSTYPEVLEAAGI
FT                   SWKIYQDIGTGLDAAGSWGWTSDAYIGNYGDNSLLYFKQYQNAQPGNPLYDKARTGTNA
FT                   AAGEGYFDILKRDVQNGTLPQVSWIAAPEAFSEHPNWPANYGAWYIDQVLQILTSNPEV
FT                   WSKTAVFVTYDENDGFFDHLVPPFASSGSNGLSTVDTTGEYFPGNSTYGAGSYGLGQRV
FT                   PMLVVSPWSKGGYVCSETFDHTSIIRFIEQRFKRTHNVRSPNISKWRRAVCGDLTSAFN
FT                   FATPNEVVPALPSTAAYVPKDKLRHASYVPLPPLVQAVPKQEAGVRASRALPYELFVRG
FT                   RQDEAAGKFQLEFVNTGDVGAAFLVYTAGSTDAPRTYTVEAGKRLSDKLAVNAGGAYDF
FT                   TVHGPNGFLRRFVGKLTLSGLLSPHGHALEVKEGYDVANGNLQLRLINHGRAPTVFTIK
FT                   SAYTGESVQREVRGGDDASVYLDLRSHHAWYDLTVTASTDAGFARRLAGHVETGRVSAS
FT                   DPALSA"
FT   sig_peptide     194325..194399
FT                   /locus_tag="Rpic_0175"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.979 at
FT                   residue 25"
FT   gene            complement(196502..196612)
FT                   /locus_tag="Rpic_0176"
FT   CDS_pept        complement(196502..196612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0176"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25339"
FT                   /db_xref="GOA:B2UDZ9"
FT                   /db_xref="UniProtKB/TrEMBL:B2UDZ9"
FT                   /protein_id="ACD25339.1"
FT                   /translation="MTHYWGYPFADVLAIVVIVGLSALALYQAHTYTKQL"
FT   gene            196922..197383
FT                   /locus_tag="Rpic_0177"
FT   CDS_pept        196922..197383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0177"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RSc0320 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25340"
FT                   /db_xref="UniProtKB/TrEMBL:B2UE00"
FT                   /protein_id="ACD25340.1"
FT                   /translation="MNTRLAIAFSRHTLVALVATVSASAALLSAQPAAAAVQSSADPYT
FT                   QGAVAKADPYTQGAAAKYDVYTQGADRQADTYGYLSWKNDRFDPYTQGAVGKADPYTDG
FT                   AIAKADPYTDGAAAKYDVYTQGADRQADTYGYLSWNGDASYPKDAASQA"
FT   sig_peptide     196922..197029
FT                   /locus_tag="Rpic_0177"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.967 at
FT                   residue 36"
FT   gene            complement(197460..198461)
FT                   /locus_tag="Rpic_0178"
FT   CDS_pept        complement(197460..198461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0178"
FT                   /product="lipoic acid synthetase"
FT                   /note="KEGG: rso:RSc0322 lipoyl synthase; TIGRFAM: lipoic
FT                   acid synthetase; PFAM: Radical SAM domain protein; SMART:
FT                   Elongator protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25341"
FT                   /db_xref="GOA:B2UE01"
FT                   /db_xref="InterPro:IPR003698"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR031691"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2UE01"
FT                   /protein_id="ACD25341.1"
FT                   /translation="MTDSAAGATEVATPATPSNKPYDATAKQKSLDKTARIPIKIVPAE
FT                   KLKKPDWIRVRAATGNSRFYEIKDILRANNLVTVCEEASCPNIGECFGKGTATFMIMGD
FT                   KCTRRCPFCDVGHGRPDPLDVNEPENLAKTIAELKLNYVVITSVDRDDLRDGGAQHYVD
FT                   CISRTRALSPATRIEVLVPDFRGRLEKALDILQECPPDVMNHNLETVPRLYKQARPGAD
FT                   YAHSLKLLKDFKARNPNVPTKSGLMVGLGETDEEILEVMRDMREHDIDMLTIGQYLAPS
FT                   GHHLPVLRYVHPDTFKMFEEKAYEMGFTHAAVGAMVRSSYHADQQAHEAGVV"
FT   gene            complement(198504..199193)
FT                   /locus_tag="Rpic_0179"
FT   CDS_pept        complement(198504..199193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0179"
FT                   /product="lipoate-protein ligase B"
FT                   /note="TIGRFAM: lipoate-protein ligase B; PFAM:
FT                   biotin/lipoate A/B protein ligase; KEGG: rso:RSc0323
FT                   lipoyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25342"
FT                   /db_xref="GOA:B2UE02"
FT                   /db_xref="InterPro:IPR000544"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR020605"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2UE02"
FT                   /protein_id="ACD25342.1"
FT                   /translation="MIPIDIVERGLQDYAACFDEMQTFTARRGPDTPDTIWLVEHPPVF
FT                   TLGLAGDPAHLLAPGNIPLVKVDRGGQITYHGPGQVVAYLLLDLRRRGLFVKALVDAIE
FT                   AAVIQTLATYNVASERKAGAPGIYLSSGPHAGAKIAALGLKIRNGCSYHGVSLNLAMDL
FT                   SPFTQINPCGYAGLETVDMVTAGARDASGRAVDANDWQTVSRDLANALVAQLQQRAQAH
FT                   PAEAATA"
FT   gene            complement(199354..199713)
FT                   /locus_tag="Rpic_0180"
FT   CDS_pept        complement(199354..199713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0180"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RSc0324 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25343"
FT                   /db_xref="InterPro:IPR021317"
FT                   /db_xref="UniProtKB/TrEMBL:B2UE03"
FT                   /protein_id="ACD25343.1"
FT                   /translation="MKAVLTKIVFTLQPGEVVALRMPANQNLRVEEACGRDVWVTHENK
FT                   AGDEWLRAGGSVAVKRGEEIVVSVDPKALGPVALAVEATDGHMPRKPWHVTNGWRHTLA
FT                   ALGWNEHADTPIVAA"
FT   gene            199864..200826
FT                   /locus_tag="Rpic_0181"
FT   CDS_pept        199864..200826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0181"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: rso:RSc0325 probable transcription
FT                   regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25344"
FT                   /db_xref="GOA:B2UE04"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2UE04"
FT                   /protein_id="ACD25344.1"
FT                   /translation="MTEIREPMRLPSLGALRVFEAAARYESFSRAATELFVTHGAVSHQ
FT                   MRTLEDELGVPLFERRGKRVMLTHAGRAYADRVREALDQIAQATHQLRAGNRDNRLAIS
FT                   TMPSFAARWLTPHIGTFIERHPELEVELFSSPALVDFAREEVDVALRMGSGNYPGLYVE
FT                   KLLDDVFFPICSPSFNGGRLPRTLAEMASMTLLRSEGEAWKPWFDAAGLEGFVEPRGGL
FT                   MFQDSSLLLQAAAAGQGIALIRPTLAFNELLAGRVVRLFETTIPCPWNYYFVCPHSALQ
FT                   TPKMQAFRTWLLPEIAAFKLKLAGLMNDNAVCLGHVSKG"
FT   gene            complement(200916..201215)
FT                   /locus_tag="Rpic_0182"
FT   CDS_pept        complement(200916..201215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0182"
FT                   /product="protein of unknown function DUF493"
FT                   /note="PFAM: protein of unknown function DUF493; KEGG:
FT                   rso:RSc0326 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25345"
FT                   /db_xref="InterPro:IPR007454"
FT                   /db_xref="InterPro:IPR027471"
FT                   /db_xref="UniProtKB/TrEMBL:B2UE05"
FT                   /protein_id="ACD25345.1"
FT                   /translation="MTSSHTPPPGHIPPEQSLIEYPSDFPIKVMGPMHDDFAATIVEVV
FT                   RLHDPEFHEGRLEKRPSSSGNYLGLTVIVRATSREQLDALYQALTSHPMVKIVL"
FT   gene            complement(201236..202438)
FT                   /locus_tag="Rpic_0183"
FT   CDS_pept        complement(201236..202438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0183"
FT                   /product="Serine-type D-Ala-D-Ala carboxypeptidase"
FT                   /EC_number="3.4.16.4"
FT                   /note="PFAM: beta-lactamase; peptidase S11
FT                   D-alanyl-D-alanine carboxypeptidase 1; Penicillin-binding
FT                   protein 5 domain protein; KEGG: rso:RSc0327 probable
FT                   penicillin-binding (D-alanyl-D-alanine carboxypeptidase)
FT                   transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25346"
FT                   /db_xref="GOA:B2UE06"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR012907"
FT                   /db_xref="InterPro:IPR015956"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="InterPro:IPR037167"
FT                   /db_xref="UniProtKB/TrEMBL:B2UE06"
FT                   /protein_id="ACD25346.1"
FT                   /translation="MQTRFAHFTPFAFHSAAATAVAAAVLVTALPAMAQPVPAPQVAAR
FT                   SWMLTDVTSGQVLGGANMDERIEPASLTKLMTAYLVFEAVRDGKLKYDQMITPTETVRT
FT                   VKTDESRMFLEAGKPASVREMTQGLIIQSGNDAALVLAEAVGGTETNFVMLMNREAERL
FT                   GMKNTHFANAAGLPDPNHYSTARDLSILTAALIKDFPQDYKFYSQKEFTYNNIKQSNRN
FT                   RLLWLDPTVDGGKTGHTKSAGYCLVTSANRPLPDVPGANRRLLSVIIGTKSDAIRTQES
FT                   LKVLNYGYQFFDTVRLYKAKEALQTPDVYKGQAKSVKLGVAEDKWITVPKGAGARLKPV
FT                   LERKDPLIAPIAQGQQLGTVKVMDGSTVVSEFPVVALEAVPEAGFVGRTIDAVKLWFKK
FT                   K"
FT   sig_peptide     complement(202334..202438)
FT                   /locus_tag="Rpic_0183"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 35"
FT   gene            complement(202533..203180)
FT                   /locus_tag="Rpic_0184"
FT   CDS_pept        complement(202533..203180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0184"
FT                   /product="putative transmembrane protein"
FT                   /note="KEGG: rso:RSc0328 probable transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25347"
FT                   /db_xref="GOA:B2UE07"
FT                   /db_xref="InterPro:IPR000383"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B2UE07"
FT                   /protein_id="ACD25347.1"
FT                   /translation="MNVHTEERLIPGPVGQIDLSIDRPDTAPRGLALIGHPHPLFGGTK
FT                   DNKVAQTLARTFVGLGYVTVRLNFRGVGKTEGTHDNGIGEQDDMLAVLDWMRTQTEWSA
FT                   DVATLPLALGGFSFGSFVVSQVARRLAEAGTPAERLALVGTATSRWDVAPVPADTIIIH
FT                   GEQDDTVPLIDVLNWARPQELPVIVIPGADHFFHRKLHLIRQLITGAWAPKP"
FT   gene            complement(203216..203545)
FT                   /locus_tag="Rpic_0185"
FT   CDS_pept        complement(203216..203545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0185"
FT                   /product="putative ferredoxin 2Fe-2S protein"
FT                   /note="KEGG: rso:RSc0329 putative ferredoxin 2Fe-2S
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25348"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B2UE08"
FT                   /protein_id="ACD25348.1"
FT                   /translation="MSSHYQHHVFFCLNEREDGSRCCADFGAKAMQEYAKKRCKELGIN
FT                   GEGRVRINKAGCLDRCELGPVMVVYPEAVWYTFVDKEDIDEIIQSHLIEGKPVERLMVD
FT                   RPASA"
FT   gene            203997..205286
FT                   /locus_tag="Rpic_0186"
FT   CDS_pept        203997..205286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0186"
FT                   /product="sodium:dicarboxylate symporter"
FT                   /note="PFAM: sodium:dicarboxylate symporter; KEGG:
FT                   rso:RSc0330 C4-dicarboxylate transporter DctA"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25349"
FT                   /db_xref="GOA:B2UE09"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR018107"
FT                   /db_xref="InterPro:IPR023954"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:B2UE09"
FT                   /protein_id="ACD25349.1"
FT                   /translation="MKKPFYKILYVQVLAAIVIGVLLGHYSPELAVKMKPLGDGFIQLI
FT                   KMVIGPIIFCTVVSGIAGMRDMKKVGRVGGKALLYFEVVSTFALIIGLAAGHIFNPGAG
FT                   FNVDVNTIDAKAVAQYAAKAHSASTVDFLLNIIPSTVVDAFAKGDILQILLIALLFGGA
FT                   LSAMGERAQMVTDFIDQISHVFFRIVHVITRVAPIGAFGAMAFTIGKYGVISLVPLLKL
FT                   VGTFYFTAIIFVVVVLGIIARVVGFNIFRFVAYIKEELLIVLGTSSSESALPHLMEKME
FT                   KLGCSKSVVGLVVPTGYSFNLDGTNIYMTMAVIFISQALNIELTWTQQLTILAVAMLTS
FT                   KGASGITGAGFITLAATLAVVPDIPVAGMVLILGIDRFMSECRALTNITGNGVACVVIS
FT                   AWERELDRAKLARVLSGDRSDEGVPATPAV"
FT   gene            205388..207406
FT                   /locus_tag="Rpic_0187"
FT   CDS_pept        205388..207406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0187"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; KEGG: rso:RSc0331
FT                   probable C4-dicarboxylate transport sensor kinase
FT                   transcription regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25350"
FT                   /db_xref="GOA:B2UE10"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR017055"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B2UE10"
FT                   /protein_id="ACD25350.1"
FT                   /translation="MHLVKHLGDMPTAGTALEGTATLSAADLQPMSDPDFSFTSASGSR
FT                   RGFWWLVALGLVVVMAVVCATTFVVAWNRGLTQAQQAAGGRVDRYAANLKSTLDRYEYL
FT                   PALVALHPFIHDLLANPTPANVDRANRYLREVNDRAHATATYVIAPSGKALAASNYNQP
FT                   DSFVGAEYLFRPYFQQAAEGHVGRFYGIGITREEPGYYISQPVMQDGRVIGVTVVKLNL
FT                   EWFGRASHDASEPVMVADENGVIFLSSVPAWQYRTVEPLTSKLQAQLEATRQYYRKQIT
FT                   PLPLQPEAPAFLRLTGRLPEGAELIRVGERTNATRYLQVSRELVEPDWTLMYLTPVEPV
FT                   MSAARSATVAAAFAFAFACLLLFYWRQRRLRMMEMLRSRRLLEAAYDQLERRVEDRTAD
FT                   LMATNEQLQHEIVDRTRAEAELRATQDELVQASKLAALGQMAAGITHELNQPLAALRTF
FT                   SDNTRILLERGQHGAATDNLQAIADLTERMGKITAQLKLFAGRSRRKVVDVQVRVALDH
FT                   TLALLRPRLGDVLVELHWRIPETEAVVRADELKLEQVLINLIGNALDAINANEPVRAGR
FT                   IDITIGPTEGAQAQSNQLTIAVRDNGPGIPPDAMPHLFEPFFTTKEIGQGLGLGLAIST
FT                   SIARDFGGSLSAANMPGGGAQFTLTLVRADVTSAATT"
FT   gene            207432..208748
FT                   /locus_tag="Rpic_0188"
FT   CDS_pept        207432..208748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0188"
FT                   /product="two component, sigma54 specific, transcriptional
FT                   regulator, Fis family"
FT                   /note="PFAM: response regulator receiver; sigma-54 factor
FT                   interaction domain-containing protein; helix-turn-helix
FT                   Fis-type; ATPase associated with various cellular
FT                   activities AAA_5; SMART: AAA ATPase; KEGG: rso:RSc0332
FT                   probable C4-dicarboxylate transport response regulator
FT                   transcription regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25351"
FT                   /db_xref="GOA:B2UE11"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2UE11"
FT                   /protein_id="ACD25351.1"
FT                   /translation="MSEGLNVLFIEDDPPVRQATAQSLELAGFNVQAFGSAEEAVGKID
FT                   ANFPGVVVSDLRLPGASGLDVLTHCQSFGTGIPVVLVTGHGDITMAVQAMREGAFDFIE
FT                   KPFPAERLTETVRRAVERRALELENRALRRELAGPAAGTRIIGRSPAMAAVRALIENVA
FT                   TTDAPVLINGETGTGKELVARSLHMLSPRHDKPFIALNCGAVPEQIFESEMFGYEAGAF
FT                   TGAGKRRIGKLEHASGGTLFLDEIESMPIALQVKLLRVLQEGALERLGSNASVRIDVRI
FT                   VAAAKGDMEALIEAGGFRRDLYYRLNVVVIDLPPLRERREDIIPLFEHFLLEAAVRYQR
FT                   PLPMLAERQRHELMQSNWPGNVRELRNAADRLVLGVGRMPVVPDASEDGMPLKERVERY
FT                   ERTVIAETLARTGGSVHQAADILQVGRATLYDKIKRYGL"
FT   gene            complement(208806..209543)
FT                   /locus_tag="Rpic_0189"
FT   CDS_pept        complement(208806..209543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0189"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RSc1547 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25352"
FT                   /db_xref="InterPro:IPR019268"
FT                   /db_xref="UniProtKB/TrEMBL:B2UE12"
FT                   /protein_id="ACD25352.1"
FT                   /translation="MVNHYCMFKGKLKFGVPYLEGYNGNPHYAIVLEAPDGADFVVLAN
FT                   VKSDSSMPGAGAAGYHVLYQWTTDLQLPITADLTALAPGLHAGGFPRLDYLRDAGLVDF
FT                   PNMRPIALDTETEHNDINALVDDMLNLDRTATPIDYVYHGSSGDDDRKGWPPRTDVTVY
FT                   GFGFLFEPQHNGLHETHMNQGNPVVHTPGVKDHSRENGTQQDGAVIVETDGKFQALLIA
FT                   FQTQRIPTDDRGYPVADAHPIPG"
FT   gene            complement(209683..210243)
FT                   /locus_tag="Rpic_0190"
FT   CDS_pept        complement(209683..210243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0190"
FT                   /product="Redoxin domain protein"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; Redoxin domain protein; KEGG:
FT                   rso:RSc0333 putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25353"
FT                   /db_xref="GOA:B2UE13"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B2UE13"
FT                   /protein_id="ACD25353.1"
FT                   /translation="MASTLTSSAAPATATATSGGRRWLLPVIMLVLAVGGWFGWRAFSP
FT                   SQQVPAATFTLLDGQKLSTQDLKGKVYLVNFWATSCATCIKEMPNMIQTYNKYKGEGLE
FT                   YVAVAMSYDAPMYVMNFSQTRQLPFKVAMDADGSAAKAFGDVQLTPTTFLVDREGRILK
FT                   RYVGEPEWSSFDSLLKQALGKQA"
FT   sig_peptide     complement(210193..210243)
FT                   /locus_tag="Rpic_0190"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.703) with cleavage site probability 0.542 at
FT                   residue 17"
FT   gene            complement(210346..210858)
FT                   /locus_tag="Rpic_0191"
FT   CDS_pept        complement(210346..210858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0191"
FT                   /product="Appr-1-p processing domain protein"
FT                   /note="PFAM: Appr-1-p processing domain protein; KEGG:
FT                   rso:RSc0334 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25354"
FT                   /db_xref="InterPro:IPR002589"
FT                   /db_xref="UniProtKB/TrEMBL:B2UE14"
FT                   /protein_id="ACD25354.1"
FT                   /translation="MPISVTVRALRADITTLDCDAIVNAANSSLFGGGGVDGAIHRAAG
FT                   PELLEACRALHGCRTGEAKLTPGFRLPARYVIHTVGPIWHGGRQDEAALLAACYRNSLE
FT                   LARKHEVRSIAFPCISTGVYGFPPQLAAPIAVRAAREHGAGLDAITFCCFSATHLALYE
FT                   AALASDK"
FT   gene            210943..211512
FT                   /locus_tag="Rpic_0192"
FT   CDS_pept        210943..211512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0192"
FT                   /product="putative transmembrane protein"
FT                   /note="KEGG: rso:RSc0335 putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25355"
FT                   /db_xref="GOA:B2UE15"
FT                   /db_xref="UniProtKB/TrEMBL:B2UE15"
FT                   /protein_id="ACD25355.1"
FT                   /translation="MAVKVTAGWRIGLGALACALLVACSPKYDWRTVHSNEGAYAVDYP
FT                   AKPTAEARPIAINGQRMPMTMQAASVDGTLFAIGVVELPADDPVWRQRAVEALRNGLSA
FT                   NLKGHVTERDIVVQTAAQPPLSLPALELIALGAGGDDPAPRRLTARVVATGKHAYQAVV
FT                   LESGDAARDARQQEQVDQFLASFHPY"
FT   gene            211603..212244
FT                   /locus_tag="Rpic_0193"
FT   CDS_pept        211603..212244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0193"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   reu:Reut_A0287 lysine exporter protein (LysE/YggA)"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25356"
FT                   /db_xref="GOA:B2UE16"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:B2UE16"
FT                   /protein_id="ACD25356.1"
FT                   /translation="MTLQVWLAFFLAAWVIAISPGSGAILCMSHGLTHGVRRTSVTIAG
FT                   LELGIVVILFIAGAGLGALLIASEHAFTAIKIIGAMYLIYLGIVQWRTPIQIAKPTEGE
FT                   PLKVSGSGARRRFLVGLLTNLTNPKGILFMVAVLPQFIDPAKPLLSQLGILAATMVFVD
FT                   LIVMHGYALLASRAQRLFRNPRALRWQSRFFGGMLMSIGAALFFVKRQTA"
FT   sig_peptide     211603..211674
FT                   /locus_tag="Rpic_0193"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.806) with cleavage site probability 0.263 at
FT                   residue 24"
FT   gene            complement(212305..213837)
FT                   /locus_tag="Rpic_0194"
FT   CDS_pept        complement(212305..213837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0194"
FT                   /product="Mg chelatase, subunit ChlI"
FT                   /note="KEGG: rso:RSc0338 probable Mg(2+) chelatase family
FT                   protein; TIGRFAM: Mg chelatase, subunit ChlI; PFAM:
FT                   magnesium chelatase ChlI subunit; ATPase associated with
FT                   various cellular activities AAA_5; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25357"
FT                   /db_xref="GOA:B2UE17"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2UE17"
FT                   /protein_id="ACD25357.1"
FT                   /translation="MSLAVLRSRALSGIDAPAVSVEVHLANGLPSFTIVGLPDTEVKES
FT                   KDRVRAAIQNSRFEFPARRITVNLAPADLPKESGRFDLAIALGILAASRQIPHTHLDAH
FT                   EFAGELSLSGDLRPIRGALAMAYALSRNPVSADGDAPLARDFVLPAENAAEAALVSGTK
FT                   VLPARTLIEVCDHLSAPDRKLAPALPALVDADIRYPDLADVRGQPQARRALEVAAAGGH
FT                   SMLMIGPPGTGKSMLAQRFPGLLPDMSDDEALSAAAVMSLTTRGFDARRWKVRPFRSPH
FT                   HTASAVAMVGGGNTPRPGEISLAHQGVLFLDELPEFERRVLEVLREPLETGHITISRAA
FT                   RQTDFPASFQLIAAMNPCPCGYRGHPLRACRCTPDQVERYQARISGPLLDRIDVQIEVP
FT                   TPSQEELLDGPPGEPTRNVAERVSAAHARQLARQGKRNALLGGHEIDLHCSRTDAADGL
FT                   LRHAMTRFSWSARAYARVLKLARTIADLAGDEQIDAAHVGEAIQYRRGVKAD"
FT   gene            complement(214052..214564)
FT                   /locus_tag="Rpic_0195"
FT   CDS_pept        complement(214052..214564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0195"
FT                   /product="putative transmembrane protein"
FT                   /note="KEGG: rso:RSc0339 probable transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25358"
FT                   /db_xref="GOA:B2UE18"
FT                   /db_xref="UniProtKB/TrEMBL:B2UE18"
FT                   /protein_id="ACD25358.1"
FT                   /translation="MQHRLYFLMPDVVSARRVMNDLLLARITERHIHFVSKPGVDLTGL
FT                   HEANILQTSDIVHATQNGLVIGGGAGVLAGIVAAIFPVIGEGPQWGMVGITTVVGALFG
FT                   AWASSMIGSSVPNSRLKPFKQAVEDGQILLMVDVPRSRVSEVRALLQRTHPEGRFSGED
FT                   SAMPAFP"
FT   gene            complement(214742..214999)
FT                   /locus_tag="Rpic_0196"
FT   CDS_pept        complement(214742..214999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0196"
FT                   /product="protein of unknown function DUF526"
FT                   /note="PFAM: protein of unknown function DUF526; KEGG:
FT                   rso:RSc0340 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25359"
FT                   /db_xref="InterPro:IPR007475"
FT                   /db_xref="UniProtKB/TrEMBL:B2UE19"
FT                   /protein_id="ACD25359.1"
FT                   /translation="MKPTDLFSDFQNRVSEALRNSPAADIEKNVRAMMTQGFSKLDLVT
FT                   REEFDVQSQVLARTRARLEELETRVAALEAQLKSAAPADQ"
FT   gene            215532..216347
FT                   /locus_tag="Rpic_0197"
FT   CDS_pept        215532..216347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0197"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   rso:RSc0341 probable signal peptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25360"
FT                   /db_xref="InterPro:IPR010239"
FT                   /db_xref="UniProtKB/TrEMBL:B2UE20"
FT                   /protein_id="ACD25360.1"
FT                   /translation="MKKFAYAASLVLLTGAVAGVSQTAIAQSAPAADAPAAAPAPAPAA
FT                   LTANVTLASQYRYRGIMQTNNKPAIQGGFDYAIPGGVLPEGFYIGNWNSSISWLSDSNS
FT                   NVSAPIEMDFYGGYKTEIVKDVPIDVGVLQYYYPGSYPDGFTRPHTTEGYAQIGYGPVT
FT                   FKYSHAFSNLFGTPDSHHSQYFDLSGNFDTGFWGLTLNLHAGYQQVPHQTVRASYADWK
FT                   VGVTKDFGNGWAASLAYIDTNASRAFYTNTRGNYMGKATALLSITKTFQ"
FT   sig_peptide     215532..215612
FT                   /locus_tag="Rpic_0197"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.928 at
FT                   residue 27"
FT   gene            216394..216732
FT                   /locus_tag="Rpic_0198"
FT   CDS_pept        216394..216732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0198"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /note="PFAM: nitrogen regulatory protein P-II; KEGG:
FT                   rso:RSc0342 probable nitrogen regulatory P-II transcription
FT                   regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25361"
FT                   /db_xref="GOA:B2UE21"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR002332"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:B2UE21"
FT                   /protein_id="ACD25361.1"
FT                   /translation="MKLIMAIIKPFKLDEVREALSEVGVSGITVTEVKGFGRQKGHTEL
FT                   YRGAEYIVDFLPKVKIEVAVPDDVVERAVEAIEKSARTGKIGDGKIFVADVEQVIRIRT
FT                   GETGGDAL"
FT   gene            216763..218310
FT                   /locus_tag="Rpic_0199"
FT   CDS_pept        216763..218310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0199"
FT                   /product="ammonium transporter"
FT                   /note="TIGRFAM: ammonium transporter; PFAM: Rh family
FT                   protein/ammonium transporter; KEGG: reh:H16_A0321 ammonium
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25362"
FT                   /db_xref="GOA:B2UE22"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:B2UE22"
FT                   /protein_id="ACD25362.1"
FT                   /translation="MKTWFTRFLTAGAVAAVLAGAVISAPAAAQDKPAAEASAPVAAAA
FT                   ASEPAAAAPAAAAPAAAPAAAAAPAAAAPAAAAPVPNKGDTAWLLVSTAFVILMTLPGL
FT                   ALFYGGLVRKKNMLSVLMQCMGIFSLIIILWAIYGYSFAFTEGNAFFGGLDRLFLKGLT
FT                   PDSVAATFSKGVVVPEYAYFAFQGAFAAITCALIIGAFAERAKFSAVLLFVVLWFTFSY
FT                   VPIAHMVWFWPGPDGFTDAKAAEVMTAKSGWLFQKGALDFAGGTVVHINAAVAGLVGAF
FT                   LFGKRIGFGREALKPHSLTLTMVGASLLWFGWFGFNAGSALEANGSAALAFVNTLLATA
FT                   AAVLSWSFGEWFGKSKPSMLGAASGAVAGLVAITPAAGFVGPMGSIALGIIAGLLCLWG
FT                   VNGLKRMLGMDDTLDVFGVHGVGGILGALLTGVFAAPSLGGTGIYDYVANKVADDYSIG
FT                   GQLWIQFQGVATTVIWSAVVAFISYKIVDAIVGLRVPEEEEREGLDITSHGETAYED"
FT   sig_peptide     216763..216852
FT                   /locus_tag="Rpic_0199"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 30"
FT   gene            218677..219972
FT                   /locus_tag="Rpic_0200"
FT   CDS_pept        218677..219972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0200"
FT                   /product="glutamate/cysteine ligase"
FT                   /note="TIGRFAM: glutamate/cysteine ligase; PFAM:
FT                   glutamate--cysteine ligase GshA; KEGG: rso:RSc0344
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25363"
FT                   /db_xref="GOA:B2UE23"
FT                   /db_xref="InterPro:IPR011718"
FT                   /db_xref="InterPro:IPR042520"
FT                   /db_xref="UniProtKB/TrEMBL:B2UE23"
FT                   /protein_id="ACD25363.1"
FT                   /translation="MVPHLITALNGPLLELEQKILDATPAIERWFRLEWQEHTPPFYCS
FT                   VDLRNAGFKLAPVDTNLFPGGFNNLAPEMLPLAVQAAMAAIEKICPDAKNLLLIPERHT
FT                   RNMFYLQNVARLSQIMRQAGLNVRLGSLSEDITEPTSIDLPDGQRLVVEPIKRIGTKGR
FT                   RLGMEDFDPCSILLNNDLSAGVPPILENINEQYLLPPLHAGWSQRRKTNHFAAYDEVAK
FT                   KFAKLIDIDPWMVNPYFTKCSGLDFHERAGEEELAHAVETVLKKTAKKYKEYGVTETPY
FT                   VVVKADAGTYGMGVMTVRDPSEVKGLNRKERNKMSVVKEGLEVSEVIVQEGVHTFEKIN
FT                   EAVAEPVVYMIDRYVVGGFYRVHTGRGVDENLNAPGMHFVPLPFASNSLPDSHAKPGAG
FT                   EPNRFYMYGVVARLALLAASLELEKTDPNPLI"
FT   gene            220005..220976
FT                   /locus_tag="Rpic_0201"
FT   CDS_pept        220005..220976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0201"
FT                   /product="glutathione synthetase"
FT                   /EC_number="6.3.2.3"
FT                   /note="KEGG: rso:RSc0345 glutathione synthetase; TIGRFAM:
FT                   glutathione synthetase; PFAM: glutathione synthetase domain
FT                   protein; glutathione synthetase ATP-binding; RimK domain
FT                   protein ATP-grasp"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25364"
FT                   /db_xref="GOA:B2UE24"
FT                   /db_xref="InterPro:IPR004215"
FT                   /db_xref="InterPro:IPR004218"
FT                   /db_xref="InterPro:IPR006284"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:B2UE24"
FT                   /protein_id="ACD25364.1"
FT                   /translation="MRILFIVDPLSTFKTYKDSTFAMMREAAARGYAIYTCLQSQLTLA
FT                   NNVVETVATPIALTGDEDDWYRAGDARLLPLTGFDAVLMRKDPPFDMEYVTSTWLLEIA
FT                   ERQGARVFNKPQAIRDHSEKLAIAQFREFTVPTIVSRDAKRLREFHAEQGDVIFKPLDG
FT                   MGGAGIFRVGPDGLNLGAVIESLTDNGARTIMAQQYIPAIREGDKRILLIGGSPVPHSL
FT                   ARVPMAGEVRGNLAAGGTGRAQPLSERDQVIAHALAPVLWQRGLLLVGLDVIGDYLTEV
FT                   NVTSPTCFQEITQQTGFNVAGMFIDALERAAGKSSGLGRKPA"
FT   gene            221096..221551
FT                   /locus_tag="Rpic_0202"
FT   CDS_pept        221096..221551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0202"
FT                   /product="PTS system fructose subfamily IIA component"
FT                   /note="PFAM: PTS system fructose subfamily IIA component;
FT                   KEGG: rso:RSc0346 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25365"
FT                   /db_xref="GOA:B2UE25"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR033887"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="UniProtKB/TrEMBL:B2UE25"
FT                   /protein_id="ACD25365.1"
FT                   /translation="MAGILIIAHAPLASALRDCAAHVYCGQPEGLGAIDVLPDAEPAAV
FT                   LAQARDKLAELIEANGALVLTDIFGATPANIASRLADPGRVRVLAGVNLPMLVRAICYR
FT                   SEKLEQLAAKALAGGAQGVLQVGSTAVQNQVANHPDKYAAEGYHHHQ"
FT   gene            221520..221789
FT                   /locus_tag="Rpic_0203"
FT   CDS_pept        221520..221789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0203"
FT                   /product="Phosphotransferase system, phosphocarrier protein
FT                   HPr"
FT                   /note="TIGRFAM: phosphocarrier, HPr family; PFAM:
FT                   phosphocarrier HPr protein; KEGG: rso:RSc0347 probable
FT                   phosphocarrier protein HPr (phosphohistidinoprotein-hexose
FT                   phosphotransferase)"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25366"
FT                   /db_xref="GOA:B2UE26"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR002114"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/TrEMBL:B2UE26"
FT                   /protein_id="ACD25366.1"
FT                   /translation="MLQRDITIINKLGLHARASAKLTQLASKFDSQIKMSRNGRQVDAK
FT                   SIMGVMMLAAGIGSTVTLEIDGPDEHDAMDGLVALINDRFGEGE"
FT   gene            221835..223586
FT                   /locus_tag="Rpic_0204"
FT   CDS_pept        221835..223586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0204"
FT                   /product="phosphoenolpyruvate-protein phosphotransferase"
FT                   /note="TIGRFAM: phosphoenolpyruvate-protein
FT                   phosphotransferase; PFAM: PEP-utilizing protein;
FT                   PEP-utilising protein mobile region; PEP-utilising protein
FT                   domain protein; KEGG: rso:RSc0348 probable
FT                   phosphoenolpyruvate-protein phosphotransferase
FT                   transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25367"
FT                   /db_xref="GOA:B2UE27"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR024692"
FT                   /db_xref="InterPro:IPR036618"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:B2UE27"
FT                   /protein_id="ACD25367.1"
FT                   /translation="MPFTLHGIPVSRGISIGRAHMLARAALDVSHYLVDEDKLDAEVER
FT                   LRSARATVRSELAALKRDLPSDVPEEMGAFLDVHAMILDDALLSQVPETLIRQRRYNAE
FT                   WALTTQLEELIRQFGEIEDEYLRERKADIEQVVERILKVLAGAPALAPAPVAVGCDPDA
FT                   GMIVVAHDIAPADMLQFRGQTFAGFVTDLGGRTSHTAIVARSLDIPAAVGVHNASTLIR
FT                   QDDIVVIDGDNGIVIVDPSTSILEEYRHRRSEGELQKKRLERLRHTPTVTLDGTQIELQ
FT                   ANIEMPEDAAAAVKAGAVGVGLFRSEFLFMNRRGALPDEEEQFRAYRTAVESMMGLPVT
FT                   IRTIDIGADKPLDIRDDVFETAPNPALGLRAIRWSLSEPAMFLTQLRALLRASAFGPIK
FT                   ILVPMLAHAREIDQTLELLARAKASLDADGLAYDPGIKVGAMIEIPAAVLILPVFLRRM
FT                   DFLSIGTNDLIQYTLAIDRADNAVAHLYDPLHPAVLQLIARTIREAHQAGKPVSVCGEM
FT                   AGDASMTRLLLGMGLTEFSMHPSQLLSVKQQILRSDRPRLMREADRLLHACEPAEIEEA
FT                   LGALARA"
FT   gene            223817..224092
FT                   /locus_tag="Rpic_0205"
FT   CDS_pept        223817..224092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0205"
FT                   /product="BFD domain protein (2Fe-2S)-binding domain
FT                   protein"
FT                   /note="PFAM: BFD domain protein [2Fe-2S]-binding domain
FT                   protein; KEGG: rso:RSc0349 putative
FT                   bacterioferritin-associated ferredoxin protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25368"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:B2UE28"
FT                   /protein_id="ACD25368.1"
FT                   /translation="MYVCICNQVTDREIHGAARLGVSTMDELAETLGVGTCCGQCRDCA
FT                   KQVLAEAVSCIPVDQTLGRASTHAIIERRDEPVANDQAIVAGALAA"
FT   gene            224241..224720
FT                   /locus_tag="Rpic_0206"
FT   CDS_pept        224241..224720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0206"
FT                   /product="bacterioferritin"
FT                   /note="TIGRFAM: bacterioferritin; PFAM: Ferritin Dps family
FT                   protein; KEGG: rso:RSc0350 probable bacterioferritin BFR
FT                   (cytochrome b-1) (cytochrome b-557) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25369"
FT                   /db_xref="GOA:B2UE29"
FT                   /db_xref="InterPro:IPR002024"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:B2UE29"
FT                   /protein_id="ACD25369.1"
FT                   /translation="MKGDKKVIQYLNAQLKNELTAINQYFLHARMYGHWGLKRIGDHEY
FT                   KESIGEMKHADRLIERILMLDGLPNLQDLGKIFIGQDTKEIIECDLKLERAAHGTVVEG
FT                   IAYCESVKDYVSREILVDILDDTEEHIDWLETQLELIDKVGIQNYLQSQMEPEGE"
FT   gene            complement(224786..225535)
FT                   /locus_tag="Rpic_0207"
FT   CDS_pept        complement(224786..225535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0207"
FT                   /product="UBA/THIF-type NAD/FAD binding protein"
FT                   /note="PFAM: UBA/THIF-type NAD/FAD binding protein;
FT                   MoeZ/MoeB domain protein; KEGG: rso:RSc0351 molybdopterin
FT                   biosynthesis protein MoeB"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25370"
FT                   /db_xref="GOA:B2UE30"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:B2UE30"
FT                   /protein_id="ACD25370.1"
FT                   /translation="MNDDQLLRYSRHILLDEIGIEGQTRLLESHALVIGAGGLGAAALP
FT                   YLAAAGIGTLTIVDDDTVDLTNLQRQIIHTTESVGQPKVASAQAAIARLNPDVRVHAVQ
FT                   RRLDTDAIGARLDGVSVVLDCSDNFGTRQATNLACVRAGVPLVSGAAIRFDGQISVFDS
FT                   RAGGPCYACLFPPDEPAPDVACATMGVFSPLVGMVGTVQAAEALKLIAGIGSSLAGRLL
FT                   MLDGLTMEWTTMRIARQPSCPVCGGMH"
FT   gene            complement(225605..227221)
FT                   /locus_tag="Rpic_0208"
FT   CDS_pept        complement(225605..227221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0208"
FT                   /product="carboxyl-terminal protease"
FT                   /EC_number="3.4.21.102"
FT                   /note="KEGG: rso:RSc0352 putative carboxy-terminal
FT                   processing protease transmembrane protein; TIGRFAM:
FT                   carboxyl-terminal protease; PFAM: PDZ/DHR/GLGF domain
FT                   protein; peptidase S41"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25371"
FT                   /db_xref="GOA:B2UE31"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:B2UE31"
FT                   /protein_id="ACD25371.1"
FT                   /translation="MRTSLKNISLIAIGLVTGVLATLQLSATAQNATVGPLPLEKLRLM
FT                   ADIFGQIKREYVEPVDDDKLLTEAIKGMVASLDPHSAYLDKKDFQELQEGTQGRFAGLG
FT                   IEISQEEGLVKVINPIEDTPAFRAGVQPGDLITRIDDKPVRGMPLEQAVKRMRGAPGTK
FT                   VTLTIYRKKEERTFPLTITRAEIQVQSVKAKMLDNGIAWVRITSFQERTVPDLAKKLND
FT                   LAKQDPHLKGLILDLRNNGGGVLQAAVGVSAAFLPPDATVVSTNGQVPDAKRTYKATFA
FT                   NYRLSNLDSDPLVGLDPEFKTVPIIVLTNAYTASASEIVAGALQDHHRAKTMGKTTFGK
FT                   GSVQTVRPLSNDTGIKLTIAYYYTPSGKSIQAKGIRPDIPVDQNPDGDPDDALITREID
FT                   TERHLHNKQESEEAEMTEREKRRVEELRRLEEENAKKTPEQREKERNKKPIEFGSAEDF
FT                   MLQQALADLKGQPVKRSKSVLEAAAAAVPDKAVKSPAAKDSSAPAKLPKGKATPASEPP
FT                   APKPNVPASGVQPAPEPTGAR"
FT   sig_peptide     complement(227132..227221)
FT                   /locus_tag="Rpic_0208"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.881 at
FT                   residue 30"
FT   gene            complement(227340..228095)
FT                   /locus_tag="Rpic_0209"
FT   CDS_pept        complement(227340..228095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0209"
FT                   /product="phosphoglycerate mutase 1 family"
FT                   /EC_number="5.4.2.-"
FT                   /note="KEGG: rso:RSc0353 phosphoglyceromutase; TIGRFAM:
FT                   phosphoglycerate mutase 1 family; PFAM: Phosphoglycerate
FT                   mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25372"
FT                   /db_xref="GOA:B2UE32"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR005952"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:B2UE32"
FT                   /protein_id="ACD25372.1"
FT                   /translation="MAVMHKLVLIRHGESTWNLENRFTGWVDVDLTDTGVAQARQGGKL
FT                   LREAGFTFDLAYTSVLKRAIRTLWHVQDEMDLMWIPTRNEWRLNERHYGALSGLNKAET
FT                   AAQYGDEQVLVWRRSYDTPPPALEPGADNDAFGNPRYAGLTREQVPLTECLKDTVARVM
FT                   PLWEESIAPAIKSGKRVVIAAHGNSIRALVKYLDGISDADIVGLNIPNGTPLVYELDAN
FT                   LKPIRHYYLGDQEAIAASLAAVASQGKSK"
FT   gene            228261..228683
FT                   /locus_tag="Rpic_0210"
FT   CDS_pept        228261..228683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0210"
FT                   /product="Rhodanese domain protein"
FT                   /note="PFAM: Rhodanese domain protein; KEGG: rso:RSc0354
FT                   probable transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25373"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:B2UE33"
FT                   /protein_id="ACD25373.1"
FT                   /translation="MKFFADYNNLALLAVAIVSGLLLLWAPIQRRIAGGGGAKVGASAA
FT                   TQLINRRNAVVVDVRENAEYAAGHLPQAKHAPLGELAGKAAGLAKNKETPIILVCQTGQ
FT                   RAGRAQAVLKQAGYSEVYSLEGGLAAWQQAGLPVVK"
FT   gene            228702..228959
FT                   /locus_tag="Rpic_0211"
FT   CDS_pept        228702..228959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0211"
FT                   /product="glutaredoxin 3"
FT                   /note="TIGRFAM: glutaredoxin 3; PFAM: glutaredoxin; KEGG:
FT                   rso:RSc0355 probable glutaredoxin 3 (GRX3) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25374"
FT                   /db_xref="GOA:B2UE34"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011767"
FT                   /db_xref="InterPro:IPR011900"
FT                   /db_xref="InterPro:IPR014025"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B2UE34"
FT                   /protein_id="ACD25374.1"
FT                   /translation="MAHVVMYSTTVCPYCVAAERLLKQRGVEQIEKILIDREPGKREEM
FT                   MTRTNRRTVPQIYIDERHIGGFDDLSALDREGGLVPLLAA"
FT   gene            229120..229638
FT                   /locus_tag="Rpic_0212"
FT   CDS_pept        229120..229638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0212"
FT                   /product="protein-export protein SecB"
FT                   /note="TIGRFAM: protein-export protein SecB; PFAM: protein
FT                   export chaperone SecB; KEGG: rso:RSc0356 preprotein
FT                   translocase subunit SecB"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25375"
FT                   /db_xref="GOA:B2UE35"
FT                   /db_xref="InterPro:IPR003708"
FT                   /db_xref="InterPro:IPR035958"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2UE35"
FT                   /protein_id="ACD25375.1"
FT                   /translation="MSDQQQQQPGQDGQPFFNIQRVYLKDLSLEQPNSPHIFLEQEQPS
FT                   VEVQVDVAASQLAEGVFEVTVIGTVTTKVQEKVAFLVEAKQAGIFDIRNVPAEQMDPLL
FT                   GIACPTIVYPYLRSNIADTIGRAGFQPIHLAEINFQALYEQRLAAAMEQQGQAGGTGLV
FT                   MPDGSKATH"
FT   gene            229731..230762
FT                   /locus_tag="Rpic_0213"
FT   CDS_pept        229731..230762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0213"
FT                   /product="Glycerol-3-phosphate dehydrogenase (NAD(P)(+))"
FT                   /EC_number="1.1.1.94"
FT                   /note="PFAM: NAD-dependent glycerol-3-phosphate
FT                   dehydrogenase domain protein; KEGG: rso:RSc0357
FT                   NAD(P)H-dependent glycerol-3-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25376"
FT                   /db_xref="GOA:B2UE36"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2UE36"
FT                   /protein_id="ACD25376.1"
FT                   /translation="MLNTRMRISVLGAGAWGTALASHAAQSHDVMLWGRDANLVAQMAA
FT                   THINAPYLPGMTLRASLHFSADLQAALDHAAGDDALAVIASPVAGLADLTRTIAAHGGV
FT                   RNVIWLCKGFDPETSALPHAIVADVLKVSGRTDLAVGVLSGPSFAKEVAQGLPCAMTVA
FT                   STSDALCKLTQRGFHHHAMRVYASDDLVGVEVGGAVKNVLAIATGAADGLGLGLNARAA
FT                   LVTRGLAEMTRLGLALGGRLETFMGLTGVGDLLLTATGDLSRNRTVGMQLAQGRTLDDI
FT                   LHSLGHVAEGVRCARAVAALARAKGVDMPITFTVCEVLFEGLPAAKAVERLLQRDAKSE
FT                   SAR"
FT   sig_peptide     229731..229805
FT                   /locus_tag="Rpic_0213"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.713 at
FT                   residue 25"
FT   gene            complement(230792..231262)
FT                   /locus_tag="Rpic_0214"
FT   CDS_pept        complement(230792..231262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0214"
FT                   /product="RNA methyltransferase, TrmH family, group 2"
FT                   /note="TIGRFAM: RNA methyltransferase, TrmH family, group
FT                   2; PFAM: tRNA/rRNA methyltransferase (SpoU); KEGG:
FT                   rso:RSc0358 putative tRNA/rRNA methyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25377"
FT                   /db_xref="GOA:B2UE37"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR016914"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:B2UE37"
FT                   /protein_id="ACD25377.1"
FT                   /translation="MFNVILVEPEIPPNTGNVIRLCANTGAQLHLIEPLGFPLEDARMR
FT                   RAGLDYHEYATMRVHADWDAFLRDAQPDPTRMFALTTRGSTPFASVAFQPGDWFVFGSE
FT                   TRGLSEERREWFPASQRIRLPMRPDNRSLNLSNTVAVVVFEAWRQNGFAGGA"
FT   gene            complement(231374..232096)
FT                   /locus_tag="Rpic_0215"
FT   CDS_pept        complement(231374..232096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0215"
FT                   /product="putative competence protein F-related protein"
FT                   /note="KEGG: rso:RSc0359 putative competence protein
FT                   F-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25378"
FT                   /db_xref="GOA:B2UE38"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:B2UE38"
FT                   /protein_id="ACD25378.1"
FT                   /translation="MHKHALSAWFRAGLRHLLPCACALCGAVQGDLVCNGCTGDLASHL
FT                   HRRRCIQCAIALDARHAARHCRTCLAGAPDFDATVVIADYAWPLDHLVTGLKFRAQLPL
FT                   ADWLAAQLGNALAAAPGDLPDMLLPVPLSPARLRSRGYNQAWEVARRIARRLDIPAHAG
FT                   ALQRVRDNVAQATLDRAERLANLHGAFVVAEPARIAGRHIGVVDDVMTTGTTLGEIATQ
FT                   LKRAGATRVTNVVALRTP"
FT   gene            232205..233146
FT                   /locus_tag="Rpic_0216"
FT   CDS_pept        232205..233146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0216"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: rso:RSc0360 putative biotin synthesis
FT                   protein (methyltransferase)"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25379"
FT                   /db_xref="GOA:B2UE39"
FT                   /db_xref="InterPro:IPR011814"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B2UE39"
FT                   /protein_id="ACD25379.1"
FT                   /translation="MSDPVLARPAALRRAFDRRAARFADVDFLLREVGSRMQDRLSYIK
FT                   ATPVRALDLGCGLGQGLAVLRAQYPDAQICGVDWSSAMLAQAQKLDPQRTDAGWLGRLL
FT                   KKRPVFDFAQADFRALPFAGASFDLLWSNLALHWDPAPHAIFPEWHRITTEGGLLMFSL
FT                   FGPDTLRELRSALAGIDAGVHTLRFVDMHDIGDMLVHSRWSTPVMDMEQITITYETPQA
FT                   LLADVHLLGGMAGLTDEAGHSLAGAGLHTPRWRQRLFDAFDAQRNPDGLIPLTFEIVYG
FT                   HAWKLAPTQRQALDEQGRAMIPIDQIGRKPRA"
FT   gene            233339..233662
FT                   /pseudo
FT                   /locus_tag="Rpic_0217"
FT   gene            233773..235029
FT                   /locus_tag="Rpic_0218"
FT   CDS_pept        233773..235029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0218"
FT                   /product="cytochrome c oxidase, subunit II"
FT                   /note="TIGRFAM: cytochrome c oxidase, subunit II; PFAM:
FT                   cytochrome c oxidase subunit II; cytochrome c class I;
FT                   cytochrome C oxidase subunit II transmembrane region; KEGG:
FT                   rso:RSc0362 putative cytochrome c oxidase polypeptide II
FT                   precursor (cytochrome AA3 subunit 2) transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25380"
FT                   /db_xref="GOA:B2UE40"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR014222"
FT                   /db_xref="InterPro:IPR034210"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:B2UE40"
FT                   /protein_id="ACD25380.1"
FT                   /translation="MKMLNKTLASLLAAGSLLALSQTALAVEDMPGGPAVRQLNLAPPV
FT                   TKIAAEIHWLHWMMLIICIVIFIGVFGVMFYSIFKHRKSVGHKPATFHESTTVEIIWTI
FT                   VPFLIVIGMALPATKAVVAMKDTTNSDLTIKATGYQWKWGYDYLKGEGEGISFLSTLTT
FT                   PRDQINNQAPKSNTYLIEVDNELVVPVNRKVRIVTTANDVIHSWMIPAFGVKQDAIPGF
FT                   VRDAWFKAEKVGVYRGQCAELCGKEHAFMPIVVRVLSQDDYTKWVDGKKKEMAAKADDP
FT                   NKTYTLEELKSRGEKVYTANCAVCHQPNGKGGGPFPALDGSKIANGPLADHVGIVLHGK
FT                   GAMPPWASALNDVEIAAVVTYERNNWGNHTGDLLQPTQVKDARGGKMPEGGAAKTATTE
FT                   SAGKVASKQANAAEDRNAG"
FT   sig_peptide     233773..233853
FT                   /locus_tag="Rpic_0218"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.993 at
FT                   residue 27"
FT   gene            235070..236674
FT                   /locus_tag="Rpic_0219"
FT   CDS_pept        235070..236674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0219"
FT                   /product="cytochrome c oxidase, subunit I"
FT                   /EC_number="1.9.3.1"
FT                   /note="KEGG: rso:RSc0363 probable cytochrome c oxidase
FT                   polypeptide I (cytochrome AA3 subunit 1) transmembrane
FT                   protein; TIGRFAM: cytochrome c oxidase, subunit I; PFAM:
FT                   cytochrome c oxidase subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25381"
FT                   /db_xref="GOA:B2UE41"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014241"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR033944"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:B2UE41"
FT                   /protein_id="ACD25381.1"
FT                   /translation="MSTAVTHPQDHAHGHGDDHAHDHPHGWRRWLFATNHKDIGTLYLL
FT                   FSFMMLLSGGTLALLIRLELFQPGLQFFHPELFNQFTTLHGLIMVFGAIMPAFVGFANW
FT                   MIPLQVGASDMAFARMNNFSFWLLPPAALLLVGSFFAPGGATAAGWTLYAPLSVQMGPG
FT                   MDMAIFAIHIMGASSIMGAINIIVTILNMRAPGMTLMKMPMFCWTWLITAYLLIAVMPV
FT                   LAGAITMVLTDRHFGTSFFSAAGGGDPVMYQHIFWFFGHPEVYIMILPAFGIVSQIVPA
FT                   FARKPLFGYSSMVYATASIAILSFIVWAHHMFTTGMPVTGQLFFMYATMLIAVPTGVKI
FT                   FNWVATMWRGSMTFETPMLFAIGFIFVFTVGGFTGLILAVAPIDIQLQDTYYVVAHFHY
FT                   VLVAGSLFALFAGFYYWGPKWSGYMYSETRGKIHFWGSMITFNLTFFPMHFLGLAGMPR
FT                   RYADYPQQFADFNAIASIGALGFGLMQVYFFFFVVLPSYRGGEKAADKPWDGAEGLEWT
FT                   VPSPAPFHTFEEPPHVK"
FT   gene            236728..236859
FT                   /locus_tag="Rpic_0220"
FT   CDS_pept        236728..236859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0220"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RSc0364 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25382"
FT                   /db_xref="GOA:B2UE42"
FT                   /db_xref="UniProtKB/TrEMBL:B2UE42"
FT                   /protein_id="ACD25382.1"
FT                   /translation="MSNPEKSPTPEQRAANRRLGLILGTIALVFFLGVIFKRVVFGG"
FT   gene            236909..237517
FT                   /locus_tag="Rpic_0221"
FT   CDS_pept        236909..237517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0221"
FT                   /product="cytochrome c oxidase assembly protein CtaG/Cox11"
FT                   /note="PFAM: cytochrome c oxidase assembly protein
FT                   CtaG/Cox11; KEGG: rso:RSc0365 cytochrome c oxidase assembly
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25383"
FT                   /db_xref="GOA:B2UE43"
FT                   /db_xref="InterPro:IPR007533"
FT                   /db_xref="InterPro:IPR023471"
FT                   /db_xref="UniProtKB/TrEMBL:B2UE43"
FT                   /protein_id="ACD25383.1"
FT                   /translation="MSQTPAQPDPTQNDKALERGLNRSMLGKLAVVVAIMFGFGYAMVP
FT                   LYKKICEITNINVLNTRDEDGGALRNSQVDKTRTITVEFDSNSQGPFRFRPVKNSMDVH
FT                   PGEISQIVYEVVNKEGRTVEAQAIPSYAPKQATEFFKKIECFCFKQQTLTANESREMPV
FT                   VFVIDPDLPKDVKTITLSYTFFEIHAPSVIAPAMPNKGT"
FT   gene            237522..237734
FT                   /locus_tag="Rpic_0222"
FT   CDS_pept        237522..237734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0222"
FT                   /product="putative transmembrane protein"
FT                   /note="KEGG: rso:RSc0366 probable transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25384"
FT                   /db_xref="GOA:B2UE44"
FT                   /db_xref="InterPro:IPR021344"
FT                   /db_xref="UniProtKB/TrEMBL:B2UE44"
FT                   /protein_id="ACD25384.1"
FT                   /translation="MDDLKEATKRRASFAQTMKAVFWSFFGVRKGRDHDRDMAQLNPVH
FT                   VIVAGILAAVIFVVVLLLIVRAVVG"
FT   gene            237823..238683
FT                   /locus_tag="Rpic_0223"
FT   CDS_pept        237823..238683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0223"
FT                   /product="cytochrome c oxidase subunit III"
FT                   /note="PFAM: cytochrome c oxidase subunit III; KEGG:
FT                   rso:RSc0367 probable cytochrome c oxidase subunit III
FT                   transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25385"
FT                   /db_xref="GOA:B2UEN9"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR033945"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:B2UEN9"
FT                   /protein_id="ACD25385.1"
FT                   /translation="MSANRANAPYYFVPGPSRHPITASLGLLIVLLSSAAWVNAQPWAP
FT                   WTFLVGLLWFLFVLRAWFADAISESETGKYGDRVDASFRWSMSWFIFSEVMFFAAFFGA
FT                   LFYARTIAMPWLGDLNNKLLWPDFNALWPNAGPAGTVSPFTTMGPWPIPTINTALLLTS
FT                   GVTLTWAHHALREGKRAQVIQGLLLTILLGFTFMGFQAFEYIHAYHELNLKLTSGIYGS
FT                   TFFLLTGFHGFHVTMGAIMLSVVLGRVIKGHFTPEHHFAFEGAAWYWHFVDVVWLGLYV
FT                   VVYWL"
FT   sig_peptide     237823..237939
FT                   /locus_tag="Rpic_0223"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.928) with cleavage site probability 0.748 at
FT                   residue 39"
FT   gene            complement(238809..239018)
FT                   /locus_tag="Rpic_0224"
FT   CDS_pept        complement(238809..239018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0224"
FT                   /product="putative transmembrane protein"
FT                   /note="KEGG: rso:RSc0368 probable transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25386"
FT                   /db_xref="GOA:B2UEP0"
FT                   /db_xref="InterPro:IPR021313"
FT                   /db_xref="UniProtKB/TrEMBL:B2UEP0"
FT                   /protein_id="ACD25386.1"
FT                   /translation="MRIVVAIAFLLILGSLASALFFLMRDKGHSNRTVRSLMFRVGFSI
FT                   ALFIFILVANRLGWIHSTGIQFGQ"
FT   sig_peptide     complement(238959..239018)
FT                   /locus_tag="Rpic_0224"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.972) with cleavage site probability 0.752 at
FT                   residue 20"
FT   gene            239088..239858
FT                   /locus_tag="Rpic_0225"
FT   CDS_pept        239088..239858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0225"
FT                   /product="putative transmembrane cytochrome oxidase complex
FT                   biogenesis factor transmembrane protein"
FT                   /note="KEGG: rso:RSc0369 putative transmembrane cytochrome
FT                   oxidase complex biogenesis factor transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25387"
FT                   /db_xref="GOA:B2UEP1"
FT                   /db_xref="InterPro:IPR002994"
FT                   /db_xref="UniProtKB/TrEMBL:B2UEP1"
FT                   /protein_id="ACD25387.1"
FT                   /translation="MTERVPMRRWFAPVPMLAGVALIALTSLLGRWQLTRAHERIERQA
FT                   RIMALENAPAQRITAQPVTADSVMYRPVLLRGTFDVAHTVLLENRPHVTNDVSRPGFEV
FT                   LIPLMLEGAGGRAVLVDRGWLPRDPADRTRIAPYTTPAGEVQVEGMAVPHASRVFSLGS
FT                   KDGADEVGQRLRQNIDLDAFSREIGVPLQPFVVQQQSDVEDGLLRDWPRADLGAERNYG
FT                   YAFQWFAMAAAVLGLMVFYSVRRYRRLAGTSEPA"
FT   gene            239911..240567
FT                   /locus_tag="Rpic_0226"
FT   CDS_pept        239911..240567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0226"
FT                   /product="putative transmembrane protein"
FT                   /note="KEGG: rso:RSc0370 probable transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25388"
FT                   /db_xref="GOA:B2UEP2"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B2UEP2"
FT                   /protein_id="ACD25388.1"
FT                   /translation="MVNQESAPGAPGTLGSSEDPRIDARTRRGRLMMLFLLLVCASPVI
FT                   ASYLAYYVFTPAGGKAAYGALVDPQRPIPTGLMVQDEHGAEVPLASLKGKWLMVSVDGS
FT                   ACDDNCARKLFTMRQLRIGQGPDRDRIVPVWLVTDRGEIDPRLIKAYNDDYGAVRFLRA
FT                   PDLPKNWLADGKTPPTDHLFLVDPLGNLMMQFPKDPDPKKVRADMTRLLKYSRIG"
FT   gene            240571..241662
FT                   /locus_tag="Rpic_0227"
FT   CDS_pept        240571..241662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0227"
FT                   /product="cytochrome oxidase assembly"
FT                   /note="PFAM: cytochrome oxidase assembly; KEGG: rso:RSc0371
FT                   putative heme O oxygenase (cytochrome AA3-controlling)
FT                   transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25389"
FT                   /db_xref="GOA:B2UEP3"
FT                   /db_xref="InterPro:IPR003780"
FT                   /db_xref="UniProtKB/TrEMBL:B2UEP3"
FT                   /protein_id="ACD25389.1"
FT                   /translation="MLLQLASIGILIALIPLCYVLVKGDRNKYRKLVWITAFLTLDLIM
FT                   FGSFTRLTDSGLGCPDWPGCYGTSNPFHAREDIHAAQAAMPSGPVTWMKAWIEMTHRYF
FT                   ALALGVLIITLVVLAWVKRKELQQSPWYATAVLALVCVQGAFGAWTVTLKLQPAIVVTH
FT                   LLLGMSLLAALIWLGCKNDAPRAVDARGASLRMAVAIGLVLLVVQIALGGWVSTNYAVL
FT                   ACTDFPLCNGQWVPPMDFAHGFTFWRQLGKTAGGDFISHDALVAIHWTHRVFAVVVLSY
FT                   LAWLGARARRIGGLGRVATVLLVVLAVQLATGLSNIVLGWPLLAAVAHNGGAAVLLLLM
FT                   VRLHYLIGLAQARAPMPVAAAVV"
FT   gene            241683..242624
FT                   /locus_tag="Rpic_0228"
FT   CDS_pept        241683..242624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0228"
FT                   /product="protoheme IX farnesyltransferase"
FT                   /note="TIGRFAM: protoheme IX farnesyltransferase; PFAM:
FT                   UbiA prenyltransferase; KEGG: rso:RSc0372 protoheme IX
FT                   farnesyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25390"
FT                   /db_xref="GOA:B2UEP4"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006369"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="UniProtKB/TrEMBL:B2UEP4"
FT                   /protein_id="ACD25390.1"
FT                   /translation="MNTVATPTTSTQLPGWRTTASQYAALTKPRVTQLAVFCAVIGMFL
FT                   ATPGMVPWSVLIGGAVGIWLFAGAAFAINCLVERKIDAMMRRTAWRPSASGELGTRQIL
FT                   VFSLVLGGAGMWTLHVFANDLTMWLTFATFIGYAIIYTLLLKPATPQNIVIGGLSGAMP
FT                   PALGWAAVANSVPAEAWILVLIIFTWTPPHFWALALYRRADYAKSGLPMLPITHGEKYT
FT                   LLHILLYTLIMIAATILPFVYGMSGYIYLVTALVLGFGFLSYAWRMYRKYSDALAQKTF
FT                   RYSIIYLSILFAALLVDHYFKFGPALTQSAAL"
FT   gene            242688..243299
FT                   /locus_tag="Rpic_0229"
FT   CDS_pept        242688..243299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0229"
FT                   /product="electron transport protein SCO1/SenC"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; electron transport protein
FT                   SCO1/SenC; KEGG: rso:RSc0373 probable lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25391"
FT                   /db_xref="GOA:B2UEP5"
FT                   /db_xref="InterPro:IPR003782"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B2UEP5"
FT                   /protein_id="ACD25391.1"
FT                   /translation="MTMLSFRYFRAALFAMLAVAVLALAACSDKPAFKNLDITGSKSFG
FT                   TDFSLTDHTGKRRTLEDFRGKVVVMFFGYTHCPDVCPTTLAELRAVMDTLGKDADRVQV
FT                   LFVTVDPERDTQDLLAKYVPAFDPRFIGLRPANETELKKVASDFKVFYSKVPGSSPDNY
FT                   TMDHTAGSYMFDPKGNLRLFIKHGQGPEPIAHDIKQLLAD"
FT   sig_peptide     242688..242765
FT                   /locus_tag="Rpic_0229"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.474 at
FT                   residue 26"
FT   gene            complement(243366..244295)
FT                   /locus_tag="Rpic_0230"
FT   CDS_pept        complement(243366..244295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0230"
FT                   /product="RNA polymerase, sigma 32 subunit, RpoH"
FT                   /note="TIGRFAM: RNA polymerase sigma factor RpoH; RNA
FT                   polymerase sigma factor, sigma-70 family; PFAM: sigma-70
FT                   region 2 domain protein; KEGG: rso:RSc0374 RNA polymerase
FT                   factor sigma-32"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25392"
FT                   /db_xref="GOA:B2UEP6"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR012759"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:B2UEP6"
FT                   /protein_id="ACD25392.1"
FT                   /translation="MNAVIPVNTVSAIATQPSGNAGNGWALAFPGNLGNIDAYIQSVNR
FT                   VPMLSAEEEQRLAREYRDNDNLDAARRLVLSHLRLVVSIARGYLGYGLPHADLIQEGNI
FT                   GLMKAVKRFDPDQGVRLVSYAMHWIKAEMHEYILKNWRMVKVATTKAQRKLFFNLRSHK
FT                   QDAQATFTSDEIDAVAAELNVKGTEVREMETRLSGGDIALEGQMDDGEESFAPIAYLAD
FT                   THNEPTRVIEARSNDRMQSEGIEAALAKLDDRSRRIIEARWLNVNDDGSGGSTLHELAD
FT                   EFGVSAERIRQIESAAMKKMKGALQAFA"
FT   gene            complement(244494..247412)
FT                   /locus_tag="Rpic_0231"
FT   CDS_pept        complement(244494..247412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0231"
FT                   /product="diguanylate cyclase with PAS/PAC sensor"
FT                   /note="KEGG: rso:RSc0375 probable transmembrane protein;
FT                   TIGRFAM: PAS sensor protein; diguanylate cyclase; PFAM:
FT                   GGDEF domain containing protein; PAS fold-3 domain protein;
FT                   PAS fold-4 domain protein; PAS fold domain protein; SMART:
FT                   PAS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25393"
FT                   /db_xref="GOA:B2UEP7"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B2UEP7"
FT                   /protein_id="ACD25393.1"
FT                   /translation="MVPRRPLVAIAGGIGFLLVLVGLTVMVGWLRHWPWAVKLGSDRLL
FT                   IVFATGVNLTLLGAGLAALLVGTVRPNVRWADPVPRGLGGVVAVLSTLRLAEMITGWPI
FT                   GLDFPGMHTWLDRQWVTGWIGGMHPSHALAMAASATALSLVPTLRKPHRARWFWGLVGL
FT                   AMLLCAGDLLGRAMALEYLYPAWLVWRASDVAAICTLLVVMGVLCVAVVRQPGVLRLRL
FT                   SPEDTIVWISGGCVVLAGLGATITAFIIQVDSVSLTFGTARARALSSYAEELDQLLAMR
FT                   AENPRLVAAATYIQEVLRHPTDNAARLRSESALQAYRQQGYSYLQLRTLADEGIVSLGT
FT                   QTLEPELSIRLHAGLAPERVTLQWVHGFAMRTETPVMADGMQIGWLVAEQPLAHMTGRY
FT                   ASERGIGKTETLAMSGFDARGRAMSFPQRFDAYVFELPALTVDRRPLPSRLALAGEAGY
FT                   GQWQDIHGMPTSFSYTPIGHTGLALISKIASAELYAPMRVQFERLGAFMLCLMIASVLV
FT                   IRLTVRPFANRLAASERALRTANESLERRRDALRASREQLRLVADNVPAQLSYVDSDGI
FT                   VRFASRTLLEAFGRSEGEMLDRHVRDIYAPEDYRTLLPYMTEVLAGYPVQFEITSMRTG
FT                   VPRYLSGHYFPDYDDRGTLRGYFSVLQDLTARTAAELALARSERALKLVLDNAPLLVSH
FT                   INPDGVFTFCNVTHARWLQRTPEEVCGQMPERVFTPGTYALLAPYMVRAQRGESVEFEI
FT                   TAPWYEKPHAAGPRNRTRHFRGQLVPDSAEAHDGRCGFYAFVQDVTAAKRSEMELSRMA
FT                   HFDALTGLPNRYELYERLRAALERRQRLPAPLGVLYLDVDHFKHINDTYGHAAGDTVLV
FT                   EVAHRLQRAVRRTDTVARLAGDEFIILLDPIDAPDDALHTAQKIVSAIRPPIHLSDGTV
FT                   LHVTTSVGVACPGPEVHDPDAALREADRALYWAKSRGRNTAA"
FT   sig_peptide     complement(247329..247412)
FT                   /locus_tag="Rpic_0231"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.647) with cleavage site probability 0.579 at
FT                   residue 28"
FT   gene            247654..248058
FT                   /locus_tag="Rpic_0232"
FT   CDS_pept        247654..248058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0232"
FT                   /product="OsmC family protein"
FT                   /note="PFAM: OsmC family protein; KEGG: rso:RSc0376
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25394"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:B2UEP8"
FT                   /protein_id="ACD25394.1"
FT                   /translation="MSIVVSKDTEGLFRHKVTFPEGVTYTDVPKPTGEGSAPDPHAYFD
FT                   AALASCKALTVTLYARQRKYPLDSIDVAVEHDGTQERQGRYRLRTVLTLHGNLTDEQRA
FT                   DLLRVAGKCPVHKLMTEVEISVDTELAEHA"
FT   gene            248072..248941
FT                   /locus_tag="Rpic_0233"
FT   CDS_pept        248072..248941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0233"
FT                   /product="Pirin domain protein"
FT                   /note="PFAM: Pirin domain protein; KEGG: rso:RSc0377
FT                   putative pirin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25395"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR008778"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B2UEP9"
FT                   /protein_id="ACD25395.1"
FT                   /translation="MTSIQHIIGPHVRDLGGFSVKRVLPSAARQTVGPFIFFDHMGPVN
FT                   FAPGEGIDVRPHPHIGLATVTYLFDGSMVHRDSLGSVQTITPGDVNWMTAGNGIVHSER
FT                   SSPEGREKGARMHGIQTWVALPKDQEKVNASFAHHAAETLPKLECPGVQGVVIAGDAFG
FT                   LTSPVKVSSRTLYVALELAAGASLVIPPEHADRGLYLVDGAVTIDGEALDPQHLAVLEP
FT                   GGDVTLTAQASSRVMLLGGAPTDGHRHIYWNFVASDKADIEDAKQRWESDAFAHVPGET
FT                   ERIPLPSK"
FT   gene            complement(248956..249966)
FT                   /locus_tag="Rpic_0234"
FT   CDS_pept        complement(248956..249966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0234"
FT                   /product="glycosyl transferase family 3"
FT                   /note="PFAM: glycosyl transferase family 3; KEGG:
FT                   rso:RSc0378 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25396"
FT                   /db_xref="GOA:B2UEQ0"
FT                   /db_xref="InterPro:IPR017459"
FT                   /db_xref="InterPro:IPR035902"
FT                   /db_xref="InterPro:IPR036320"
FT                   /db_xref="UniProtKB/TrEMBL:B2UEQ0"
FT                   /protein_id="ACD25396.1"
FT                   /translation="MPAPPILPDTAAEDALANAPFPAARFIKEIGRGADGARALVKHDA
FT                   RALFTAMLESRISDVQLGAILMAYRIKGETPEELDGMLEATHAHCRPLPAPDTPEHALP
FT                   VVIPSYNGARRQPNLVPLLAKLLAREGVPVLVHGIRRFDGRVTTAALFEALGWPLCEHM
FT                   DDARERLERDRLAYVPIDVLSPELTALLDKREIVGLRNSAHTVVKMLQPVGGHAPHEAL
FT                   RLVSYTHPEYRDTLTDYFLRHPANVLLARGTEGEAVADARRGSAVEWLHDGAHETVIEA
FT                   VEGSSDAPPELPVGTDVAATARWIEAVLDGKQPVPEPIAKQVRAIVRCARPAQAA"
FT   gene            complement(250142..250945)
FT                   /locus_tag="Rpic_0235"
FT   CDS_pept        complement(250142..250945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0235"
FT                   /product="nitrate ABC transporter, ATPase subunits C and D"
FT                   /note="KEGG: rso:RSc0379 putative nitrate ATP-binding ABC
FT                   transporter protein; TIGRFAM: nitrate ABC transporter,
FT                   ATPase subunits C and D; PFAM: ABC transporter related;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25397"
FT                   /db_xref="GOA:B2UEQ1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005890"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2UEQ1"
FT                   /protein_id="ACD25397.1"
FT                   /translation="MTDKFLRIENVGQTFKTKRGPFVALRDINLTVARGECIALIGHSG
FT                   CGKSTLLNLIAGLTRPTTGGLILAEREIAGPGPDRAVVFQNHSLLPWLTCFDNVYLAVE
FT                   RVFGKSETKAQLRDRTHAALALVGLSHAEQKYPHEISGGMKQRVGIARALSMEPKVLLM
FT                   DEPFGALDALTRAHLQDELLKIVAATGSTVVMVTHDVDEAVLLADRIVMMTNGPAATIG
FT                   EVLTVDLPRPRDRMALAEDPTYHAYRTAVLDFLYRKQRHPVAEAA"
FT   gene            complement(250963..251814)
FT                   /locus_tag="Rpic_0236"
FT   CDS_pept        complement(250963..251814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0236"
FT                   /product="nitrate ABC transporter, inner membrane subunit"
FT                   /note="TIGRFAM: nitrate ABC transporter, inner membrane
FT                   subunit; PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: rso:RSc0380 putative
FT                   nitrate transmembrane ABC transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25398"
FT                   /db_xref="GOA:B2UEQ2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005889"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B2UEQ2"
FT                   /protein_id="ACD25398.1"
FT                   /translation="MNTLVKTLSGVQSDAAPESRRFAVRDWFVAAVVRGFPPVLGLVLF
FT                   VLAWQGIATAIPALPTPAVTWKAAVALFADPFYRNGPNDQGVGWNVLASLARVGAGFGM
FT                   AAVIGIPAGFLIGRFAFLNAMASPIISLLRPVSPLAWLPIGLLLFKSANPAAIWAIFIC
FT                   SIWPMVINTAVGVTRVPQDYLNVARVLNLSEWKVFTRVLFPAVLPYMLTGVRLSIGTAW
FT                   LVIVAAEMLTGGVGIGFWLWDEWNNLKVEHIVIAIFVIGVVGLLLEHALLAIARRFSYD
FT                   AV"
FT   gene            complement(251870..253150)
FT                   /locus_tag="Rpic_0237"
FT   CDS_pept        complement(251870..253150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0237"
FT                   /product="putative nitrate transporter protein"
FT                   /note="KEGG: rso:RSc0381 putative nitrate transporter
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25399"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:B2UEQ3"
FT                   /protein_id="ACD25399.1"
FT                   /translation="MAAPDKTDALVNPINPKRRSIMKAAATIAGGSAVALIDPLVRAGA
FT                   WAAGSDAPEKTELKVGFIPLTDCASVVMASTLGLDKKYGIKITPSKEASWAGVRDKLVS
FT                   GDLDAAHVLYGLIYGVQLGIGGPKKDMAVLMTLNNNGQAITLSSKLKEAGVKDGASLKA
FT                   VMAKDKREYVFAQTFPTGTHAMWLYYWLAAHGIHPLQDAKAITVPPPQMVANMRVGNMD
FT                   GYCVGEPWGARAIADNIGFTAETTQAIWKDHPEKVLGTTAEFVQKYPNTARALTAAVLE
FT                   ASKFIDASASNRRKTAETIAAKSYVNTDMDIILDRMLGRYTNGLGKTWDDPDPMRFYHD
FT                   GAVNFPYLSDGMWFLTQHKRWGLLKAHPDYLAVAKQVNRVDIFKQAATATGTPLPKSDM
FT                   RTAKLIDGVVWDAKNPAAYADGFKLKA"
FT   gene            complement(253722..254360)
FT                   /locus_tag="Rpic_0238"
FT   CDS_pept        complement(253722..254360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0238"
FT                   /product="response regulator receiver and ANTAR domain
FT                   protein"
FT                   /note="PFAM: ANTAR domain protein; KEGG: rso:RSc0382
FT                   probable response regulator transcription regulator
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25400"
FT                   /db_xref="GOA:B2UEQ4"
FT                   /db_xref="InterPro:IPR005561"
FT                   /db_xref="InterPro:IPR008327"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B2UEQ4"
FT                   /protein_id="ACD25400.1"
FT                   /translation="MQAKPPTPSAPPAANHPAAPMRVLLVRDPLDAEQINLELIRAGLA
FT                   EAGFVDVGLADADLTLPERIAETQPDMVIVASESAARDTIEHVCVATQHAPRPIVLFTD
FT                   NDDATRIKTAFAAGITAYIVDGIKPTRVKAVLDVAYARFEHERELRAELDTAKTQLAER
FT                   KVLERAKGMLMKQMNLSEDDAFKRLRKMAMDRNIKLVEAAQRVIDVMAG"
FT   gene            254508..255209
FT                   /locus_tag="Rpic_0239"
FT   CDS_pept        254508..255209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0239"
FT                   /product="5-carboxymethyl-2-hydroxymuconate
FT                   Delta-isomerase"
FT                   /EC_number="5.3.3.10"
FT                   /note="PFAM: fumarylacetoacetate (FAA) hydrolase; KEGG:
FT                   rso:RSc0383 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25401"
FT                   /db_xref="GOA:B2UEQ5"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:B2UEQ5"
FT                   /protein_id="ACD25401.1"
FT                   /translation="MTDFVVTPPAVNGIPVRGGHGQFPVRRVYCVGRNYAAHAREMGSD
FT                   PDREPPFFFCKPADAVRYVADGETGQFVYPTETKDCHYEIELVVAIGTGGRDIAVETAA
FT                   HHVYGYAIGLDMTRRDLQNAAKKGGRPWETGKAFDGSAPIGPIVPAKDVAHPDKGAVTL
FT                   SVNGREHQRGDLSDLIWSVPETIAYLSRLFELRPGDLIYTGTPEGVGPVVVGDLMVGKI
FT                   DGVGELHVKVI"
FT   gene            255236..255886
FT                   /locus_tag="Rpic_0240"
FT   CDS_pept        255236..255886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0240"
FT                   /product="maleylacetoacetate isomerase"
FT                   /note="TIGRFAM: maleylacetoacetate isomerase; PFAM:
FT                   Glutathione S-transferase domain; KEGG: rso:RSc0384
FT                   probable maleylacetoacetate isomerase (glutathione
FT                   transferase zeta 1) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25402"
FT                   /db_xref="GOA:B2UEQ6"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR005955"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR034330"
FT                   /db_xref="InterPro:IPR034333"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:B2UEQ6"
FT                   /protein_id="ACD25402.1"
FT                   /translation="MSIKLYNYFRSSASFRVRIALEVKGLPYDYAPVHLLKGEQLAPDF
FT                   VKLNPDALVPVLCDGNDVLNQSLAIVEYLEETHPEPTLLPGSASNRAHIRAIALAIACE
FT                   IHPLNNPRVLKYLKHTFNVEEEARNEWYRHWVKLGFAALETRLSQSPLTGAYCVGDTPT
FT                   LADVCLVPQVFNGKRFDVAVEDYPTLARIFAHCMAQEAFQRAAPAAQPDAVSA"
FT   gene            complement(255967..257151)
FT                   /locus_tag="Rpic_0241"
FT   CDS_pept        complement(255967..257151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0241"
FT                   /product="signal recognition particle-docking protein FtsY"
FT                   /note="KEGG: rso:RSc0386 putative cell division protein;
FT                   TIGRFAM: signal recognition particle-docking protein FtsY;
FT                   PFAM: GTP-binding signal recognition particle SRP54 G-
FT                   domain; GTP-binding signal recognition particle SRP54
FT                   helical bundle; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25403"
FT                   /db_xref="GOA:B2UEQ7"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:B2UEQ7"
FT                   /protein_id="ACD25403.1"
FT                   /translation="MFSFWKKRKAEPQPAAEPTPAAAPEAAQAPAPAAIPGPAPVPAPV
FT                   AAPQPVAAPAPGPVAAPVHTAVPDAPAVQPPLDMQTDDIETVPTPAVIEQARKGWMSRL
FT                   RSGLSKTSKGLTTLFVGVKVDEALFEELETALLMADAGVDATEYLLGELRRRIKAQRIE
FT                   TAEGVKTALRDLLVELLHPLEKTMVLGREQPMVIMIAGVNGAGKTTSIGKLCKHFQTYG
FT                   QSVLLAAGDTFRAAAREQLVIWGQRNNVTVVAQESGDPAAVIFDAVNAARARGIDIVMA
FT                   DTAGRLPTQLHLMEELKKVRRVTAKAMATAPHETLLVIDGNTGQNALAQVKAFDEALGL
FT                   TGLIVTKLDGTAKGGILAAIARQRPVPVYFIGVGEQVEDLQPFSAREFADALLG"
FT   gene            257275..258708
FT                   /locus_tag="Rpic_0242"
FT   CDS_pept        257275..258708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0242"
FT                   /product="peptidase M16 domain protein"
FT                   /note="PFAM: peptidase M16 domain protein; KEGG:
FT                   rso:RSc0387 putative zinc protease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25404"
FT                   /db_xref="GOA:B2UEQ8"
FT                   /db_xref="InterPro:IPR001431"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:B2UEQ8"
FT                   /protein_id="ACD25404.1"
FT                   /translation="MALAAGLLAGHVGAQELAAAPGRPVAAASSAKVGASQSDTHEYKL
FT                   PNGLQLIVKEDHRAPTVAHMVWYHAGSIDEHNGTTGVAHMLEHMMFKGTKAVGPGEFSR
FT                   RVAALGGRENAMTTRDFTMYFQQIEKSHLADVMGLEADRMANLQLTDKEFKPEMNVVKE
FT                   ERRMRIDDSARSTVYEQMLATLFNAAPYRNPTIGWPGDLDTMTVQDAQNWYHAWYTPNN
FT                   VTVIVAGDVKPDEVFRLAQRTYGKLKPHALPRRYAQEEPKQIGVKRIWVKAPAENPYVV
FT                   LAYKVPRLSDVEKDVDPYALEVLSAVLDGYDNARLPSQLVKGEKRIADDVNAGYDGLNR
FT                   GPSIFLMDGTPADGHTTAEIEQALRGQIERIAKEGVTDAELKRVKAQVVAAQIYKRDSV
FT                   FGQGMEIGMNEMSGLSWRSIDRQLEKIKGVTSAQIQHVAQTYFSEDNLVVATLLPQPID
FT                   PNKPARKPVPGMRDEGGLR"
FT   gene            258708..260060
FT                   /locus_tag="Rpic_0243"
FT   CDS_pept        258708..260060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0243"
FT                   /product="peptidase M16 domain protein"
FT                   /note="PFAM: peptidase M16 domain protein; KEGG:
FT                   rso:RSc0388 putative zinc protease-like signal peptide
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25405"
FT                   /db_xref="GOA:B2UEQ9"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="UniProtKB/TrEMBL:B2UEQ9"
FT                   /protein_id="ACD25405.1"
FT                   /translation="MRAMSLTLKTALVAIVAAAAQSALAALPIEHWTATTGARVYFVPS
FT                   PSIPMLDINLDVDAGSRYEPAAKVGLASLTAGMLDKGVAAQGNAPARDEAAIADAFADV
FT                   GASFGGGAGGDRTSLRLRTLSDPVERGPAIALMTQIISAPTFPDAVLARDKQRLVAAIR
FT                   ESLTKPSVLAERAFGKAIYGTHPYGQTAAPETVESITRDDIVRYYQANYTAKRAVVTLI
FT                   GAISRQEAEAIAEQITRGLPADGATPPALPDVKMPLAKAETIRIPHPAQQATIILGQPG
FT                   IARGDKDYFPLLVGNYVLGGGGFSARLTNEVREKRGLTYSIGSYFAPAAQPGPFELALQ
FT                   TRKDQTEEALGVVRDTVAKFVADGPTDVELKAAKDNLVNGFPLRLDSNRKLLDNVANIG
FT                   WYNLPLDYLDTWTQRIAAVTRDQVRTAFQRALQPQTMATIVVGGPEKAAAN"
FT   sig_peptide     258708..258785
FT                   /locus_tag="Rpic_0243"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 26"
FT   gene            260154..260810
FT                   /locus_tag="Rpic_0244"
FT   CDS_pept        260154..260810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0244"
FT                   /product="methyltransferase"
FT                   /note="TIGRFAM: methyltransferase; PFAM: Protein of unknown
FT                   function methylase putative; KEGG: rso:RSc0389 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25406"
FT                   /db_xref="GOA:B2UER0"
FT                   /db_xref="InterPro:IPR004398"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B2UER0"
FT                   /protein_id="ACD25406.1"
FT                   /translation="MAPRTPSSKGPKAKTATSHARAPQQVRIIGGQYKRTPLPVIDADG
FT                   LRPTSDRVRETVFNWLGHDLTGWRCADIFAGTGALGFEAASRGAAHVTLVENHAQAVRA
FT                   LHAIRDKLGARMVDIVSGDAFAWLARQPDAALDAVFIDPPFAQDWTLRALEAAARVVKP
FT                   GGVIYVEAAQQLADVSADSHGGEPAAGIGLPADLVLHKHLRAGAVHAHLLLRKNG"
FT   gene            261008..261511
FT                   /locus_tag="Rpic_0245"
FT   CDS_pept        261008..261511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0245"
FT                   /product="pantetheine-phosphate adenylyltransferase"
FT                   /EC_number="2.7.7.3"
FT                   /note="KEGG: rso:RSc0390 phosphopantetheine
FT                   adenylyltransferase; TIGRFAM: pantetheine-phosphate
FT                   adenylyltransferase; cytidyltransferase-related domain
FT                   protein; PFAM: cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25407"
FT                   /db_xref="GOA:B2UER1"
FT                   /db_xref="InterPro:IPR001980"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2UER1"
FT                   /protein_id="ACD25407.1"
FT                   /translation="MVIAVYPGTFDPFTRGHEDLVRRASNIFDELIVGVAQSPNKRPFF
FT                   ALEERIEIAREVLGHYPNVRVEGFSGLLKDFVRKNGARVIVRGLRAVSDFEYEFQMAGM
FT                   NRYLLPDVETMFLTPSDQYQFISGTFVREIAVLGGDVSKFVFPSVEKWLKEKTGKTEGS
FT                   GKSE"
FT   gene            261562..261825
FT                   /locus_tag="Rpic_0246"
FT   CDS_pept        261562..261825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0246"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: rso:RSc0391 probable ferredoxin protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25408"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B2UER2"
FT                   /protein_id="ACD25408.1"
FT                   /translation="MALMITDECINCDVCEPECPNGAISMGPEIYVIDPGKCTECVGHF
FT                   DEPQCQQVCPVDCIPKDPAHEETHDQLMQKYTQLTSAPPRAA"
FT   gene            complement(261893..262528)
FT                   /locus_tag="Rpic_0247"
FT   CDS_pept        complement(261893..262528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0247"
FT                   /product="putative proline-rich transmembrane protein"
FT                   /note="KEGG: rso:RSc0392 probable proline-rich
FT                   transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25409"
FT                   /db_xref="GOA:B2UER3"
FT                   /db_xref="InterPro:IPR025392"
FT                   /db_xref="UniProtKB/TrEMBL:B2UER3"
FT                   /protein_id="ACD25409.1"
FT                   /translation="MTPFAILTSRPAVLAGLALGLAASLPVHAQVYRCSENGQTTYSDH
FT                   PCGTRAKPVPLIDNTPSAADQKAARERASAEAAEVQQMETARRKAQAAEDAREAQMAAQ
FT                   AAEQARRDQRQKVVVAQEGVRYCHRVYVGPLPYPQPYPTPMPVIRQPPAPAAGALRQPG
FT                   NGPKPFAQAPVAPTPIVPRPPHPHYPYYRIVCEPGYAYEGPEDLLPIQ"
FT   sig_peptide     complement(262439..262528)
FT                   /locus_tag="Rpic_0247"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 30"
FT   gene            complement(262553..263155)
FT                   /locus_tag="Rpic_0248"
FT   CDS_pept        complement(262553..263155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0248"
FT                   /product="Aminoacyl-tRNA hydrolase"
FT                   /EC_number="3.1.1.29"
FT                   /note="PFAM: peptidyl-tRNA hydrolase; KEGG: rso:RSc0393
FT                   peptidyl-tRNA hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25410"
FT                   /db_xref="GOA:B2UER4"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2UER4"
FT                   /protein_id="ACD25410.1"
FT                   /translation="MIKLIVGLGNPGAEYAATRHNAGFWLVDQLARMGNVTLRNETRFH
FT                   GYAARANLWGNEVWLLQPQTFMNRSGLATVALARFYKVMPDEILVVHDELDLPPGTVKL
FT                   KLGGGSGGHNGLKDIAAHLTTQQFWRLRLGIGHPRNLLPPGTAASGQHDVANFVLKAPR
FT                   KEEQDLIDRAIDQSLDALPELIAGNAEKAMMRLHTAH"
FT   gene            complement(263325..263951)
FT                   /locus_tag="Rpic_0249"
FT   CDS_pept        complement(263325..263951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0249"
FT                   /product="ribosomal 5S rRNA E-loop binding protein
FT                   Ctc/L25/TL5"
FT                   /note="TIGRFAM: ribosomal 5S rRNA E-loop binding protein
FT                   Ctc/L25/TL5; PFAM: ribosomal protein L25; KEGG: rso:RSc0394
FT                   50S ribosomal protein L25/general stress protein Ctc"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25411"
FT                   /db_xref="GOA:B2UER5"
FT                   /db_xref="InterPro:IPR001021"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR020055"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020057"
FT                   /db_xref="InterPro:IPR029751"
FT                   /db_xref="InterPro:IPR037121"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2UER5"
FT                   /protein_id="ACD25411.1"
FT                   /translation="MKVVAFERSVQGTGASRRLRNSGKTPAIIYGAGAEPKLIELDHNA
FT                   LYHALKKEAFHSSILDIEVAGKVEKALLRDFQLHPFKQLVLHVDFQRVSAKEKIHVKVP
FT                   LHFLNQETAPGVKLGHGIVNHILNDVEVSCLPADLPEFIEVDLGTLEIGQTLHIADLKL
FT                   PKGVTILTHGGDENPAVANISVPAGEKSAAAEEGAAAAGEDKPAA"
FT   gene            complement(264104..265054)
FT                   /locus_tag="Rpic_0250"
FT   CDS_pept        complement(264104..265054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0250"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /EC_number="2.7.6.1"
FT                   /note="KEGG: rso:RSc0395 ribose-phosphate
FT                   pyrophosphokinase; TIGRFAM: ribose-phosphate
FT                   pyrophosphokinase; PFAM: phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25412"
FT                   /db_xref="GOA:B2UER6"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="InterPro:IPR037515"
FT                   /db_xref="UniProtKB/TrEMBL:B2UER6"
FT                   /protein_id="ACD25412.1"
FT                   /translation="MSSEGLMVFTGNANPKLAEAVVKHLGIPLGKALVGRFSDGEVQVE
FT                   IQENVRGKHVFILQSTCAPTNDNLMELMVMVDALKRASARRITAAIPYFGYARQDRRPR
FT                   SARVAITAKVVANMLEVAGVERVLTMDLHADQIQGFFDIPVDNIYASPILLEDLRKKNY
FT                   EDLLVVSPDVGGVVRARALAKQLGVDLAIIDKRRPKANVAEVMNIIGEVDGRNCVIMDD
FT                   MIDTGGTLCKAAQVLKERGAKQVFSYCTHPVLSGGAAARIADSALDEVVVTDTIPLRED
FT                   AIKCGKIRQLSTAPLLAETFTRIVRGDSIMSLFAE"
FT   gene            complement(265135..265211)
FT                   /locus_tag="Rpic_R0001"
FT                   /note="tRNA-Gln1"
FT   tRNA            complement(265135..265211)
FT                   /locus_tag="Rpic_R0001"
FT                   /product="tRNA-Gln"
FT   gene            complement(265262..266131)
FT                   /locus_tag="Rpic_0251"
FT   CDS_pept        complement(265262..266131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0251"
FT                   /product="4-diphosphocytidyl-2C-methyl-D-erythritol kinase"
FT                   /EC_number="2.7.1.148"
FT                   /note="KEGG: rso:RSc0396
FT                   4-diphosphocytidyl-2-C-methyl-D-erythritol kinase; TIGRFAM:
FT                   4-diphosphocytidyl-2C-methyl-D-erythritol kinase; PFAM:
FT                   GHMP kinase; GHMP kinase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25413"
FT                   /db_xref="GOA:B2UER7"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2UER7"
FT                   /protein_id="ACD25413.1"
FT                   /translation="MSSAPVELRDCPAPAKLNLFLHVVGRRPDGYHLLQTVFQLIDWSD
FT                   TLHFARRPDRRLVRTTDILGVPADDDLVIRAARLLQAETGCTYGVDIAIEKRLPMGGGL
FT                   GGGSSDAATTLLALNRLWGLDLPRAQLMKIGLKLGADVPFFVFGQNAFAEGIGEKLTPI
FT                   TLPPAAFVVIHPRVHVPTPAIFSDEGLTRDTPLTIITDFPDQQIVFAYGRNDLQAVAER
FT                   KYGEIARALVWLRQFSPLARMTGSGACVFAPFDNVEHAQAVADQVPSEWEGRCAAGLTH
FT                   HPLARFAV"
FT   gene            complement(266146..266769)
FT                   /locus_tag="Rpic_0252"
FT   CDS_pept        complement(266146..266769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0252"
FT                   /product="outer membrane lipoprotein LolB"
FT                   /note="PFAM: outer membrane lipoprotein LolB; KEGG:
FT                   rso:RSc0397 outer membrane lipoprotein LolB"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25414"
FT                   /db_xref="GOA:B2UER8"
FT                   /db_xref="InterPro:IPR004565"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2UER8"
FT                   /protein_id="ACD25414.1"
FT                   /translation="MAMRFAHALGALMLGAGCALFSGCASLRPANDLFAGTQDADTNIT
FT                   RYQGRFSARYTQNNAEQSAVGSFLWRERGPDVQLELMSPLGQTLAIVSQSNQGATLELP
FT                   NQPPRRAPEVDTLMQDALGFSLPVSGLRDWLRARPAPGTPARVARDAQSRPETIEQNGW
FT                   TVHYVAWTDDGNNTDGAKVGIRRLDLDRPQGTNGPLSVRLVLDQ"
FT   sig_peptide     complement(266686..266769)
FT                   /locus_tag="Rpic_0252"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.979) with cleavage site probability 0.669 at
FT                   residue 28"
FT   gene            complement(266769..268706)
FT                   /locus_tag="Rpic_0253"
FT   CDS_pept        complement(266769..268706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0253"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: rso:RSc0398
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25415"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:B2UER9"
FT                   /protein_id="ACD25415.1"
FT                   /translation="MPHALSRSPATQRPRRFLRSRTALLAALVVGGLTSLPAWSSQSVA
FT                   GAPLIAQAAQEGGTGGRAAIQIERSRPRPGLLRSERTDLPRVALTEDIMYRVLASEVSL
FT                   QRGLVEPAYRTYLGLAQDTRDPRFAQRATEIAFLTRSPAQALTATRLWVELSPTSMPAR
FT                   QVQQLLLVATGQWSEVEPMLQAQLNKVSPGQRADALLQLQQQMSKSSDPAGAVGALQRI
FT                   ASHDMQRPETHLALARAKVAAKDTAGALTELDTALKLRPGYEDAAILAAELRADSDPDA
FT                   AITGLRSFLKAAPASIDGHLALARMYLVRNQQDKARAEFETLKKIAPNDARITLALGLL
FT                   NLQQRQYDDAERYLKEYVTATAKSPTLSPEPGYQGLAQLAEEKRDYAGALGWVDKITGS
FT                   ANGDTDGQTALAAGIKRGQLLGKLRRIDEAQQTFDELVADSEDVPDGPRRQALMDGIRQ
FT                   AEIGMLMDAKAYGRARARVNELLKNDPDNVEYSYQLAMLEEHDGHYDNMETLLRKVIDL
FT                   RPGQAIGYNALGYSLADRSVRLQEAQELLEKAVSLAPDDPYIADSLGWVKYRRGDLPAA
FT                   TDILRKAWATAPQAEIGAHLGEVLWQSGKQDDARQIWTEASKLDVNDTTLRDTLRRFGQ
FT                   PVPNVPVSTN"
FT   sig_peptide     complement(268584..268706)
FT                   /locus_tag="Rpic_0253"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.773 at
FT                   residue 41"
FT   gene            268808..269683
FT                   /locus_tag="Rpic_0254"
FT   CDS_pept        268808..269683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0254"
FT                   /product="formamidopyrimidine-DNA glycosylase"
FT                   /EC_number="3.2.2.23"
FT                   /note="KEGG: rso:RSc0399 formamidopyrimidine-DNA
FT                   glycosylase; TIGRFAM: formamidopyrimidine-DNA glycosylase;
FT                   PFAM: Formamidopyrimidine-DNA glycosylase catalytic domain
FT                   protein; Formamidopyrimidine-DNA glycolase, H2TH DNA
FT                   binding"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25416"
FT                   /db_xref="GOA:B2UES0"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2UES0"
FT                   /protein_id="ACD25416.1"
FT                   /translation="MPELPEVEVTRLGLLPHITGRRIVRAVVRHHGLRWPVDPALPELL
FT                   AGLTVTRLLRRGKYLLIECVPEVEQSGRAADTVGGWLLIHLGMTGTLRVLETPVPPGLH
FT                   DHVDIELAGATGVHVTLRYRDPRRFGAVLWHAGDEAGLAEHPLLRNLGIEPFDARFDGD
FT                   WMFARTRGRRVAIKSALLAGDIVVGVGNIYCSESLFRAGIRPTTAAGRISRPRYAALAD
FT                   AIRATLADAIARGGSTLRDFVGSDGQSGYFQLEAFVYDRAGLPCRACGTPIRQIVQGQR
FT                   STFCCPTCQR"
FT   gene            269969..271915
FT                   /locus_tag="Rpic_0255"
FT   CDS_pept        269969..271915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0255"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RSc0400 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25417"
FT                   /db_xref="InterPro:IPR022812"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2UES1"
FT                   /protein_id="ACD25417.1"
FT                   /translation="MMNNTLSTQFEQYSAWRASVLQSVGEFQDWLQAQELYDAQADMRA
FT                   QRIRGVLRSDKLKVAFIAEFSRGKSELINAIFFADFGRRILPSSAGRTTMCPTELMYDE
FT                   SYPPSIRLLPIETRLHDASTADFRDAGSHWLSVPLDPSSPEGMLEAFRHVVETVRVPKE
FT                   EAEQLGLYNDADPDAAFSVDAAGTVEVSKWRHAIINFPHPMLKQGLVILDTPGLNAIGT
FT                   EPELTLRLIPDAHVVVFVLAADAGVTKSDLELWRSHVGGGQRKGCIAVLNKVDGLWDPL
FT                   KSEEEVENEVSRQIMTTAQVLDIDVERVYPVSAQKGLVAKVSHDHELLAKSRLLELESV
FT                   LSDQLIPQRREIVTEQVQLAVKDMATGAQQLLQMRRRDIVEQLFELRGLRGKNHTMVKH
FT                   MLMRVQGEKEEFEQSIAKFQALRTVFGRHSAEIIKSVQLKQIRSTMREAREKMKERVFS
FT                   RGLRDDMDKLFGHLTGLVRDAANRIDQLHQMVDGMYKKFNAEHGFTLSPPLRFLGTRYD
FT                   ADLKETLMLAHNHFGAFSFLTRPKPQLVHGAFSTVASRVLDTFQDMNRDIEIWLKSVMT
FT                   PLEAQVRDHQKQLRKRVDSIERIHEATDTLEARITELEALLNTLDERSGTIAQYTDRIL
FT                   AAGTILERQSFAA"
FT   gene            272019..273167
FT                   /locus_tag="Rpic_0256"
FT   CDS_pept        272019..273167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0256"
FT                   /product="A/G-specific adenine glycosylase"
FT                   /note="TIGRFAM: A/G-specific adenine glycosylase; PFAM:
FT                   helix-hairpin-helix motif; HhH-GPD family protein; KEGG:
FT                   rso:RSc0401 probable A/G-specific adenine glycosylase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25418"
FT                   /db_xref="GOA:B2UES2"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR005760"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="InterPro:IPR029119"
FT                   /db_xref="UniProtKB/TrEMBL:B2UES2"
FT                   /protein_id="ACD25418.1"
FT                   /translation="MTASPRRTRRVAQPVPVLPPLPDDFATRVIAWQQRHGRHHLPWQN
FT                   TGDAYRTWLSEIMLQQTQVSAVLGYYARFIERFPTVQALAAAPADDVMAAWAGLGYYTR
FT                   ARNLHRCAQIVVAEHGGIFPRDPDVLVALPGIGRSTAAAIAAFSYGVRAAILDGNVKRV
FT                   FARAFGIDGFPGDKRVEDTMWRIAETVLPPAEGIQPYTQGLMDLGATVCTRGKPACLTG
FT                   ERACPLESLCEARSTGRVMELPVPRPRKAIPERAATLVIALHADAVLLQRRPQRGIWGG
FT                   LWSLPLVGEMDDALDAHPLNVDTVRRAAQAYGAVSTLEMAGALTHTFTHFRLQMHLLRA
FT                   EIASPAALGDDWRWIPLAQLNSVGLPAPVKLALETLVQPSLI"
FT   gene            complement(273198..273851)
FT                   /locus_tag="Rpic_0257"
FT   CDS_pept        complement(273198..273851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0257"
FT                   /product="peptidase S16 lon domain protein"
FT                   /note="PFAM: peptidase S16 lon domain protein; KEGG:
FT                   rso:RSc0402 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25419"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:B2UES3"
FT                   /protein_id="ACD25419.1"
FT                   /translation="MQEDIALSPFSPLPPLPTELPLFPLHTVLFPGGLLPLRIFEARYM
FT                   DMVRTCLRDKTPFGVCLIERGNEVATTDGTTVPVDVGCIAHIVECDMEQLGLLMIKVRG
FT                   TQRFKVLSFETTPDGLMRGTVEPIGADVEDCKGELFDDCVGALRRIITTLGSREDGNVP
FT                   MVEPYEWNSPSWVANRLCELLPVPLKAKQKLMELMDAGMRIEIVHRYMKQHHIL"
FT   gene            complement(273954..274847)
FT                   /locus_tag="Rpic_0258"
FT   CDS_pept        complement(273954..274847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0258"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   rso:RSc0403 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25420"
FT                   /db_xref="GOA:B2UES4"
FT                   /db_xref="InterPro:IPR005337"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2UES4"
FT                   /protein_id="ACD25420.1"
FT                   /translation="MRIILITGMSGSGKSVALNVLEDAGYYCVDNLPAQFIPELARYLA
FT                   DQGYTHLGVATDIRSRESLRKVPETVTVLRKEHDVRMLFLTASTTALVQRYSETRRRHP
FT                   LSIRNGRPDTAANVQAAAKGLDTSLIEAIEMERELLSPLADPAHRIDTSTLRTNALRAY
FT                   IKEFISDEPHDITLMFESFGFKHGVPTDADLVFDVRSLPNPYYDTQLRPLTGRDQPVID
FT                   FLQSQPMVLAMAEDIRAYVEKWLPSFIADNRSYLTVAIGCTGGQHRSVYIAERLATYFR
FT                   AHGNVLVRHRELAVDG"
FT   gene            complement(274942..275283)
FT                   /locus_tag="Rpic_0259"
FT   CDS_pept        complement(274942..275283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0259"
FT                   /product="conserved hypothetical signal peptide protein"
FT                   /note="KEGG: rso:RSc0404 hypothetical signal peptide
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25421"
FT                   /db_xref="InterPro:IPR011690"
FT                   /db_xref="UniProtKB/TrEMBL:B2UES5"
FT                   /protein_id="ACD25421.1"
FT                   /translation="MKQLIAACALALPFLAGQAFAQGSAPAAAPAAPAAAPAAKNSQQD
FT                   KMKQCNMDAAGKKGDERKAFMKGCLSDKPAAAAKPMTQQEKMAACSKANKGKKGDEYKN
FT                   AQKACLSNG"
FT   sig_peptide     complement(275218..275283)
FT                   /locus_tag="Rpic_0259"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 22"
FT   gene            complement(275471..276445)
FT                   /locus_tag="Rpic_0260"
FT   CDS_pept        complement(275471..276445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0260"
FT                   /product="HPr kinase"
FT                   /note="PFAM: HPr serine kinase domain protein; KEGG:
FT                   rso:RSc0405 HPr kinase/phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25422"
FT                   /db_xref="GOA:B2UES6"
FT                   /db_xref="InterPro:IPR003755"
FT                   /db_xref="InterPro:IPR011104"
FT                   /db_xref="InterPro:IPR011126"
FT                   /db_xref="InterPro:IPR028979"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2UES6"
FT                   /protein_id="ACD25422.1"
FT                   /translation="MELTGVIAQSIFDDNAADLKLSWVAGLEGADRAFDVDFAKEATSA
FT                   ADLVGHLNLIHPNRIQVLGKPEITYYQRLSEENRKRQMGELILLEPPFLVVADGVDPPP
FT                   DLELRCTRSSTPLFTSPISSAAVIDHLRLYLSRISAPRVTMHGVFLDILGMGVLIMGDS
FT                   GLGKSELGLELISRGHGLVADDAVDFVRLGPDFIEGRCPPLLQNLLEVRGLGLLDIKTI
FT                   FGETAVRRKMKIKLIVQLVRRNDGEFERLPLDSQYLDVLGLPIHMVKIQVAAGRNLAVL
FT                   VEAAVRNTILRLRGIDTLRDFMDRQRAAMQAEAASHSPQGRLL"
FT   gene            complement(276519..276974)
FT                   /locus_tag="Rpic_0261"
FT   CDS_pept        complement(276519..276974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0261"
FT                   /product="PTS IIA-like nitrogen-regulatory protein PtsN"
FT                   /note="TIGRFAM: PTS IIA-like nitrogen-regulatory protein
FT                   PtsN; PFAM: phosphoenolpyruvate-dependent sugar
FT                   phosphotransferase system EIIA 2; KEGG: rso:RSc0406
FT                   putative nitrogen regulatory IIA (enzyme IIA-NTR)
FT                   (phosphotransferase enzyme II, A component) transcription
FT                   regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25423"
FT                   /db_xref="GOA:B2UES7"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR006320"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:B2UES7"
FT                   /protein_id="ACD25423.1"
FT                   /translation="MNRLAKLLPPGNIALDVSVTSKKRVFEQAGLLFENNHGVARAVVT
FT                   DNLFARESLGSTGLGAGVAIPHGRIKGLKQPLAAFMRLSEPVPFESPDGKPVSLLIFLL
FT                   VPEQATQQHLEILSEIAQLLSDRDMREGLATLPSPEAIHQLLTDWRP"
FT   gene            complement(277321..277674)
FT                   /locus_tag="Rpic_0262"
FT   CDS_pept        complement(277321..277674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0262"
FT                   /product="sigma 54 modulation protein/ribosomal protein
FT                   S30EA"
FT                   /note="TIGRFAM: ribosomal subunit interface protein; PFAM:
FT                   sigma 54 modulation protein/ribosomal protein S30EA; KEGG:
FT                   rso:RSc0407 putative sigma-54 modulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25424"
FT                   /db_xref="GOA:B2UES8"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="UniProtKB/TrEMBL:B2UES8"
FT                   /protein_id="ACD25424.1"
FT                   /translation="MNFKLSGHHLDITPALREYVETKLERVIRHFDQVIGVSVLLSVDN
FT                   HKEKDRRQYAEINLHLKGKDVFVESHHEDLYAAIDLLVDKLDRQVIKYKDRVQGHDRDS
FT                   MKHQAFQAVQMQQ"
FT   gene            complement(277725..279236)
FT                   /locus_tag="Rpic_0263"
FT   CDS_pept        complement(277725..279236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0263"
FT                   /product="RNA polymerase, sigma 54 subunit, RpoN"
FT                   /note="TIGRFAM: RNA polymerase sigma-54 factor, RpoN; PFAM:
FT                   sigma-54 factor; sigma-54 factor core-binding region;
FT                   sigma-54 DNA-binding domain protein; KEGG: rso:RSc0408 RNA
FT                   polymerase factor sigma-54"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25425"
FT                   /db_xref="GOA:B2UES9"
FT                   /db_xref="InterPro:IPR000394"
FT                   /db_xref="InterPro:IPR007046"
FT                   /db_xref="InterPro:IPR007634"
FT                   /db_xref="InterPro:IPR038709"
FT                   /db_xref="UniProtKB/TrEMBL:B2UES9"
FT                   /protein_id="ACD25425.1"
FT                   /translation="MKQSLQLRLSQHLALTPQLQQSIRLLQLSTIELQQEVEQALTENP
FT                   LLERENEWLDTSARIGADGSLNALQSNSATPLPTESPPPAPNGGDSSDSSDSSYENGHD
FT                   NGADFDSDYGSDRSDWSLDDFARKPQSDEDDRAPLQLREAEQSLREFLMEQLAPLKLSM
FT                   RDKGLVIFLIESLDDEGYLSGTLDEILADLPPELEVELDELQAALRMLQSFDPPGIGAR
FT                   SAAECLSLQLHRLDSPAKGLALIIVNQHLELLAARDYTRLKKALCVDEPTLKAAHELIR
FT                   SLAPFPGHAFGRAEADFVVPDVIVRKTSAGWMAQLNPDVMPRLRINDMYAQILRSSRGE
FT                   SGAANLQQKLQEARWLIKNIQQRFDTILRVSQAIVERQKSFFTHGEIAMRPLVLREIAD
FT                   TLGLHESTISRVTTNKYMATPMGTFELKYFFGSHVSTETGGAASSTAIRALIKQLVGAE
FT                   DPKNPLSDSRIAELLGEQGFVVARRTVAKYREALKIPAVNLRKSL"
FT   gene            complement(279333..280121)
FT                   /locus_tag="Rpic_0264"
FT   CDS_pept        complement(279333..280121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0264"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: rso:RSc0409 probable ATP-binding ABC transporter
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25426"
FT                   /db_xref="GOA:B2UET0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030921"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:B2UET0"
FT                   /protein_id="ACD25426.1"
FT                   /translation="MSATTLAPKTAAPQATTSSTLVVRHLKKRYGTRTVVKDVSLDVKS
FT                   GEVVGLLGPNGAGKTTSFYMIVGLVALDAGDIVLDGEHISRLPIHQRARMGLSYLPQEA
FT                   SVFRKLNVQENIRAVLELQEQNGKKLSQDEVNRRLDGLLDDLQIAHLRDNPALSLSGGE
FT                   RRRVEIARALASSPRFILLDEPFAGVDPIAVGEIQRIVSFLKDRNIGVLITDHNVRETL
FT                   GICDHAYIISEGTVLAAGMPEQIIENEDVRKVYLGDNFRM"
FT   gene            complement(280152..280739)
FT                   /locus_tag="Rpic_0265"
FT   CDS_pept        complement(280152..280739)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0265"
FT                   /product="lipopolysaccharide transport periplasmic protein
FT                   LptA"
FT                   /note="TIGRFAM: lipopolysaccharide transport periplasmic
FT                   protein LptA; PFAM: OstA family protein; KEGG: rso:RSc0410
FT                   putative signal peptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25427"
FT                   /db_xref="GOA:B2UET1"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="InterPro:IPR014340"
FT                   /db_xref="UniProtKB/TrEMBL:B2UET1"
FT                   /protein_id="ACD25427.1"
FT                   /translation="MTLSLRAAGLAIVAALLLPALPAHAERADRDKPLVLEADNASYDD
FT                   LKQVYHLTGNVVLTKGTMVLRSDQADLRTDPEGYNYAVATSKPGNLAFIRQKRDNVDEY
FT                   IQGWGERIEYDGKQEISKLITRARMERLQGATQLDEIRGAVITYDGQKEFYTASGGAEN
FT                   ATAANPSGRVRAVLAPRTSAPAAPASAPAAKP"
FT   sig_peptide     complement(280662..280739)
FT                   /locus_tag="Rpic_0265"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 26"
FT   gene            complement(280799..281431)
FT                   /locus_tag="Rpic_0266"
FT   CDS_pept        complement(280799..281431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0266"
FT                   /product="protein of unknown function DUF1239"
FT                   /note="PFAM: protein of unknown function DUF1239; KEGG:
FT                   rso:RSc0411 probable transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25428"
FT                   /db_xref="GOA:B2UET2"
FT                   /db_xref="InterPro:IPR010664"
FT                   /db_xref="InterPro:IPR026265"
FT                   /db_xref="UniProtKB/TrEMBL:B2UET2"
FT                   /protein_id="ACD25428.1"
FT                   /translation="MASERSQRLVSSVLQIMLRGLPILLMAIVCGVTFLLVQVNTPQTD
FT                   EAATQPKRHTADYTMDGISATALDETGTTKYRFTGVHMNHYEDDLTYDVTYPALRVYAP
FT                   DRPQVTARADLGKMNGDGTVVDLYNNAKVIRAQGSDARQDPLMTADSTYFQVLLNDDIV
FT                   RTDKPVELHRGPSIMNANGLTFNNVTRQVQLLGNVRGRIEGLGAPKQ"
FT   gene            complement(281436..282032)
FT                   /locus_tag="Rpic_0267"
FT   CDS_pept        complement(281436..282032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0267"
FT                   /product="3-deoxy-D-manno-octulosonate 8-phosphate
FT                   phosphatase, YrbI family"
FT                   /EC_number="3.1.3.45"
FT                   /note="TIGRFAM: hydrolase, HAD-superfamily, subfamily IIIA;
FT                   3-deoxy-D-manno-octulosonate 8-phosphate phosphatase, YrbI
FT                   family; KEGG: rso:RSc0412 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25429"
FT                   /db_xref="GOA:B2UET3"
FT                   /db_xref="InterPro:IPR010023"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B2UET3"
FT                   /protein_id="ACD25429.1"
FT                   /translation="MITLAPFPTDSVHSNIDARFPQAMERAARVRLMVFDVDGVLTDGR
FT                   LLVGPEGEISKAFDTLDGHGIKLLAQAGVTPAIITGRQSEIVAWRAGELGIEHLYQGVA
FT                   DKREAFAHLLAATQLQAADAGYMGDDWPDLPVMTMAGFTACPAQAHAELRSRAHYVAQA
FT                   TGGRGAVREVADLILKAQGAYDALLAQLLQAPQPF"
FT   gene            complement(282049..283032)
FT                   /locus_tag="Rpic_0268"
FT   CDS_pept        complement(282049..283032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0268"
FT                   /product="KpsF/GutQ family protein"
FT                   /EC_number="5.3.1.13"
FT                   /note="KEGG: rso:RSc0413 hypothetical protein; TIGRFAM:
FT                   KpsF/GutQ family protein; PFAM: CBS domain containing
FT                   protein; sugar isomerase (SIS)"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25430"
FT                   /db_xref="GOA:B2UET4"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004800"
FT                   /db_xref="InterPro:IPR035474"
FT                   /db_xref="UniProtKB/TrEMBL:B2UET4"
FT                   /protein_id="ACD25430.1"
FT                   /translation="MIANFNPDRALALAQQTFDIEARAVLGLKTQVSADFARAVEMVLG
FT                   CTGRVVVSGMGKSGHVARKIAATLASTGTPAFFVHPAEASHGDLGMVTRDDVFIGFSNS
FT                   GEVSELNVILPLVKRMGAKLIAVTGNPGSSLGKHADVVLNSHVDVEACPLNLAPTASTT
FT                   AQIALGDALAVAVLDARGFGAEDFARSHPGGSLGRKLLTHVRDVMRAGDAIPRVDQDTP
FT                   LSQALMEITRKGMAMTAVVDAQGHAVGVFTDGDLRRLLETPRDWRTVPINEVMHRNPRS
FT                   IGPDQLAVEAVEVMETHRINQLLVVDAAGLLVGALHIHDLTRAKVI"
FT   gene            283343..285322
FT                   /locus_tag="Rpic_0269"
FT   CDS_pept        283343..285322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0269"
FT                   /product="sodium/hydrogen exchanger"
FT                   /note="PFAM: TrkA-N domain protein; TrkA-C domain protein;
FT                   sodium/hydrogen exchanger; KEGG: rso:RSc0414 putative
FT                   glutathione-regulated potassium-efflux system K+/H+
FT                   antiporter transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25431"
FT                   /db_xref="GOA:B2UET5"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:B2UET5"
FT                   /protein_id="ACD25431.1"
FT                   /translation="MHSPLELTLVLLAAAVIGVVLFRMLQLPPMLAYLVVGVLIGPKAT
FT                   GLESDSAQTRYLAEFGVVFLMFSIGLEFNLSKLRSMRRLVLGLGASQVGLTILLTIPVS
FT                   MVLSHWYPLSWQAGLALGGALAMSSTAIVSKMLAERLQLETEHGRNIISVLLFQDLAVV
FT                   LLLIVVPSLGKNPTDLVLALSIAALKITVALVLILFLGQKLLSRWFHLVAARRSQELFM
FT                   LNLLLVTLGMAALTERLGLSMALGAFLAGMLVSETPYKLQVEEDIKPFRDVLLGLFFVT
FT                   VGMLLDPRVVFEHWALVLGLVMAPVLFKFVLIALLARVFGSGGGAAIRTALGLAQAGEF
FT                   GFVLLNQIDGMRLIDPLLGQAILAAMLLSMLLAPFLIQYSDVIAMRLSRTDWLMQSLAM
FT                   TKIAAQSIATERHVIICGYGRSGQNLAHMVEQEGIGYVALDLDPDRVRDAAAAGEHVVY
FT                   GDAARRESLVAAGIHRAAAVAITYADTASALKVLHHVQALEPTLPVIVRTIDDADLDRL
FT                   QQAGATEVVPEIIEGSLMLASHALVLLGVPLRRVVRRAQEMRDARYSLLRGYFHGQDDE
FT                   EDMLERDAVRLHSVPLAKGSPAIGRKLGTMGLETFKTSVTAIRRQGIRALDPDPDTVLE
FT                   LGDIVVLRGTPEGLQMAEERLSPR"
FT   gene            complement(285332..285736)
FT                   /locus_tag="Rpic_0270"
FT   CDS_pept        complement(285332..285736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0270"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RSc0415 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25432"
FT                   /db_xref="InterPro:IPR027373"
FT                   /db_xref="InterPro:IPR038268"
FT                   /db_xref="UniProtKB/TrEMBL:B2UET6"
FT                   /protein_id="ACD25432.1"
FT                   /translation="MCEIFIRANPHSYDSLARSLRLHGVATSVRLECLFWEVLEEIGQR
FT                   DGLTVNQLISKLYDELFERRGEVANFASFLRVCCLRYLMLKQDGRIPADTRVSISSLDA
FT                   AAVLDGLPPNMADAPPPRRSRGPLLESLVK"
FT   gene            complement(285777..286355)
FT                   /locus_tag="Rpic_0271"
FT   CDS_pept        complement(285777..286355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0271"
FT                   /product="intracellular protease, PfpI family"
FT                   /note="TIGRFAM: intracellular protease, PfpI family; PFAM:
FT                   ThiJ/PfpI domain protein; KEGG: rso:RSc0416 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25433"
FT                   /db_xref="GOA:B2UET7"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR006286"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B2UET7"
FT                   /protein_id="ACD25433.1"
FT                   /translation="MAKKILMLVGDYVEDYEVMVPFQALQMVGHTVHAVCPDKRAGDSV
FT                   ATAVHDFEGAQTYSEKPGHRFTVNATFADVDPAAYDALVVPGGRAPEYLRLNARVLEVV
FT                   RHFFQADKPVAAICHGAQLLSAAGVLEGKACSAYPACGPEVTAAGGTFKDIPVDQAHTD
FT                   GKLVTAPAWPAHPAWLAQFLEVLGTRVLH"
FT   gene            286464..287072
FT                   /locus_tag="Rpic_0272"
FT   CDS_pept        286464..287072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0272"
FT                   /product="adenine phosphoribosyltransferase"
FT                   /note="TIGRFAM: adenine phosphoribosyltransferase; PFAM:
FT                   phosphoribosyltransferase; KEGG: rso:RSc0417 adenine
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25434"
FT                   /db_xref="GOA:B2UET8"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005764"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:B2UET8"
FT                   /protein_id="ACD25434.1"
FT                   /translation="MSQVPHHQAALLTPSSVPASTELGDVSRYLRDRIRTVPDWPQAGV
FT                   MFRDITPLLQDPKSLRVLVDVFVHRYMGQGLNLVAGIDARGFILGSIVAYELNLGFVPI
FT                   RKKGKLPFNTVAEEYMLEYGSATVEIHADACKPGDRVLLIDDLIATGGTMLADKRLLER
FT                   LGATVVEGAAIVDLPELGGSQLLIEGGLPLFTVCRFDGH"
FT   gene            287198..287815
FT                   /locus_tag="Rpic_0273"
FT   CDS_pept        287198..287815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0273"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   rso:RSc0418 probable transport transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25435"
FT                   /db_xref="GOA:B2UET9"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:B2UET9"
FT                   /protein_id="ACD25435.1"
FT                   /translation="MPHVWLFLLTSIAITVMPGPDNLQVIARGASQGRKAGLTAAAGFA
FT                   SGCLFHTTLAALGLAAVLQSSPVAFQAIRWLGAAYLIWLGIQALRSKGGGLGHAGPQAA
FT                   PGLWQVYRQSVFANLLNPKVTLFFVVFLPQFVDAQAGHAALRMLLLGGVFMAQTIVVFS
FT                   AYGWCAAALGGWMRRTPRASLWLDRLSGCIFIGLGLRVALTK"
FT   gene            complement(287846..288331)
FT                   /locus_tag="Rpic_0274"
FT   CDS_pept        complement(287846..288331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0274"
FT                   /product="protein of unknown function DUF355"
FT                   /note="PFAM: protein of unknown function DUF355; KEGG:
FT                   rso:RSc0419 probable transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25436"
FT                   /db_xref="InterPro:IPR007153"
FT                   /db_xref="InterPro:IPR036902"
FT                   /db_xref="UniProtKB/TrEMBL:B2UEU0"
FT                   /protein_id="ACD25436.1"
FT                   /translation="MDLTVVPIVKPEATNFIFGQSHFIKTVEDLHEALVGAVPGIRFGI
FT                   AFCEASGKRLVRWSGNDETALQLARDNALAIGAGHTFLIFLGDGFFPVNVLAAVRAVPE
FT                   VCRIYCATANPTQVIVAQTELGRGVLGVVDGASPLGVETDADIAWRKDLLRQIGYKL"
FT   gene            complement(288415..291279)
FT                   /locus_tag="Rpic_0275"
FT   CDS_pept        complement(288415..291279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0275"
FT                   /product="excinuclease ABC, A subunit"
FT                   /note="TIGRFAM: excinuclease ABC, A subunit; PFAM: ABC
FT                   transporter related; KEGG: rso:RSc0420 probable
FT                   excinuclease ABC subunit A (DNA repair ATP-binding) ABC
FT                   transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25437"
FT                   /db_xref="GOA:B2UEU1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR004602"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041102"
FT                   /db_xref="InterPro:IPR041552"
FT                   /db_xref="UniProtKB/TrEMBL:B2UEU1"
FT                   /protein_id="ACD25437.1"
FT                   /translation="MDEIKIRGARTHNLKNINLDLPRNQLIVITGLSGSGKSSLAFDTL
FT                   YAEGQRRYVESLSAYARQFLQLMEKPDVDLIEGLSPAISIEQKATSHNPRSTVGTVTEI
FT                   HDYLRLLYARAGTPYCPDHGQPLEAQSVSQMVDAVLALPADTKLMILAPVVANRKGEHV
FT                   DLFEAMQAQGFVRFRIRSGGGTAHEAEAKVYEVDNLPKLKKNDKHSIEVVVDRVKVNPE
FT                   LKQRLAESFETALRLADGRAIALEMDTGKEHGFSSKFACPICSYSLQELEPRLFSFNNP
FT                   MGACPHCDGLGQITFFDPKRVVAFPNLSLASGAIKGWDRRNQFYFQMLQSLAAFYDVDI
FT                   DVAFEDLPAEIQEIVLHGSGKQQIPFTYINERGKTTVREHAFEGIIPNLERRYKETDSI
FT                   AVREELAKYQNNQPCPECHGTRLRREARFVKIGEADQARGIYEINGWPLRDALTYFLTL
FT                   NMHGAKREIADKIVKEISARLNFLNNVGLDYLSLERSADTLSGGEAQRIRLASQIGSGL
FT                   TGVMYVLDEPSIGLHQRDNDRLIGTLKHLRDLGNSVLVVEHDEDMIRASDYVVDIGPGA
FT                   GVHGGQIIAEGTPQQVEQSPASLTGDYLSGKRRIEVPKQRTAPDEERWLRIINASGNNL
FT                   KNVSADIPIGLLTCITGVSGSGKSTLINDTLYHAVARHLYGSTPEPAAHDRIDGLEHFD
FT                   KVINVDQSPIGRTPRSNPATYTGLFTPIRELFAGVPSAKERGYDPGRFSFNVKGGRCEA
FT                   CQGDGVLKVEMHFLPDVYVPCDVCHGKRYNRETLEVLYKGKNITEVLEMTVEQAHEFFA
FT                   PVPVVRRKLQTLLDVGLGYIRLGQSATTLSGGEAQRVKLSLELSKRDTGRTLYILDEPT
FT                   TGLHFHDIELLLKVIYKLRDHGNTIVIIEHNLDVIKTADWLLDLGPEGGAGGGQIIAKG
FT                   TPEDVAKSKASFTGKYLAPLLKRK"
FT   gene            291522..292685
FT                   /locus_tag="Rpic_0276"
FT   CDS_pept        291522..292685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0276"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   rso:RSc0421 putative multidrug-efflux transporter
FT                   transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25438"
FT                   /db_xref="GOA:B2UEU2"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2UEU2"
FT                   /protein_id="ACD25438.1"
FT                   /translation="MNGLELRAAASLAGIFALRMLGLFMIMPVFAVFAKTLPDGNNTQL
FT                   VAFAIGVYGLTQAVLYIPYGWLSDRFGRKPVIVTGLVIFAVGSLVAAFSHSVAGIAVGR
FT                   AIQGAGAISSAVIAFVADLTREEHRTKAMAMIGGSIGLSFAVAIVSAPVIFRWVGMPGM
FT                   FTAIGVLAIVAIGVVLWVVPNPPRPPEHVKAPFREVLRHPELLRLNFGVFALHATQTAL
FT                   FVVLPHMLEAAGLPVDSHWKIYLPVMGVSFVLMVPAIIAAEKRGKMKAVLLSAVALVMV
FT                   AQLALGEVNPTLAALAIALLVYFLGFNVLEASQPSLVSKYAPGVRKGAAMGVYNTTQAL
FT                   GLFAGGAGGGWILLHAGQHAVFLTCAALAFAWLIIASPMQMPALRRH"
FT   sig_peptide     291522..291626
FT                   /locus_tag="Rpic_0276"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.974 at
FT                   residue 35"
FT   gene            292737..293294
FT                   /locus_tag="Rpic_0277"
FT   CDS_pept        292737..293294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0277"
FT                   /product="single-strand binding protein"
FT                   /note="TIGRFAM: single-strand binding protein; PFAM:
FT                   single-strand binding protein/Primosomal replication
FT                   protein n; KEGG: rso:RSc0422 single-strand DNA-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25439"
FT                   /db_xref="GOA:B2UEU3"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:B2UEU3"
FT                   /protein_id="ACD25439.1"
FT                   /translation="MASVNKVIIVGNLGADPETRYMPSGDAVTNIRVATTDRYKDKASG
FT                   EMKEATEWHRIAFFGRLAEIAGEYLKKGSSVYIEGRLKTRQWEKDGQKQYSTEIVADQM
FT                   QMLGGRGGEGGGSSGGGGGGYSRGGEGGGGGYGGGRSQGQSQGQGGGYTRGGEGGGGQG
FT                   GGARRQPATSNGFEDMDDDIPF"
FT   gene            293506..293931
FT                   /locus_tag="Rpic_0278"
FT   CDS_pept        293506..293931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0278"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eca:ECA1059 putative integrase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25440"
FT                   /db_xref="UniProtKB/TrEMBL:B2UEU4"
FT                   /protein_id="ACD25440.1"
FT                   /translation="MAEFIAKRVRFQNGEHHSVLTRPGGLPVHEAALYLARHRKRGLAA
FT                   NSIHSVCRVLAFLYRELAQANIDLLERIRPGQFLTAPELNRLAEAAQYGVDDSEHAEKE
FT                   GQRSRKVIDIKRIRMRRGPAAVDVKAVSEARRSATDL"
FT   gene            complement(294000..296619)
FT                   /pseudo
FT                   /locus_tag="Rpic_0279"
FT   gene            295113..295919
FT                   /locus_tag="Rpic_0280"
FT   CDS_pept        295113..295919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0280"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   bxe:Bxe_C0489 putative transposase IS4"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25441"
FT                   /db_xref="GOA:B2U8P5"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:B2U8P5"
FT                   /protein_id="ACD25441.1"
FT                   /translation="MEKRRPYPSDVSDEEWSFAAPYLTLMNQDAPQRRYELRELFNALR
FT                   WLARAGAAWRMLPTNFPPWEAVYQQTQRWLRGGCFEAMVQDLRSVLRVAQGRQGQPSAV
FT                   ILDGRTLQSTCESGPRAGYDGYKRKRGSKVHMAVDTLGHLLAVHITPANEQERAQVQVL
FT                   AREVQLVTGQTVKLAFADQGYTGEEPAQAARDEGIELQVIKLPEAKKGFVLLPRRWVVE
FT                   RSFGWLNRFRRLARDYERLPETLAGLHFVVFAMLMLVHAAPVVQSA"
FT   gene            complement(297160..297495)
FT                   /locus_tag="Rpic_0281"
FT   CDS_pept        complement(297160..297495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0281"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25442"
FT                   /db_xref="UniProtKB/TrEMBL:B2UEU6"
FT                   /protein_id="ACD25442.1"
FT                   /translation="MPKRLHVRPFTVLLMGLALLGGSASAQVVAPTSANTKSAVPAQDS
FT                   PANPSIEDAPLTALPTHVKSGAPPVHGGFEVERCREVNATTGKCVDAMCVGYTDQGVRS
FT                   EHFECVP"
FT   sig_peptide     complement(297415..297495)
FT                   /locus_tag="Rpic_0281"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.902 at
FT                   residue 27"
FT   gene            298828..299634
FT                   /locus_tag="Rpic_0282"
FT   CDS_pept        298828..299634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0282"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   bxe:Bxe_C0489 putative transposase IS4"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25443"
FT                   /db_xref="GOA:B2U8P5"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:B2U8P5"
FT                   /protein_id="ACD25443.1"
FT                   /translation="MEKRRPYPSDVSDEEWSFAAPYLTLMNQDAPQRRYELRELFNALR
FT                   WLARAGAAWRMLPTNFPPWEAVYQQTQRWLRGGCFEAMVQDLRSVLRVAQGRQGQPSAV
FT                   ILDGRTLQSTCESGPRAGYDGYKRKRGSKVHMAVDTLGHLLAVHITPANEQERAQVQVL
FT                   AREVQLVTGQTVKLAFADQGYTGEEPAQAARDEGIELQVIKLPEAKKGFVLLPRRWVVE
FT                   RSFGWLNRFRRLARDYERLPETLAGLHFVVFAMLMLVHAAPVVQSA"
FT   gene            299866..303531
FT                   /locus_tag="Rpic_0283"
FT   CDS_pept        299866..303531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0283"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC and GAF sensor(s)"
FT                   /note="KEGG: rfr:Rfer_1983 diguanylate
FT                   cyclase/phosphodiesterase with PAS/PAC and GAF sensor(s);
FT                   TIGRFAM: PAS sensor protein; diguanylate cyclase; PFAM:
FT                   GGDEF domain containing protein; EAL domain protein; GAF
FT                   domain protein; histidine kinase HAMP region domain
FT                   protein; PAS fold-3 domain protein; PAS fold-4 domain
FT                   protein; PAS fold domain protein; SMART: PAS domain
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25444"
FT                   /db_xref="GOA:B2UEU8"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B2UEU8"
FT                   /protein_id="ACD25444.1"
FT                   /translation="MVKYARLQSLHARIFLVICAAAFPLLIGSGYYLYKQSELVRVAAQ
FT                   VEANQYLTLAAEYAQAEILGAGEALDAISATPSIQSRNWALCNEYLHRLVTQRADRYSN
FT                   IGVVDLNGNLLCSGVPVSARTLFNFADRTYFQLALKRPGLAVGDYQTGRLTGLPAISVA
FT                   TAMRDGGGKPFAVVFASLRLTSLERESPNSVDSEARITILDRNGVILLASDPLIGRVGQ
FT                   SLQRSGLREAFMARARDVRISTDATEPFRLIGSMSAGPRDDPSAITVLYTSRGSAVFSG
FT                   LYRDLRLRALAALALIAIAVSAGWTGTNALIGKNIRRIANAAARMRGRDFHTRVAHEVS
FT                   GSEFQLIAVQLDEMAKELEQREREWMSSIQRQSHQVDLLRRIAQTEPLEGILRSICEFA
FT                   EEQVPGAQASLLLVDEDRCVTSCIAPKLPKSYCDSLIGIRAVSGAGSCGTAIAERRVIV
FT                   SEDIESDPLWVDFRTLATSHGLRACWSYPVISTGDRVFGSFALYFNEQRAPRPDELPVS
FT                   RMAAEVAAVAIDRYQTGEALAQSEAEYRSLFETNPYPMWVSESASGKFLAVNDSAIKHY
FT                   GFSRETFLAMRANDLDAPEQHSQKSEPSTESGGERPTVTSGVKLHRDARGDTLEVELAY
FT                   FPLRFQGRNATLALISDVTYRSALTHTIREQKEFFSLLMGSTVEAICGLDQNGCCTFAN
FT                   AACERLLGYSAQELAGKPMHALIHHTHEDGSPYELAACQIQNSIASGAHVHVDNEVFWR
FT                   SDGTSLPVEYWAYPIVRDGQVAGSIVTFIETSERRRQQDELRRRATFDDLTGLLNRPSF
FT                   VTALETRLQQADASERHPVVAILDLDGFKEINDSLGHATGDQLLRGVAERLTDQLGPHA
FT                   DVGRLGGDEFAFVVDESYGPPIATRIEAVMESIRRPFSIAGLDLAINGSVGAARYPGAG
FT                   LDVDTLLRSADVAMYVAKREGHGFTFTDRVDAGTPRPFLLSELRRALQEDEFILHFQPT
FT                   IPLQGLPHFGFEALIRWNHPRLGIVGPGEFMPMVEVSDLIHPLTEWVIASAVSRFKTII
FT                   ESWPNAFVAVNVSMRNLINQKFTSSVQYLVEQNRFPVNCLKIEVTESAVMADPDRTLRA
FT                   LNELHGLGVRIAVDDFGTGYSSLAYLQKLPVDDLKIDRSFVSGLSGSQPSKAIVHSIIS
FT                   LAHSLGLSVTAEGIESEADMRILRAAGCDFGQGYYIGHPMPFDAVHDWLKSRSFV"
FT   gene            303721..303884
FT                   /pseudo
FT                   /locus_tag="Rpic_0284"
FT   gene            complement(304111..306174)
FT                   /locus_tag="Rpic_0285"
FT   CDS_pept        complement(304111..306174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0285"
FT                   /product="GAF modulated sigma54 specific transcriptional
FT                   regulator, Fis family"
FT                   /note="PFAM: sigma-54 factor interaction domain-containing
FT                   protein; helix-turn-helix Fis-type; GAF domain protein;
FT                   SMART: AAA ATPase; KEGG: reh:H16_B1055 transcriptional
FT                   regulator, PspF-family"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25445"
FT                   /db_xref="GOA:B2UEU9"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:B2UEU9"
FT                   /protein_id="ACD25445.1"
FT                   /translation="MPGAPSDPAPTNDARVSQVSSAWNLLDTPLSGTSWQRQHAAVIEQ
FT                   SHRRSTTYGLQVTDNPDFSALSKAALSLAIEQNRTLYAYALPVMETLYEQISHHHNIVL
FT                   LTDAQGVILHAQGDKDFLEKADRVALSLGVTWSERLRGTNGIGTALVEGAPVQVSANEH
FT                   YLGVNHVLNCSAVPLFDASGKVTGVLNVSGDPGNFPAHTMALVRMSALQIENQLFAAAN
FT                   PDCITLHLHSRPELIGTLMEGMLSFGLDGRYRAVNRSALFQLGLTPSALAGHTLESLLG
FT                   LSVPALFDHYRSATPDPLRVHAANGISLYAKVSIRQRTDCGSLLRPLSADKVGQEAESR
FT                   AGTASPVRARATSGLGQLDTGDPEIARVISKLKKFNGRDIPTLIIGETGTGKELLAQAI
FT                   HEDSPRCAGPFVAVNCASIPETLIESELFGYEEGAFTGARRRGSLGKILQANGGTLFLD
FT                   EIGDMPLTLQARLLRVLQERIVTPLGSAKAIPVNVALVCATHRNLRDMIARGTFRDDLY
FT                   YRLNGLLVKLPPLRQRRDFEAVLNRLLVGEHGGQRFRVAPEVLRLLKTYDWPGNIRQLV
FT                   NLVRSAMVMAEGDEIQLDDLPDDFLEDVRHREQPAQEPPAHDMLPVSADQATLDLLESS
FT                   LIRQVLKSNGGNVSAAARALGVSRNRIYRKLQSLGAAPTSDLQSPQRDSRPL"
FT   gene            306623..306697
FT                   /locus_tag="Rpic_0286"
FT   CDS_pept        306623..306697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0286"
FT                   /product="coenzyme PQQ biosynthesis protein A"
FT                   /note="PFAM: coenzyme PQQ biosynthesis protein A; KEGG:
FT                   mfa:Mfla_0021 coenzyme PQQ biosynthesis protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25446"
FT                   /db_xref="GOA:B2UEV0"
FT                   /db_xref="InterPro:IPR011725"
FT                   /db_xref="UniProtKB/TrEMBL:B2UEV0"
FT                   /protein_id="ACD25446.1"
FT                   /translation="MAWQKPEATDLRFGFEITMYIANR"
FT   gene            306893..308152
FT                   /locus_tag="Rpic_0287"
FT   CDS_pept        306893..308152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0287"
FT                   /product="putative glucose/sorbosone dehydrogenase"
FT                   /note="KEGG: rsh:Rsph17029_1399 putative glucose/sorbosone
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25447"
FT                   /db_xref="GOA:B2UEV1"
FT                   /db_xref="InterPro:IPR011041"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR012938"
FT                   /db_xref="UniProtKB/TrEMBL:B2UEV1"
FT                   /protein_id="ACD25447.1"
FT                   /translation="MTSKLAARLALLCAAVSCSVAAQAQDNMQKLEGFKSTGASLNIET
FT                   VPQGGARAAALKANLKQVKLPPGFKIDLYAIVPDARHMAVGPNTGVVFVGTRKTRVWAV
FT                   SDRTKSRVADEVKVFAPSVSFKIPNGLCFSPDGVLYVAEQNRVLAFPAADFFYESPDVA
FT                   TAPVVPQGELIPVEEESFNHTARTCRIGPDDKLYITLGNPFNVPPKEKVALYDKVGMMG
FT                   IIRMDRDGKHREVFARGVRNSVGMDFNPKDKTLWFTDNQVDGMGDDIPPGELNRATKAG
FT                   ENFGFPWYGGGHIRTVEYKSETPPSGVVFPQVEMAAHAADLGMTFYKGKMFPAKYQGGV
FT                   FSAQHGSWNRTTPVGARIMYTPVKADGTAGKTEVFAEGWLTSNNEYLGRPVDVATLPDG
FT                   SLLISDDYAGAIYRVSYAAE"
FT   sig_peptide     306893..306967
FT                   /locus_tag="Rpic_0287"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.937 at
FT                   residue 25"
FT   gene            308139..308462
FT                   /locus_tag="Rpic_0288"
FT   CDS_pept        308139..308462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0288"
FT                   /product="cytochrome c class I"
FT                   /note="PFAM: cytochrome c class I; KEGG: psa:PST_0367
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25448"
FT                   /db_xref="GOA:B2UEV2"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:B2UEV2"
FT                   /protein_id="ACD25448.1"
FT                   /translation="MRRSKGLLGLGAALMLAAAPAIAAGSGAPAKATQCFACHGADGLS
FT                   KAPDAPNLAGQNEQYLVKALQDFRSGARAHEVMSMMAKGLSDQDIQAVSAYFSAIAISV
FT                   KAP"
FT   sig_peptide     308139..308210
FT                   /locus_tag="Rpic_0288"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.979 at
FT                   residue 24"
FT   gene            308553..309488
FT                   /locus_tag="Rpic_0289"
FT   CDS_pept        308553..309488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0289"
FT                   /product="coenzyme PQQ biosynthesis protein B"
FT                   /note="TIGRFAM: coenzyme PQQ biosynthesis protein B; KEGG:
FT                   pna:Pnap_0732 coenzyme PQQ biosynthesis protein B"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25449"
FT                   /db_xref="GOA:B2UEV3"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR011842"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:B2UEV3"
FT                   /protein_id="ACD25449.1"
FT                   /translation="MTLMRIIVLGASAGGGFPQWNCNCRNCAGYRAGTVRALARTQSSI
FT                   AVSTNGLDWLLINASPDILTQIRATPALQPGRATRDTGIAAVLLMDAQVDHVTGLMMLR
FT                   EGGRLRVHCTASVWEDLTERLPLTRVLAHYCGTDWQPITLDTEAGLQRPFEVAGIHHLR
FT                   ITPFPLSSKAPPYSPRRLEPDPGDNIGILLEDTHTGRKTFYAPGLGVIEPHIATAMAGA
FT                   DCVLVDGTFWTEDEMVRSGLSSKLAHEMGHLPLSGDAGMLAFLNTLDARRKIVIHINNS
FT                   NPILDDDSAERAELTRYGVEVAYDGMEIEL"
FT   gene            309485..310198
FT                   /locus_tag="Rpic_0290"
FT   CDS_pept        309485..310198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0290"
FT                   /product="coenzyme PQQ biosynthesis protein C"
FT                   /EC_number="1.3.3.11"
FT                   /note="KEGG: bxe:Bxe_B2468 pyrroloquinoline quinone
FT                   biosynthesis protein PqqC; TIGRFAM: coenzyme PQQ
FT                   biosynthesis protein C; PFAM: TENA/THI-4 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25450"
FT                   /db_xref="GOA:B2UEV4"
FT                   /db_xref="InterPro:IPR004305"
FT                   /db_xref="InterPro:IPR011845"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="InterPro:IPR039068"
FT                   /db_xref="UniProtKB/TrEMBL:B2UEV4"
FT                   /protein_id="ACD25450.1"
FT                   /translation="MSRTNASPDAAWPPEEFEVQLRAKGAGYHIHHPFNVRMNNGELTP
FT                   DQVRGWIANRFYYQVNIPRKDGAIIANCPDRETRRLWVQRILDHDGNADSPGGIEAWVR
FT                   LGEAAGIPEQDLWSLKHVVPGVRFAVDAYVNFARSVPWQEAVCSSLTEMFAPKIHRDRL
FT                   ANWPQHYPWIEAGGLHYFRSRITLAQRDVEHGLKVTLAHFTTRAQQERALDILQFKLDV
FT                   LWSMLDAIERAYPTR"
FT   gene            310209..310469
FT                   /locus_tag="Rpic_0291"
FT   CDS_pept        310209..310469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0291"
FT                   /product="coenzyme PQQ synthesis D"
FT                   /note="PFAM: coenzyme PQQ synthesis D; KEGG: bxe:Bxe_B2469
FT                   pyrroloquinoline quinone synthesis D"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25451"
FT                   /db_xref="GOA:B2UEV5"
FT                   /db_xref="InterPro:IPR008792"
FT                   /db_xref="InterPro:IPR022479"
FT                   /db_xref="InterPro:IPR041881"
FT                   /db_xref="UniProtKB/TrEMBL:B2UEV5"
FT                   /protein_id="ACD25451.1"
FT                   /translation="MTIPKKPRVAKMFRLQWEPAQQAHVLLYPEGMVKLNQSAAEILKR
FT                   CDGSRDLSTLVSELEQAFGSTGLQQDVEDFLQAAADQGWIQ"
FT   gene            310466..311626
FT                   /locus_tag="Rpic_0292"
FT   CDS_pept        310466..311626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0292"
FT                   /product="coenzyme PQQ biosynthesis protein E"
FT                   /note="KEGG: pna:Pnap_0729 coenzyme PQQ biosynthesis
FT                   protein E; TIGRFAM: coenzyme PQQ biosynthesis protein E;
FT                   PFAM: Radical SAM domain protein; SMART: Elongator protein
FT                   3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25452"
FT                   /db_xref="GOA:B2UEV6"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR011843"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017200"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="UniProtKB/TrEMBL:B2UEV6"
FT                   /protein_id="ACD25452.1"
FT                   /translation="MTDVQTLPVDGAAVSPPLWLLAELTHRCPLHCVFCYNPVDFARRR
FT                   DELSTAQWIDVLRQARQLGAAQLGFSGGEPLLRDDLEELVAEGRQLGFYTNLITSGIGL
FT                   TEARLARLKAAGLDHIQLSFQDSTREMNDFLSNTRTFDLKSRIALLIKQYDYPMVLNVV
FT                   LHRHNLDHVERIIEMAVAMGVEYLELANTQYYGWGLINRAQLMPTREQLQRAEAVVNAY
FT                   RGKLGNRLRILFVVPDYFESRPKACMSGWGAVFLAVTPDGTALPCHAAQTIPGLRFPNV
FT                   ADMPLAEIWNQSEAFNHFRGDAWMQEPCRSCPEKHKDFGGCRCQALALTGDAAQADPVC
FT                   DKSPHHSRVQEIVLHARHTQQSAVTGEHPLIFRSDANSLRLSSAPK"
FT   gene            complement(311694..311885)
FT                   /pseudo
FT                   /locus_tag="Rpic_0293"
FT   gene            complement(311890..313386)
FT                   /locus_tag="Rpic_0294"
FT   CDS_pept        complement(311890..313386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0294"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; KEGG: pol:Bpro_0544 periplasmic
FT                   sensor signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25453"
FT                   /db_xref="GOA:B2UEV7"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B2UEV7"
FT                   /protein_id="ACD25453.1"
FT                   /translation="MSGRGEAVLSRRLSLVFAVLLLVCCGTSAWLQLRSNGRHEQEVIQ
FT                   RLSSGLAAHIAENAELMRPEGLNPVAVKDLFDKLMAVNPSVEVYLLSPDGHIAAQAAPP
FT                   GHLKRDRVDLAPVRRLLAGATMPVLGDDPRNLQTPKVFSAAPMRVDGRDAGYVYVVLQG
FT                   EDHDAVAAHVAADNVLRTTLWSMGLVALLGLVAGTVAFWLITRPLRELTAVVRRFESEG
FT                   IGSLESQTATLERIARGGGEIATLSQAFVQMTRRIAEQWRELTLQDQQRRELVANISHD
FT                   LRTPLTSLHGYLETLRLKAGILDDEERRRYLDIALGQSRKVGRLAQELFELARLEYGVV
FT                   KPEKENFALADLVQDVFQKFELAAGARQQQLKPDIAPGLPIVSADLGMIERVLTNLLDN
FT                   AIHHTPVGGAIEVQLRPTNTGVAVQVSDTGPGIPGELQKGLFVRPVFMSGARSDGSRSG
FT                   GLGLMIVQRILQLHGSEIRLVPQPGKGAVFCFQLAGAASG"
FT   sig_peptide     complement(313291..313386)
FT                   /locus_tag="Rpic_0294"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.818) with cleavage site probability 0.460 at
FT                   residue 32"
FT   gene            complement(313383..314111)
FT                   /locus_tag="Rpic_0295"
FT   CDS_pept        complement(313383..314111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0295"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: pol:Bpro_0543 two component
FT                   transcriptional regulator, winged helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25454"
FT                   /db_xref="GOA:B2UEV8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B2UEV8"
FT                   /protein_id="ACD25454.1"
FT                   /translation="MDSAKRVLLVEDDAHIAELLRMHLRDEGYAVVHAADGHAGQREME
FT                   RGNWDALVLDLMLPGIDGLEICRRARVQARYTPIIIISARSTEVHRILGLELGADDYLA
FT                   KPFSVLELVARVKALIRRTDALARNARMESGSLTLGNLEIEPLAREVRVDGKPIELTPR
FT                   EFDLLHFFARHPGKVFSRLDLLNQVWGYQHDGYEHTVNTHINRLRAKVEVDPAQPRRIL
FT                   TVWGRGYKLSIGADGKEDAA"
FT   gene            314244..314918
FT                   /locus_tag="Rpic_0296"
FT   CDS_pept        314244..314918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0296"
FT                   /product="thiosulfate reductase cytochrome b subunit
FT                   (membrane anchoring protein)"
FT                   /note="KEGG: dac:Daci_3135 thiosulfate reductase cytochrome
FT                   b subunit (membrane anchoring protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25455"
FT                   /db_xref="GOA:B2UEV9"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:B2UEV9"
FT                   /protein_id="ACD25455.1"
FT                   /translation="MKRDAHLSMPTSIDTSPVHPLWMRCTHWFNALAVMVLVLSGWRIY
FT                   NAAPFFPFTIPASATLGGWLGGALQWHFAAMWLLVVNGLVYLVMNVASGRLARKFFPVT
FT                   PAGVRCDMVAALKGRLSHADPRHYNNVQRLAYLLVILDIVLLVLSGLVLWKSVQFATLR
FT                   ELLGGYEVARRIHFCAMAGAVAFVVVHLVMVALVPRTLLTMLGGRVAGTPSPIQDRSSH
FT                   DA"
FT   gene            314927..315718
FT                   /locus_tag="Rpic_0297"
FT   CDS_pept        314927..315718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0297"
FT                   /product="oxidoreductase molybdopterin binding"
FT                   /note="PFAM: oxidoreductase molybdopterin binding; KEGG:
FT                   dac:Daci_3134 oxidoreductase molybdopterin binding"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25456"
FT                   /db_xref="GOA:B2UEW0"
FT                   /db_xref="InterPro:IPR000572"
FT                   /db_xref="InterPro:IPR036374"
FT                   /db_xref="UniProtKB/TrEMBL:B2UEW0"
FT                   /protein_id="ACD25456.1"
FT                   /translation="MKIFKAPRFDGIDGDAVLIEARRQIARHVNLPARRAFLQRSLTLG
FT                   GLSLLTGCSISDNEQVEAALSRISRFNDKVQGLIFDPNQLAPTYPDSMITRPFPFNAYY
FT                   GEDEVRQVDEQAWRLEVTGLVSDRRQWNLADLRAMQQYDQVTRHICVEGWSAIGKWGGV
FT                   RFGDFLRRVGADLSAKYVGFKCADDYHTSIDMATALHPQTLMAITYDGAPLPPKYGFPM
FT                   KLRMPTKLGYKNPKHIQAIFVTNTYPGGYWEDQGYNWFGGS"
FT   gene            315839..316168
FT                   /locus_tag="Rpic_0298"
FT   CDS_pept        315839..316168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0298"
FT                   /product="pentapeptide MXKDX repeat protein"
FT                   /note="TIGRFAM: pentapeptide MXKDX repeat protein; KEGG:
FT                   dac:Daci_3133 pentapeptide MXKDX repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25457"
FT                   /db_xref="InterPro:IPR014299"
FT                   /db_xref="UniProtKB/TrEMBL:B2UEW1"
FT                   /protein_id="ACD25457.1"
FT                   /translation="MNKFATTLLAVSLTFGGASAVFAADAMGKDAMSKDAMSKDAMSKD
FT                   AMSKDAMSKDAMSKDAMSKDAMSKDAMSKDAMSKDAMKKDSMKKDAMKKDAMKKDAMKK
FT                   DAMSQ"
FT   sig_peptide     315839..315910
FT                   /locus_tag="Rpic_0298"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 24"
FT   gene            316214..317614
FT                   /locus_tag="Rpic_0299"
FT   CDS_pept        316214..317614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0299"
FT                   /product="cytochrome c biogenesis protein transmembrane
FT                   region"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; cytochrome c biogenesis protein
FT                   transmembrane region; Redoxin domain protein; KEGG:
FT                   pol:Bpro_0539 cytochrome c biogenesis protein,
FT                   transmembrane region"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25458"
FT                   /db_xref="GOA:B2UEW2"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B2UEW2"
FT                   /protein_id="ACD25458.1"
FT                   /translation="MTLFIISFLGGALTVLAPCILPVIPFVFARVDQPFVKSGLPMLVG
FT                   MASTFAAVGTLGAAAGSWAVEANEYGRIAATALLGLMGAAMVFPRLAERLTRPLVSVGL
FT                   DLSNAANAHTAMAGNCVLPSFIRGVATGLLWAPCAGPILGLILTGAVLQGPNVKTSLLL
FT                   LAYGAGAVSSLALVLLAGHRIFAAMKRSLGIGEWFRKGLGITVLSGAVVVMTGVDTGWL
FT                   AQVSSGSVEASVEKMLLQHFAPRQTGKMPIVDGQQQAKRNAPGGRLILVQAQQNRQPLN
FT                   LPVEGLFPPLTGAVDWLNSPPLTVEALRGKVVLVNFWTFGCINCRNVLPYVREWDRKYK
FT                   DQGLVVVSVHAPEFAYEKNIENVKRAASELGATFPIAIDNRFEIWKAFNNNYWPANYFI
FT                   DSQGRIRFHHFGEGEYEKSERVIQQLLKEARVGDRPVPMTETTLETLNAALALQRAGDF
FT                   VAAGVGAG"
FT   sig_peptide     316214..316303
FT                   /locus_tag="Rpic_0299"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.938) with cleavage site probability 0.925 at
FT                   residue 30"
FT   gene            complement(318020..318280)
FT                   /locus_tag="Rpic_0300"
FT   CDS_pept        complement(318020..318280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0300"
FT                   /product="putative signal peptide protein"
FT                   /note="KEGG: rso:RSc0424 probable signal peptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25459"
FT                   /db_xref="UniProtKB/TrEMBL:B2UEW3"
FT                   /protein_id="ACD25459.1"
FT                   /translation="MNGRLLLIPALLVALLSPLAHADLSETKENIKQDTKEAARKTGHA
FT                   AKEAGHATANAARAVGHGVKNAAHATKCGVKHVFKKPCESD"
FT   sig_peptide     complement(318212..318280)
FT                   /locus_tag="Rpic_0300"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 23"
FT   gene            complement(318305..318766)
FT                   /locus_tag="Rpic_0301"
FT   CDS_pept        complement(318305..318766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0301"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RSc0425 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25460"
FT                   /db_xref="InterPro:IPR016776"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B2UEW4"
FT                   /protein_id="ACD25460.1"
FT                   /translation="MTSNAQPTPPLDRNWIAARIPHSGTMCLLDTVVAWDDAHIRCNAT
FT                   SHRDTANPLRSHGQLAAVCGIEYAAQAMAVHGALCDAAQARPRAGFLASVRSIEAHVPR
FT                   LDTIETPLDVEAERIGGDGINVLYRFTVRSGARILLTGRAAVVLDASVA"
FT   gene            complement(318763..319566)
FT                   /locus_tag="Rpic_0302"
FT   CDS_pept        complement(318763..319566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0302"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_A6097 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25461"
FT                   /db_xref="GOA:B2UEW5"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:B2UEW5"
FT                   /protein_id="ACD25461.1"
FT                   /translation="MTRLSAFIESAGILGPGLPDWPHTADVLAGRARYAHAPTELPPPA
FT                   GLPSVERRRTGPVVKLALAVGHEAVAASGRDAATLATVFSSSGGDGHNCNAICETLAGD
FT                   DRKLSPTRFHNSVHNAPAGYWSIATHAMAPSNVLCAYDGSFAAGLLDGLCQVAIDATPA
FT                   LVIAYDGDYPEPLNAVRPVPDPFAVALVLAPEAGPRTLARIDVALTDAPLTALAQPGLE
FT                   TLWHGNAAARALPLLEALAARRAGRVVLEYLHETRVQVDITFGTP"
FT   gene            complement(319563..320780)
FT                   /locus_tag="Rpic_0303"
FT   CDS_pept        complement(319563..320780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0303"
FT                   /product="Beta-ketoacyl synthase"
FT                   /note="PFAM: Beta-ketoacyl synthase; KEGG: rso:RSc0427
FT                   3-oxoacyl-(acyl carrier protein) synthase I"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25462"
FT                   /db_xref="GOA:B2UEW6"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:B2UEW6"
FT                   /protein_id="ACD25462.1"
FT                   /translation="MKPVLLTHFTATSCLGRGLDATLDALRGQRGGLAPCTFPRADLDT
FT                   WIGEVPGADAAPVRADLADFDCRNNRLAQIGLTQDGFAESVEAAKARHGAGRVGVFIGT
FT                   STSGILETERAYQQRDPQTGALPASFHYAQTHNIYSPAAFVRAYFGLSGPATAISSACS
FT                   SGAKVFASARRMLAAGLIDAAVVGGVDSLCLTALYGFNSLELLSRQPCRPYDVARDGIS
FT                   IGEAAAFALLERAPEANDALDDDAILLLGIGESSDAHHMSSPHPEGLGARAAMAQALAT
FT                   SGLSTADIDYINLHGTGTPSNDAAESRAIQALFHGTACSSTKGATGHTLGAAGALEAVI
FT                   TALALRHQFLPAGINTTQPDPALIANYLTESGHARVRTALSNAFGFGGTNCSLVFGRAD
FT                   HLGLSS"
FT   gene            complement(320855..321718)
FT                   /locus_tag="Rpic_0304"
FT   CDS_pept        complement(320855..321718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0304"
FT                   /product="polysaccharide deacetylase"
FT                   /note="PFAM: polysaccharide deacetylase; KEGG:
FT                   bur:Bcep18194_A6095 polysaccharide deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25463"
FT                   /db_xref="GOA:B2UEW7"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:B2UEW7"
FT                   /protein_id="ACD25463.1"
FT                   /translation="MNAPITPPLGTARRWKPSPLISGALALHAGAAVAVAADPSTWPWA
FT                   GGGVIASHLVLMAGGLWPRSTWLGPNWTHLPATAGQRIAMTIDDGPDPDVTPRVLDILD
FT                   QYGAKATFFCIGELAQRHPRCVEAIVARGHAVENHSQRHRHTFSLKGPGALRREIAAAQ
FT                   DTLTQITGTRPLFFRAPAGLRNPFLEPVLCQLGLQLASWTRRGFDTRSRNPEAVTQRLL
FT                   HGLAPQDILLLHDGHAARDAHGDPVLLTVLPKVLETAARAQLQCTTLRAALAPEPAQAT
FT                   RSQMTI"
FT   sig_peptide     complement(321608..321718)
FT                   /locus_tag="Rpic_0304"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.626 at
FT                   residue 37"
FT   gene            complement(321715..324147)
FT                   /locus_tag="Rpic_0305"
FT   CDS_pept        complement(321715..324147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0305"
FT                   /product="MMPL domain protein"
FT                   /note="PFAM: MMPL domain protein; KEGG: bch:Bcen2424_2764
FT                   exporter-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25464"
FT                   /db_xref="GOA:B2UEW8"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:B2UEW8"
FT                   /protein_id="ACD25464.1"
FT                   /translation="MKRLHALRRPAVLVWLTGLLLCAVVIGRTSFTADLSAFLPRSPSA
FT                   EQRVLVDQLREGLVSRLILVGIDGGDAATRATLSKQLAARLRADAQFSAVNNGEPVSEA
FT                   RDRQFIFDHRYVLSPAVTPQRFSAEGLHAALGESLDLLSSSAGLVAKNMLPRDPTGEVA
FT                   ALVSQLDNTALPSSKHGVWASRDGQRAVLVVQTTAAGSDTDAQAHAIDAVRGAFDAVAR
FT                   AVPNAASTRILMTGPGVFSVESRDTIKHDVERLSAVSLVLVVALLLTVYRSPRTMVLGL
FT                   LPVLSGVAAGVAAVSLTFGAVHGLTLGFGTTLIGEAVDYSIYLFVQSARLHGATPHDSL
FT                   RAWIATYWPTIRLGVLTSVCGFASMLFSGFPGLVQLGLYSIVGLVTAALVTRYVLPHLR
FT                   GAEVATRDLSRVGAWLTRATSAAPRLRWLLAAVLIGACAALSLHRDSLWSRELAALSPV
FT                   PAKSQALDASLRADVGAPDVRYLVVIPAATEQAALEGAEKIATQLQPLVDNGVLAGFEN
FT                   PARYLPSDATQRARLASLPAADALATRMRSAVEDQPIRVKPDLFAPFIADVDAARAQPF
FT                   LRRADLKGTSMALAVDALLTEHAGQWNAMLPLRAPPDAPSAAPATTNNASNPPSLDAAP
FT                   IRAAVEHATVPGALFVDMKVEADRMYVNYVREDLRLSLAGFAAIALLLIVALRSPQRTL
FT                   RALAPLVAAVLVVTAGFALARVPLTILHLVGMLLIVAVGSNYALFFNQRAQAIAPQTLV
FT                   SLLVANLATVAGFGLLALSRVPMLETFGLTVGPGAMLALLFAAILAPRANHDQHATA"
FT   sig_peptide     complement(324049..324147)
FT                   /locus_tag="Rpic_0305"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.972 at
FT                   residue 33"
FT   gene            complement(324161..324757)
FT                   /locus_tag="Rpic_0306"
FT   CDS_pept        complement(324161..324757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0306"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bam:Bamb_2815 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25465"
FT                   /db_xref="GOA:B2UEW9"
FT                   /db_xref="InterPro:IPR004564"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/TrEMBL:B2UEW9"
FT                   /protein_id="ACD25465.1"
FT                   /translation="MTATRPFFRAFLALLAASMLAATAHAADSAWTLDRLMSTLARNKS
FT                   GRATFTETKTLSIAAQPIESSGELVFVAPDHLEKHTLAPKPEHLVIDGDKLTVERNQRK
FT                   FTMPLSQYPELGAFIESIRATLAGNRYALEAIYKVAIAGHGDDWTLTLSPIDTRMQQVV
FT                   RTITLEGTRDVLRSVAIRQADGDHSLMRLQRVLGN"
FT   sig_peptide     complement(324677..324757)
FT                   /locus_tag="Rpic_0306"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.993 at
FT                   residue 27"
FT   gene            complement(324754..325716)
FT                   /locus_tag="Rpic_0307"
FT   CDS_pept        complement(324754..325716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0307"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RSc0431 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25466"
FT                   /db_xref="GOA:B2UEX0"
FT                   /db_xref="InterPro:IPR004960"
FT                   /db_xref="InterPro:IPR014548"
FT                   /db_xref="UniProtKB/TrEMBL:B2UEX0"
FT                   /protein_id="ACD25466.1"
FT                   /translation="MKRSDWAERPERSNLALLRLMTWLSLRLGRPFGRVLLRLIALYFV
FT                   AASPAARGASRDYLRRALGRTATLCDVFRHMLTFATTIHDRIYLISGRFGLFDIQLQGQ
FT                   QHVHNVLAQGRGAFLLGAHLGSFEVVRALGRTVPDLRVAVAMYEENARNINAAVAAINP
FT                   AAAPEVIPLGRVDAMLQVREALDDNRLVGMLADRTLLRDAGPSVRHMDFLGSPAAFPLG
FT                   PLHMAAMLKRPVLFMTGLHLGGNRYAVHFDLLADFTDVRREDRAAAVQAALGRYVERVE
FT                   HYCRTAPYNWFNYFDFWQDADAAGAPDHAPADHQTTQTP"
FT   gene            complement(325713..327410)
FT                   /locus_tag="Rpic_0308"
FT   CDS_pept        complement(325713..327410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0308"
FT                   /product="Beta-hydroxyacyl-(acyl-carrier-protein)
FT                   dehydratase FabA/FabZ"
FT                   /note="PFAM: Beta-hydroxyacyl-(acyl-carrier-protein)
FT                   dehydratase FabA/FabZ; KEGG: rso:RSc0432 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25467"
FT                   /db_xref="GOA:B2UEX1"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B2UEX1"
FT                   /protein_id="ACD25467.1"
FT                   /translation="MPTYPLVSHPTLDNTLAWRDGTPVSARTFLADVMALAAMLPPGGH
FT                   VFNACADRYRFAVGLGAALVAGKVSLLPPMQTAQMVRQLSAFAPDVFCLHDATACPVDL
FT                   PAFRYPDALTPGAAPIDVPQIDTSQVMAVLFTSGSTGTPVPHRKTWGALARCMRTAVAH
FT                   LGLADGRAFTLVGTVPAQHMYGLEVTVLLALQGGLAFSNRQPFYPADIREALDAVPQPR
FT                   VLVTSPVHLRALLASEPALPSASLVLSATAPLSEALARKTETRLSTPLLEIYGSTETGQ
FT                   VATRRTAQETAWHLYPGVRMESRSGTPEDEGPTVWVYGGHVETPVPMGDAIELIDDTHF
FT                   LLHGRKADLINIAGKRSSLAYLNHQLNAIAGVVDGVFYMPDDAPAARHTHGSAAVTRLV
FT                   ALVVAPGLSAADVLRALHDRIDAAFMPRPLLLVDALPRNETGKLARDVLAALIAQHSHR
FT                   NAHKHGMRFTIPADHPALPGHFPGHPIVPGVVLLDHALHTIGAALGRSLDACKISSAKF
FT                   LSPAAPGEVLDLAFETTPSNAVRFTIRAGEREVASGVLSAPAPEGVAA"
FT   gene            complement(327437..328111)
FT                   /locus_tag="Rpic_0309"
FT   CDS_pept        complement(327437..328111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0309"
FT                   /product="putative transmembrane protein"
FT                   /note="KEGG: rso:RSc0433 probable transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25468"
FT                   /db_xref="GOA:B2UEX2"
FT                   /db_xref="UniProtKB/TrEMBL:B2UEX2"
FT                   /protein_id="ACD25468.1"
FT                   /translation="MHRLTSFARGAAGVGAIVAYQVGAHYAAATPGAHGVGLAMALLPP
FT                   LAIALVAATRTTHRAWLLPLWLLVCSVLWMARAPLAAHFDWGLYLEHASFNLMMAYVFG
FT                   RTLVAGREPLCTRFAHMVHGTLTPRIARYSRQVTLVWTLFFLATAAVSTLLFATASTVT
FT                   WSTFANYLSLPLVGVVFVAEYLCRRIVLRGEPHSSLFDAVRAYRQSEQSGHVTPAATER
FT                   SR"
FT   sig_peptide     complement(328022..328111)
FT                   /locus_tag="Rpic_0309"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.807) with cleavage site probability 0.667 at
FT                   residue 30"
FT   gene            328523..328783
FT                   /locus_tag="Rpic_0310"
FT   CDS_pept        328523..328783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0310"
FT                   /product="acyl carrier protein"
FT                   /note="KEGG: rso:RSc0434 acyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25469"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:B2UEX3"
FT                   /protein_id="ACD25469.1"
FT                   /translation="MNDLEKELAALMIGELNLEDIQLDALTADTPLYGEGFGLDSIDIL
FT                   EVALLISKKYGFELRSGDPDNQKIFASLGSLAAYVAEHRTR"
FT   gene            328838..329608
FT                   /locus_tag="Rpic_0311"
FT   CDS_pept        328838..329608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0311"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   rso:RSc0436 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25470"
FT                   /db_xref="GOA:B2UEX4"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B2UEX4"
FT                   /protein_id="ACD25470.1"
FT                   /translation="MPMTGASTSHLVLIPSYNPGHKVDDTVRSARAQWNPVWVVVDGST
FT                   DGSTERLQAMAAQDPGLRVIVLPRNRGKGVAVLAGLEAAAAAGFTYVLTMDADGQHPAN
FT                   LIPEFMAASQAAPDAMILGQPVFDATAPQMRVQGRRLSNGCADIETLWAGIGDTLFGFR
FT                   VYPIAPLAEIMRQQSWMRGFDFDPEAAVRLCWAGVRPIRLAAPVRYFRPNEGGVSHFRY
FT                   LRDNILLIAMHLRLAAEGLLRLPSMIARRLQRGW"
FT   gene            complement(329625..330137)
FT                   /pseudo
FT                   /locus_tag="Rpic_0312"
FT   gene            complement(330182..330595)
FT                   /locus_tag="Rpic_0313"
FT   CDS_pept        complement(330182..330595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0313"
FT                   /product="protein of unknown function DUF395 YeeE/YedE"
FT                   /note="PFAM: protein of unknown function DUF395 YeeE/YedE;
FT                   KEGG: rso:RSc0437 probable transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25471"
FT                   /db_xref="GOA:B2UEX5"
FT                   /db_xref="InterPro:IPR007272"
FT                   /db_xref="UniProtKB/TrEMBL:B2UEX5"
FT                   /protein_id="ACD25471.1"
FT                   /translation="MAIVIALVAGLLFGAGLIVSGMANPAKVLGFLDLFGQWDPSLAFV
FT                   MAGAIAVGVIAFFVARRRGRSWLGTPIQLPSATGVTARLVLGSAVFGIGWGLAGFCPGP
FT                   ALVALGAGVPKAVGFVAAMLAGMAVFSWLQRKR"
FT   sig_peptide     complement(330524..330595)
FT                   /locus_tag="Rpic_0313"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.989) with cleavage site probability 0.949 at
FT                   residue 24"
FT   gene            complement(330597..331031)
FT                   /locus_tag="Rpic_0314"
FT   CDS_pept        complement(330597..331031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0314"
FT                   /product="protein of unknown function DUF395 YeeE/YedE"
FT                   /note="PFAM: protein of unknown function DUF395 YeeE/YedE;
FT                   KEGG: rso:RSc0438 probable transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25472"
FT                   /db_xref="GOA:B2UEX6"
FT                   /db_xref="InterPro:IPR007272"
FT                   /db_xref="UniProtKB/TrEMBL:B2UEX6"
FT                   /protein_id="ACD25472.1"
FT                   /translation="MSIDFTHFTPGAALVGGLIIGLAAAVLVLGTGRIAGISGIVGGLL
FT                   LRPRGDMDWRIAFLIGLMGAPVVAALLGHPVVPEIAAGWGEVLAAGFLVGIGTRYAGGC
FT                   TSGHGVCGLSRGSVRSLVATLSFVTAGIVTVFVVRHVFGG"
FT   sig_peptide     complement(330954..331031)
FT                   /locus_tag="Rpic_0314"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.787) with cleavage site probability 0.556 at
FT                   residue 26"
FT   gene            331364..332335
FT                   /locus_tag="Rpic_0315"
FT   CDS_pept        331364..332335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0315"
FT                   /product="Alpha/beta hydrolase fold-3 domain protein"
FT                   /note="PFAM: Alpha/beta hydrolase fold-3 domain protein;
FT                   KEGG: rso:RSc0439 putative lipase/esterase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25473"
FT                   /db_xref="GOA:B2UEX7"
FT                   /db_xref="InterPro:IPR002168"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR033140"
FT                   /db_xref="UniProtKB/TrEMBL:B2UEX7"
FT                   /protein_id="ACD25473.1"
FT                   /translation="MSWQNWVVSRMVRNQIKKPTEREPFDPIATRLHAEKRKMPSPVEL
FT                   PPDWRIVPADGVNGDGLTGEWIEPADPDLHDDAPVVLYLHGGGYFFCSPRTHRPITIGL
FT                   ATHARARVCVPDYRLAPEHPFPAPVEDALFTYRTLVTQGVSPSRIVVAGDSAGGGLALA
FT                   LLVALRDAADPLPAGAVLYSPWTDLAATGQSLIDNDESDVMFRGAWMAHGAALYLGDSG
FT                   APADHPLASPLYADFTGLPTLHCYVSTSEVLRDDTLRMAERARAAGVSVSVEMGRRLPH
FT                   VWPIFYPFLPEARVALKRSGEQIRRLVAAQHKNREPVELTPA"
FT   gene            332393..333187
FT                   /locus_tag="Rpic_0316"
FT   CDS_pept        332393..333187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0316"
FT                   /product="putative signal peptide protein"
FT                   /note="KEGG: rso:RSc0440 putative signal peptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25474"
FT                   /db_xref="UniProtKB/TrEMBL:B2UEX8"
FT                   /protein_id="ACD25474.1"
FT                   /translation="MRRVVVLGVVLAVVAGAWHWSRLHRLRLADVRFAPIENVAAATGS
FT                   AGAPVLNANKSHWLKACDQALGPMRVEVRATETPLSFSNDRSVDQLTAEAPPYDRSARV
FT                   LGKTYATLVARFDVNSRYMAIATQPPTTCLRPSISVELVLNNFRVTVAREFAPGTCAYN
FT                   AIREHELRHVAVNRAVLPHAAEVIRKEIESEYGGRLYFGDPDRIAADLQAALTRHWLPR
FT                   AQSLIELGLQAHEQIDTARERERMSRVCNGEVQAVLQQLTRS"
FT   gene            complement(333207..333716)
FT                   /locus_tag="Rpic_0317"
FT   CDS_pept        complement(333207..333716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0317"
FT                   /product="carbohydrate kinase, thermoresistant glucokinase
FT                   family"
FT                   /EC_number="2.7.1.12"
FT                   /note="KEGG: rso:RSc0441 probable thermoresistant
FT                   gluconokinase (gluconate kinase 2) protein; TIGRFAM:
FT                   carbohydrate kinase, thermoresistant glucokinase family;
FT                   PFAM: shikimate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25475"
FT                   /db_xref="GOA:B2UEX9"
FT                   /db_xref="InterPro:IPR006001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:B2UEX9"
FT                   /protein_id="ACD25475.1"
FT                   /translation="MIVVVMGVSGCGKSTVGQKIAERLGCAFRDGDEFHSEANRAKMHA
FT                   GIPLNDDDRKPWLESIRAYMDEKTSSGQSLVVACSALKQRYRDVLRGAAGNAEFVYLKG
FT                   DFDLLQGRLAARKDHFFNPSLLRSQFDALEEPTDAVIVDIALPPEAIVDEAVAQLQARA
FT                   AHRPAA"
FT   gene            333949..335664
FT                   /locus_tag="Rpic_0318"
FT   CDS_pept        333949..335664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0318"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   rso:RSc0442 acyl-CoA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25476"
FT                   /db_xref="GOA:B2UEY0"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B2UEY0"
FT                   /protein_id="ACD25476.1"
FT                   /translation="MAGEVFDARPRNGASYVVGDTSVPLAHVTVSALLADTVRRCPDDE
FT                   AVVFREQNVRWTWRTFAEQVDALAAGLHALGFERGDRIGIWSPNRVEWVLTQFATARLG
FT                   LILVNINPAYRLSELEYALNKVGCKAIVAAEAFKTSRYLEMLQTLAPELATAQPGALNA
FT                   AKLPALRWVIRMGEAGTPGMLNFADVVARGKSVPVDALDAITATLSPDDAINIQFTSGT
FT                   TGAPKGATLTHVNVVNNARFVAMAMNLQEGDRLCIPVPLYHCFGMVMSVLTCTATGACM
FT                   VFPGEAFDPLATLRTVAEERCTQLHGVPTMFIAQLDHPDFKSFDVSTLRGGIMAGSPCP
FT                   IEVMKRVVSELNLREVTIAYGMTETSPVSFQSAVTDPLDKRVTTVGRIQPHLQVKLVDG
FT                   AGEVVPVGEKGELCTKGYSVMLGYWDDEAKTAESIHDGWMRTGDLATFDAEGYCNIVGR
FT                   VKDMLIRGGENVYPREIEEFLFRHPKVQAVNVFGVPDPKYGEEVCAWIVLKPGQQATEE
FT                   EIRTFCQGQIAHYKIPRYIRFVTEMPMTVTGKVQKFVMRDRMVEELKLTVAATA"
FT   gene            336366..337640
FT                   /locus_tag="Rpic_0319"
FT   CDS_pept        336366..337640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0319"
FT                   /product="putative glycin-rich signal peptide protein"
FT                   /note="KEGG: rso:RSc0443 probable glycin-rich signal
FT                   peptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25477"
FT                   /db_xref="UniProtKB/TrEMBL:B2UEY1"
FT                   /protein_id="ACD25477.1"
FT                   /translation="MKKTLLATAIAMGLGVSGVALADIGNTASGAGDKTQTTTSTINRT
FT                   STDTDTTTTTTATDNSNQHNNSSQGSNRDNSGTASATGYGTAASNNGGVSTATFTNSFN
FT                   TSKAIAISKLEGTVTNLSISGIGNVATNNGGSANGGAGGRGGYGYGGAGAGGNGGAGGA
FT                   GGGGGAGGSSGSVTHGSATNGGATAGNGGNGGGAAGNAGSGGSGGSSGTLSASLGAGLG
FT                   GLAGSASAAGGGAGGSGGGAGGSNGGDANHHHGSGSATGGAAAAAGGNGAAGGTGTSGS
FT                   STASGGAGTGTSTATGTSTGGAGAAGGAATNVAGTGGAGGTSTNGSATNGAASSTAGNG
FT                   AVGAVGAAGGAGGVGNGGVGNGAVGGTGGAGGTVMVDAGTFNMSNAMTSVGQSAAGVMV
FT                   ASQNSGFASLIQQSINVQANLNVGK"
FT   sig_peptide     336366..336434
FT                   /locus_tag="Rpic_0319"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 23"
FT   gene            337765..338199
FT                   /locus_tag="Rpic_0320"
FT   CDS_pept        337765..338199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0320"
FT                   /product="conserved hypothetical signal peptide protein"
FT                   /note="KEGG: rso:RSc0444 hypothetical signal peptide
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25478"
FT                   /db_xref="UniProtKB/TrEMBL:B2UFF5"
FT                   /protein_id="ACD25478.1"
FT                   /translation="MRSDRRTTAGWAAWWLACGLVAWPAAAATAANDAPIADGAQVAST
FT                   EAVRPPAAAAMSVPGLGHAVGADRLDSYRGGTQDLYQTVNEARLSGTVSDNAAINVATG
FT                   SNIVRDGSFANASGIPTVIQNSGANVLIQNATIVNVQFRP"
FT   sig_peptide     337765..337848
FT                   /locus_tag="Rpic_0320"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.658 at
FT                   residue 28"
FT   gene            338216..338899
FT                   /locus_tag="Rpic_0321"
FT   CDS_pept        338216..338899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0321"
FT                   /product="peptidase C39 bacteriocin processing"
FT                   /note="PFAM: peptidase C39 bacteriocin processing; KEGG:
FT                   rso:RSc0445 hypothetical signal peptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25479"
FT                   /db_xref="GOA:B2UFF6"
FT                   /db_xref="InterPro:IPR005074"
FT                   /db_xref="UniProtKB/TrEMBL:B2UFF6"
FT                   /protein_id="ACD25479.1"
FT                   /translation="MMRKTFGAVLVALICGPALAGTIDMLGTGGGTYAMPVTSMKAARY
FT                   LRTVHQRFDFSCGSAAVATLLTYQYGYPVSEQTVFQAMYEHGNQEKIRREGFSLLDIKR
FT                   YLASLGFEADGFEQPLDALKGAHLPAIVLLTENGYHHFVVVKGVQEGRVLVGDPAMGTR
FT                   AIPRASFESMWDNHLLFVVHNREAGATFNASSDWRVAPRAPLEEGMDRSGLGNIVVPKH
FT                   GPSDF"
FT   sig_peptide     338216..338278
FT                   /locus_tag="Rpic_0321"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 21"
FT   gene            338945..339481
FT                   /locus_tag="Rpic_0322"
FT   CDS_pept        338945..339481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0322"
FT                   /product="putative lipoprotein"
FT                   /note="KEGG: rso:RSc0446 probable lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25480"
FT                   /db_xref="UniProtKB/TrEMBL:B2UFF7"
FT                   /protein_id="ACD25480.1"
FT                   /translation="MKRFGKVAWAAGWFALAAAGHACAAGMGGMDNNPVHAWQAVSEDK
FT                   LDDMRGGFDVPSLAGLRISFGIDRAVFINGDLVASASVNIPDVARMTTTQAQQLASVVN
FT                   TVNIVQNGPNNVAPPDVATGGAAAATVIQNSLNNQTLQAVTTINAAVNSLPQFRQMNLS
FT                   NVLQGALANVVTMLH"
FT   sig_peptide     338945..339019
FT                   /locus_tag="Rpic_0322"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.853 at
FT                   residue 25"
FT   gene            complement(339483..340793)
FT                   /locus_tag="Rpic_0323"
FT   CDS_pept        complement(339483..340793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0323"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RSc0447 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25481"
FT                   /db_xref="UniProtKB/TrEMBL:B2UFF8"
FT                   /protein_id="ACD25481.1"
FT                   /translation="MKNAPWGPLRAVACACLLLCGRSALAQTNEPVDDKPPSLEALQRE
FT                   LVDTQARLQELKRSIQQQEAHLRHMRRALGMSEGRLDTVRGAGAPGAAGDAVELAQNDQ
FT                   PGTTPVGKPPEPPDRPPRIAQIFDEPSALTPPGKVVVEPSFQMAYSSSDRVALVGYTII
FT                   PALLIGLIDVRQVKTTTLTGTVAMRYGLARRWELEARVPYVYSKSDTVSRELFTGTATD
FT                   NAFSSHGHGIGDVELTARYQINAGGVDKPFYIGWLRFKTRTGKDPFEVTTDCVTRCVSN
FT                   TTGTGLPLQQPTGSGFFAVQPGLTWLFPTDPAVFFGSISYLHNFERKDVSLNLVDGSKQ
FT                   FLGNVKAGDIIGLNFGMGLALNEKASFSIGYDQSIIGPTTQNGQRVPGSVRTILGTLLV
FT                   GYSYRLSPKMALNLSVGAGLTRDTPDLTVTLRLPIQF"
FT   sig_peptide     complement(340713..340793)
FT                   /locus_tag="Rpic_0323"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 27"
FT   gene            complement(341017..341853)
FT                   /locus_tag="Rpic_0324"
FT   CDS_pept        complement(341017..341853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0324"
FT                   /product="7-cyano-7-deazaguanine reductase"
FT                   /note="TIGRFAM: 7-cyano-7-deazaguanine reductase; PFAM: GTP
FT                   cyclohydrolase I; KEGG: rso:RSc0448 7-cyano-7-deazaguanine
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25482"
FT                   /db_xref="GOA:B2UFF9"
FT                   /db_xref="InterPro:IPR016428"
FT                   /db_xref="InterPro:IPR029139"
FT                   /db_xref="InterPro:IPR029500"
FT                   /db_xref="UniProtKB/TrEMBL:B2UFF9"
FT                   /protein_id="ACD25482.1"
FT                   /translation="MSNQPEHSPLGKTSAYKTEYDPHLLFPIPRQGKRDEIGLAAGTPL
FT                   PFFGVDLWNLYELSWLNLRGKPQVALGTVIVPADSPNIVESKSFKLYLNSFNQTKVASH
FT                   EALQQLIHHDLSEACGAPVQVRIVTQEEFARQKMGELDGLLLDRLDIETDVYQPTPELL
FT                   HADEEESPVEETLVSHLLKSNCLVTGQPDWGSVQIRYVGAPINQEALLKYLISFREHNE
FT                   FHEQCVERIFTDILRQCRPVKLAVYARYTRRGGLDINPFRTNYNTPWPDNLRNARQ"
FT   gene            complement(341853..343373)
FT                   /locus_tag="Rpic_0325"
FT   CDS_pept        complement(341853..343373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0325"
FT                   /product="threonine dehydratase, biosynthetic"
FT                   /note="TIGRFAM: threonine dehydratase, biosynthetic; PFAM:
FT                   Threonine dehydratase domain protein;
FT                   Pyridoxal-5'-phosphate-dependent protein beta subunit;
FT                   KEGG: rso:RSc0449 threonine dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25483"
FT                   /db_xref="GOA:B2UFG0"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001721"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005787"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="InterPro:IPR038110"
FT                   /db_xref="UniProtKB/TrEMBL:B2UFG0"
FT                   /protein_id="ACD25483.1"
FT                   /translation="MAIDYLKKILTAKVYDVAVETELKFAPNLSVRTGNRVYLKREDDQ
FT                   PVFSFKLRGAYNKMASLTPAERKRGVITASAGNHAQGVAFSAARMECKAVICMPVTTPQ
FT                   LKIDGVRSRGGDWVDVVLHGESYSDAYNHAAKLQEKHGYTFVHPFDDPEVIAGQGTIAM
FT                   EILRQHPQPIHAIFCSIGGGGLISGIAAYVKAVRPDVKVIGVQSVDSDAMARSVAAGKR
FT                   VELKEVGLFADGTAVKLVGKETFRLTRELVDEIITVDTDAICAALKDVFQDTRSLLEPS
FT                   GALALAGLKQYAETHKLKNESLVAVASGANMNFDRLRFVAERAEVGEAREAVFAVTIPE
FT                   ERGSFKRFCELVGWSRNVTEFNYRIASKDAAHIFVGVQIASRAEGDKIAENFRKHGFPT
FT                   LDLSNDELAKQHIRYMVGGRSPLAENEHLYRFEFPERPGALMKFLSSMSPNWNISLFHY
FT                   RNQGADSSNILVGIQVPKNEKREFKAFLATLGYTYWDESENPVYSLFL"
FT   gene            343516..344433
FT                   /locus_tag="Rpic_0326"
FT   CDS_pept        343516..344433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0326"
FT                   /product="K channel inward rectifier conserved region 2
FT                   domain protein"
FT                   /note="PFAM: Ion transport 2 domain protein ; K channel
FT                   inward rectifier conserved region 2 domain protein; KEGG:
FT                   rso:RSc0450 putative ATP-sensitive inward rectifier
FT                   potassium channel related transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25484"
FT                   /db_xref="GOA:B2UFG1"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="InterPro:IPR013518"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR016449"
FT                   /db_xref="InterPro:IPR041647"
FT                   /db_xref="UniProtKB/TrEMBL:B2UFG1"
FT                   /protein_id="ACD25484.1"
FT                   /translation="MNTPSSSSGRAGRARRGRKVWSGTQHVIAYGMPPLGWRDLYHHAL
FT                   EVNWPTFFALLATLFLALNAVFAGLYSLGDGAIANQSPPGFVGAFFFSVETLATVGYGD
FT                   MHPQTLYAHVIATLEIFIGMSGIAMATGLVFARFSRPRAKIMFARNVVVRPLNGKSTLM
FT                   LRAANARQNVIAEATARLRLMQDEVSPEGYAIYKIHDLKLERSEHPIFLLGWVMMHVID
FT                   EASPLHGATAESLAAGDALLLLTIEGADETAAQTVQARYSWRHDEIRWNHRYADLIRDE
FT                   SGVTSVDYDNFHLIHPIETPPQAQ"
FT   gene            344465..345712
FT                   /locus_tag="Rpic_0327"
FT   CDS_pept        344465..345712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0327"
FT                   /product="nucleoside recognition domain protein"
FT                   /note="PFAM: nucleoside recognition domain protein; KEGG:
FT                   rso:RSc0452 putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25485"
FT                   /db_xref="GOA:B2UFG2"
FT                   /db_xref="InterPro:IPR011415"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="UniProtKB/TrEMBL:B2UFG2"
FT                   /protein_id="ACD25485.1"
FT                   /translation="MALNLVWLAFFLVAFVTACVQVVQGDMEVFSRMLTGMFDAARTGF
FT                   EIAIGLTGMMALWLGIMRVGERAGVVDLFARLVNPLMRHLFPSVPAGHPANGAMMMNVS
FT                   ANVLGLDNAATPLGLQAMRELQQINPQPQRASDAQLMFVVLNTAGVTLVPTSVIAIRQA
FT                   MAVKQGLVGFNAADIFLPTLLSTFIGFCAGIAAVAWYQRINLFKPALLAYFGGFVATMG
FT                   LLFAWLRQFPPQQMAAWIGLIGAGAILTIVVAFLVCGAIRRINVYETFVDGAKDGFQVA
FT                   IGIVPYLVAVLVGIAVFRAAGCMDFLMQGLSVLFTHLGIDTRFVPALPVGLMKTLSGAG
FT                   ARGLMVDVMTTYGVDSFQGKLAAIIQGSTETTFYVLAVYFGSVGIKDTRYALACGLWAD
FT                   LVGLIGAVLVAYLFFA"
FT   sig_peptide     344465..344542
FT                   /locus_tag="Rpic_0327"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.947) with cleavage site probability 0.253 at
FT                   residue 26"
FT   gene            345770..346351
FT                   /locus_tag="Rpic_0328"
FT   CDS_pept        345770..346351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0328"
FT                   /product="putative transmembrane protein"
FT                   /note="KEGG: rso:RSc0453 probable transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25486"
FT                   /db_xref="GOA:B2UFG3"
FT                   /db_xref="UniProtKB/TrEMBL:B2UFG3"
FT                   /protein_id="ACD25486.1"
FT                   /translation="MEQWIDTLFATLALPKVGLPAIFVVSFISATLLPLGSEPAVFAYI
FT                   KLNPEMFWPAIIVATLGNTLGGVVDWWMGYAAKLALVRYHLGRRRRQHNVEHAHHVPHP
FT                   KRHREPPLDKKYFRWMRRIGPVSLLVSWLPGIGDPLCTLAGWLRLKFWPSVMYMAIGKF
FT                   LRYLAMTAALMTLPDGFWHGILGWIKSVMM"
FT   gene            346553..350590
FT                   /locus_tag="Rpic_0329"
FT   CDS_pept        346553..350590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0329"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="PFAM: protein of unknown function DUF224
FT                   cysteine-rich region domain protein; FAD linked oxidase
FT                   domain protein; KEGG: rso:RSc0454 putative oxidoreductase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25487"
FT                   /db_xref="GOA:B2UFG4"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR021817"
FT                   /db_xref="InterPro:IPR022153"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:B2UFG4"
FT                   /protein_id="ACD25487.1"
FT                   /translation="MNAPLLIDAKLTAQDAAPRLREIPYNYTSFSDREIVIRLLGESAW
FT                   QILDELRAERRTGRSARMLYEVLGDVWVVRRNPYLQDDLLDNPKRRQMLIDALNHRLAE
FT                   IEKRRVADHDSHHDPVGDERASKVEQLVVHARRAVKAFQEEFAQVYDLRRRAQKVLGRV
FT                   TAKDNIKFDGLSRVSHVTDATDWRVEYPFVVLTPDTEEEIAGIVKGCFELGLTIIPRGG
FT                   GTGYTGGAVPLTPFSAVINTEKLERLDAVEMTDLPGVDHPVATIYSGAGVVTRRVADAA
FT                   EKAGLVFAVDPTSIDASCIGGNVAMNAGGKKAVLWGTALDNLAWWRMVDPDGNWLEVTR
FT                   LNHNLGKIHDAPVVTFELKWFDGNAPVGAKLLRTETLTIEGRKFRKEGLGKDVTDKFLA
FT                   GLPGVQKEGCDGIITSARWILHRMPKSIRTVCLEFFGQARDAIPSIVEIKDYLDAETKK
FT                   PGGAILAGLEHLDERYLRAVGYATKSKRNAFPKMVLIGDIVGDDDDAVARATSEVIRLA
FT                   NGKSGEGFVAVSPEARKKFWLDRSRTAAIAKHTNAFKINEDVVIPLNRMGEYTDGIERI
FT                   NIELSIKSKLKLTDALLDFFAGSNLPLGRTDDANEIPSAELLEDRVQQAQQLLRATRAR
FT                   WQYLLDHLDTPVTTARASLIGVGLGYLAQTIDDRLVNQPDANLFHLLQDRTIRVSWKAE
FT                   IRAELRKIFNGGEFKPILDEAQAIHKKVLRGRVFVALHMHAGDGNVHTNIPVNSDDYDM
FT                   LQDAHKAVARIMTLARSLDGVISGEHGIGITKLEFLTDEEIADFAAYKRRVDPNGRFNK
FT                   GKLLRDINDPQGLAADLRNAYTPSFGLMGHESIIMQQSDIGAISESIKDCLRCGKCKPV
FT                   CATHVPRANLLYSPRNKILATSLLIEAFLYEEQTRRGVSVKHWEEFADVGDHCTVCHKC
FT                   VTPCPVKIDFGDVSMNMRNLLRKMGQKKFNPGTAAAMFYLNATNPETINFTRKVMFDWG
FT                   YKAQRLGNDILKKFAKKQTARPPATVGKPPVREQVIHFINKKMPGNLPKKTARALLDIE
FT                   DNEIVPIIRNPKATTPDSEAVFYFPGCGSERLFSQVGLATQAMLWHAGVQTVLPPGYLC
FT                   CGYPQRGTGQFDKAEKIVTDNRVLFHRVANTLNYLDIKTVVVSCGTCYDQLAGYEFDKI
FT                   FPGCRIIDIHEYLLEKGVKIDGVQGTRYMYHDPCHTPIKTMDPTKLVNQLMGGNIGADG
FT                   QTHAIEKNDRCCGESGTLAISRPDISTQVRFRKEEEMQKGADKLRSLGQTSGQGGEAFN
FT                   GDVKILTSCPACLQGLSRYTEDVSVQADYIVVEMARHVLGETWLQDYVAQANAGGIERV
FT                   LV"
FT   gene            350593..351030
FT                   /locus_tag="Rpic_0330"
FT   CDS_pept        350593..351030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0330"
FT                   /product="histidine triad (HIT) protein"
FT                   /note="PFAM: histidine triad (HIT) protein; KEGG:
FT                   rso:RSc0455 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25488"
FT                   /db_xref="GOA:B2UFG5"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR026026"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:B2UFG5"
FT                   /protein_id="ACD25488.1"
FT                   /translation="MTERAPGCALCEADGGEPVWRNAKARVVLVEHARFPGFCRVIWND
FT                   HVAEQTDLSDNDRHWLMELVSRVERVLRAELAPDKINLASFGNFVPHLHWHVIPRYRWD
FT                   THFPEAVWGPEQRAPDNERMAEITAKLPALSYALQAALADA"
FT   gene            351145..352989
FT                   /locus_tag="Rpic_0331"
FT   CDS_pept        351145..352989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0331"
FT                   /product="ABC transporter domain protein"
FT                   /note="PFAM: ABC transporter related; SbmABacA family
FT                   protein; ABC transporter domain protein; SMART: AAA ATPase;
FT                   KEGG: rso:RSc0456 probable ATP-binding transport ABC
FT                   transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25489"
FT                   /db_xref="GOA:B2UFG6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:B2UFG6"
FT                   /protein_id="ACD25489.1"
FT                   /translation="MTTPRTAATPDSHKDSISELTVHHGRLNLSETWQLIRPYWFSEDR
FT                   HKAWGLLALVVALNLFLVYMNVLFTDWNRLFYNALEQKNYGEFWTQLGRFSWIAALLIF
FT                   GSIMRLYYSMMLQMRWRTWITGSFLDDWLSKQAFYRLEQTHSADNPDQRIADDLRNFTD
FT                   ATLTLALGFLNSAVTLVSFFGILWAVSGPLAFSLGGHDFVIPGYMVWFALLYSIVGSVI
FT                   IHFVGRPLIGLSFQQERYEAYFRFLLVRVRENSESIALYRGEPTEKAILRGRFERIRTN
FT                   WNQLMDYTRRLTFASSGYAQFAIIFPFLVSAPRYFGGTLTLGGMMQVATAFGQVQDAMS
FT                   WFVTNYRTLVTWKASTNRLIEFQRAIRAAEREEEHRAGVRDVEVETAAVPAIEARGLAL
FT                   NLPNRKPEDLLVEPFDMTLARGERVLVSGPSGCGKSTLVRAVAGIWPYGSGRIEVPDDA
FT                   RVLFLPQRSYLPSGTLADALSYPDLATQYTAERLTQVLNACRLPALVDLLDEVSNWSLR
FT                   LSPGEQQRLAFARALLQRPDYLFLDEATSALDEDTEAFMYSLMLESMPDVTIVSVAHRS
FT                   TVARFHHRRLRYIPEGDPLTAVSYRVVEEPAHMALAAS"
FT   gene            353021..353437
FT                   /locus_tag="Rpic_0332"
FT   CDS_pept        353021..353437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0332"
FT                   /product="protein of unknown function DUF971"
FT                   /note="PFAM: protein of unknown function DUF971; KEGG:
FT                   rso:RSc0457 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25490"
FT                   /db_xref="InterPro:IPR010376"
FT                   /db_xref="InterPro:IPR038492"
FT                   /db_xref="UniProtKB/TrEMBL:B2UFG7"
FT                   /protein_id="ACD25490.1"
FT                   /translation="MAGLSADTPHPTGITVHTQSRVLQIAFADGKQFSLPFEYLRVLSP
FT                   SAEVQGHGPGQEVLQTGKREVGIVGVEPVGNYAIRPLFSDGHDSGIFDWAYLYRLGIEH
FT                   GALWQAYLDRLAAAGVDRDAPMAENAGHACGHSH"
FT   gene            353492..354223
FT                   /locus_tag="Rpic_0333"
FT   CDS_pept        353492..354223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0333"
FT                   /product="ubiquinone/menaquinone biosynthesis
FT                   methyltransferase"
FT                   /note="TIGRFAM: ubiquinone/menaquinone biosynthesis
FT                   methyltransferase; PFAM: UbiE/COQ5 methyltransferase;
FT                   Methyltransferase type 11; Methyltransferase type 12; KEGG:
FT                   rso:RSc0458 ubiquinone/menaquinone biosynthesis
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25491"
FT                   /db_xref="GOA:B2UFG8"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR023576"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2UFG8"
FT                   /protein_id="ACD25491.1"
FT                   /translation="MSQTHFGFQQVDEQEKAGKVAGVFHSVASKYDVMNDLMSGGLHRV
FT                   WKMFTIAQAAVRPGYKVLDIAGGTGDLAKAFARQAGPTGEVWLTDINESMLRVGRDRLL
FT                   DAGVLTPTALCDAEHIPFPNAYFDVVTVAFGLRNMTHKDRALAEMRRVVKPGGKVMVLE
FT                   FSKVWQPLEKAYDVYSFKVLPWLGSKVAGDPESYRYLAESIRMHPDQETLKQMMEQAGL
FT                   DSVEYFNLTAGVVALHVGRRL"
FT   gene            354378..355397
FT                   /locus_tag="Rpic_0334"
FT   CDS_pept        354378..355397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0334"
FT                   /product="import inner membrane translocase subunit Tim44"
FT                   /note="PFAM: import inner membrane translocase subunit
FT                   Tim44; KEGG: rso:RSc0459 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25492"
FT                   /db_xref="GOA:B2UFG9"
FT                   /db_xref="InterPro:IPR007379"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:B2UFG9"
FT                   /protein_id="ACD25492.1"
FT                   /translation="MAGALVATLALGTAIDANAKRMGGSRSIGKQSSTVTQRQQTPPAT
FT                   TPSPTQQAAPAAQPSPAAPAPGAPAAKPGRNWGGMLGGLAAGLGIGYLLSKFGLGAGLA
FT                   SLLSNLILIALVAFVVMWIIRKVRGSRPQGPAYATGGPSLGGDREPYVPQPAAPAPQAS
FT                   APAAASLNTGNTSGLGAGAATAAQSWNLGGSAASAQAVNAQPAAAAPQQPWGVPADFDT
FT                   QAFLRNAKVYFIRLQAAWDAGNLNDIREFTTPEMFAEIKMDLADRGTSPNKTDVVSVEA
FT                   EMLGIETQAAEYLASVRFSGMIREEANAPAQPFAEVWNLTKPTQGAGGWVLAGIQQLQ"
FT   gene            355543..356205
FT                   /locus_tag="Rpic_0335"
FT   CDS_pept        355543..356205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0335"
FT                   /product="Sterol-binding domain protein"
FT                   /note="PFAM: Sterol-binding domain protein; KEGG:
FT                   rso:RSc0460 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25493"
FT                   /db_xref="GOA:B2UFH0"
FT                   /db_xref="InterPro:IPR003033"
FT                   /db_xref="InterPro:IPR038989"
FT                   /db_xref="UniProtKB/TrEMBL:B2UFH0"
FT                   /protein_id="ACD25493.1"
FT                   /translation="MSSTATSSPSSFPLVLMQPLLLALNHLLRQEPWAQETLRPFAGRV
FT                   ARFDLAPMSMTLQVDAAGLVTAPAPDVEPAVTVVVPLAAAAGDYATGGQAAVLKHVRIE
FT                   GEAEFANVLSTLLRNLRWDAAEDLSRVFGDVIAQRMVSGAQAARTEATRVSRSLAESVA
FT                   SYLTDEQPTLVRHARLAQFAADVAALRDAEARLVKRLERLEKLPRPATRTARQGESA"
FT   gene            356202..357779
FT                   /locus_tag="Rpic_0336"
FT   CDS_pept        356202..357779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0336"
FT                   /product="2-polyprenylphenol 6-hydroxylase"
FT                   /note="TIGRFAM: 2-polyprenylphenol 6-hydroxylase; PFAM:
FT                   ABC-1 domain protein; KEGG: rso:RSc0461 putative ubiquinone
FT                   biosynthesis protein UbiB"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25494"
FT                   /db_xref="GOA:B2UFH1"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR010232"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:B2UFH1"
FT                   /protein_id="ACD25494.1"
FT                   /translation="MTRFFRLGKIVFVILYYGLDQLALSGFKSRRIRALVWLLTLGRKP
FT                   KLPRGERLRLALEQLGPIFVKFGQVLSTRRDLLPPDVADELAKLQDRVPPFDPKVAAAI
FT                   VEKSLGKPLSALFHRFDHHPVASASIAQVHFATLRGGPYDGREVAVKVLRPGMLPVIDS
FT                   DLALMRDLATWIEKLWADAKRLKPREVVAEFDKYLHDELDLMREAANASQLRRNFAKSD
FT                   LLLVPEVFWDWCTSEVFVMERMHGMRISHTEELRAAGVDMHKLARDGVEIFFTQVFRDG
FT                   FFHADMHPGNILVSVAPETLGRYIALDFGIVGALSEFDKNYLAQNFLAFFQRDYHRVAV
FT                   LHIESGWAPEETRVEELEGAIRACCEPYFDRPLGEISLGLVLMRLFQTSRRFNVEVQPQ
FT                   LVLLQKTLLNVEGLGRQLDPDLDLWKTAKPFLERWMHEQIGWRGFVERLKVEAPQWANK
FT                   LPDFPRLVHQILDRHSREDGNAQTAALTALLAEQKRTNRLLSAALLFVGGFAVGIVATH
FT                   VLAWMARY"
FT   gene            357803..358432
FT                   /locus_tag="Rpic_0337"
FT   CDS_pept        357803..358432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0337"
FT                   /product="thiopurine S-methyltransferase"
FT                   /note="PFAM: thiopurine S-methyltransferase;
FT                   Methyltransferase type 12; KEGG: rso:RSc0462 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25495"
FT                   /db_xref="GOA:B2UFH2"
FT                   /db_xref="InterPro:IPR008854"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B2UFH2"
FT                   /protein_id="ACD25495.1"
FT                   /translation="MAQPPVFQSRDAADPAFWDERFTREHTPWDAAGVPAAFRQFCEAQ
FT                   PAPLSTLIPGCGNAYEAGWLAERGWPVTAIDFAPSAVASARAVLGPHADVVQLADFFRF
FT                   SPPRPVHWIYERAFLCAMPRRLWPDYAAQVAKLLPPRGLLAGFFAVVEGREAMPKGPPF
FT                   ETTQPELDALLSPAFERISDMPIAETDSIPVFAGRERWQVWRRRAD"
FT   gene            358663..360102
FT                   /locus_tag="Rpic_0338"
FT   CDS_pept        358663..360102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0338"
FT                   /product="Na+/solute symporter"
FT                   /note="PFAM: Na+/solute symporter; KEGG: rso:RSc0463
FT                   probable sodium/solute symporter transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25496"
FT                   /db_xref="GOA:B2UFH3"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:B2UFH3"
FT                   /protein_id="ACD25496.1"
FT                   /translation="MLIWFVIVYWVISVGIGLWAALRVRSTADFAVAGRSLPFYVVTAT
FT                   VFATWFGSEAVLGIPAEFLKDGLHGVVADPFGSSLCLVLVGLFFAKPLYRMNLLTIGDF
FT                   YRNRFGRVAETLTTLCIVVSYLGWVAAQIKALGLVFYTVSDGAVSQDLGMMIGAGSVLV
FT                   YTLFGGMWSVAVTDFIQMIIIVIGMLYIGWEVSGQAGGVGAVVAHAAASGKFSFWPAFN
FT                   PIEVIGFVTAWITMMLGSIPQQDVFQRVTSSRTERIAGTASVLGGVLYFMFAFVPMFLA
FT                   YSATLIDPEMVAKYIDTDSQMILPNLVLQHAPIFAQVMFFGALLSAIKSCASATLLAPS
FT                   VTFAENVLRPLLPNMDDKRFLRVMQAVVLTFTVLVTLFALNSHLSIFHMVESAYKVTLV
FT                   AAFVPLAFGLFWRRATKQGGLLAIILGLAAWIWCEAFQPNAMLPPQLVGLLASFGAMVL
FT                   GSLGPQWIANRAPTTKAVTQA"
FT   gene            360350..360691
FT                   /locus_tag="Rpic_0339"
FT   CDS_pept        360350..360691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0339"
FT                   /product="regulatory protein, FmdB family"
FT                   /note="TIGRFAM: regulatory protein, FmdB family; PFAM:
FT                   Putative regulatory protein FmdB; KEGG: rso:RSc0464
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25497"
FT                   /db_xref="InterPro:IPR013429"
FT                   /db_xref="UniProtKB/TrEMBL:B2UFH4"
FT                   /protein_id="ACD25497.1"
FT                   /translation="MPIYAYRCDACGHAKDVLQKMSDAPLTDCPACGAPAFKKQLTAAG
FT                   FQLKGSGWYVTDFRGGSGGASAAAPATGSAAKTEPAAPAAAAASSDSASSSASTPAASG
FT                   GCGTSCACH"
FT   gene            360723..361460
FT                   /locus_tag="Rpic_0340"
FT   CDS_pept        360723..361460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0340"
FT                   /product="protein of unknown function DUF502"
FT                   /note="PFAM: protein of unknown function DUF502; KEGG:
FT                   rso:RSc0465 probable transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25498"
FT                   /db_xref="GOA:B2UFH5"
FT                   /db_xref="InterPro:IPR007462"
FT                   /db_xref="UniProtKB/TrEMBL:B2UFH5"
FT                   /protein_id="ACD25498.1"
FT                   /translation="MKQKTSALKTWFLTGLLVLVPLAITLWVLSLIIGTMDQSLALLPS
FT                   AWQPDQLFGRRIPGVGAILTLAFILIVGVLAHNFIGQKLVLWWEALVGRIPVVGPIYSS
FT                   VKQVSDTLLSSNGNAFRKALLVQYPREGSWTIAFLTGRPGGDVENHLQGEYVSVYVPTT
FT                   PNPTSGFFLMMPKADTIELDMTVDAALKYIVSMGVVAPEALPRRMDPPDASPQTEDRSP
FT                   AQVPRDPSNPTALPAEGGAIAAP"
FT   sig_peptide     360723..360794
FT                   /locus_tag="Rpic_0340"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.800) with cleavage site probability 0.276 at
FT                   residue 24"
FT   gene            361512..363383
FT                   /locus_tag="Rpic_0341"
FT   CDS_pept        361512..363383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0341"
FT                   /product="aspartyl-tRNA synthetase"
FT                   /note="TIGRFAM: aspartyl-tRNA synthetase; PFAM: tRNA
FT                   synthetase class II (G H P and S); GAD domain protein; tRNA
FT                   synthetase class II (D K and N); nucleic acid binding
FT                   OB-fold tRNA/helicase-type; KEGG: rso:RSc0466 aspartyl-tRNA
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25499"
FT                   /db_xref="GOA:B2UFH6"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004115"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004524"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029351"
FT                   /db_xref="UniProtKB/TrEMBL:B2UFH6"
FT                   /protein_id="ACD25499.1"
FT                   /translation="MRDASLAARFAENHNMQMRTQYCGQVTEQLLGQSVTLSGWAHRRR
FT                   DHGGVIFIDLRDREGLVQVVCDPDRPEMFKVAEGVRNEFCLQVKGVVRARPEGTTNANL
FT                   TSGKVEVLCHELTVLNASVTPPFQLDDDNLSETTRLTHRVLDLRRPQMQYNLRLRYKVA
FT                   MEVRKYLDDKGFIDIETPMLTKSTPEGARDYLVPSRVNAGQFFALPQSPQLFKQMLMVS
FT                   GFDRYYQITKCFRDEDLRADRQPEFTQIDCETSFLSEQEIRDLFEEMIRTVFKNTMSVD
FT                   LDAKFPVMEFREAMARFGSDKPDLRVKLEFTELTDAMKDVDFKVFSGPANAEGGRVVAL
FT                   RVPGGASLSRGDIDAYTKFVEIYGAKGLAWIKVNEVAKGRDGLQSPIVKNLHDAAIAEI
FT                   LKRSGAQDGDILFFGADRAKVVNDAMGALRLKVGHSDFAKSTGLFEDAWKPLWVIDFPM
FT                   FEYDEEDARWVAMHHPFTSPKDEHLEYLETDPGKCIAKAYDMVLNGWEIGGGSVRIYRE
FT                   EVQSKVFRALKINDEEARAKFGFLLDALQYGAPPHGGIAFGLDRVVTMMAGADSIRDVI
FT                   AFPKTQRAQDLLTQAPSPVDEKQLRELHIRLRAAEAKVAAPTAATTA"
FT   gene            363546..364406
FT                   /locus_tag="Rpic_0342"
FT   CDS_pept        363546..364406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0342"
FT                   /product="putative transmembrane protein"
FT                   /note="KEGG: rso:RSc0467 probable transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25500"
FT                   /db_xref="GOA:B2UFH7"
FT                   /db_xref="UniProtKB/TrEMBL:B2UFH7"
FT                   /protein_id="ACD25500.1"
FT                   /translation="MDYIDFARTWVVTHAEFLLTWLITALLVMTLAWIEIRRATRRAAM
FT                   AMTEAVATTVAACVPEIAAAAQSAHPGVSASASSPGLVEAMRALGHLSADRMHWLHAVA
FT                   NLRLPETALPPAAPGMPVHPLVYDTPRPLAEAHLAAERCFADHARVLQAERRALQALET
FT                   AEREGSSELHRIERETSAIVERFDQANAQSEQTDVQRFLIQKFNTLGNRERELTAQLAA
FT                   LRQQLGERTEALWAQSQRAADDYAAMLDPLVAVARRELGHETATDETALWLARTRTGQG
FT                   PLRAA"
FT   gene            364523..365008
FT                   /locus_tag="Rpic_0343"
FT   CDS_pept        364523..365008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0343"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: rso:RSc0468 dATP
FT                   pyrophosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25501"
FT                   /db_xref="GOA:B2UFH8"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR003564"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:B2UFH8"
FT                   /protein_id="ACD25501.1"
FT                   /translation="MPHKIPVSVLVVIHTPDLHVLVMERADHPGFWQSVTGSCDALDEP
FT                   LADTARREVLEETGIDAAQHHLIDWGHHIEYEIYPRWRHRYAPGITRNTEHWFGLLVSG
FT                   KMPVRMSPREHVQAEWLPYQDAAARCFSRSNAEAILQLPERLAAYHARQAALTKDQA"
FT   gene            365010..365756
FT                   /locus_tag="Rpic_0344"
FT   CDS_pept        365010..365756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0344"
FT                   /product="Endonuclease/exonuclease/phosphatase"
FT                   /note="PFAM: Endonuclease/exonuclease/phosphatase; KEGG:
FT                   rso:RSc0469 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25502"
FT                   /db_xref="GOA:B2UFH9"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:B2UFH9"
FT                   /protein_id="ACD25502.1"
FT                   /translation="MLRLRVATYNIHKGVTGIARRVRVHDVRQGLHSMDADIVFLQEVQ
FT                   DRNDRLVAAELFDPNYTQLRYLATDVYPHTVYGRNAVYEHGHHGNAILSRFPILLSENL
FT                   DISDHRFEQRGLLHAVTDLGFGEVHLLCAHFGLFARSRQRQAEALVDRVRSVVPPDAPL
FT                   VVAGDFNDWNNRLDRTICQALGATEVADKAANARPVRTFPSHMPWLRLDRIYVRGFDIE
FT                   RAHALTGREWAQRSDHVPLLAELAHP"
FT   gene            365753..367021
FT                   /locus_tag="Rpic_0345"
FT   CDS_pept        365753..367021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0345"
FT                   /product="phospholipase D/Transphosphatidylase"
FT                   /note="PFAM: phospholipase D/Transphosphatidylase; KEGG:
FT                   rso:RSc0470 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25503"
FT                   /db_xref="GOA:B2UFI0"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="InterPro:IPR030872"
FT                   /db_xref="UniProtKB/TrEMBL:B2UFI0"
FT                   /protein_id="ACD25503.1"
FT                   /translation="MRVVRDAGPLRSEWRRGKPLPGNDVDLLCGGAEFFPALIEAIDAA
FT                   QRRVALETYIYTDDATAHSVTEALARAARRGVDVHLTIDGFGTGLLPPSIAAMLETAGV
FT                   NLRIYRPVRGFRLQRRHLRRLHRKIAVIDDDEAFVGGINIIDDLNHAPFNDTALGPRYD
FT                   FAVRVRGPLVAQIALTVDRLWWQMGVRVGMREVGVTGVAAEFPVMTDTPRPRHRGASGR
FT                   ESERAPGTVLASLVLRDNVRNRRAIEREYLRALGAARHEVIIANAYFLPGVRFMRALAA
FT                   CRRRGVRVRLLLQGQVEYRLQHYATRSLYHMLLRDNVEIHEYTASFLHAKVAVVDDRWA
FT                   TVGSSNIDPFSLLLAREANVVVWDSTVANELRGALEGAMAHHARRVLADAHAARRWWWR
FT                   LADWCAYRLVRLGVVISGRAAQY"
FT   gene            367061..368725
FT                   /locus_tag="Rpic_0346"
FT   CDS_pept        367061..368725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0346"
FT                   /product="coenzyme A transferase"
FT                   /note="PFAM: coenzyme A transferase; KEGG: rso:RSc0471
FT                   putative transferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25504"
FT                   /db_xref="GOA:B2UFI1"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR014388"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:B2UFI1"
FT                   /protein_id="ACD25504.1"
FT                   /translation="MQVITADEAARLVQPGWTVACAGFVGAGHAEAVTHALERRFLTTG
FT                   EPRDLTLVYSAGQGDRATRGVNHFGNPEMTRCVVGGHWRSATRLADMALAEQCDAFNLP
FT                   QGVLTHLYRAIAGGKPGVLTKMGLHTFVDPRTELDPRYHGGAINHRAKAARAAGKASWV
FT                   EYERFRGDDYLFYPSFPLHCVFLRGTAADPRGNISTHEEAFHHELLAMAQAARNSGGIV
FT                   IAQVRRLVDRHDNLQAIHVPGILVDYVVVAEDEAEHQMTFGEAFNPTYIRPWQGEAIQL
FT                   KEDAIEASDALEASQHGALDARTLVQRRAVLELMAQQPRVVNLGVGMPAAVGALAEQEG
FT                   ARGFTLTVEAGPIGGTPADGLSFGASAYPEAVVDQPAQFDFYEGGGIDLAILGLAELDG
FT                   AGNVNVSLFGEGGDTIVAGVGGFINITQSARSIVFMGTLTAGGLQVEAEGGKLRIVREG
FT                   RLKKIVPAVSHLTFNGEYAARSGIPVRYVTERAVFEMRADGNGGRRLTLTEIAPGIDLQ
FT                   RDVLDQCAAEVAVAADLREMDARIFRRGAMCAGITPV"
FT   gene            369079..369720
FT                   /locus_tag="Rpic_0347"
FT   CDS_pept        369079..369720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0347"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: rso:RSc0472
FT                   putative transcription regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25505"
FT                   /db_xref="GOA:B2UFI2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:B2UFI2"
FT                   /protein_id="ACD25505.1"
FT                   /translation="MRHPTARLESNHAAATPMRKGELTRAAILDAALELASRDGLEGLT
FT                   IGVLAERMQMSKSGVFAHFGSREDLQVEVVREYHKRFEQEVFYPSLTEPRGLPRLWSMV
FT                   RRWMERRIQEVTTGCIYISGAVEYDDRAESPVRDELVKSVTIWRAALARAIAQAKEEGH
FT                   LRAEADPQLMLFEMYSLELGLHHDARFLRLPNSAELAMVALNKLIQSYRT"
FT   gene            369773..371560
FT                   /locus_tag="Rpic_0348"
FT   CDS_pept        369773..371560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0348"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein; KEGG:
FT                   rso:RSc0473 putative acyl-CoA dehydrogenase oxidoreductase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25506"
FT                   /db_xref="GOA:B2UFI3"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR020953"
FT                   /db_xref="InterPro:IPR025878"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B2UFI3"
FT                   /protein_id="ACD25506.1"
FT                   /translation="MGQYTAPLRDMQFVLHELLGVENHLKEMPQHAEIDADTINQVIEE
FT                   AGKFCSEVIFPLNQSGDREGCTYHGDGVVTAPKGFKEAYQQYVEAGWPSLGCDPEYGGQ
FT                   GLPILINNALYEMLNSANQAWTMYPGLSHGAYEALHAHGTDELKQRYLPKLVSGVWTGT
FT                   MCLTEPHCGTDLGILRTRAEPLADGSYAITGTKIFISAGEHDLAENIIHLVLARLPDAP
FT                   GGTKGISLFVVPKFIPDANGNPGERNTVKCGSIEHKMGIHGNATCVINLDGARGWMVGE
FT                   PNKGLNAMFVMMNAARLGVGMQSLGLTEVAYQNSAAYAKERLQMRSLSGPKAPDKPADP
FT                   IIVHPDVRRMLLTQRAFAEGGRAFSYWIALQIDRELSHSDESARKDAADLVALLTPIAK
FT                   AFLSDNAFISTNEGMQVFGGHGYIAEWGMEQYVRDARINMIYEGTNTVQSLDLLGRKIL
FT                   GDMGAKMKKFGKLVQDFVEAEGTNEAMQEFINPLADIGDKVQKLTMEIGMKAMANPDEV
FT                   GAAAVPYLRVVGHLVFSYFWARMAKIALEKQDSGDSFYKVKLATARFYFAKLLPETASQ
FT                   IRMARAGGATLMALEADLF"
FT   gene            371636..374116
FT                   /locus_tag="Rpic_0349"
FT   CDS_pept        371636..374116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0349"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase NAD-binding"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase;
FT                   3-hydroxyacyl-CoA dehydrogenase domain protein;
FT                   3-hydroxyacyl-CoA dehydrogenase NAD-binding; KEGG:
FT                   rso:RSc0474 putative 3-hydroxyacyl-CoA dehydrogenase
FT                   oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25507"
FT                   /db_xref="GOA:B2UFI4"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2UFI4"
FT                   /protein_id="ACD25507.1"
FT                   /translation="MTRTELPTSAQPQAGQRSNFLVRRVAVLGAGVMGAQIAAHLINAK
FT                   VPVTLFDLPAKEGPKSGIALKAIENLKKLSPAPLGIKDDANLIQAANYEDDIEKLRDCD
FT                   LVIEAIAERMDWKHDLYKKVAPHIAPHAIFASNTSGLSITELSDGFDAELKSRFCGVHF
FT                   FNPPRYMHLVELIPTAHTRGDILDKLETFLTSALGKGVVRAKDTPNFIANRVGIFSILA
FT                   VFAESAKYGIPFDVVDDLTGSKLGRAKSATFRTADVVGLDTMAHVIKTMQDNLKEDPFA
FT                   PVYATPPVLAKLVEAGALGQKAGAGFYKKEGKEIKVLDPQSGQYGPSGKKADDIVVRIL
FT                   KKEPAERLKLLRESTNPQAQFLWAVFRDVFHYIAVYLEQIADSAAEVDLAIRWGFGWNS
FT                   GPFEDWQEAGWKQVAEWVKEDIEAGKALSNAALPQWVFSGPVADNGGVHSAQGSWSAKQ
FT                   GTFLQRSTLPVYGRQVFRAPIKGATTVNPLTYGKTIEETDAVRIWVDDAAGQDDVLVVS
FT                   FKSKMNTIGPSVIDGLTRAVDLAEAGYKGLVVWQPTSLKLGAPGGPFSAGANLEEAMPA
FT                   FMMGGAKGIEPFVKKFQDGMMRVKYAGVPVVSAASGIALGGGCELLLHSAKRVAALETY
FT                   IGLVEVGVGLVPAGGGLKEAALAAAKAAQAAGSTNILQFLTNRFQAAAMAKVSSSALDA
FT                   QKIGYLQPTDTIVFNVHELLHVARNEVRALSDSGYRAPLRPVGIPVAGRSGIATIKASL
FT                   VNMRDGGFISQHDFTIASRIAEAVCGGDVEAGALVDEEWLLALERKAFVDLLGSAKTQE
FT                   RIMGMLQTGKPVRN"
FT   gene            374150..375349
FT                   /locus_tag="Rpic_0350"
FT   CDS_pept        374150..375349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0350"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.16"
FT                   /note="KEGG: rso:RSc0475 acetyl-CoA acetyltransferase;
FT                   TIGRFAM: acetyl-CoA acetyltransferase; PFAM: Thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25508"
FT                   /db_xref="GOA:B2UFI5"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:B2UFI5"
FT                   /protein_id="ACD25508.1"
FT                   /translation="MTKQLQDAYIVAATRSPIGKAPKGTLKNLRPDDLLATILKSAVAQ
FT                   VPNLDPALIEDAIVGCAIPEAQQGLNVARIGALLAGLPNSVGGVTVNRFCASGLTAVAM
FT                   AADRIRVGESDVMIAAGVESMSMVPMMGNSPSMSPEIFTRDENVGIAYGMGLTAEKVAQ
FT                   QWKISREAQDAFSLASHQKALAAQQAGEFKDEITPIEIIEKFPNLGTGAIDIRTRTMSL
FT                   DEGPRADTSVEGLGKLRAVFANKGSVTAGNSSQTSDGSGALILVSEKILKQFNLVPLAR
FT                   FVSFAVRGVPPEIMGIGPKEAIPAALKAGGLTQDQIDWIELNEAFAAQSLAVIQDLGLD
FT                   TSKINPLGGAIALGHPLGATGAIRAATVVHGLRRRNQKYGMVTMCVGTGMGAAGIFERM
FT                   "
FT   gene            375568..376533
FT                   /locus_tag="Rpic_0351"
FT   CDS_pept        375568..376533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0351"
FT                   /product="DegV family protein"
FT                   /note="PFAM: DegV family protein; KEGG: reu:Reut_A0449
FT                   DegV"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25509"
FT                   /db_xref="InterPro:IPR003797"
FT                   /db_xref="UniProtKB/TrEMBL:B2UFI6"
FT                   /protein_id="ACD25509.1"
FT                   /translation="MGNTIGDTIVLTDAACDMPRSMIDQLGLGVVPFRIRAGELFVEDR
FT                   RDEAALPQLYRKYLVDKQDHYAESIPLLEREIEDFLLKHVVTQHDRALLLTIASSRSHF
FT                   YSHATGAVVGTTAKSFKPRKDAGRSGLFELTVVDTGAIGPGQALMVHEAARMLREGAEV
FT                   RDVVHVIENRLRDASHVYLVPDELLYMYTRAKQKGEKSITWGRYMMGTAFNVRPLIHMH
FT                   RGDTEAIAKVRGSDEGIRRLLAHTETMITEERLATPVVAITYSGSLDTVRRMEPVQALM
FT                   RTAQEHGVEVLLAPMSLTVALNVGANAFSVGYLSDSPVPI"
FT   gene            376560..377324
FT                   /locus_tag="Rpic_0352"
FT   CDS_pept        376560..377324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0352"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   rso:RSc0476 enoyl-CoA hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25510"
FT                   /db_xref="GOA:B2UFI7"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:B2UFI7"
FT                   /protein_id="ACD25510.1"
FT                   /translation="MSIRTETADGVLTLTFDRLDRKNAITAAMYQTLADALVAAETDPA
FT                   IRVIVLAGHESVFTAGNDLEDFMKNPPKDESAPVHQFLRAISTASKPLIASVSGAAVGV
FT                   GTTMLLHCDLVYASETAKLSMPFAQLGLCPEAASSLLLPQLAGYHRAADKLLFGEPFDA
FT                   NEARELGLVNRVLPAGELDAFVRTQARKLTLLPPASLRATKRLMKEGATPQIAERMSVE
FT                   GKQFGEMLRAPEAREAFTAFFEKRRPDFSKFN"
FT   gene            complement(377390..377827)
FT                   /locus_tag="Rpic_0353"
FT   CDS_pept        complement(377390..377827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0353"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   rso:RSc0477 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25511"
FT                   /db_xref="GOA:B2UFI8"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR033120"
FT                   /db_xref="InterPro:IPR040170"
FT                   /db_xref="UniProtKB/TrEMBL:B2UFI8"
FT                   /protein_id="ACD25511.1"
FT                   /translation="MLPCIIMSDTHAATETVTLPADKQPAVRVMPMPSDANVHGDVFGG
FT                   WIMSQVDIAGSIPAVVRANGRVATIAVNSFVFKQPVYVGDLVSFYANVVKTGRTSITVD
FT                   VEVYAQRMHASGRHATVKVTEATLTYVATDETRKPRVLPPL"
FT   gene            377919..379757
FT                   /locus_tag="Rpic_0354"
FT   CDS_pept        377919..379757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0354"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter transmembrane region; ABC
FT                   transporter related; SMART: AAA ATPase; KEGG: rso:RSc0478
FT                   probable composite ATP-binding transmembrane ABC
FT                   transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25512"
FT                   /db_xref="GOA:B2UFI9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:B2UFI9"
FT                   /protein_id="ACD25512.1"
FT                   /translation="MRRFPASSEPPPPGAARGDWRTIKSLLPYLLAYKWRVALALSFLI
FT                   AAKVANLGVPMVMKRLIDAMNVSPSDPRALLVVPVGIIIGYGLLRLSTSLFSELREILF
FT                   AKVTESSVRTLALQVFRHLHALSLRFHLERQTGGMSRDIERGTRGIQSLISYSLYSILP
FT                   TLVEVGLVITYFFVKYDVWFALITFCALVSYIVFTVTVTNWRTHFRRKMNELDSRANQK
FT                   AIDSLLNFETVKYFGNEDYEARRYDENLKHYRAAAIRSQNSLSVLNFGQQLIVATALIL
FT                   ILYRATQGVAAGHMTLGDLVLVNTLMLQIYIPLNFLGVIYRELKQAVTDMDRMFNLLQT
FT                   NREVADKPDAPPLTVHAGEVRFAHVDFSYEANRQILFDVDFTIPAGTTTAVVGQSGSGK
FT                   STLARLLFRFYDVKSGAIQIDGQDLRDVTQSSVRAAIGIVPQDTVLFNDSIYYNIAYGR
FT                   PDASREEVIEAARAAQIHHFVESLPDGYETQVGERGLKLSGGEKQRVAIARTLLKRPPI
FT                   LVFDEATSALDSRTEHAIQEELMRLAQNHTTLVVAHRLSTIVRAHQILVMEHGRIIERG
FT                   THESLLRAEGRYAQMWRMQAREPERVAEEAEDARAG"
FT   gene            379773..380717
FT                   /locus_tag="Rpic_0355"
FT   CDS_pept        379773..380717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0355"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: rso:RSc0479 putative transcription
FT                   regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25513"
FT                   /db_xref="GOA:B2UFJ0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2UFJ0"
FT                   /protein_id="ACD25513.1"
FT                   /translation="MELKWLEDFISLAETRSFSRSAELRHVTQPAFSRRIQSLEAWLGN
FT                   ELIDRSSYPTRLTPAGEVFYEQALAMLAQVSETRALMRGQRPASASTIDFAVPHTLSLT
FT                   FFPGWLAQVEEKIGKLQCRLRALNVHDAVMTLVEGGCDLVMVYHHARQMIQLDPTRYDM
FT                   LVLGTERLSPFSKPDASGRPIYRLVPTARKPIAYLSYTPNAFLGRMVDVLLENSPVAPL
FT                   LDKCYETDMAEALKVMALAGHGVAFLPESAVREDVAAGRLVRAEGKGGGTLSIEMEIRL
FT                   YREHPQSGAHDRRHPQSKRKRELIDTLWSALAG"
FT   gene            380869..382170
FT                   /locus_tag="Rpic_0356"
FT   CDS_pept        380869..382170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0356"
FT                   /product="Glu/Leu/Phe/Val dehydrogenase"
FT                   /note="PFAM: Glu/Leu/Phe/Val dehydrogenase ;
FT                   Glu/Leu/Phe/Val dehydrogenase dimerisation region; KEGG:
FT                   rso:RSc0480 probable glutamate dehydrogenase (NAD(P)+)
FT                   oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25514"
FT                   /db_xref="GOA:B2UFJ1"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR014362"
FT                   /db_xref="InterPro:IPR033524"
FT                   /db_xref="InterPro:IPR033922"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2UFJ1"
FT                   /protein_id="ACD25514.1"
FT                   /translation="MSNVASPSTLQHAIPSYLPADNLGPWGIYLQQVDRVTPYLGSLAR
FT                   WVETLKRPKRALIVDVPIQMDDGRIAHFEGYRVQHNTSRGPGKGGVRFHQDVTLSEVMA
FT                   LSAWMSVKNAAVNVPYGGAKGGIRVDPRKLSSGELERLTRRYTSEIGIIIGPNKDIPAP
FT                   DVNTNAQIMAWMMDTYSMNEGSTATGVVTGKPIALGGSLGRREATGRGVFVVGSEAARN
FT                   LGIDVKGARVVVQGFGNVGSVAAKLFHDAGAKVIAVQDHKGIVFNGNGLDVDALIKHVD
FT                   HNGSVAGFAAEAVSQDDFWALDCEFLIPAALEGQITAKNAPHIKAKIVVEGANGPTTPE
FT                   ADDILRDRGILVCPDVIANAGGVTVSYFEWVQDFSSFFWTEDEINQRLVRIMQDAFRGV
FT                   WQVAQDNKVTLRTAAFIIACTRILQARQERGLYP"
FT   gene            382692..383600
FT                   /locus_tag="Rpic_0357"
FT   CDS_pept        382692..383600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0357"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="PFAM: extracellular solute-binding protein family 3;
FT                   KEGG: rso:RSc0481 probable amino-acid-binding periplasmic
FT                   (PBP) ABC transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25515"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:B2UFJ2"
FT                   /protein_id="ACD25515.1"
FT                   /translation="MNLAKLATVVAAVGVAVGAFGSAAHAEELTGTLKKIKDTGTITLG
FT                   VRDSSIPFSYNVGGVRTIGYSYDVATKIAEDVKKQLGLKDLKVNEIPVTSQNRITLLQN
FT                   GTIDLECGSTTNNLERQKQASFTNTIFIIGTRIMVKKDSGVKDWADLKGKNVVTTAGTT
FT                   SERLLRKMNDEKQMGMNIISTKDHGQSFLTLESGRAVAFMMDDALLYGERAKAKNPAEW
FT                   VVVAKPQSREAYGCMVRKDDKPFKALADKTIAGMMKDGTINAEYKKWFEQPVPPKGVNM
FT                   EFPLSDDMKALIKNPNDKALD"
FT   sig_peptide     382692..382772
FT                   /locus_tag="Rpic_0357"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 27"
FT   gene            383700..384428
FT                   /locus_tag="Rpic_0358"
FT   CDS_pept        383700..384428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0358"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: rso:RSc0482
FT                   probable glutamate/aspartate transmembrane ABC transporter
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25516"
FT                   /db_xref="GOA:B2UFJ3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR030202"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B2UFJ3"
FT                   /protein_id="ACD25516.1"
FT                   /translation="MNYHWNWGVFFTEAAQNQTYLDWLLAGLKTTVVLGLSSWIIALVI
FT                   GSVLGVLRTVPNKWLSGLAAAYVEVFRNIPLIVQLFIWYFVMPELVPGGDYIKQMNPAT
FT                   AMFLSAMLCLGTFTAARVCEQVRSGINSLPRGQRNAGLAMGFTLAQTYRYVMLPMSFRI
FT                   IVPPLTSEFLNIFKNSAVASTIGLLELAAQGRQLVDYTAQPYESFIAVTLMYMLINLTV
FT                   MGLMRWVEARSRLPGFIGGK"
FT   gene            384446..385129
FT                   /locus_tag="Rpic_0359"
FT   CDS_pept        384446..385129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0359"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: rso:RSc0483
FT                   probable glutamate/aspartate transmembrane ABC transporter
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25517"
FT                   /db_xref="GOA:B2UFJ4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR030205"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B2UFJ4"
FT                   /protein_id="ACD25517.1"
FT                   /translation="MAYQFDFSSINVDNMRVLGEGMLLSLEITGTAILVGIVWGTLLAM
FT                   MRLSGIKPLQVFGQAYVNLFRSIPLVMVLLWFFLIVPQVLQKIFNLSPATDMRMTSALV
FT                   AFALFEAAYYSEIIRAGIQSVSRGQMFAAYAMGMTYGQAMRLVILPQAFRNMIPLLLTQ
FT                   AIVLFQDTSLVYVSALSDFFTQAYNIGERDGRIVELLLFAGLCYFVICFGASVLVKRLQ
FT                   KKVTQ"
FT   gene            385126..385860
FT                   /locus_tag="Rpic_0360"
FT   CDS_pept        385126..385860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0360"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: rso:RSc0484 putative glutamate/aspartate transport
FT                   ATP-binding ABC transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25518"
FT                   /db_xref="GOA:B2UFJ5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:B2UFJ5"
FT                   /protein_id="ACD25518.1"
FT                   /translation="MIEIKNVSKWYGSFQVLTDCTTSVKKSEVVVVCGPSGSGKSTLIK
FT                   TVNALEPFQKGEIFVDGTSVGAKGTNLPKLRSRVGMVFQNFELFPHLSITENLTIAQQK
FT                   VLGRSKEEAMAKGLKYLDRVGLKAHAAKYPGQLSGGQQQRVAIARALSMDPICMLFDEP
FT                   TSALDPEMVNEVLDVMVELAKEGMTMMCVTHEMGFARKVANRVIFMDQGRIVEDCEKEE
FT                   FFGNIDARSDRAKQFLSKILSH"
FT   gene            complement(386050..386880)
FT                   /locus_tag="Rpic_0361"
FT   CDS_pept        complement(386050..386880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0361"
FT                   /product="glutamine amidotransferase class-II"
FT                   /note="PFAM: glutamine amidotransferase class-II; KEGG:
FT                   rso:RSc0485 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25519"
FT                   /db_xref="GOA:B2UFJ6"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR026869"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:B2UFJ6"
FT                   /protein_id="ACD25519.1"
FT                   /translation="MCQLLGMNCAEPTDVTFSFTGFAARGGVTDHHADGFGVAFFEDKA
FT                   CRLFIDNQSAGTSPVAELVKRYPIKSKNVISHIRKATQGTVRLENCHPFMRELWGRHWI
FT                   FAHNGDLKNFSPFLSGVYQPVGDTDSELAFCFIMQALRKRFPGSQPPLNELFYALSDIT
FT                   KEITRYGVFNFLLCNGQAQFAHCSTRLYYIVRQWPFSTAHLIDADMTIDFAKYTTPADR
FT                   VAVIATAPLTDNEVWTQFAPGELLMFESGQATMATKVPIPEAVQIANAANTACT"
FT   gene            387039..388337
FT                   /locus_tag="Rpic_0362"
FT   CDS_pept        387039..388337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0362"
FT                   /product="Hydroxypyruvate reductase"
FT                   /EC_number="1.1.1.81"
FT                   /note="PFAM: MOFRL domain protein; KEGG: rso:RSc0486
FT                   putative hydroxypyruvate reductase oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25520"
FT                   /db_xref="GOA:B2UFJ7"
FT                   /db_xref="InterPro:IPR007835"
FT                   /db_xref="InterPro:IPR025286"
FT                   /db_xref="InterPro:IPR037035"
FT                   /db_xref="InterPro:IPR038614"
FT                   /db_xref="InterPro:IPR039760"
FT                   /db_xref="UniProtKB/TrEMBL:B2UFJ7"
FT                   /protein_id="ACD25520.1"
FT                   /translation="MKLDRTAARALLLESYAAAVGAADPLKIVADFLPPPHAGGKTLVV
FT                   GAGKAAASMALAVEQAYAGRAKIEGLVITRYAHGLPTEHIRVIEAGHPVPDEAGEQAAQ
FT                   EILDRVCALTERDRLIVLVSGGGSSLLSLPAEGIPMGDLKDVTRELLRCGAPITDMNIV
FT                   RKHLSRIQGGRLAAASRAPATTLIVSDVAGDDPSAIASGPTVPDASTYADALAIIKRWG
FT                   AQIPDTVHAHLERGARGEIAETPKPGDACFARVTNHVIATAQQSLQAGAQVFATRGIHT
FT                   AILGDTVTGEAREVAQVYGALARQVRQHGTPFVAPVALISGGECTVTIPPGVTGGRGGR
FT                   CAEFLLSLGVTLEDMGDIYALAADTDGIDGSEDNAGALLDPGSIARAAAKGVAARAALD
FT                   AHDAYGFFAAADDLIVTGPTRTNVNDYRVILIL"
FT   gene            388371..389405
FT                   /locus_tag="Rpic_0363"
FT   CDS_pept        388371..389405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0363"
FT                   /product="dihydroorotase, homodimeric type"
FT                   /EC_number="3.5.2.3"
FT                   /note="KEGG: rso:RSc0487 dihydroorotase; TIGRFAM:
FT                   dihydroorotase, homodimeric type; PFAM: amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25521"
FT                   /db_xref="GOA:B2UFJ8"
FT                   /db_xref="InterPro:IPR002195"
FT                   /db_xref="InterPro:IPR004721"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2UFJ8"
FT                   /protein_id="ACD25521.1"
FT                   /translation="MTDTLTIVRPDDWHLHLRDGDALADVVGDTARQFGRAIIMPNLKP
FT                   PVTTTAQARAYRERILAALPAGTQFEPLMTLYLTDNTSPEVIREARASGFIHGVKLYPA
FT                   GATTNSDAGVTDLRRCAKTLEAMQEVGMPLLVHGEVTDPTVDIFDREAVFIDTVMLPLR
FT                   RDFPALKVVFEHITTKHAAEYVRDAEGPVGATITAHHLLYNRNALFVGGIRPHYYCLPV
FT                   LKRETHRLALVAAATSGHPRFFLGTDSAPHAKGVKEHACGCAGCYTALHAMELYAEAFE
FT                   DANALDKLEGFASLHGPDFYGLPRNAGTLTLTRSQWQLPAEVPFGEQTLVPLRGGEMLR
FT                   WKSV"
FT   gene            389410..390210
FT                   /locus_tag="Rpic_0364"
FT   CDS_pept        389410..390210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0364"
FT                   /product="putative transmembrane protein"
FT                   /note="KEGG: rso:RSc0488 putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25522"
FT                   /db_xref="GOA:B2UFJ9"
FT                   /db_xref="InterPro:IPR021390"
FT                   /db_xref="UniProtKB/TrEMBL:B2UFJ9"
FT                   /protein_id="ACD25522.1"
FT                   /translation="MAADLGAIDWGHPAFAPLAAVGAPLADAIARGADLRDALNAQPAA
FT                   QAIRTCSGHAVRFVPQDALPAGTAYEANIAATGEVPTRDNLHDFFNALIWLHWPRAKAA
FT                   LNARQARAITQDGIGTARGTVRDAATLFDENALIFLHTQDAPERYLTGFDWRGLFVEGR
FT                   ATWGATCAVLPFGHAVLEKLVAPYKSITAHAWPVRVAALPAERPSLDAALAETLLHADL
FT                   APRHFRPLPVMGIPGWCNANEDAGFYLDTTVFRLGRRRFVPEQC"
FT   gene            390274..390549
FT                   /gene="rnpB"
FT                   /locus_tag="Rpic_R0066"
FT   ncRNA           390274..390549
FT                   /gene="rnpB"
FT                   /locus_tag="Rpic_R0066"
FT                   /product="Bacterial RNase P"
FT                   /note="Bacterial RNase P class A as predicted by Rfam
FT                   (RF00010), score 180.33; RNA component of RNaseP"
FT                   /ncRNA_class="RNase_P_RNA"
FT   gene            complement(390571..391017)
FT                   /locus_tag="Rpic_0365"
FT   CDS_pept        complement(390571..391017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0365"
FT                   /product="OsmC family protein"
FT                   /note="PFAM: OsmC family protein; KEGG: rso:RSc0489
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25523"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:B2UFK0"
FT                   /protein_id="ACD25523.1"
FT                   /translation="MDCTVSWTGPDGMAFLAETGSGHLVTMDGAPDGGGRNLAPRPMEM
FT                   VLLGTGGCTAYDVVLILKRGRQDVQGCSVKLHADRAETDPKVFTRIHFTFTVTGRNLKR
FT                   ETVERAVQLSHEKYCSASIMLAKTAEITHSLELVDLATQPTASE"
FT   gene            391718..392146
FT                   /locus_tag="Rpic_0366"
FT   CDS_pept        391718..392146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0366"
FT                   /product="ribosomal protein L13"
FT                   /note="PFAM: ribosomal protein L13; KEGG: rso:RSc0490 50S
FT                   ribosomal protein L13"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25524"
FT                   /db_xref="GOA:B2UFK1"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2UFK1"
FT                   /protein_id="ACD25524.1"
FT                   /translation="MKTFSAKPHEVKRDWYVIDATDKVLGRVASEVAHRLRGKHKPEFT
FT                   PHVDTGDFIIVINAAKLRVTGAKTTDKKYYRHSGYPGGIYETTFGKMQQRFPGRALEKA
FT                   VKGMLPKGPLGYAMIKKLKVYAEGSHPHEAQQPKALEI"
FT   gene            392159..392551
FT                   /locus_tag="Rpic_0367"
FT   CDS_pept        392159..392551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0367"
FT                   /product="ribosomal protein S9"
FT                   /note="PFAM: ribosomal protein S9; KEGG: rso:RSc0491 30S
FT                   ribosomal protein S9"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25525"
FT                   /db_xref="GOA:B2UFK2"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2UFK2"
FT                   /protein_id="ACD25525.1"
FT                   /translation="MIGNWNYGTGRRKSAVARVFIKSGKGDIIVNGKAINEYFARETSL
FT                   MIVRQPLELTNHAATFDIKVNVVGGGETGQAGAVRHGITRALIDYDATLKPALSKAGLV
FT                   TRDAREVERKKVGLRKARRAKQFSKR"
FT   gene            392783..393538
FT                   /locus_tag="Rpic_0368"
FT   CDS_pept        392783..393538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0368"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RSc0492 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25526"
FT                   /db_xref="GOA:B2UFK3"
FT                   /db_xref="InterPro:IPR000299"
FT                   /db_xref="UniProtKB/TrEMBL:B2UFK3"
FT                   /protein_id="ACD25526.1"
FT                   /translation="MKARRLLRRASVLAPNVTVRSRLPWPVTVLLVAVVLGLAAAAALW
FT                   AFEEGRRLTGPHDADLRAMNRELTARLAAVQAERDKLSASAGTVDARLGIAEGAQAQMA
FT                   EQLKALETENAQLKEDLAFFDSLLPAPTNSAGIYVRSFRIAPDEAQPTRMRFRVLLMQG
FT                   GGKAFAPVSEFEGQLALTLNVVQAGKPATIDFPGAAASGSPATSARVKLTHYQRLEGWV
FT                   DVPPGTTVQSVMVKVLQNGKIKASQSFSI"
FT   sig_peptide     392783..392923
FT                   /locus_tag="Rpic_0368"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.840 at
FT                   residue 47"
FT   gene            393582..393986
FT                   /locus_tag="Rpic_0369"
FT   CDS_pept        393582..393986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0369"
FT                   /product="protein of unknown function DUF583"
FT                   /note="PFAM: protein of unknown function DUF583; KEGG:
FT                   rso:RSc0493 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25527"
FT                   /db_xref="InterPro:IPR007607"
FT                   /db_xref="UniProtKB/TrEMBL:B2UFK4"
FT                   /protein_id="ACD25527.1"
FT                   /translation="MLFGKKKGLAIETLLGARTKLEGDLRFSGGLRIDGEIKGNIYGDP
FT                   DKPSMLVITDSARVEGEVHVGHLILNGTVVGPVHVAELLELQPKARIEGNVQYAALEMH
FT                   QGAVVMGTLTHATPGDVKLLPNLKLASNQD"
FT   gene            394113..394487
FT                   /locus_tag="Rpic_0370"
FT   CDS_pept        394113..394487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0370"
FT                   /product="iron-sulfur cluster assembly accessory protein"
FT                   /note="TIGRFAM: iron-sulfur cluster assembly accessory
FT                   protein; PFAM: HesB/YadR/YfhF-family protein; KEGG:
FT                   rso:RSc0494 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25528"
FT                   /db_xref="GOA:B2UFK5"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR017870"
FT                   /db_xref="InterPro:IPR023063"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2UFK5"
FT                   /protein_id="ACD25528.1"
FT                   /translation="MNAVAQAATPDVNEVPAPLVFTDSAADKVKQLIEEEGNPELKLRV
FT                   FVQGGGCSGFQYGFTFDEETNEDDTTMTKNGVSLLIDSMSYQYLVGAEIDYKEDINGAQ
FT                   FVIKNPNASTTCGCGSSFSV"
FT   gene            complement(394554..395708)
FT                   /locus_tag="Rpic_0371"
FT   CDS_pept        complement(394554..395708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0371"
FT                   /product="protein of unknown function UPF0075"
FT                   /note="PFAM: protein of unknown function UPF0075; KEGG:
FT                   rso:RSc0495 anhydro-N-acetylmuramic acid kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25529"
FT                   /db_xref="GOA:B2UFK6"
FT                   /db_xref="InterPro:IPR005338"
FT                   /db_xref="UniProtKB/TrEMBL:B2UFK6"
FT                   /protein_id="ACD25529.1"
FT                   /translation="MSHPNPTALPADRYIGLMSGTSLDGVDGVLADFSGEHPAVLADAY
FT                   VPFSPELRQRFLDLQHAGHDEIHREALAANALAMIYAECVARLLASTGLAAHDVQAIGA
FT                   HGQTIRHQPGTHDGIGYTRQTQHPAVLAERTGIDVIADFRSRDIAAGGQGAPLVPALHR
FT                   ALFGLPDAWRVVCNIGGIANLTVLPPQTSDTRDAVLGFDCGPGNALMDYWVHTHRDSPY
FT                   DADGAWARSGRVGEALLERLKAEPFFAAPPPKSTGRDLFNPAWLQQALGDALNTARPED
FT                   VQATLLALTADTITDAVRAHAPQAASLLVCGGGARNGALMARIGQQLPGVRVAPTDAFG
FT                   VPAHQVEALAFAWLARQCVLRAHGNLHTATGASGARVLGAIYPA"
FT   gene            395884..397149
FT                   /locus_tag="Rpic_0372"
FT   CDS_pept        395884..397149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0372"
FT                   /product="tyrosyl-tRNA synthetase"
FT                   /note="TIGRFAM: tyrosyl-tRNA synthetase; PFAM:
FT                   aminoacyl-tRNA synthetase class Ib; RNA-binding S4 domain
FT                   protein; KEGG: rso:RSc0496 tyrosyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25530"
FT                   /db_xref="GOA:B2UFK7"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024088"
FT                   /db_xref="InterPro:IPR024108"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:B2UFK7"
FT                   /protein_id="ACD25530.1"
FT                   /translation="MTASATPAASDNATPGTLKYPVTPEVAHAMEVSLRGCDELLIAAE
FT                   WEQKLAKSAATGVPLRIKLGLDPTAPDIHIGHTVVLNKMRQLQDLGHQVIFLIGDFTST
FT                   IGDPSGRNATRPPLTREQIEANAQTYYRQASMVLDPSKTEIRYNSEWCDPLGARGIIQL
FT                   AAKYTVARMMERDDFTKRYKAGVPISVHEFLYPLMQGYDSVALKSDLELGGTDQKFNLL
FT                   VGRELQKEYGQEPQCILTMPLLVGLDGVEKMSKSKGNYVGISEAPNEMFGKLMSISDDL
FT                   MWTYYTLLSFRPLAEIDLMKQEIALGRNPRDCKVMLAQEIVARFHSQADAERALEDFNH
FT                   RARGGVPDDIPQIELSGAPLGIAQLLKQAGLCPSTSDANRNIEQGGVKIDGTVISDKGL
FT                   KVDAGTFVMQVGKRRFARVVLK"
FT   gene            397146..397658
FT                   /locus_tag="Rpic_0373"
FT   CDS_pept        397146..397658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0373"
FT                   /product="D-tyrosyl-tRNA(Tyr) deacylase"
FT                   /note="PFAM: D-tyrosyl-tRNA(Tyr) deacylase; KEGG:
FT                   rso:RSc0497 D-tyrosyl-tRNA deacylase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25531"
FT                   /db_xref="GOA:B2UFK8"
FT                   /db_xref="InterPro:IPR003732"
FT                   /db_xref="InterPro:IPR023509"
FT                   /db_xref="UniProtKB/TrEMBL:B2UFK8"
FT                   /protein_id="ACD25531.1"
FT                   /translation="MIGLIQRVSEAAVRVDGRVVGEIGPGLLALVCAERGDTAAEADRL
FT                   LEKLLNYRVFSDAQGKMNLPVRNIDGNGQAGGLLVVSQFTLAADTKSGTRPSFTPAAAP
FT                   EDGRRLYEHFVARARAQHPIVATGEFGADMKVSLVNDGPVTFWLQIAPQAAASVAKTAA
FT                   PEAAKSV"
FT   gene            397678..398358
FT                   /locus_tag="Rpic_0374"
FT   CDS_pept        397678..398358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0374"
FT                   /product="Phosphoglycerate mutase"
FT                   /note="PFAM: Phosphoglycerate mutase; KEGG: rso:RSc0499
FT                   putative phosphoglycerate mutase 2 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25532"
FT                   /db_xref="GOA:B2UFK9"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:B2UFK9"
FT                   /protein_id="ACD25532.1"
FT                   /translation="MPRAAAIPLPMLQITHIVLIRHGETDWNRERRLQGQLDVPLNTQG
FT                   LEQAAQLGKALARERFDAVYASDLSRARQTARALADEVGVPVRDDAGLRERCYGQFEGL
FT                   TYAEVAARHPDDFDAWQNRVPEFAPPGGETLTEFHERAVETALRLIRRHPGERIALVSH
FT                   GGVLDCLYRHANAMTLTEPRQHELRNASINRLSSDGHQLTVLQWGDVAHLDLLVLDEVD
FT                   RRVP"
FT   gene            complement(398355..399071)
FT                   /locus_tag="Rpic_0375"
FT   CDS_pept        complement(398355..399071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0375"
FT                   /product="conserved hypothetical integral membrane protein"
FT                   /note="TIGRFAM: conserved hypothetical integral membrane
FT                   protein; PFAM: protein of unknown function DUF165; KEGG:
FT                   reh:H16_A0494 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25533"
FT                   /db_xref="GOA:B2UFL0"
FT                   /db_xref="InterPro:IPR003744"
FT                   /db_xref="UniProtKB/TrEMBL:B2UFL0"
FT                   /protein_id="ACD25533.1"
FT                   /translation="MSAAPHHPNRTFRYYDFIMAAFVTVLLCSNLIGASKAAQVTLPVL
FT                   GSVTFGAGVLFFPISYIFGDILTEVYGYGRDRRVVWAGFAALIFASFMSLVVLALPVAP
FT                   FMAGYQRSLNDVFGNTPRIVAGSLIAFWCGSFANSYTLAKMKIATEGKWLWTRIVGSTV
FT                   VGEAVDSSLFYVIAFYGIWPHEQVLRVAIAQYILKTGWEIVATPLTYRVVAFLKRAENE
FT                   DYYDRDTNFTPFRLKV"
FT   sig_peptide     complement(398958..399071)
FT                   /locus_tag="Rpic_0375"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.732) with cleavage site probability 0.649 at
FT                   residue 38"
FT   gene            complement(399089..400162)
FT                   /locus_tag="Rpic_0376"
FT   CDS_pept        complement(399089..400162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0376"
FT                   /product="Holliday junction DNA helicase RuvB"
FT                   /note="KEGG: rso:RSc0500 Holliday junction DNA helicase B;
FT                   TIGRFAM: Holliday junction DNA helicase RuvB; PFAM: AAA
FT                   ATPase central domain protein; Holliday junction DNA
FT                   helicase RuvB domain; ATPase associated with various
FT                   cellular activities AAA_5; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25534"
FT                   /db_xref="GOA:B2UFL1"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004605"
FT                   /db_xref="InterPro:IPR008823"
FT                   /db_xref="InterPro:IPR008824"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041445"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2UFL1"
FT                   /protein_id="ACD25534.1"
FT                   /translation="MIETDKLAAKAVSAERIISASPASPNEEAFERALRPKLLDEYVGQ
FT                   EKVRGQLDIFMTAAKNRSEALDHVLLFGPPGLGKTTLAHIIAREMGVNLRQTSGPVLER
FT                   PGDLAALLTNLEANDVLFIDEIHRLSPVVEEILYPALEDYQIDIMIGEGPAARSVKLDL
FT                   QPFTLVGATTRAGMLTNPLRDRFGIVARLEFYTPAELAKIVTRSSGLLNAHIVDEGALE
FT                   IAKRSRGTPRIANRLLRRVRDFAEVKADGIITREVADAALAMLDVDAVGFDLMDRKLLE
FT                   AILHKFNGGPVGIDNLAAAIGEERDTIEDVLEPYLIQQGYLQRTPRGRVATASAYQHFG
FT                   LGAPKSGPVRDLWDDNQ"
FT   gene            complement(400226..400807)
FT                   /locus_tag="Rpic_0377"
FT   CDS_pept        complement(400226..400807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0377"
FT                   /product="Holliday junction DNA helicase RuvA"
FT                   /note="KEGG: rso:RSc0501 Holliday junction DNA helicase
FT                   motor protein; TIGRFAM: Holliday junction DNA helicase
FT                   RuvA; PFAM: RuvA domain protein; DNA recombination protein
FT                   RuvA domain I; SMART: Helix-hairpin-helix DNA-binding class
FT                   1"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25535"
FT                   /db_xref="GOA:B2UFL2"
FT                   /db_xref="InterPro:IPR000085"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR011114"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013849"
FT                   /db_xref="InterPro:IPR036267"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2UFL2"
FT                   /protein_id="ACD25535.1"
FT                   /translation="MIGRIAGTLIEKNPPHLLVDCHGVGYEIDVPMSTFYNLPATGEKV
FT                   VLLTQQIVREDAHLLYGFGTAAERETFRQLIKISGIGARIALAVLSGMSVAELAQAVTL
FT                   QEAGRLTRIPGIGKKTAERLLLELKGKLGADLGTVPGGPAVSDDAVDVLNALLALGYSD
FT                   KEAALAIKQVPAGTGVSEGIKLALKALSKG"
FT   gene            complement(400908..402047)
FT                   /locus_tag="Rpic_0378"
FT   CDS_pept        complement(400908..402047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0378"
FT                   /product="glycerophosphoryl diester phosphodiesterase"
FT                   /note="PFAM: glycerophosphoryl diester phosphodiesterase;
FT                   KEGG: rso:RSc0502 putative glycerophosphoryl diester
FT                   phosphodiesterase, periplasmic precursor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25536"
FT                   /db_xref="GOA:B2UFL3"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:B2UFL3"
FT                   /protein_id="ACD25536.1"
FT                   /translation="MPRRLILPSLLILSTSVALYACRLEYHHGSGGGGNTTPIATIQVI
FT                   GHRGASALRPEHTLASYQKAIDDGADIIEPDLVSTKDGVLVARHENEISGTTNVADVAA
FT                   FAGRKTTKTIDGQSVTGWFTEDFTLGELKTLRARERIPNIRPDNVAYNDQFDIPTLDEI
FT                   IALARDQSAKLGRNIGIYPETKHPTYFQSIGLPLEDRLIDGLRRDAFTASRTTVYIQSF
FT                   EVANLKAIRNKIGGSQPNWKLVQLMGTSGRQPYDFVVAKDSRTFGDMMTSQGMRDIAAY
FT                   ANGVGPDKSSIMGLDANGKLTDPTDLIRNAHNAGLVVHPYTFRPENTFLPPSLRSGADN
FT                   TRNVNGSITEIQAFLRAGVDGFFTDDPAVGRQAVSTFKR"
FT   sig_peptide     complement(401982..402047)
FT                   /locus_tag="Rpic_0378"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.988 at
FT                   residue 22"
FT   gene            complement(402126..402671)
FT                   /locus_tag="Rpic_0379"
FT   CDS_pept        complement(402126..402671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0379"
FT                   /product="crossover junction endodeoxyribonuclease RuvC"
FT                   /EC_number="3.1.22.4"
FT                   /note="KEGG: rso:RSc0503 Holliday junction resolvase;
FT                   TIGRFAM: crossover junction endodeoxyribonuclease RuvC;
FT                   PFAM: Crossover junction endodeoxyribonuclease RuvC"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25537"
FT                   /db_xref="GOA:B2UFL4"
FT                   /db_xref="InterPro:IPR002176"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR020563"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2UFL4"
FT                   /protein_id="ACD25537.1"
FT                   /translation="MRILGIDPGLRTTGFGVLERHGHKLVYVASGTIKSNGNADLPSRL
FT                   KTLYDGVSELVSTYRPDCASIEKVFVNVNPQSTLLLGQARGAVICGLMSGNLPVFEYTA
FT                   LQLKQAVVGYGRANKDQVQEMVVRLLNLEGKPGADASDALGVAICHAHGGETLAAMAGL
FT                   APQLAQKGLRVRRGRLVG"
FT   gene            complement(402754..404328)
FT                   /locus_tag="Rpic_0380"
FT   CDS_pept        complement(402754..404328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0380"
FT                   /product="phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase/IMP cyclohydrolase"
FT                   /EC_number="2.1.2.3"
FT                   /note="KEGG: rso:RSc0504 bifunctional
FT                   phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase/IMP cyclohydrolase; TIGRFAM:
FT                   phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase/IMP cyclohydrolase; PFAM: MGS domain
FT                   protein; AICARFT/IMPCHase bienzyme formylation region"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25538"
FT                   /db_xref="GOA:B2UFL5"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2UFL5"
FT                   /protein_id="ACD25538.1"
FT                   /translation="MIQQALLSVSDKTGIVDFARALHERGVKLLSTGGTAKLLAESSLP
FT                   VTEVADYTGFPEMLDGRVKTLHPKVHGGILARRDLPEHMAALSEHSIPTIDLLVVNLYP
FT                   FQQTVAKDECSLADAIENIDIGGPTMLRSAAKNHRDVTVIVDPADYATVLAEMQANNNT
FT                   VGYETNFMLAKKVFAHTAQYDGAITNYLTSLGADKSHSTRSAYPQTLNLAFDKVQEMRY
FT                   GENPHQSAAFYRDLKAVDGALANYKQLQGKELSYNNIADADAAWECVKSFDAAHGAACV
FT                   IIKHANPCGVAIGGTAQEAYEKAFKTDSTSAFGGIIAFNVPLDEAAAQVVAKQFVEVLI
FT                   APGFSEGARAVFAAKQNVRVLEIPLGKGVNAYDFKRVGGGLLVQSPDAKNVQPSELRVV
FT                   TKRHPTPKEMDDLMFAWRVAKFVKSNAIVFCGGGMTLGVGAGQMSRVDSARIASIKAQN
FT                   AGLTLAGSAVASDAFFPFRDGLDVVVDAGASCVIQPGGSVRDDEVIAAADERNVAMIFT
FT                   GTRHFRH"
FT   gene            complement(404425..404658)
FT                   /locus_tag="Rpic_0381"
FT   CDS_pept        complement(404425..404658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0381"
FT                   /product="transcriptional regulator, Fis family"
FT                   /note="PFAM: helix-turn-helix Fis-type; KEGG: rso:RSc0505
FT                   DNA-binding protein fis"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25539"
FT                   /db_xref="GOA:B2UFL6"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR005412"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:B2UFL6"
FT                   /protein_id="ACD25539.1"
FT                   /translation="MSRNPIERCIRDSLDAYYRDLDGENPSNVYDMVLQAIERPLLETV
FT                   MEWASNNQSQAADYLGINRNTLRKKLQQHGLI"
FT   gene            complement(404655..405722)
FT                   /locus_tag="Rpic_0382"
FT   CDS_pept        complement(404655..405722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0382"
FT                   /product="TIM-barrel protein, nifR3 family"
FT                   /note="TIGRFAM: TIM-barrel protein, nifR3 family; PFAM:
FT                   dihydrouridine synthase DuS; KEGG: rso:RSc0506 probable
FT                   NifR3-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25540"
FT                   /db_xref="GOA:B2UFL7"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR024036"
FT                   /db_xref="InterPro:IPR032887"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:B2UFL7"
FT                   /protein_id="ACD25540.1"
FT                   /translation="MQIGPHTLRNNLFVAPMAGVTDRPFRQLCKRLGAGYAVSEMVASN
FT                   AQLWKSEKTMRRANHTGEVEPIAVQIAGAEPMMMAEAARYNVDRGAQIIDINMGCPAKK
FT                   VCNVAAGSALLQNEPLVQRIVEAVVGAVGDRVPVTLKIRTGWDREHRNALSVARIAQDA
FT                   GISMLTVHGRTRADLYHGEAEYDTIAAVKASVRIPVVANGDITTPAKAKHVLAVTGADA
FT                   IMIGRAAQGRPWLFREIEHFLQTGTLLPAPEVEEIRGIMNAHLEEHYAFYGEYTGVRTA
FT                   RKHIAWYTRGLAGANLFRHRMNTIEDTAAQLAAVNAFFDEQRALSDRLVYEDQATGGDH
FT                   PRTGNNDNNKELLAA"
FT   gene            complement(405918..407201)
FT                   /locus_tag="Rpic_0383"
FT   CDS_pept        complement(405918..407201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0383"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   rso:RSc0507 probable amino acid dehydrogenase transmembrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25541"
FT                   /db_xref="GOA:B2UFL8"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B2UFL8"
FT                   /protein_id="ACD25541.1"
FT                   /translation="MACAEVGAAGDRQQITVVGAGIVGTACALQLQRDGHQVTLLDQAG
FT                   IGEGCSFGNAGCLSVASVVPMALPGMLKQVPKWLADPMGPLTVRWHYLPRALPWLLQWV
FT                   FAGNETQARATAQPLASLFSATFPGYRNLLDAAQYDGLIRQTGHLYVWRTLARSSGDVL
FT                   AQSIRDATGVRSQALSAGEARELEPALAADIQSGLLLPDNGFTVNPERLVKTLAANFAA
FT                   AGGTFLRRKVLDVEFGRSDYGGPTRLHTDCGTLPVSKLVLCAGAWSMRLGAKLTSIRIP
FT                   LNTERGYHATLRAPSVQPSRPIMDCERKFIATPMEGGLRIAGTVEIGGLDAAPDYRRAR
FT                   ILMRQGQQLFPGLGFTDDSQWMGHRPSLPDSLPVIDRSERYRNVFFAFGHGHLGMTGAP
FT                   GTARLIADLVSERTPFIDGRPYGLQRFR"
FT   gene            complement(407205..408440)
FT                   /locus_tag="Rpic_0384"
FT   CDS_pept        complement(407205..408440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0384"
FT                   /product="2-polyprenyl-6-methoxyphenol 4-hydroxylase"
FT                   /note="TIGRFAM: Ubiquinone biosynthesis hydroxylase,
FT                   UbiH/UbiF/VisC/COQ6 family; 2-polyprenyl-6-methoxyphenol
FT                   4-hydroxylase; PFAM: monooxygenase FAD-binding; KEGG:
FT                   rso:RSc0508 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25542"
FT                   /db_xref="GOA:B2UFL9"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR010971"
FT                   /db_xref="InterPro:IPR011295"
FT                   /db_xref="InterPro:IPR018168"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B2UFL9"
FT                   /protein_id="ACD25542.1"
FT                   /translation="MTDSITASSAAPDFDVAIVGAGPVGLALANWLLRDTDWRIALFDA
FT                   RDAEAAARDPRALALSHGSRVLLQEIGGWPTRATPITHIHVSQRGHFGQAHIRREDYDV
FT                   PALGHVVQYGDLSAALNAALDTQMERHPGRLTRYDHTPVERVEQLPRADGTVAPARVRA
FT                   LREGRHPLAIETEVVIQAEGGLFDDARKQQRGIAQARRRDYGQTAIVAHVRCSAPLEGW
FT                   AWERFTPEGPLALLPQDDAQGPGYALVWCCAPDEARRRAALPDDAFLAELGAAFGERMG
FT                   RFTHASPRHTFALGLHAQRIPVDRRVAAIGNAAQTIHPVAGQGFNLGLRDAFEMARALR
FT                   DGATAATLARFARERAFDRAVTIGLTDLLPRAFAVPGRSFGHLRGAALTLLECLPPLKH
FT                   GLARQMMFGQRG"
FT   gene            complement(408437..409816)
FT                   /locus_tag="Rpic_0385"
FT   CDS_pept        complement(408437..409816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0385"
FT                   /product="peptidase M24"
FT                   /note="PFAM: peptidase M24; peptidase M24B X-Pro
FT                   dipeptidase/aminopeptidase domain protein; KEGG:
FT                   rso:RSc0509 probable Xaa-Pro aminopeptidase (aminopeptidase
FT                   P II) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25543"
FT                   /db_xref="GOA:B2UFM0"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="InterPro:IPR007865"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:B2UFM0"
FT                   /protein_id="ACD25543.1"
FT                   /translation="MSATELAFLQTYRQRRERIVQWLRAAGGGVAIVPTAPEAMRNRDS
FT                   DYPYRHDSYFYYLTGFTEPEAVLAIVVPAGSAPARSVLFCRPKHEEREIWDGFRFGPEA
FT                   AKDAFGLDEAHSVEEIDATLPKLLANAAAVACPLAESSAFDRRMRRWLDAVRMQGRAGV
FT                   SSPHQALDVRAILDEMRLFKDASELDIMRRAGRISAGAHVRAMQASRAGLREYHLEAEL
FT                   LYEFRRHGAQSVAYNSIVATGPNACVLHYRAGNAELRDGDLCLIDAGCELDGYASDITR
FT                   TFPVNGRFTGPQRELYALVVAAQEAALAETRPGVPYNVPHDAATRVLAQGMLDTGLLDA
FT                   DKVGTLDDVIAGGQYRQFYMHRTGHWLGMDVHDVGEYRTPGTAAPAEGERPWRPLEAGM
FT                   VLTVEPGIYVRPAPGVPEQYWHIGIRIEDDAIVTPEGCEIITRDVPVAPDEIELVMRGQ
FT                   A"
FT   gene            410043..412100
FT                   /locus_tag="Rpic_0386"
FT   CDS_pept        410043..412100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0386"
FT                   /product="diguanylate cyclase/phosphodiesterase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; EAL domain protein; MHYT domain
FT                   protein; KEGG: rso:RSc0510 probable transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25544"
FT                   /db_xref="GOA:B2UFM1"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR005330"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:B2UFM1"
FT                   /protein_id="ACD25544.1"
FT                   /translation="MLASSYNPLLVLLSLFVAILASYTALDMAGRVVTAQGRAALWWLI
FT                   GGASAMGLGIWSMHFVGMLALNLPIPVGYDVGITLASLAIGIGASTFALWLVSRRELPW
FT                   PRLVGGALLMGAGVAGMHYTGMAALRMNPGIQYNPGRFGVSVVIAVLASGVALWIAFRL
FT                   RRQSRRVRALRAGSAVVMGVAIVGMHYTGMSAAAFPLGSVCGAAHTGASAEWLALVIII
FT                   VTLAVLAIALIISVLDLRMEARTALLANSLAAANKELAYLALHDNLTKLSNRVLLEDRL
FT                   TQAIRTAEREKHRFALMFMDLDGFKAVNDVYGHHVGDLLLIDVAQRIGARVRQQDTVAR
FT                   VGGDEFVVLAYVDDPEDAGTLANALLEVVREPFMAGGHELRVSTSIGIAIYPGDGGNQH
FT                   DLLTNADAAMYHAKGLGRNAYSFFEPSMNADVHQQLQLVQDLRRAVERHELVLHYQPKF
FT                   NAPNGPIMGVEALVRWQHPQRGLVPADEFIPLAEKTGLIVPLGAWVLDEACRQMAQWQR
FT                   EGHSGWSVAVNLSALQFGHAALIDSVRDTLARHALDPRSLTLEITESTAMRDVDASLQI
FT                   LQRLDAMGVRISIDDFGTGYSSLLYLKRLPASELKIDRGFVRDLAHDTEDAAIVSAIVA
FT                   LGQTLNLRIVAEGVETAEQQAFLTRLGCHSLQGYLLGRPMTAESLSAAMA"
FT   sig_peptide     410043..410117
FT                   /locus_tag="Rpic_0386"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.949) with cleavage site probability 0.357 at
FT                   residue 25"
FT   gene            complement(412105..412797)
FT                   /locus_tag="Rpic_0387"
FT   CDS_pept        complement(412105..412797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0387"
FT                   /product="Nucleotidyl transferase"
FT                   /note="PFAM: Nucleotidyl transferase; KEGG: rso:RSc0511
FT                   putative mannose-1-phosphate guanyltransferase-related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25545"
FT                   /db_xref="GOA:B2UFM2"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B2UFM2"
FT                   /protein_id="ACD25545.1"
FT                   /translation="MIFAAGRGDRMRPLTDHTPKPLLTVGGKPLIVWQIERLAAAGVRD
FT                   IVINHAWLGAQIEAALGDGSAWGVRLAYSPEGQALETAGGVAQAMSLLHAGEGHSVFIA
FT                   VSGDVFCDYDYALLRDRAPAMAAQAAPSMHLVMVPNPPYHLRGDFALDNEGVLHADGTE
FT                   RLTFGNIGLYDTRLFASIAPGTRLAMTPLYHQAIAEGRATGERFDGRWENVGTPAQLAA
FT                   LDAELAVR"
FT   gene            complement(412815..413141)
FT                   /locus_tag="Rpic_0388"
FT   CDS_pept        complement(412815..413141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0388"
FT                   /product="branched-chain amino acid transport"
FT                   /note="PFAM: branched-chain amino acid transport; KEGG:
FT                   rso:RSc0512 probable transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25546"
FT                   /db_xref="GOA:B2UFM3"
FT                   /db_xref="InterPro:IPR008407"
FT                   /db_xref="UniProtKB/TrEMBL:B2UFM3"
FT                   /protein_id="ACD25546.1"
FT                   /translation="MKALILFGVLLIAGAATYLIRLSFIALEGRMNLPTWFRNSLPYVP
FT                   AAMLTALIAPDLLMRDGALAVSVDNPRLLAGIVAIVIARVTKSAMWTIVGGMAVLLILM
FT                   KVMA"
FT   gene            complement(413138..413866)
FT                   /locus_tag="Rpic_0389"
FT   CDS_pept        complement(413138..413866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0389"
FT                   /product="AzlC family protein"
FT                   /note="PFAM: AzlC family protein; KEGG: rso:RSc0513
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25547"
FT                   /db_xref="GOA:B2UFM4"
FT                   /db_xref="InterPro:IPR011606"
FT                   /db_xref="UniProtKB/TrEMBL:B2UFM4"
FT                   /protein_id="ACD25547.1"
FT                   /translation="MVSPRAVEFRAGMLALAPMLLGVVPFGLIYGVLATSAGMPAWLAV
FT                   AMSAIVFGGASQMILVQLWAGGAPALVIAATVSMVNLRHALYSASIAPALAHLPRRWKW
FT                   LIAYLLTDEAFAAMNRRVVTAQAGSAEAAYRHWYFLGAGVALWSSWQASTIVGVVLGAQ
FT                   VPTSWPLDFFLPLTFIAIVVPALRTRAQLAAALAGAALAVAWTGWPHKLGLMSAACVGI
FT                   AVGALVERLLARPSDKGAAA"
FT   gene            complement(413866..414939)
FT                   /locus_tag="Rpic_0390"
FT   CDS_pept        complement(413866..414939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0390"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /note="PFAM: aminoglycoside phosphotransferase; KEGG:
FT                   rso:RSc0514 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25548"
FT                   /db_xref="GOA:B2UFM5"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:B2UFM5"
FT                   /protein_id="ACD25548.1"
FT                   /translation="MASTPGAAAGATDARLSQLRDWLGTLPAAHGLRIDTLQPASADAS
FT                   FRRYFRLDSAVSGKPGTLVVMDAPPPQEDCRPFVHVAGLLNGAGVRAPLVLEQDLAQGF
FT                   LLLTDLGPQTYLQSLRERDFDLAYANTLFRPAIHTLVRWQLASREGELPPYDEALLRRE
FT                   LSLFPDWYVDRHLQRPLDATQRESLDKVFKLLVDSALAQPRVYVHRDYMPRNLMINAAD
FT                   PSQPGVLDFQDAVYGPITYDAASLLRDAFLSWDEEQELDWAVRYWEAARAAKLPVDEDF
FT                   GEFYRALEWMGAQRHLKVAGIFARLCYRDGKTGYVEDTPRFIAYLRRVCSRYNALAPLA
FT                   RLLDQLEDRAQQIGYTF"
FT   gene            415116..417557
FT                   /locus_tag="Rpic_0391"
FT   CDS_pept        415116..417557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0391"
FT                   /product="Organic solvent tolerance protein"
FT                   /note="PFAM: OstA family protein; Organic solvent tolerance
FT                   protein; KEGG: rso:RSc0515 probable organic solvent
FT                   tolerance transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25549"
FT                   /db_xref="GOA:B2UFM6"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="InterPro:IPR007543"
FT                   /db_xref="InterPro:IPR020889"
FT                   /db_xref="UniProtKB/TrEMBL:B2UFM6"
FT                   /protein_id="ACD25549.1"
FT                   /translation="MTEPNRARKNRQRAAVAAPDQRPADLATIRRGTLALRPLVFAVAG
FT                   VWTATSAAQSTGTTQATAPAVTPASSVTALATSGPTTPGGSPLVPKMAEPVQRPDNTVP
FT                   TFTAADKMDGRTNEDIHLRGNGELRRNGSVLKGDTLDYNQDTDVATATGNVRLFKGGTL
FT                   VTGPDAKLKITANEGTISTPSYEFHSNGGHGTADRIDFVDKDNSRITRGTYTTCSPDNV
FT                   DWYFSASRIDIDSDRQVGTGRNGVLHFFGVPVFAAPVMDFPLNDDRRSGFLAPVFGYNS
FT                   RSGADVTLPYYFNIAPNRDLTLYPRLLSQRGLQLGAEYRYLDTSYSGVLRGEFLPDDRE
FT                   AGRNRWSISAVHTQRLAPGLTGYINYNKVSDNTYPDDLGRSIVTATQRQYIQEGGVSYS
FT                   FGDWVALARVQKFQTLSTATTPLAAPYERLPQLSLTYNKYDVGGFDINFLTDYTRFSIP
FT                   TANTVQGERLFMQPTISYPIVRPGWYVTPKFILNTTAYRLDRPAGDTQDTQINRTLPTF
FT                   SLDSGMTFERDAPLVSKLFGVSYIQTLEPRVFYVYTPYRDQSQIPLFDTGQSDYNLGQI
FT                   FTENPYTGYDRIADNNKVTAGVTTRFIEAESGIERLRATIAQRVDLDGQRVTLAGAAPT
FT                   SVRRYSDLLGATTIQMFRGIFFDTNLQYNQDLDRIMRSTVAFSWKPEANKVINLGYRYY
FT                   RQDANTGQLPLEQADISTQWPITRRLYGLGRIGYDLDARKPSDVLLGLEYVADCWVGRL
FT                   AVQRYSNAVSGYTTHIFAQIEFKGLSKVGNNPIDVIRLNVPGYQPVNAQPITPSVLDQY
FT                   E"
FT   gene            417550..419052
FT                   /locus_tag="Rpic_0392"
FT   CDS_pept        417550..419052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0392"
FT                   /product="SurA domain"
FT                   /note="PFAM: PpiC-type peptidyl-prolyl cis-trans isomerase;
FT                   SurA domain; KEGG: rso:RSc0516 probable peptidyl-prolyl
FT                   cis-trans isomerase (rotamase C) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25550"
FT                   /db_xref="GOA:B2UFM7"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR015391"
FT                   /db_xref="InterPro:IPR023034"
FT                   /db_xref="InterPro:IPR023058"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:B2UFM7"
FT                   /protein_id="ACD25550.1"
FT                   /translation="MNNDIMAFQSTAFATRVAPLGRLRVATGVLLALLAGTTLSPAVHA
FT                   QQAQSAKKSAPVRGIFANPGSSPSQPLLQGTLPEPTAPGAPRSQLVDEVVAVVNTDVIT
FT                   RRELLNRADLVERTFRAQNRPLPPRADLLGEVLEQLILERVQAQTAKESGIRVSDADVD
FT                   RAVESVAQRNNLSVPQLKSKLKDAGMTYDKYRDDLRQEILLARLREREVDSKVQVYDGE
FT                   IDNYLAQQGGGTAPAGEQQYNVAQILVPVAEGATDAEKAAARKKAEGLLKQAQGGADFA
FT                   KLARDNSGAQDAAQGGELGLRPIGRLPAVFANAVVDMKAGQVASQVVESPAGYHVIKLL
FT                   EKRASSTAIAAKVQQTQVRHILIKTGPTMSADDARRQLVGLRDRIVHGYDFGDAARRYS
FT                   QDGSAGAGGELGWVSPGQLVPEFEQAMNQLKPGDVSQPVQSQFGVHLIQVEGRREAEVS
FT                   GDRERDYARSVIREQKVQAAYEDWLRELRDSAHVEYRVNRQQ"
FT   sig_peptide     417550..417687
FT                   /locus_tag="Rpic_0392"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.997 at
FT                   residue 46"
FT   gene            419141..420157
FT                   /locus_tag="Rpic_0393"
FT   CDS_pept        419141..420157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0393"
FT                   /product="4-hydroxythreonine-4-phosphate dehydrogenase"
FT                   /EC_number="1.1.1.262"
FT                   /note="KEGG: rso:RSc0517 4-hydroxythreonine-4-phosphate
FT                   dehydrogenase; TIGRFAM: 4-hydroxythreonine-4-phosphate
FT                   dehydrogenase; PFAM: Pyridoxal phosphate biosynthetic
FT                   protein PdxA"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25551"
FT                   /db_xref="GOA:B2UFM8"
FT                   /db_xref="InterPro:IPR005255"
FT                   /db_xref="InterPro:IPR037510"
FT                   /db_xref="UniProtKB/TrEMBL:B2UFM8"
FT                   /protein_id="ACD25551.1"
FT                   /translation="MLNIAITTGEPAGIGPDITVAALLHLARQALPRYADVQWHVIGDA
FT                   ALLQARADAIAQGDFWRVASTALTVVERPLGAPVRAGVLDAANGRYVLDLLDAAIDGCQ
FT                   IGTEDGVRYDAMVTAPVQKSTINDAGVPFTGHTEYLAERSRTPRVVMMLAGPQPAHDNA
FT                   MLRVALATTHLPLREVPDAITPAVLDETLDIVQRDLRMRFGLNAPRILVTGLNPHAGES
FT                   GHLGREEIEVIEPAIARARARGIDARGPYPADTLFQPRLLADADCVLAMYHDQGLAPLK
FT                   YGTFGHGVNITLGLPFVRTSVDHGTALDLAGTGRAEFGSMIEAIDTAIAMARHTARS"
FT   gene            420190..421035
FT                   /locus_tag="Rpic_0394"
FT   CDS_pept        420190..421035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0394"
FT                   /product="dimethyladenosine transferase"
FT                   /note="TIGRFAM: dimethyladenosine transferase; PFAM:
FT                   ribosomal RNA adenine methylase transferase; KEGG:
FT                   rso:RSc0518 dimethyladenosine transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25552"
FT                   /db_xref="GOA:B2UFM9"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B2UFM9"
FT                   /protein_id="ACD25552.1"
FT                   /translation="MARSTTGVHQGHQARKRFGQNFLVDDGVIHAIVAAIDPKPDDVLV
FT                   EIGPGLGALTVPLMERVRTLQVVELDRDLVARLQQRFGDRLIVHAGDALAFDFGSLQEA
FT                   GRPLRIVGNLPYNISSPLLFHLATFADRVRDQHFMLQKEVVDRMVAAPGSKAFSRLSVM
FT                   LQVRYYMELVLDVPPGSFNPPPKVDSAVVRMIPWPADKSPYAPVDLRALGTVVTMAFSQ
FT                   RRKVLRNTLGALRDVIDFEALGFDLGRRAEEVSVEDFVAVANALPANRIAGSASDLSED
FT                   "
FT   gene            complement(421022..421927)
FT                   /locus_tag="Rpic_0395"
FT   CDS_pept        complement(421022..421927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0395"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: rso:RSc0519 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25553"
FT                   /db_xref="GOA:B2UFN0"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B2UFN0"
FT                   /protein_id="ACD25553.1"
FT                   /translation="MATATDAIRRPLDGTAIGLMVVLCMCWGFQQVAIKVAAHDVGPVM
FT                   QAGVRSAIASVLVLAFALWRGTCLSVRDGTLAGGLMAGVLFGVEFLCIFIGLSYTTASR
FT                   MAVFLYTAPIFTALGLHFFVPGEHLRPRQWAGIGIAFAGIVLAFADGVLHPAAGPSTSL
FT                   GDALGVVAGALWGATTIVVRASKLSEAPAAKTLLYQLAVSAVLLLLMAAGTGQAFTANL
FT                   TPTALASLAYQSVLIAFASYLTWFWLLRRYLASRLSVFSFLTPLFGVAFGVLLLHEPVG
FT                   LRFALAAALVLSGILLVNLR"
FT   gene            complement(421911..422318)
FT                   /locus_tag="Rpic_0396"
FT   CDS_pept        complement(421911..422318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0396"
FT                   /product="lactoylglutathione lyase"
FT                   /EC_number="4.4.1.5"
FT                   /note="KEGG: rso:RSc0520 probable lactoylglutathione lyase
FT                   (methylglyoxalase) protein; TIGRFAM: lactoylglutathione
FT                   lyase; PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25554"
FT                   /db_xref="GOA:B2UFN1"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR004361"
FT                   /db_xref="InterPro:IPR018146"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B2UFN1"
FT                   /protein_id="ACD25554.1"
FT                   /translation="MRMLHTMLRVGDMQRSIDFYTKVLGMQLLRTSDNPEYKYSLAFVG
FT                   YGPEASNTVIELTYNYGVSEYELGTAFGHLAIEVDDAAQACDQIRNAGGKVTREAGPVK
FT                   GGSTIIAFVEDPDGYKIELIQARSMPDGNRH"
FT   gene            complement(422438..423316)
FT                   /locus_tag="Rpic_0397"
FT   CDS_pept        complement(422438..423316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0397"
FT                   /product="protein of unknown function DUF45"
FT                   /note="PFAM: protein of unknown function DUF45; KEGG:
FT                   rso:RSc0521 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25555"
FT                   /db_xref="InterPro:IPR002725"
FT                   /db_xref="UniProtKB/TrEMBL:B2UFN2"
FT                   /protein_id="ACD25555.1"
FT                   /translation="MKLLRPPTSPTTADSVQLELPLLAPEASSPTQPPDAPLLAPPALD
FT                   FSTAPLGPHQRRLTLGERALIYNLKRSSRRTIGFVIDDRGLSITAPRWVTLAEIEHAIA
FT                   EKQKWIFAKLAEWRTSAARRMLPTMEWQDGAGLPFLGKTITLKLESPIGALMFDADTSM
FT                   LHLGLPHTTTEQQIKDRVQGWLQTQARRLFGERLEVYAERLGVRHSAYALSSAATRWGS
FT                   CTADGKIRLNWRLVHFPLSLIDYVVAHELAHLKEMNHSPRFWDTVESIFPEFREAREQL
FT                   RSHPPEYLPAF"
FT   gene            complement(423313..424065)
FT                   /locus_tag="Rpic_0398"
FT   CDS_pept        complement(423313..424065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0398"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /note="PFAM: phospholipid/glycerol acyltransferase; KEGG:
FT                   rso:RSc0522 putative acyltransferase transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25556"
FT                   /db_xref="GOA:B2UFN3"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:B2UFN3"
FT                   /protein_id="ACD25556.1"
FT                   /translation="MTFIRSLLYLIFLIVWTPIYAVACFIVFPFMNPARRFWMVSGWTK
FT                   SAIWMARWLLGIRWQYQGWEHIEEAVATNKPVVLLSKHQSAWETMAYVATMPRPLCYVF
FT                   KRELLYVPFFGWALGMLKMVHINRKDGANAFASVARQGKERMAEGAWVIMFPEGTRTRS
FT                   GDPKPRYKSGGARFAVDTGAWVIPIAHNSGRVWPRNSFLKHPGLITLSVGPAIPTAGKT
FT                   SDELNREVEAWIEAEMRRIDADSYREHA"
FT   sig_peptide     complement(423994..424065)
FT                   /locus_tag="Rpic_0398"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.704) with cleavage site probability 0.518 at
FT                   residue 24"
FT   gene            complement(424077..424655)
FT                   /locus_tag="Rpic_0399"
FT   CDS_pept        complement(424077..424655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0399"
FT                   /product="histidinol-phosphate phosphatase family protein"
FT                   /note="TIGRFAM: histidinol-phosphate phosphatase family
FT                   protein; hydrolase, HAD-superfamily, subfamily IIIA; PFAM:
FT                   Polynucleotide kinase 3 phosphatase central region; KEGG:
FT                   rso:RSc0523 D,D-heptose 1,7-bisphosphate phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25557"
FT                   /db_xref="GOA:B2UFN4"
FT                   /db_xref="InterPro:IPR004446"
FT                   /db_xref="InterPro:IPR006543"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B2UFN4"
FT                   /protein_id="ACD25557.1"
FT                   /translation="MPHVPKLVILDRDGVINRDSDQFIKSPDEWIALEGSLEAIAELNQ
FT                   AGYQVVVATNQSGIGRGLFEAAALNAMHEKMYKALATYGGRVDAVFFCPHTAADACECR
FT                   KPKSGMLREIARRFDVDLTGVPVVGDSLRDLQAGVEVGAVPHLVLTGKGTKTRDAGDLP
FT                   PGTQIHEDLRAFARALLSPAPQGTPTRAP"
FT   gene            complement(424687..426780)
FT                   /locus_tag="Rpic_0400"
FT   CDS_pept        complement(424687..426780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0400"
FT                   /product="glycyl-tRNA synthetase, beta subunit"
FT                   /EC_number="6.1.1.14"
FT                   /note="KEGG: rso:RSc0524 glycyl-tRNA synthetase subunit
FT                   beta; TIGRFAM: glycyl-tRNA synthetase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25558"
FT                   /db_xref="GOA:B2UFN5"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR015944"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2UFN5"
FT                   /protein_id="ACD25558.1"
FT                   /translation="MSTLLIELLTEELPPKALARLGEAFARGLFDGLSAQGLLEEGAAV
FT                   EGFATPRRLAASITGARRTAPDRELREKVLPVTIAFDAEGKPAAPLVKKLAALAKTVGV
FT                   EVIAAESLERGPDGKAEALFYRYTARGAVLADGLQTALSQTIANLPIPKVMTYQRPNGE
FT                   NVQFVRPAHKLIALLDSEVIPVSAFGLQSGNVTLGHRFLSAGEIVIQDAASYASTLESQ
FT                   GKVIAGYGKRKEAIRAELLKTAGADTVVMPEALLDEVNALVEWPVVYPCHFEEAFLAVP
FT                   QECLILTMQTNQKYFALTDAQGHLRNRFLIVSNIATDTPEAIIQGNERVVRPRLADARF
FT                   FFEQDKKKPLADRVPLLSRVVYHNKIGTQLERVSRLQAIAGQLAEKLGADVAHASRGAL
FT                   LAKADLLTDMVGEFPELQGTMGTYYARHDGEPDDVALACSEHYQPRFAGDALPSTATGT
FT                   VVALADKLETLVGIWGIGLQPTGEKDPFALRRHALGILRMLIEKPLALTIDDALQIAAA
FT                   SFDGIAAVKPNLAAITDFLYDRLRGYLKDKGYSTNEVEAVVSQRPQRLDDIVARLEAVR
FT                   AFAALPQAEALAAANKRITNILKKTDVAIGAVQPPLLKEDAERALHQSVVSAEPQVHDA
FT                   FARGDFTTALKTLAGLREAVDTFFDGVMVMADDTALRDNRLALLAELHGLMNRVADISK
FT                   LAA"
FT   gene            complement(426867..427526)
FT                   /locus_tag="Rpic_0401"
FT   CDS_pept        complement(426867..427526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0401"
FT                   /product="conserved hypothetical signal peptide protein"
FT                   /note="KEGG: rso:RSc0525 hypothetical signal peptide
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25559"
FT                   /db_xref="UniProtKB/TrEMBL:B2UFN6"
FT                   /protein_id="ACD25559.1"
FT                   /translation="MTANRARRGLALLTAASIAALTLPASVAQAARHRTSKPASAEKVF
FT                   VVPNTLTQLCVADSKPLQQALSAAWTPPPPSLDQWTSLVRTMACDLSGARDLGWHRVPL
FT                   RTYATALRFPLTWVEWQGTGVKAQRRARVFRSAGQLPSRLEFNVSGTLQEVRYDARRGL
FT                   LSARFLRRDAAVPGTTPAPIAPPPPPGQCAGTQLQFQQQNGVWLLSGVEPVPGSPC"
FT   sig_peptide     complement(427434..427526)
FT                   /locus_tag="Rpic_0401"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.442 at
FT                   residue 31"
FT   gene            complement(427523..428509)
FT                   /locus_tag="Rpic_0402"
FT   CDS_pept        complement(427523..428509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0402"
FT                   /product="glycyl-tRNA synthetase, alpha subunit"
FT                   /EC_number="6.1.1.14"
FT                   /note="KEGG: rso:RSc0526 glycyl-tRNA synthetase subunit
FT                   alpha; TIGRFAM: glycyl-tRNA synthetase, alpha subunit;
FT                   PFAM: glycyl-tRNA synthetase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25560"
FT                   /db_xref="GOA:B2UFN7"
FT                   /db_xref="InterPro:IPR002310"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="UniProtKB/TrEMBL:B2UFN7"
FT                   /protein_id="ACD25560.1"
FT                   /translation="MLTFQQLILKLQSYWDAQGCALLQPIDLEVGAGTSHVHTFLRAIG
FT                   PEPWRAAYVQPSRRPKDGRYGENPNRLQHYYQYQVVLKPAPENILDLYLGSLEALGLDL
FT                   KQNDVRFVEDDWENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLDCKPVTGEITYGIE
FT                   RLAMYLQQVENIYDLVWTEWEEPGPNGPVKRRLTYGDVYHQNEVEQSTYNFEQADTTVL
FT                   FRRFAEHEAEAKRLMGVRAEGDAAAEGDAPVVQLALPAYEQVLKAGHTFNLLDARGAIS
FT                   VTERAAYIGRIRNLSRLVAQAYYDSRERLGFPMCGTAAAAVKTTEAA"
FT   gene            complement(428685..430196)
FT                   /locus_tag="Rpic_0403"
FT   CDS_pept        complement(428685..430196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0403"
FT                   /product="apolipoprotein N-acyltransferase"
FT                   /note="TIGRFAM: apolipoprotein N-acyltransferase; PFAM:
FT                   Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase; KEGG: rso:RSc0527 apolipoprotein
FT                   N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25561"
FT                   /db_xref="GOA:B2UFN8"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR004563"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:B2UFN8"
FT                   /protein_id="ACD25561.1"
FT                   /translation="MPLARLRFAMPLAALLGVMHTLSFAPNHWWWLQILSLTGLAALVQ
FT                   RAARLREAAWVGYAFGLGWFLSGVWWLYISMHVYGDMPAWMGALAVLLFAGYLALHPAL
FT                   AVWAWQWLTRRGRWSGTASALIFGAAWAVTEWLRGTVWTGFPWINGGYAHTDGPLAGYA
FT                   PLVGVYGIVLIAAVLAGLLCVAAERRLHWLAGIAGALVLVAGWPLHGIAWTQPVGKPIS
FT                   VRLLQGNVPQDVKFQQTGIERSLELYTKMVTEKPAQLVVTPETAFPIMIQEMPQEIALA
FT                   LRTYVDTTGSSVLFGAASEDSRVDYTNSVFGIGPQFQGVYRYNKHHLVPFGEFIPFGFH
FT                   WFVNMMNMPLGDFRRGLPVQPPMAVADQRVAPNICYEDLFGEEIAASLRHADQPATMLA
FT                   NVTNLAWFGDTIALDQHLQISRMRALETGRPMLRATNTGATAVVRPDGSVQARLPVFTL
FT                   GTLQTDVQGTQGLTPFVRTGNAPALGLGALVLLVAFVRRRRASAD"
FT   gene            complement(430261..431190)
FT                   /locus_tag="Rpic_0404"
FT   CDS_pept        complement(430261..431190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0404"
FT                   /product="CBS domain containing protein"
FT                   /note="PFAM: CBS domain containing protein;
FT                   transporter-associated region; KEGG: rso:RSc0528
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25562"
FT                   /db_xref="GOA:B2UFN9"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:B2UFN9"
FT                   /protein_id="ACD25562.1"
FT                   /translation="MLARCLTTRDRAMNDPYPSPKPADKPRTLLERLTDLISPEPESRA
FT                   ELLEILQDAHARSLIDADSLSMIEGVFQVSDLCARDIMIPRAQMDALNIADAPSEFIPF
FT                   VQEAAHSRFPVYEGSRDNIIGILLAKDLLRFYTDEDFDVRDMLRPAVFIPESKRLNVLL
FT                   RDFRVNRNHIAIVVDEYGGVAGLITIEDVLEQIVGDIEDEYDFDQEEDNILPTADGHMR
FT                   VRGLTEISQFNEAFGTHFSDEDVDTVGGLLSNHLGRVPHRGEKIVMGTLQFDVLRADAR
FT                   QVQVLLVRRLTTPAGGNATADTSGSHPA"
FT   gene            complement(431317..432531)
FT                   /locus_tag="Rpic_0405"
FT   CDS_pept        complement(431317..432531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0405"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pfa:PFD1175w Plasmodium falciparum trophozoite
FT                   antigen r45-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25563"
FT                   /db_xref="UniProtKB/TrEMBL:B2UFP0"
FT                   /protein_id="ACD25563.1"
FT                   /translation="MRQRFMDSIPWTTLLVGVGVGTALAVTPRIAHADHKQSCYAGIVV
FT                   VFDGAWHPGAVVGCRTVNISDSNNVVGAEVNLMVAQGTIRPRVQAVVGSTSVQALIGGG
FT                   YDFASSKALVGVGATGDHWLAGVDMEIAGRWTAYGGASTLGRYHSNSHPADPAPAATTP
FT                   TGNNDAPPPSGNNTPPSKPSPTPAPAPGASPSPGPTPAPTPSPGPSPSPTPSPSPTPSP
FT                   TPTPAPTPTPSPSPVPSPCGSCHGGGHHHGHDHDHDHDHDHSGDHDHGGDRNHGGDHNH
FT                   GGDGSHGGDHDHGGDGNHDHGGNSNHGGDRDHGGGGNHGGHHDHGGDGNHGGDHDHGGG
FT                   GNHGGDHDHGGDGNHGGDHHHGGDDNHGGDHDHGGDGNHGGDHDHGGGGTHGGDHDRGG
FT                   EGGHD"
FT   sig_peptide     complement(432430..432531)
FT                   /locus_tag="Rpic_0405"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.985) with cleavage site probability 0.501 at
FT                   residue 34"
FT   gene            complement(432904..433716)
FT                   /locus_tag="Rpic_0406"
FT   CDS_pept        complement(432904..433716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0406"
FT                   /product="protein of unknown function UPF0054"
FT                   /note="PFAM: protein of unknown function UPF0054; KEGG:
FT                   rso:RSc0529 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25564"
FT                   /db_xref="GOA:B2UFP1"
FT                   /db_xref="InterPro:IPR002036"
FT                   /db_xref="InterPro:IPR020549"
FT                   /db_xref="InterPro:IPR023091"
FT                   /db_xref="UniProtKB/TrEMBL:B2UFP1"
FT                   /protein_id="ACD25564.1"
FT                   /translation="MAKAKTDTKAKTKKTQPAAAESFGPRVDVFDAQGKPRTVDASALR
FT                   IAFADGRSLILGLPNTVDGPITLVAEHADADMHAMLSLRPEHHDSITLRIETQPAELAD
FT                   STEEAFDDDTAGAEMLTLDLTVQYGDELKAAARKALPKERDIEGWIAPALFADAQLNVR
FT                   FVGEEEGRTLNRTYRGKDYATNVLTFSYAESAEDPVSADIVLCCTVVEKEAKEQKKPLL
FT                   AHYAHLIVHGALHAQGYDHEDAADAKEMEGIETEILRDLGFADPYADR"
FT   gene            complement(433729..434721)
FT                   /locus_tag="Rpic_0407"
FT   CDS_pept        complement(433729..434721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0407"
FT                   /product="PhoH family protein"
FT                   /note="PFAM: PhoH family protein; KEGG: reh:H16_A0527
FT                   phosphate starvation-inducible protein PhoH,predicted
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25565"
FT                   /db_xref="GOA:B2UFP2"
FT                   /db_xref="InterPro:IPR003714"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2UFP2"
FT                   /protein_id="ACD25565.1"
FT                   /translation="MKPTIAEFTAPKNDNTRLQNLCGPLDENLRQIEQALDVTINRRGS
FT                   KFTVRGANAQGAANALETFYNAARDPLSVDDIQLGLVETRQVAAHGAYLPESGTDEPDG
FT                   NDLSPVLHTRRTDLHGRTPMQRAYLRNVLSHDLSFGIGPAGTGKTYLAVACAVDALERD
FT                   AIKRIVLTRPAVEAGERLGFLPGDLAQKVDPYLRPLYDALYDLLGFDKTQKMFERQMIE
FT                   IAPLAYMRGRTLNHAFIILDEAQNTTPEQMKMFLTRIGFGSKAVITGDTTQIDLPRGQK
FT                   SGLIEAQHVLRDVRGVAMTRFTSVDVVRHPLVARIVEAYDEFHAQHKDA"
FT   gene            complement(434743..436113)
FT                   /locus_tag="Rpic_0408"
FT   CDS_pept        complement(434743..436113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0408"
FT                   /product="tRNA-i(6)A37 thiotransferase enzyme MiaB"
FT                   /EC_number="1.3.1.74"
FT                   /note="KEGG: rso:RSc0531 hypothetical protein; TIGRFAM: RNA
FT                   modification enzyme, MiaB family; tRNA-i(6)A37
FT                   thiotransferase enzyme MiaB; PFAM: deoxyribonuclease/rho
FT                   motif-related TRAM; Radical SAM domain protein; Protein of
FT                   unknown function UPF0004; SMART: Elongator protein
FT                   3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25566"
FT                   /db_xref="GOA:B2UFP3"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006463"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2UFP3"
FT                   /protein_id="ACD25566.1"
FT                   /translation="MKKVFIKTYGCQMNEYDSDKMSDVLNAAEGLVPTDTPEDADVILF
FT                   NTCSVREKAQEKVFSELGRVKALKALKPDLVVGVGGCVASQEGASIVARAPYVDVVFGP
FT                   QTLHRLPDLIAARRRTGRSQVDVSFPEIEKFDHLPPARVDGASAYVSIMEGCSKYCSYC
FT                   VVPYTRGEEVSRPFDDVLAEVAGLAEQGVREVTLLGQNVNAYIGKMGDTSERADFALLL
FT                   EYVAEIPGIERIRYTTSHPKEFSSRLIEAYATNPKLVDHLHLPVQHGSDRILMAMKRGY
FT                   TVLEYKSSIRKLRAIRPNISIATDFIVGFPGETDADFAKTMDLIHEIGYDTSFSFIYSP
FT                   RPGTPAANLHDDTPQAVKLERLKHLQATIEENVARISQGMVGSVQRILVEGPSRKDPTE
FT                   LHGRTENNRVVNFALPDLPQVRREQLIGQMLDVRIVHAFPHSLRGEVAEERMASAAH"
FT   gene            complement(436166..436579)
FT                   /locus_tag="Rpic_0409"
FT   CDS_pept        complement(436166..436579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0409"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RSc0532 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25567"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:B2UFP4"
FT                   /protein_id="ACD25567.1"
FT                   /translation="MRTRRQVLALAVAAVAAASAPLLSHAQVLRNIPATAPAAQLTINS
FT                   ANGGTLSTGSTGIVRILLLGFGSSSADIRFAPGVRILSLDGRLLPTSSVVGQTFKVRYQ
FT                   LDLYQQLLTAWVVSDDDYKAAVAAQSQAQAQSQ"
FT   sig_peptide     complement(436499..436579)
FT                   /locus_tag="Rpic_0409"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.890 at
FT                   residue 27"
FT   gene            complement(436670..437668)
FT                   /locus_tag="Rpic_0410"
FT   CDS_pept        complement(436670..437668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0410"
FT                   /product="putative transmembrane protein"
FT                   /note="KEGG: rso:RSc0533 putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25568"
FT                   /db_xref="GOA:B2UFP5"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B2UFP5"
FT                   /protein_id="ACD25568.1"
FT                   /translation="MSQPSIAIVGAGIAGVACANALAAEGIATTVYERAGGVGGRLATT
FT                   VLPESAPAYAFDHGAQSFNVRSEVFRRAVDAAGRQGSVLPWPARWGHRTIDALQADSRD
FT                   EARYVGLPGMGALVRSLAAPLDVRFGHAVTRVAHDGRRWTIERNGTDAAHADFLALALP
FT                   APELSALFHGATPASLQEAIAPVHYAPCWALMMGFAQPLGLPYDGIRIDDDVLAWAARD
FT                   NSKPGRVMVDESWVVHASPGWSAAHAQDTPEQAVHAMHARFAEAFPGTPQPDVMAAHLW
FT                   PHALVEQSAGVPCHWDAAARLGACGDWCEGPRVEAAFLSGIALAAKIAEAL"
FT   sig_peptide     complement(437597..437668)
FT                   /locus_tag="Rpic_0410"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.993 at
FT                   residue 24"
FT   gene            complement(437812..438738)
FT                   /locus_tag="Rpic_0411"
FT   CDS_pept        complement(437812..438738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0411"
FT                   /product="OmpW family protein"
FT                   /note="PFAM: OmpW family protein; KEGG: bmn:BMA10247_3516
FT                   outer membrane protein, OmpW family"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25569"
FT                   /db_xref="GOA:B2UFP6"
FT                   /db_xref="InterPro:IPR005618"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:B2UFP6"
FT                   /protein_id="ACD25569.1"
FT                   /translation="MNRTARRLAAAIACAAASTLAAPLAHAQSTAEANVAASASNGSGM
FT                   SSGGGGGFSGFMDNYVWGRNVMALGWFYIRPMDSATPLTTTTSALGLGTYQSPGTDVKV
FT                   SNANTLSLTFTHFFNDNIAGTFVGGVPPKFNLYGSGNVIAPVPVVGPLTLVNLGLPQNN
FT                   PVATVREWSPAIVAQYYFGTKESKLRPFVGAGVSYNFFTNLKLNQNFVNGLQNLGQVLQ
FT                   LGMGQVPTGPAKVTAETSSSWTPVANVGVSYEFAKNWTAIGTVSYLPLKTTSTITIRSQ
FT                   QGQVLAVNKTDIKVDPIVFGLAVGYKF"
FT   sig_peptide     complement(438655..438738)
FT                   /locus_tag="Rpic_0411"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.995 at
FT                   residue 28"
FT   gene            complement(438950..439867)
FT                   /locus_tag="Rpic_0412"
FT   CDS_pept        complement(438950..439867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0412"
FT                   /product="putative lipoprotein transmembrane"
FT                   /note="KEGG: rso:RSc0534 probable lipoprotein
FT                   transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25570"
FT                   /db_xref="GOA:B2UFP7"
FT                   /db_xref="InterPro:IPR011465"
FT                   /db_xref="UniProtKB/TrEMBL:B2UFP7"
FT                   /protein_id="ACD25570.1"
FT                   /translation="MHLRTLALATVLAGAAHAWGQPAAPDASAPAAAAQTAAPTAASQS
FT                   AAIGSFAAMDIAKQTAWLGSQVNANAFAGWSDEDVLAMAHAMKPETLVRWLKAEVAKLP
FT                   EYEYRMRRQERVKDQWQSQAALMLIRYRNAPRQVYARWLRGGAHAGQEIIYDETVRKNE
FT                   MYGHLGGLVGFVAIWSALDGSLARSQSNHTARELGLQFIVDTVERDGRAHVAAGGSGKF
FT                   NEAKMVTEDGERMLRLTWDTPSGPPTFYAKRVRLYFDLKNPWVRIEEAWDESGNQLEKI
FT                   VIESVTRKTWNDQTFNPKNPEYKF"
FT   sig_peptide     complement(439811..439867)
FT                   /locus_tag="Rpic_0412"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.751 at
FT                   residue 19"
FT   gene            complement(439888..441627)
FT                   /locus_tag="Rpic_0413"
FT   CDS_pept        complement(439888..441627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0413"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   bxe:Bxe_A2778 putative long chain fatty-acid CoA
FT                   ligase(long-chain acyl-CoA synthetase)"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25571"
FT                   /db_xref="GOA:B2UFP8"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B2UFP8"
FT                   /protein_id="ACD25571.1"
FT                   /translation="MNTVADRNSLTDRIWLKSYPEGVPAEINPDRYHSLVEVFRESVEK
FT                   YRTRIAYVSVGTEMTYDECERQAKQFAAWLQSRGVKKGDRVAIMLPNSLQYPVCLFGTL
FT                   LAGAIVVNVNPLYTVPELAHQLRDSGAQTIVVLENFARTLEQALPGSQVRNIVITGIGD
FT                   LMGGALNLKGRALNFVMRHVQKQVPPYKLPSPVWLRDALAVGGSRTMQPVQLAPEDIAF
FT                   LQYTGGTTGVAKGAMLTHRNIIANLLQAEEWSKSMLNGGVETNVTLLPLYHIFSLTVNL
FT                   LMFMTLGGRNILIANPRDTKRVIFILRNERFSGIAGVNTLFNALLEDPDFATRDFSAMK
FT                   ITIGGGMAVQRAIAQRWKEVTGHTIVEGYGLTECSPVVSMNPPHVTEFSGTIGLPAPST
FT                   EVRFKRDDGTIAPLGEPGELQVRGPQVMRGYWQRPEETAKSIDAEGWFSTGDIGVMDAN
FT                   GYIRLIDRKKDMILVSGFNVYPNEIEDVVALHPDVLEVAAIGVPDPVAGERVKIIVVPR
FT                   TGALTEPALLEHCRAHLTGYKMPRIVEFRHEELPKSTVGKILRRELRDADPDIKRARAQ
FT                   AQQ"
FT   gene            complement(441729..443048)
FT                   /locus_tag="Rpic_0414"
FT   CDS_pept        complement(441729..443048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0414"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.16"
FT                   /note="KEGG: bxe:Bxe_A2777 acetyl-CoA acetyltransferase;
FT                   TIGRFAM: acetyl-CoA acetyltransferase; PFAM: Thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25572"
FT                   /db_xref="GOA:B2UFP9"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:B2UFP9"
FT                   /protein_id="ACD25572.1"
FT                   /translation="MLVNAQLRRVAILGGNRIPFARSNTAYATASNQQMLTAALQGLID
FT                   RFNLHGQRLDEVVAGAVIKHARDFNLTRETVLSTTLAKQTPAYDIQQACGTGLEAAILV
FT                   ANKIALGQIDVGIAGGTDTTSDAPVGLNEKMRKILLEANRAKSTGARVKALAGLRPSMF
FT                   VRPLLPRNSEPRTGLSMGEHCELMAKRWGIRREDQDALALRSHHNLTAAYERGFFTDLM
FT                   TAHLGLDRDNNLRSNLTIEQLAKLQPVFDRSAAGTMTAGNSTPLTDGASCVLLASEDWA
FT                   RAHNLPVLAYMTCADTAAVDFFSSTPEQNEGLLMAPAYAVSRMLQRAGLTLQDFDYYEI
FT                   HEAFAAQVLSTLAAWESPEYCREKLGRSAPMGSIDRSKLNVNGSSLGTGHPFAATGGRI
FT                   VATLAKMLAQRGSGRGLVSICAAGGQGVVAILERPETMSH"
FT   gene            complement(443053..443973)
FT                   /locus_tag="Rpic_0415"
FT   CDS_pept        complement(443053..443973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0415"
FT                   /product="MaoC domain protein dehydratase"
FT                   /note="PFAM: MaoC domain protein dehydratase; KEGG:
FT                   pfl:PFL_2941 MaoC-like domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25573"
FT                   /db_xref="GOA:B2UFQ0"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR003965"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B2UFQ0"
FT                   /protein_id="ACD25573.1"
FT                   /translation="MRTLAQPFPMVATQTLVTEPPSPGALAWRALLSQRKGRRGGPLPR
FT                   HTLVRQEVPLEAEHIAQYAAVCGFSPAHGVPMTYPHLLGFSLQLMLMTESAFPYPVIGL
FT                   VHLCNTIRQHQRLQAGERVRVEVRPRRLFHHARGQAFAIETAIVKAGAVVWESLSTYLR
FT                   VGVPSPQGAPLIALPSVQNLSLDGRWDVPADTGRRYAGVSGDWNPIHVSNIGAKLFGFA
FT                   HPIAHGMWTKARALAALLPAAPLTEGEVVAEFKTPLSLPGAATLWQANEATPGRAFEVR
FT                   NATGDKPYLRGMLTLPHAQQDNTGD"
FT   gene            complement(443981..445393)
FT                   /locus_tag="Rpic_0416"
FT   CDS_pept        complement(443981..445393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0416"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: rso:RSc0536
FT                   3-ketoacyl-(acyl-carrier-protein) reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25574"
FT                   /db_xref="GOA:B2UG87"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2UG87"
FT                   /protein_id="ACD25574.1"
FT                   /translation="MQDKYLDFVGSGFGKWLSANLGLPQPVPLRRYVPGEPEFVGPFLV
FT                   GAAPGGSMRETLAALFAETGVPTRFHESDPEWLGAANRHGQITGRFVAPTGKDGEAFDR
FT                   IGGIVFDATGIATVDGLDALYHVFHDGVRAIGRCGRVVVIGRPPEGCKTPEMAIAQRAL
FT                   EGLTRSLGKEVRRGCTAQLVYVAEGAENVAVSTLRFLLSARSAYVSGQVVRVHRAAAVS
FT                   VDWQKPLAGRTALVTGASRGIGAAIAHVLARDGARVLCLDVPAAQEALNAVAQEIGGEA
FT                   MAYDIAAPETPALLAQQLAALGGIDILVHNAGITRDKTIARMTEPAWRSVLDINLAAQL
FT                   RINDALLAANALHAGGSIVCVSSISGIAGNLGQTNYAMSKAGVIGLVQAGAPLLAERGI
FT                   TINAVAPGFIETQMTAAVPFAIREAGRRMNAMSQGGQPVDVAETIAWFANPASNGVTGN
FT                   IVRVCGQSLLGA"
FT   gene            complement(445428..447938)
FT                   /locus_tag="Rpic_0417"
FT   CDS_pept        complement(445428..447938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0417"
FT                   /product="Protein of unknown function DUF1974"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase type 2 domain; Protein of unknown
FT                   function DUF1974; KEGG: rso:RSc0537 acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25575"
FT                   /db_xref="GOA:B2UG88"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR015396"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B2UG88"
FT                   /protein_id="ACD25575.1"
FT                   /translation="MMTIWIVLLCIGVLGLASMEASAFAWLVATAVWLVAGAWLGLVGP
FT                   VMTTVLAIVFVLPALVLALKPLRRALITRPVLAMFRKIMPEMSQTERDAIEAGTVWWDA
FT                   ELFSGRPNWSRLLSSPQPRLSAEEQSFLDVETEKLCDLANDWESTQIWQDLSPDAWDYA
FT                   KRAGFLGMIIPKEYGGKGFSAYAHSQVIMKLSTRCSAAAVSVMVPNSLGPAELLLHYGT
FT                   EAQKNHYLPRLARGEEIPCFALTNAYAGSDAAAIPDVGVVCRGVHEGRETLGFRVTWSK
FT                   RYITLGPIATVLGLAFRAVDPDGLLGGDKEPGITCALIPTKHPGVNIGRRHWPLNAVFQ
FT                   NGPNSGKDVFIPIDWVIGGQAQVGRGWRMLMECLAAGRAISLPSSNVGMAKLAVRSTGA
FT                   YAAVRRQFRTPIGKFEGIQEALGRMGGNLYMMDAARRLSALAVDLGEKPSVISAIAKYH
FT                   VTERARDVVTDAMDIVGGKGICMGPNNFLARAYQQVPIAITVEGANIMTRCLIIFGQGV
FT                   IRCHPYVLREMTAAQGADSTETLRAFDTALFGHGAFIAGNLVRAFLHALSGGRVGSAPG
FT                   NAAPEMQRYYRAVNRFSTALALLSDVSMFTLGGTLKRRESITGRLGDILSQMYLISSAL
FT                   KRFEDDGRPAEDAPLVHWSVQDALVKAHDALDGVLANFPNTGIAALLRALIFPFGTPYR
FT                   KPSDALAAQVAELMQTPGAVRDRLLADSYCPTPEVDPIAYGEAAFRLQPAVDAIEQRLK
FT                   PAIRAGKLPPVPQSLPDFEAWTAQAVAQNLIDEGERKQLCDYARYGEHAVAVDDFPPDF
FT                   NLMADLQRRKDALDALQAAERRAA"
FT   sig_peptide     complement(447861..447938)
FT                   /locus_tag="Rpic_0417"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.448 at
FT                   residue 26"
FT   gene            complement(448066..449124)
FT                   /locus_tag="Rpic_0418"
FT   CDS_pept        complement(448066..449124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0418"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: rso:RSc0538
FT                   putative transcription regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25576"
FT                   /db_xref="GOA:B2UG89"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041586"
FT                   /db_xref="UniProtKB/TrEMBL:B2UG89"
FT                   /protein_id="ACD25576.1"
FT                   /translation="MGRPGAGDTKGRILEATELLFIEFGYEAMSLRQITARAKVNLAAV
FT                   NYHFGSKEALMQSVLGRRLDPLNTRRLALLTACEERWTKEQLTCDHVLGALFVPALQMA
FT                   RNPDTGGPAFLRLMGRVYSDTSPFVQSYLLGHYALVFDRFFEAFSRALPHLPRAELGWR
FT                   LHFALKALAGVLAGDDLNNLLPLFTQGKTMNDASLLARLTALVVATLNAPLPGEAGALD
FT                   QVVELAEAQVPTPVAQADDAPNGNDSGNGGSGRHAGRGNGRAERSATPTTASPFAGDLF
FT                   GRTPARASADDAADAHDDLGAGAHDDTHGDDSDVGGPAPTARTRALAIRRSNAARAIFP
FT                   ANPMRPWRSPNA"
FT   gene            complement(449413..449582)
FT                   /pseudo
FT                   /locus_tag="Rpic_0419"
FT   gene            449858..451540
FT                   /locus_tag="Rpic_0420"
FT   CDS_pept        449858..451540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0420"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="PFAM: helicase domain protein; DEAD/DEAH box
FT                   helicase domain protein; SMART: DEAD-like helicases; KEGG:
FT                   rso:RSc0539 probable ATP-dependent RNA helicase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25577"
FT                   /db_xref="GOA:B2UG90"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028622"
FT                   /db_xref="UniProtKB/TrEMBL:B2UG90"
FT                   /protein_id="ACD25577.1"
FT                   /translation="MSFSELGLSDKLVRAVAELGYAEPTPIQRQAIPAILRGGDLLAGA
FT                   QTGTGKTAGFTLPLLHRLSAAQPNKVQTPQGMRFPIRALVLTPTRELAAQVEESVRAYG
FT                   KYLPLKSMVMFGGVGINPQIDALKRGVDIVVATPGRLLDHVGQRTIDLSHIELLVLDEA
FT                   DRMLDMGFIHDIRKILNILPAKRQNLLFSATFSDDIRELADRLLDKPALIEVARRNTTA
FT                   ETVEQRIYPVDRERKRELLAKLVRDNDWHQVLVFTRTKHGANRLAEQLTRDGIPALAIH
FT                   GNKSQSARTRALTEFKAGTLRVLVATDIAARGIDIDQLPHVVNFDLPNVPEDYVHRIGR
FT                   TGRAGAQGEAISLVCVDEHGLLRDIERLIKRELPRTVLERFEPDPTIAAEPIPNGRNPA
FT                   GRGGNARGGRPGGGRSQQPRQASGNAAPREPRAPREPREPRRESSGNGQGQGQGQNQGQ
FT                   GRNGGGSRQRQAQGQRDGQAAPKPRNGQSQARGQRQVNGQGQGQGQGQGQGNGQGGQGG
FT                   QGGQQRRASNTQAAQPAHKGQPAKQPFNGLFAKAAALLGGRKA"
FT   gene            451546..452580
FT                   /locus_tag="Rpic_0421"
FT   CDS_pept        451546..452580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0421"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /note="PFAM: aminoglycoside phosphotransferase; KEGG:
FT                   rso:RSc0540 predicted kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25578"
FT                   /db_xref="GOA:B2UG91"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR032882"
FT                   /db_xref="UniProtKB/TrEMBL:B2UG91"
FT                   /protein_id="ACD25578.1"
FT                   /translation="MHDDGPPASVDAPYDGLTPDSILDALAQVGLMPDGRMFALNSYEN
FT                   RVYQAGVEDSAPVVVKFYRPGRWTDAQIVEEHAFTAELAAAEIPVVAPLEIDDRTLHAF
FT                   ERWHFAVFPRCAGRVPAIDQDHTLEWMGRFLGRIHVVGARRPFVARPALDIDTFGVQSR
FT                   DWLLEHDFIPPDLLPAWRSVADAALDGVRRCYDRAGDVSLLRLHGDCHASNVLWIEEAD
FT                   AKQGDPLRSAGPHFVDFDDSRTGPAVQDLWMLLSGDRASMQSQLASLLAGYEDFCEFDT
FT                   RELYLVEALRTLRLLHYSAWLARRWNDPAFPAAFPWFNTQRYWQDRVLELREQIALLDE
FT                   PPLW"
FT   gene            complement(452614..453510)
FT                   /locus_tag="Rpic_0422"
FT   CDS_pept        complement(452614..453510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0422"
FT                   /product="Pirin domain protein"
FT                   /note="PFAM: Pirin domain protein; KEGG: rso:RSc0541
FT                   probable pirin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25579"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR008778"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B2UG92"
FT                   /protein_id="ACD25579.1"
FT                   /translation="METLVQPQVQRARLVERIITGRPTSDGAGVKLTRVLTNNLQRRLD
FT                   PFLMLDAFRSDDPNDYLAGFPDHPHRGFETVTYMIAGRMRHRDSAGHEGLLQHGGVQWM
FT                   TAGSGVVHSEMPEQEDGVMEGFQLWLNLPASDKMTTPWYRDIPSNEIPEFTTEDGVAVR
FT                   VIAGESHGVQGAMTREATQPLYLDITLPAGASFAQRLPAGHNAFVYVFRGSALVGDAEA
FT                   SGDAGLQRVEDKQMAILANTEGSDGVVIRAGDAEARVLLVAGKPLNESIAQYGPFVMNT
FT                   QEEIFQAVRDFQAGKFA"
FT   gene            453659..454576
FT                   /locus_tag="Rpic_0423"
FT   CDS_pept        453659..454576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0423"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: rso:RSc0542 probable transcription
FT                   regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25580"
FT                   /db_xref="GOA:B2UG93"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2UG93"
FT                   /protein_id="ACD25580.1"
FT                   /translation="MDLNQLALFVRVVEAGSFTAAATRLDLPKSSVSRGIAALEQDLNV
FT                   RLLQRTTRTLHLTDAGQSLYQVASHALEDIERATTCAGELQDLPRGKVRITSSEDVGRL
FT                   LVAPVAARFMQLYPEIDLDVVLTPRNVDLVQEGFDLAVRVGRLADSSLVARSLGVLRIG
FT                   LFASPDYLQRRGAPDTVQGLADHCCLDFRGTGRGETQWRLVGPDGLKTVAVRARLNADS
FT                   LIYLETLIASGAGIGPLPLYASAVARANAPLPRLVRVLPDYATSGEPINLVTPSARFVP
FT                   RRVRLLIDMLTESIRQELENADPT"
FT   gene            455034..455774
FT                   /locus_tag="Rpic_0424"
FT   CDS_pept        455034..455774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0424"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: rso:RSc0543 probable
FT                   response regulator transcription regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25581"
FT                   /db_xref="GOA:B2UG94"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B2UG94"
FT                   /protein_id="ACD25581.1"
FT                   /translation="MRIALLEDDPFQSEVIVQILSQSGHDVVTYTDGSTLLRMLGRSSY
FT                   DMLILDWHTPGMLGIDVLSVVRSRHKDVLPVLFVTAEEGEKSLVRALTHGADDYIAKPF
FT                   RIAELRARVDALLRRAYPIPYGRLPFAVGPYHFNPQRQQVTLHGEPVTLTGIEFQLALL
FT                   LFSNVGRTLSRDHIFGQVWGRNSSEYTRTIDSHVSRIRMKLNVEPVNEVRLVAVYKHGY
FT                   RVDHLRPADDMNALSDMDAAFYST"
FT   gene            455854..456186
FT                   /locus_tag="Rpic_0425"
FT   CDS_pept        455854..456186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0425"
FT                   /product="Cupin 2 conserved barrel domain protein"
FT                   /note="PFAM: Cupin 2 conserved barrel domain protein; KEGG:
FT                   spe:Spro_2546 cupin 2 conserved barrel domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25582"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B2UG95"
FT                   /protein_id="ACD25582.1"
FT                   /translation="MLRASHILGEAGVPLVNLNAEADALPRAWSSRVLERFGGGNFKVL
FT                   RMDGTPYPNEVHGYAEGLLVIDGQLRLRIGDEAVTVSRGELYVVPAGVPHSVDAGSAGT
FT                   LVILDV"
FT   gene            complement(456170..456745)
FT                   /locus_tag="Rpic_0426"
FT   CDS_pept        complement(456170..456745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0426"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RSc0544 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25583"
FT                   /db_xref="UniProtKB/TrEMBL:B2UG96"
FT                   /protein_id="ACD25583.1"
FT                   /translation="MSLLHTFLPEHQFSERHHIRVNASPARVLDMASQLHVTDFPVARL
FT                   LLYLRAIPARIAAALGKPSARRIDARFGLHDFTVLGRDGDQEFALGLVGRFWESAGGLI
FT                   HVEASAFRTFSEPDIAKLVMTFVARPEGADTLLTTRTCVHCSSTTALRRFTPYWILIRM
FT                   PSGLIRRMMLQRIKQLAEADDAPLTRPE"
FT   gene            complement(456765..457973)
FT                   /locus_tag="Rpic_0427"
FT   CDS_pept        complement(456765..457973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0427"
FT                   /product="monooxygenase FAD-binding"
FT                   /note="PFAM: monooxygenase FAD-binding; FAD dependent
FT                   oxidoreductase; KEGG: rso:RSc0545 probable oxidoreductase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25584"
FT                   /db_xref="GOA:B2UG97"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B2UG97"
FT                   /protein_id="ACD25584.1"
FT                   /translation="MSALRPLSIGIAGAGNAGLAAAIAFARQGHDVHVFEKHPQLTAMG
FT                   AGLLVQPQGIRALEALGVGRELEGIGAPIDRLIGLSHRGWRLLDIDYAETPGRAVTRHG
FT                   LSSMLYDAGLHAGAAFHFGCAIQQLLVDGPRARVTHAQGESIFDLFVIADGAASALREP
FT                   AGLAGPSSTYRWGTLWFQGWVDGWNPRVLQQRFRGTREMMGLLPTEVDGNCTRLSMFWS
FT                   LPGDAVDAWRQTDITQWKAHVLSLWPQAAPMVEQIGSHDDMPFAVYRHTWPRALAKPPY
FT                   CVIGDAAHAMSPQLGLGTTLAAQDALALAACVQVHGPTHGALAYHARRLRTVQAYQTLS
FT                   RALTPCFQAQYGGWMRDVVFATGLRVPGVAWLMKRSLAEPPARDAAFAPAAASTSTSEK
FT                   PQA"
FT   sig_peptide     complement(457893..457973)
FT                   /locus_tag="Rpic_0427"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.979) with cleavage site probability 0.648 at
FT                   residue 27"
FT   gene            458095..459018
FT                   /locus_tag="Rpic_0428"
FT   CDS_pept        458095..459018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0428"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bur:Bcep18194_C7601
FT                   transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25585"
FT                   /db_xref="GOA:B2UG98"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2UG98"
FT                   /protein_id="ACD25585.1"
FT                   /translation="MQIKWLEDFKELAKTRSFSRAAENRNVTHPAFGRRIKALEEWVGT
FT                   ALVERSEHPVTLTAAGRLFLDAAANAVDGLNDARLLLREAQLPVALRIGTGRTLARTFV
FT                   PGWYETLARQRGVFPLSVTTGGTQEGVLALADGTVDLLIAYASPQADALLDPRKYDHCL
FT                   LGSETLVPVSAPDKRGRPRFTLPGSAAAPLPWLAFARGLTLRQMLDSHLAAADRKAHLQ
FT                   PVFQADFYEAVEEMALRGFGMAWLPYRLARPHLNAGELRPAGDDAWHIHVNIRMMRVRS
FT                   NQSALLDEVWQRAVDNASGNGRNDLT"
FT   gene            459158..460491
FT                   /pseudo
FT                   /locus_tag="Rpic_0429"
FT                   /note="major facilitator superfamily, (MFS_1) family"
FT   gene            460523..461509
FT                   /locus_tag="Rpic_0431"
FT   CDS_pept        460523..461509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0431"
FT                   /product="Succinylglutamate desuccinylase/aspartoacylase"
FT                   /note="PFAM: Succinylglutamate
FT                   desuccinylase/aspartoacylase; KEGG: bur:Bcep18194_C7599
FT                   succinylglutamate desuccinylase/aspartoacylase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25586"
FT                   /db_xref="GOA:B2UG99"
FT                   /db_xref="InterPro:IPR007036"
FT                   /db_xref="UniProtKB/TrEMBL:B2UG99"
FT                   /protein_id="ACD25586.1"
FT                   /translation="MMTLEALRATLPVYPIELHKPDIRRWKTGTHGIDYVHTFDSGVPG
FT                   PHVMINALTHGNELCGAIAVDALLAAGVRPARGRLTLSFANVEAYERFDINDPDATRFI
FT                   DEDLNRVWSADKLDGPGNSLELRRARELRPVIDTVDYLLDIHSMHEKAEPLMLTGPHAK
FT                   GVALGRLVGAPSHLMIDAGHAAGRRLRDYGGFGDAASPKNALLIECGQHFERVSRDVAL
FT                   DACARFLVALGTVDASAVSEWLGMAPALEVRCIRVTDPVVAKSTAFRFADDYRGMETIA
FT                   RAGTVIATDGALQIVTPYDNCVLLQPSLRHLAPGVTVVRLGRLEGSA"
FT   gene            complement(461506..462174)
FT                   /locus_tag="Rpic_0432"
FT   CDS_pept        complement(461506..462174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0432"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG:
FT                   bpd:BURPS668_A2819 transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25587"
FT                   /db_xref="GOA:B2UGA0"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="UniProtKB/TrEMBL:B2UGA0"
FT                   /protein_id="ACD25587.1"
FT                   /translation="MEKTLETDDAPVRKGRPYGGVAPEARAAERRDALIRAGTRVFGTV
FT                   GFRKATVRAICQEAKLNDRYFYAAFDSTEALLRATYQQHAEDLRAQVYEATAAAEGTLE
FT                   ARIDAGLHAFFVFLREPCAARVLLLEVMGVSPETDATYQRNLLEFGKQIMANAQLPGAH
FT                   NDDDAELRADQRIIGLALVGALTNVGAAWLLTGYRDPEEKMVRNCRQVVLGTLRAMLGV
FT                   "
FT   gene            462283..463833
FT                   /locus_tag="Rpic_0433"
FT   CDS_pept        462283..463833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0433"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   bpd:BURPS668_A2821 arylesterase/monoxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25588"
FT                   /db_xref="GOA:B2UGA1"
FT                   /db_xref="InterPro:IPR020946"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B2UGA1"
FT                   /protein_id="ACD25588.1"
FT                   /translation="MNTTMERSASPGVPRNRAAAPDTDLDVLIVGAGLSGIGAAYHLRE
FT                   RCPSARFTILEGRESIGGTWDLFRYPGIRSDSDMFTLGYSFRPWHSNKAISDGQTILDY
FT                   IRDTAGVFGIDKSIRFRHKVTGASWDSAAARWTVQALRCDGSREEPVLFTCKFLYMCSG
FT                   YYDYEEGHAPTWPAMDTFQGRIVHPQHWPNDLSYGGKRVVVIGSGATAVTLVPAMAGTA
FT                   QHVTMLQRSPTYIVSRPEQDAVANTLRRWLPSGLAHRLVRTKNVLLTMYFYSLARRKPK
FT                   AFKEFIIRMAGKQIGPGFDVRKHLTPRYNPWDQRLCLVPDGDLFKTIRAGKASIATDEI
FT                   ARFTPTGLQLKSGEHLDADVIVTATGLKLKVLGGAAITVDGRAVNLAETVSYKGMMYSG
FT                   VPNLASSFGYTNASWTLKAELIAQYVCRLLNHMQSNGFDTCVPRLGDEAMSREPAVDLT
FT                   SGYIQRAAAILPKQGDKQPWKSYQNYARDLMMLKFGTLADSAMQFERRAQPTGAAQPA"
FT   gene            463857..464813
FT                   /locus_tag="Rpic_0434"
FT   CDS_pept        463857..464813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0434"
FT                   /product="alpha/beta hydrolase fold"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG:
FT                   bte:BTH_II0402 hydrolase, alpha/beta fold family"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25589"
FT                   /db_xref="GOA:B2UGA2"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B2UGA2"
FT                   /protein_id="ACD25589.1"
FT                   /translation="MTYTILGVIALAILAPVAFTFFIARRVTKGFPPEGKFIDIGGDRV
FT                   HYTDRGTGPAIVFVHGLCGNLRNFAYLDLDRLTRSHRVIVIDRPGAGRSVRGGDSPANV
FT                   YAQARTVAQCIEQLGLDKPVLVGHSLGGAISLAVGLNHPHVIRRLALIAPLTHAESTPP
FT                   GAFRGLVLTSPLVRRLVSWTLAIPLSIINSRKAIAAVFAPEAMPKDFPFKGGGLLGLRP
FT                   HVFYAASSDLVAAPEDLPDMERRYASMTVPVDVLYGRGDRILNVKRQGEALKQKLDRVN
FT                   LRIIDGGHMLPVTQPVLTTDWVLAVAAGVPVEAEALA"
FT   sig_peptide     463857..463919
FT                   /locus_tag="Rpic_0434"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.837) with cleavage site probability 0.618 at
FT                   residue 21"
FT   gene            complement(465221..465349)
FT                   /locus_tag="Rpic_0435"
FT   CDS_pept        complement(465221..465349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0435"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25590"
FT                   /db_xref="UniProtKB/TrEMBL:B2UGA3"
FT                   /protein_id="ACD25590.1"
FT                   /translation="MPDPTWFPKDAAAGRTGAAFEQQVSTAARDQGNPPPSHNRIM"
FT   gene            465455..465844
FT                   /locus_tag="Rpic_0436"
FT   CDS_pept        465455..465844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0436"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rme:Rmet_4407 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25591"
FT                   /db_xref="UniProtKB/TrEMBL:B2UGA4"
FT                   /protein_id="ACD25591.1"
FT                   /translation="MDVQQLVSEFLASEQGSQATQALAARGISTDDAQAMLSQAAETAH
FT                   AHVEEQNAGLMGEHGGRSFFAAFAAGLVRGDGFFKSLVEGGEGILTGRVAESLAGKMGI
FT                   DPSIASTVAAAATPYLVAFLKERLA"
FT   gene            466461..466955
FT                   /locus_tag="Rpic_0437"
FT   CDS_pept        466461..466955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0437"
FT                   /product="McrBC 5-methylcytosine restriction system
FT                   component-like protein"
FT                   /note="KEGG: rpb:RPB_1591 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25592"
FT                   /db_xref="InterPro:IPR019292"
FT                   /db_xref="UniProtKB/TrEMBL:B2UGA5"
FT                   /protein_id="ACD25592.1"
FT                   /translation="MRVLQPLGIVIRLQSPQKYLAFEESQQRSAFLMKPDVTASRDGRV
FT                   RWILDTKWKELSAGEAKEGVAQSDLYQMYAYASCYNCSEVVLLYPHHGALGQSAGVRAT
FT                   YLLNPWAERASQEPARRVRVATMDLADLKTVPRQLERIVLDYNAQAPVEIADGVPSHAL
FT                   R"
FT   gene            complement(467686..469287)
FT                   /locus_tag="Rpic_0438"
FT   CDS_pept        complement(467686..469287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0438"
FT                   /product="phage integrase"
FT                   /note="KEGG: rru:Rru_A3316 phage integrase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25593"
FT                   /db_xref="GOA:B2UGA6"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR025269"
FT                   /db_xref="UniProtKB/TrEMBL:B2UGA6"
FT                   /protein_id="ACD25593.1"
FT                   /translation="MQKQNYLVRRESSAHYYFRRAVPPHLRASLGKREIVISLRTRDRR
FT                   TAEVRARQHAVSTDAEFLLHEQLVHNQGNAHPDETVGLSRPLEPQHIPTLAERYHETLV
FT                   ATHLEHPPTRAELADMRTWYRQLESELTDAAVLGDTSFVEDAGQAHLAAEGFNPALTAP
FT                   ATLHLYYQRLLHADLVAIRQQLQHLSGAPIEKPKVRPSPLEGDNWEAMLECWKAERAPG
FT                   DKTWDEANRLVNRFRTFSNDLSPLDITTELVEAFRDSLLQEGLSRQRVKTILSLLRPVV
FT                   GTAIEMKRCSLTGNPFADVKINVPKRAAGKEQRQPFELEHLQALFRSPVYTDGLRPKKG
FT                   GGDAAFWLPLLGLFGGPRAEELGQLRVTDVLRRDGQLYLRISELGEDQELKTLASERMV
FT                   PVHEELLRIGFESYVETMRERGEQRLFPGLKADRYGNYTKMFSTWCNEYIDTYVVDDKR
FT                   YAYHSFRHCFEEFAGWSGLTQYQIDGILGHSPQGMAKLYGKKSGSRRTFNPKVLAEGMA
FT                   KYHVEGLDLSHLYGSY"
FT   gene            469794..470816
FT                   /locus_tag="Rpic_0439"
FT   CDS_pept        469794..470816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0439"
FT                   /product="ATPase"
FT                   /note="KEGG: bxe:Bxe_B2633 ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25594"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2UGA7"
FT                   /protein_id="ACD25594.1"
FT                   /translation="MDIKYAFWNNKGGTGKTSLAFQSIVRYAEKHSKKRILAIDMCPQA
FT                   NLSELMLGGLNNKGSEKLLARQGLVPRCSVGGYFQLRLPSPYAPPKFDAHDFITKPNSY
FT                   NVGVPRNVDLVCGDPLLELQANAVNTLANNQIPGTNPWIAVIDWLKDFLDQVEAEYDVV
FT                   FIDCNPSFSLYTQIALSTADRIVLPVMADDSSRRAIQNAFSLIYGLKLPSEIYAAYAFA
FT                   TKLKEAHRPLPKIHLIVKNRLTQYMGAASAYAAVLHAIERDVDKLLKSNPEIFGFKKLE
FT                   SGFVEVRDFQTTGVVAFAKGLPFSKLPVGKQSISGHRVQVKEDYLLNAQKAMDGLVASL
FT                   "
FT   gene            470844..471803
FT                   /locus_tag="Rpic_0440"
FT   CDS_pept        470844..471803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0440"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mac:MA3443 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25595"
FT                   /db_xref="GOA:B2UGA8"
FT                   /db_xref="InterPro:IPR007560"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:B2UGA8"
FT                   /protein_id="ACD25595.1"
FT                   /translation="MADEYHYPPDLFDLLVDALGRLNKSKKGVVLFLRGAGVDETDLAE
FT                   VDRTVRASPDAINKFEIARNVLIKVNARGDSGLRPRREIIKRVVEFEDFSNCWPEDQLK
FT                   ARGLVAAIREAVNRKDSFTRMKQERDAEREQALVRQRAEQAAVAVKRAKIEQVTTGLSA
FT                   LFGMDAKPQERGKLLEGVLNDLFHAYGVYVREDFRRKDPDTSVVLEQIDGVIELDGTVY
FT                   LVEMKWLKNPVGVAEFAPHLVRLFGRANASGIFISTTGYTEPVIKECINVLNQKTMVLC
FT                   SLQEIVMLLQRQDDLIAFLKKKTHAAIIDKNPFLQILS"
FT   gene            471980..472939
FT                   /locus_tag="Rpic_0441"
FT   CDS_pept        471980..472939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0441"
FT                   /product="plasmid replicase"
FT                   /note="PFAM: plasmid replicase; Primase 1; KEGG:
FT                   bxe:Bxe_A3944 putative replicase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25596"
FT                   /db_xref="InterPro:IPR004322"
FT                   /db_xref="InterPro:IPR014820"
FT                   /db_xref="UniProtKB/TrEMBL:B2UGA9"
FT                   /protein_id="ACD25596.1"
FT                   /translation="MEQARYDFYTHLNEAVVTTNDFSEGTKFRKREKVDQFAYCGLNPM
FT                   YRSYLSFDLDMPGSAFRFEDAHLPPPTIITINPENAHCHMLYRLVTPVAFTKNARSGPQ
FT                   DYFGAIQREMERRLGADTAYNHTITKNPLNPRWKVITHPAAKYHLGDFLEWIDLPSARI
FT                   AVPGNTVYKGRNHQLFDTLLRWAYGAVHAHADEQRWYATVHAKAEEINAIFTQPLGFSE
FT                   VRATARSTAKRVWQRRHEPHHSRPRILTFTDESSEERMRQGAAYTNAIRREKSLQTLQE
FT                   AFNALRIEHGDQITVRQLVDHTAMNIKTVRKYLPQIVR"
FT   gene            complement(473259..473684)
FT                   /locus_tag="Rpic_0442"
FT   CDS_pept        complement(473259..473684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0442"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25597"
FT                   /db_xref="UniProtKB/TrEMBL:B2UGB0"
FT                   /protein_id="ACD25597.1"
FT                   /translation="MDTNKKREIIKGKFPCEVPIIFSGIAPGVLDFVVHCKEEDKHLFE
FT                   MFAATLRFRASRGAYTRNNAYNKMRRLILSAQYKESGSFILEFEWPKEPVFLHLDEEDV
FT                   LSPCDDEHFTSLEKKNLRAALESKLNINRPAAKQLKI"
FT   gene            complement(473700..474980)
FT                   /locus_tag="Rpic_0443"
FT   CDS_pept        complement(473700..474980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0443"
FT                   /product="MT-A70 family protein"
FT                   /note="PFAM: MT-A70 family protein; SMART: ParB domain
FT                   protein nuclease; KEGG: smd:Smed_1667 MT-A70 family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25598"
FT                   /db_xref="GOA:B2UGB1"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR007757"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:B2UGB1"
FT                   /protein_id="ACD25598.1"
FT                   /translation="MKTPTDKATPVGGFVIHAAANLFPAMNDSEFEEFKEDIRQNGQQV
FT                   PILVQNGQLIDGRHRYRACCELGIEPKVEEVPVDQSIERLVISLNQHRRHLLESQRAMI
FT                   AARLANIGLGGNQHTGGLSQQQAADDLDVSVASVQRAKSVLVRGTDELIQAVDAGKVDV
FT                   SNGADLAKLPQPSQRKVMSDVEKGILKEAKEIRKAIAAERREQCLAALEVKRANSKPLD
FT                   PTKGPFSVVLADPPWNYLSEAQLGYTTMTLEEICQMPVNELAAEDAVLFLWCSASLPQE
FT                   ALDVIKAWGFTFKTQAIWDKVHPGMGSYFRIQHEHLMIATRGNVPEVPGTVRFASVFTE
FT                   KRREHSRKPDCAYEMIEAMYPELNKIELFCRGEPRTGWAGWGNECGNGEIVQAGVEVVV
FT                   DTDAMPDAANDGGDPPRRRGRPRKVIA"
FT   gene            complement(474996..475394)
FT                   /locus_tag="Rpic_0444"
FT   CDS_pept        complement(474996..475394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0444"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25599"
FT                   /db_xref="UniProtKB/TrEMBL:B2UGB2"
FT                   /protein_id="ACD25599.1"
FT                   /translation="MNKNVNSIITSAGMSAFDLCCDVEPVIEAVIDQTTFVVMRYITSS
FT                   ADFAAIFVVDMDKMAGVCVVQQQYFHMLTAILADPRHHKQVGEPVRFVGEDVPAEIAIF
FT                   MTIATMAPEVLDGHDGYVSFEINVAAKQ"
FT   gene            475533..476390
FT                   /locus_tag="Rpic_0445"
FT   CDS_pept        475533..476390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0445"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25600"
FT                   /db_xref="UniProtKB/TrEMBL:B2UGB3"
FT                   /protein_id="ACD25600.1"
FT                   /translation="MTEMTDPNKVDSEDGAEGKHNAGRDRRSLLNIMRSRAYLYELMRR
FT                   TNVVDVGKIRKAVLLEGGDSVSSRSLAETWNPRFDRAINGNLVITEQVLNQVSQKKRLA
FT                   SARLVHEVGPEENGGNVPLWAIFEDRFEEFDDIIESGLRLSKSGSDLGLNRADRIALLF
FT                   LPADQWHQLRTSPGVAVGPNLVQQAYDAGYFAADVLRLATAIAFWRLCLHGADAWAPIE
FT                   TLLDWLMVGPYAGVVANLGISAEMRDLLRMIAEDHHIQQGNVTAAARALTRFGSDGKRA
FT                   DPFG"
FT   gene            complement(476387..477463)
FT                   /locus_tag="Rpic_0446"
FT   CDS_pept        complement(476387..477463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0446"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25601"
FT                   /db_xref="UniProtKB/TrEMBL:B2UGB4"
FT                   /protein_id="ACD25601.1"
FT                   /translation="MLSTVLGRQPNSDVAQRERWTDEVALAQWLGEPVGTVEGWRLEAA
FT                   GKQQYLLGAVIDWLDGHMVALMGSEAGTDEDATRIAEACWTSLIPALEVDGHLIGFFRS
FT                   LHLEMEPQGYVIVYGDDMRALETARLTPEHATNLMAGYRALADFAQQLSTSPNQALAIW
FT                   HGVQDIVSPHLALQFFLATIGRDYDVAMEIVAGLDNTLLRSRWHLGCWLWELLLNHEFS
FT                   NLNAGTLLSAFAFAISRGIDINIVKGNKDSLGYPVFNGTAAHLLADTHGDHFRADLHRG
FT                   FDEQVYKEFLCGLLGRSLDIDLANFGGLTARDIDESVQSKHGRRNPFGKVLNAYMLHDK
FT                   LADTLPDNKPGKPGKQLI"
FT   gene            477646..480615
FT                   /locus_tag="Rpic_0447"
FT   CDS_pept        477646..480615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0447"
FT                   /product="type I site-specific deoxyribonuclease, HsdR
FT                   family"
FT                   /note="KEGG: mfa:Mfla_1215 type I site-specific
FT                   deoxyribonuclease, HsdR family; TIGRFAM: type I
FT                   site-specific deoxyribonuclease, HsdR family; PFAM: type
FT                   III restriction protein res subunit; protein of unknown
FT                   function DUF450; SMART: DEAD-like helicases"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25602"
FT                   /db_xref="GOA:B2UGB5"
FT                   /db_xref="InterPro:IPR004473"
FT                   /db_xref="InterPro:IPR007409"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR022625"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040980"
FT                   /db_xref="UniProtKB/TrEMBL:B2UGB5"
FT                   /protein_id="ACD25602.1"
FT                   /translation="MTAENRVEQDLISKLCDLKYTYRPDIRDRAALEANFREKFEALNR
FT                   VHLTDSEFQRLLDSVITSDVYNAAQTLRNINSFERDDGTPLNFTLVNIRDWCKNDFEVV
FT                   NQLRINTDNSHHRYDVMLLINGVPVVQIELKTLAVSPRRAMQQIVDYKSDPGNGYGKTL
FT                   LCFIQLFIVSNRTDTWYFANNNARHFSFNADERFLPVYQFASEDNKKITQLDSFAEKFL
FT                   AKCTLGQMVSRYMVLVASEQKLLMMRPYQIYAVKAIVDCIHQNCGNGYIWHTTGSGKTL
FT                   TSFKASTLLKDNPDIDKCLFVVDRKDLDRQTREEFNRFQEGCVEENTNTETLVRRLLSD
FT                   DYADKVIVTTIQKLGLALDGTNKRNYKERLEPLRNQRMVFIFDECHRSQFGENHKAIKE
FT                   FFPNAQLFGFTGTPIFEQNASYQQIEGQQASYRTTDDLFQRCLHQYTITHAIEDRNVLR
FT                   FHVDYFKPEGKNPPKPGEGLAKAKVIETILTKHDAATNERKFNAVLATASINDAIEYFE
FT                   AFKILQAKRQDEDETFQQLNVACVFSPPAEGNKDVQQIQEDLPQEKEDNQQDPEGKKAS
FT                   LTRIIADYNARFGTNHRIGEFDLYYQDVQKRIKDQQYPNADLPHAEKIDITIVVDMLLT
FT                   GFDSKYLNTLYVDKNVKHHGLIQAFSRTNRVLNDSKPYGNILDFRQQQKPVEDAITLFS
FT                   GEKIDNPREIWLVDPAPKVIDSLQTATQKLADFMQSQGLANAPEDVANLKGDAARSQFV
FT                   NLFKEVQRLKTQLDQYTDLSEEQKTQITQIASPDQLQGFKGVYLETAKRLKEQQDKQGD
FT                   QALPEVQQLDFEFVLFASAVIDYDYIMALIARMTQQKPGKLTLNREQLIGLIQSDAKFI
FT                   DEREDIAEYIRGLPVGQALDETAIRAGFERFKAEKKTRELTDIATKHGLAAEALQAFVD
FT                   DVLRRRIFDGEALSELMAPLGLGWKARTQKELALVEDLTPLLHKLAQGREISGLSAYEQ
FT                   "
FT   gene            480605..481912
FT                   /locus_tag="Rpic_0448"
FT   CDS_pept        480605..481912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0448"
FT                   /product="restriction modification system DNA specificity
FT                   domain"
FT                   /note="PFAM: restriction modification system DNA
FT                   specificity domain; KEGG: mfa:Mfla_1216 restriction
FT                   modification system DNA specificity domain"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25603"
FT                   /db_xref="GOA:B2UGB6"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:B2UGB6"
FT                   /protein_id="ACD25603.1"
FT                   /translation="MNNKDMGAMSEQNNPKRALVPRLRFPEFQDAGNWKTEALRKLAKR
FT                   CAKKNSEGEHKRVLTNSAEYGVIDQRDYFDKDIANQGNLEGYYIVEKGDYVYNPRISAS
FT                   APVGPISKNNVGTGVMSPLYTVFRFISSENDFFAHYFKSPHWHHYMRQASSTGARHDRM
FT                   SITNDDFMNMPLPVSVPKEQQKIADSLSSLDELIMAENRKLGTLKVYKNGLMQQLFPRE
FT                   GETVPRLRLPGFRRDPQWISATLGDIANVQSGGTPARTNPAYWNGDIPWVTTSLIDSST
FT                   ILKADEYITKAGLEESSAKIFPKGTLLMAMYGQGRTRGRVSVLGIDAATNQACAAIILK
FT                   RRGISTDFVFQNLASRYEEIRKISNSGGQENLSAGLIEGISFSFPDNESEQEYIANTLS
FT                   SIDGLITTQRQKIDALEIHKKGLMQQLFPVMAEALA"
FT   gene            481909..483009
FT                   /locus_tag="Rpic_0449"
FT   CDS_pept        481909..483009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0449"
FT                   /product="anticodon nuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25604"
FT                   /db_xref="InterPro:IPR026866"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2UGB7"
FT                   /protein_id="ACD25604.1"
FT                   /translation="MKPGQAFTDLPALAAQLRQELENKKTILLYAYNGTGKTRLSMAFK
FT                   DIGKQGDARDTLYFNAFTEDLFHWDNDLDGDSDRQLTLNAASRFFVGLAELEMDNRIRP
FT                   LLQRYADFDFRIDTQEWVVRFSRTLDGQIIDNIKVSRGEENIFVWCFFLAIVQLVLDGA
FT                   EAYRWVKYIYIDDPISSLDEHNAIAVANHLAQLLKRPESKLKTVISTHHTLFFNVLCNE
FT                   LGKARKYFVNKNSTGSGYVLREEMGDTPFFHHVAALAELYQAAQEDRLFTHHFNMLRTI
FT                   LEKTASFHGHKNFSACIKQEDDDPDGVLHTRLINILSHGNYSLFEPQQMLDENKAYFRK
FT                   ILHDFLNRYPFNPDLFPQAVEEAGTQ"
FT   gene            483006..484619
FT                   /locus_tag="Rpic_0450"
FT   CDS_pept        483006..484619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0450"
FT                   /product="type I restriction-modification system, M
FT                   subunit"
FT                   /note="TIGRFAM: type I restriction-modification system, M
FT                   subunit; PFAM: N-6 DNA methylase; KEGG: mfa:Mfla_1220 type
FT                   I restriction-modification system, M subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25605"
FT                   /db_xref="GOA:B2UGB8"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR004546"
FT                   /db_xref="InterPro:IPR022749"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038333"
FT                   /db_xref="UniProtKB/TrEMBL:B2UGB8"
FT                   /protein_id="ACD25605.1"
FT                   /translation="MTDLEKQKLGKTLWAIADQLRGAMNADDFRDYMLAFLFLRYLSDN
FT                   YEAAAKKELGRDYPQQLDSSVSTPLQRWYESNLDDVPEFEKQMRRKVHYVIEPQFLWGN
FT                   IAEMARTQDAVLLKTLQKGFSYIETESFASTFRGLFSEINLASDKLGKTYAERNARLCK
FT                   IIKEIADGLKQFSTDSDTLGDAYEYLIGQFAAGSGKKAGEFYTPQRISDILSAIVTLDS
FT                   QEPATGKRSHLDRVMDLACGSGSLLLNVRHRMKEAKGTIGKIYGQEKNITTYNLARMNM
FT                   LLHGVKDSEFEIFHGDTLLNEWDMLRETNPAKMPKFDAVVANPPFSYRWEPTEALGEDV
FT                   RFKNYGLAPKSAADFAFLLHGFQFLKQDGVMAIILPHGVLFRGGAEARIRTKLLKDGHI
FT                   DTVIGLPANLFFSTGIPVCILVLKKCKKPDDVLFINAAEHFEKGKRQNQILPEHIDKII
FT                   DTYQFRKEEARYSRRVGMEEIEKNDFNLNISRYVSTTEAEEEIDLAAVHAELVSLDKKI
FT                   KMATEQHNKFLKELGLPLLP"
FT   gene            484957..485367
FT                   /locus_tag="Rpic_0451"
FT   CDS_pept        484957..485367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0451"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25606"
FT                   /db_xref="UniProtKB/TrEMBL:B2UGB9"
FT                   /protein_id="ACD25606.1"
FT                   /translation="MEQQFEQAVPATSSNTNQTIAEQRRTQRVELRVTAIERAQLEALA
FT                   LASGYANLAQYLREIGLHTGRALPPTADYQLQLQWLQAINRIADHVREIADQLVGGRQP
FT                   DDDMLYYLLQVHEMAEDIWKEARQNSKPAGDA"
FT   gene            485364..486737
FT                   /locus_tag="Rpic_0452"
FT   CDS_pept        485364..486737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0452"
FT                   /product="Relaxase/mobilization nuclease family protein"
FT                   /note="PFAM: Relaxase/mobilization nuclease family protein;
FT                   KEGG: bxe:Bxe_A3938 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25607"
FT                   /db_xref="InterPro:IPR005094"
FT                   /db_xref="UniProtKB/TrEMBL:B2UGC0"
FT                   /protein_id="ACD25607.1"
FT                   /translation="MIVRIFNSGTSGGESPVRYLLSDTDHAGEKRSVEPEVLSGSPDLT
FT                   IATINTITRKHKYVSGAIAFRDQERPSREQIMDIIGRFKQTVCPGLDARHYNSLFVLHR
FT                   DKGNTEIHFVVPSLELTTGRRLSIHPPGPRNIALYDAFTKVTNHEFGYDQVIVDPLKLA
FT                   LSDFERKVPEGQRDRSNKLHLHKHLARSIRRGEITNRDQLCQHLEEQFGVVVTRKGADY
FT                   MSVKFPGSQQAKRMRGPLYRADADYAQLLEQYRRPPPAKLTAAEYRQHKSVLAKLVAER
FT                   KLFFAAAYLQPRQLRAHKARAALRPRPMRDRRPPSHNHKETKTMHPELNAIKRIASDAL
FT                   SVARQIRAERPVFTPANRAVVASRIQRLRDQAYQPRKTDLSEHAAMDTVHEVENALGEI
FT                   ESDLSAATADVSHAKTPEQRRKAEERVAKLIAQKNRLLQQLAQAKLRQINASAKRWRT"
FT   gene            486839..487147
FT                   /locus_tag="Rpic_0453"
FT   CDS_pept        486839..487147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0453"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25608"
FT                   /db_xref="UniProtKB/TrEMBL:B2UGC1"
FT                   /protein_id="ACD25608.1"
FT                   /translation="MDAHRKTPLTFFQQAIPEPFKNDSNADIGEVFIALIYPEILIRDA
FT                   TGDYIIDCRQDGFYAEADDFPLLNFLEMFPTICDSLIAECTALKQRYERYLTDLQCL"
FT   gene            complement(487120..488115)
FT                   /locus_tag="Rpic_0454"
FT   CDS_pept        complement(487120..488115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0454"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25609"
FT                   /db_xref="GOA:B2UGC2"
FT                   /db_xref="UniProtKB/TrEMBL:B2UGC2"
FT                   /protein_id="ACD25609.1"
FT                   /translation="MDDDFYSPESERKRQQAWREQLLDTQQSWGTLDDQHVAPPTDSSR
FT                   HYWQWIANSEQKRAESSTGSSGINSGGGGGSGGGEFLLGLLLLPLLTVAILPTALVWHY
FT                   RKKNWFYLVLTALLFAASAWYFLTKTHGALLDTALGVQVVFGVVYLPFAVTGWICHRLN
FT                   DRIAKGAPFNFGAWSWIVLFSLAISFETLFFLWIEGFHWGADLVRFVGNSIVFFGGKTY
FT                   ISLSNYNDSATMLLAAFPNAVALSVLQAWFRKRQAQGKRAIPWLLYLPVVWVVGMALFL
FT                   GFVITVNHLQRNSHASAMTPENQLAQAAAQPSLPSHARCAQHHKHCKSVR"
FT   gene            complement(488148..489248)
FT                   /locus_tag="Rpic_0455"
FT   CDS_pept        complement(488148..489248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0455"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25610"
FT                   /db_xref="GOA:B2UGC3"
FT                   /db_xref="UniProtKB/TrEMBL:B2UGC3"
FT                   /protein_id="ACD25610.1"
FT                   /translation="MDERAASNTQPSGDSTVRSALRLSSDWVSPINATVFTSTLILDLL
FT                   APLFGRATSRLAAVAGAACILLLLITMIRLERRRTEQQPIRSRLDFYARSRKLWLATTC
FT                   CMGGFALAFATFSHADAPNPSAIGSAVPAIGQLQQSLAALHAKVDVVAQRTSDIQDDTQ
FT                   AIRRAVDPQDDRGRLTRLGYGLDDESKARAIEACDIDATTLYAHLNETMPLALPVFGKR
FT                   GGSTLEAPILAKNEHFAEMLRILSDDPKFDKAALSTAFPLTFTQAQTRSIPAMDGLLAK
FT                   ARRRGLRTVGLLPSMVKASPLIVAIWSGNADAATALLNAGANADAPAIEVIVPVMDHGN
FT                   PALKNVSISTAREEAQRMKWTVPGLE"
FT   gene            complement(489269..489790)
FT                   /locus_tag="Rpic_0456"
FT   CDS_pept        complement(489269..489790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0456"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25611"
FT                   /db_xref="GOA:B2UGC4"
FT                   /db_xref="UniProtKB/TrEMBL:B2UGC4"
FT                   /protein_id="ACD25611.1"
FT                   /translation="MESTFKRQYEKETLPDGSIKLTYKGSRHGAHFKAAMLVFNTGIVL
FT                   FGWLISFLVIGAIAKDFTVGMVAGILLMGGVVFLYRKLFSKTTSITVRPEGIIFNKRGK
FT                   TVFGGGEGRLAFRDVSGFGIATETASRNAEYTESSYIYANAGGQQISVTCHITRALAEA
FT                   LLAEIHQVAA"
FT   gene            complement(489855..490532)
FT                   /locus_tag="Rpic_0457"
FT   CDS_pept        complement(489855..490532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0457"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ajs:Ajs_3592 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25612"
FT                   /db_xref="UniProtKB/TrEMBL:B2UGC5"
FT                   /protein_id="ACD25612.1"
FT                   /translation="MRHSYRAAVLAAACTMLTACAGLPQQMDQVADNLRQLGQSVSSPL
FT                   VPSGPSAFSQSGLANVFKGTDPASKWPRVALTIDNMPADAQNNWFEWRAAPVPAASVAV
FT                   APANYCITISAVVWKSEKSSQRFDHIPYCGRDAKVRDITDDYTFMLLGWAQMPKNGGKN
FT                   TGASRTFGPNPPLKSFPSRSIIIDTANSRASFMFAHLLMSMGLDLTVDYLHENRLWVVS
FT                   TVQ"
FT   sig_peptide     complement(490467..490532)
FT                   /locus_tag="Rpic_0457"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.983 at
FT                   residue 22"
FT   gene            complement(490598..491809)
FT                   /locus_tag="Rpic_0458"
FT   CDS_pept        complement(490598..491809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0458"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bmu:Bmul_4115 outer membrane autotransporter
FT                   barrel domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25613"
FT                   /db_xref="UniProtKB/TrEMBL:B2UGC6"
FT                   /protein_id="ACD25613.1"
FT                   /translation="MKTILAYKKRALSIQNIVALSTVAIALAACGGGSDGSGSSNTSTS
FT                   GGSTTTTPQQDAVSQSSTALVAQTGATAVPGTTSTAQAFDLTADIGDTWRLVLNQDGSF
FT                   TIKVLSTQYGLTDISGTYTQSTSGSFTTYTGTSANGSFTLKLDTRTHIMGGNVVLRTRS
FT                   SSVAGSGYSVPANTATLAGDYFYIGATRNASDGGSPSFLGGTFRVAANGTDVTWCDSGL
FT                   INASGTCNAVAGSSSPSQQFAFKLVKNTTDGLTHVQGSGSDLGILSFQAGDRGPVLVID
FT                   RFGYSQSATPVLRTGVIYASKQQVLAGTELNGSWTCTDRGTTIGTVTINGTTVKTADTS
FT                   GVSTAETLYFNDISTNTGLVAVNGAATSVVNGQAPSSGVILLPLSSSMFVVERDAAQSV
FT                   ATCR"
FT   sig_peptide     complement(491714..491809)
FT                   /locus_tag="Rpic_0458"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.436 at
FT                   residue 32"
FT   gene            491925..492170
FT                   /locus_tag="Rpic_0459"
FT   CDS_pept        491925..492170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0459"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   ppg:PputGB1_4174 transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25614"
FT                   /db_xref="GOA:B2UGC7"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B2UGC7"
FT                   /protein_id="ACD25614.1"
FT                   /translation="MPRVSFKTDRDGQLALIGAAVRARRKAIPLSQEALADLAEIDRSH
FT                   MGKIERGERNVTMLNVLRIAQALGCQPSELLADAGL"
FT   gene            complement(492274..493035)
FT                   /locus_tag="Rpic_0460"
FT   CDS_pept        complement(492274..493035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0460"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="PFAM: regulatory protein LuxR; Autoinducer-binding
FT                   domain protein; KEGG: nmu:Nmul_A2417 transcriptional
FT                   regulator, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25615"
FT                   /db_xref="GOA:B2UGC8"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR005143"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036693"
FT                   /db_xref="UniProtKB/TrEMBL:B2UGC8"
FT                   /protein_id="ACD25615.1"
FT                   /translation="MVSPLYTFEGLLTAGSHAEIAAFMERHAGNLGYGRFFYSPLLVAG
FT                   DARHFFKDDHNVVAAEMLYTKNIFSTYPASWIRRYQEAGHVAADPVVKLITTSNLPIHW
FT                   DADDLQAARSPVFDEAREHGLATGITIPINGFDHTRALFSVTSDQAPERSQRHTDAISG
FT                   LAVLTALHLHEAVRRLDASMSNAPIPSLTSREKECLQWAAAGKTSWEIARILSVSERTV
FT                   IFHIGNATKKLGATNRRQAVARAISLRLIAP"
FT   gene            complement(493040..493639)
FT                   /locus_tag="Rpic_0461"
FT   CDS_pept        complement(493040..493639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0461"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25616"
FT                   /db_xref="UniProtKB/TrEMBL:B2UGC9"
FT                   /protein_id="ACD25616.1"
FT                   /translation="MDFENRIKKEMTEGIVKAILEDAGYRVIDSGIEKVIRELSCMSSF
FT                   EYAKLAYPDAMSRLPDFTVMTKDQDDKFLVEVKYRSKWGKDLFEEIRPQVEIFGELVLV
FT                   SINADPPNHKGLYYPSTYLRCCRVRYQDEKYSVQLKYEDDQVWRHYWKAVDELKEDSLW
FT                   WAMSQLDKVFPLLKDRKLDAQNSLDSAIKALSGILK"
FT   gene            complement(493734..495053)
FT                   /locus_tag="Rpic_0462"
FT   CDS_pept        complement(493734..495053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0462"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG: bmu:Bmul_0646
FT                   integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25617"
FT                   /db_xref="GOA:B2UGD0"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:B2UGD0"
FT                   /protein_id="ACD25617.1"
FT                   /translation="MHKIPRLLRSRHGVYYLRLTHGKTDTRRSLGTKDFQRAKLSALLL
FT                   NVHVEMSKSRLDAEMFRHLDIALPNGVKLTNIQPEDKGILFDILDKLGVTGEQLAAMPT
FT                   TEVARLLAGPEPQRMEPPKPKSKPLSDVIALYLTEKKLDNVAKTLEDKERTFTEFQGFF
FT                   QDSDINAFDADTAIAYKNRLLAANASASRINAKTSFLRDLFAYAINNNLYFTTNPFEKV
FT                   RVSSKTKLKQQVESYREFTDDDLKLIFAEAPYREFMNKPDYHWLPLLALYTGARVEELA
FT                   SLSLNQIKKDGGIHYFEIEKAKNLNSIRKIPLHRQIETSGFLAYVDSVRAQGATMLFPH
FT                   LTAGKNGYSKNMSRRFGAYLDSLKISDSRKVFHSFRHTFITRMTELNVHPVLVMSMVGH
FT                   YAQAKVDLSAPHVVNYQHEKPLSVLKQTIDRLEFPIKHFW"
FT   gene            complement(495138..495214)
FT                   /locus_tag="Rpic_R0002"
FT                   /note="tRNA-Met5"
FT   tRNA            complement(495138..495214)
FT                   /locus_tag="Rpic_R0002"
FT                   /product="tRNA-Met"
FT   gene            complement(495263..496966)
FT                   /locus_tag="Rpic_0463"
FT   CDS_pept        complement(495263..496966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0463"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1; KEGG: rso:RSc0547 putative
FT                   sugar transporter transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25618"
FT                   /db_xref="GOA:B2UGD1"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2UGD1"
FT                   /protein_id="ACD25618.1"
FT                   /translation="MATVQSAPNAPVGRVQPAPMTREEKKVIFASSLGTVFEWYDFYLY
FT                   GSLAAIIAKQFFSGLDPTAGFIFALLAFAAGFLVRPFGALVFGRLGDMIGRKYTFLVTI
FT                   VIMGTSTFIVGLLPSYGTIGVAAPVILIALRMLQGLALGGEYGGAATYVAEHAPHGRRG
FT                   AYTSWIQTTATLGLFLSLVVILAVRELTGKAFDDWGWRIPFLVSILLLATSVYIRLSMS
FT                   ESPAFQKMKAEGKTSKAPLTEAFGQWRNLKIVILALLGLTAGQAVVWYTGQFYALFFLT
FT                   QVLKVDAFTANVLIAVALAIGTPFFVFFGSLSDRIGRKKIIMAGCLLAVLTYFPLFKAL
FT                   THYANPALERAQQTAQITITVDPKECSFQGSPIAREVDFRSSCDIAKRTLAQSSASYET
FT                   VEGPAGTVASVSIAGKQITSLNATRTADGQNFDADSKAKIADFKKQVSESLKAANYPAK
FT                   ADPAQMNTIMVLVILVILVIYVTMVYGPIAAMLVEMFPTRIRYSSMSLPYHIGNGWFGG
FT                   LLPTISFALVAQNGNIYHGLWYPIWIAAITFVIGVLFVRETKDVDIYRND"
FT   gene            497479..497787
FT                   /locus_tag="Rpic_0464"
FT   CDS_pept        497479..497787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0464"
FT                   /product="protein of unknown function DUF485"
FT                   /note="PFAM: protein of unknown function DUF485; KEGG:
FT                   bur:Bcep18194_B1981 protein of unknown function DUF485"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25619"
FT                   /db_xref="GOA:B2UGD2"
FT                   /db_xref="InterPro:IPR007436"
FT                   /db_xref="UniProtKB/TrEMBL:B2UGD2"
FT                   /protein_id="ACD25619.1"
FT                   /translation="MQDGLVGKIEAHPKYAQLKQRRNRLGLVLTVLMLAVYYGYIALIA
FT                   FDKAFLAKPVGTGVMSVGMPVGMAVIIFTVVITGIYVRRANSEYDQLTQDILKDVAK"
FT   gene            497784..499514
FT                   /locus_tag="Rpic_0465"
FT   CDS_pept        497784..499514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0465"
FT                   /product="SSS sodium solute transporter superfamily"
FT                   /note="TIGRFAM: SSS sodium solute transporter superfamily;
FT                   PFAM: Na+/solute symporter; KEGG: bur:Bcep18194_B1980
FT                   Na+/solute symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25620"
FT                   /db_xref="GOA:B2UGD3"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR018212"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:B2UGD3"
FT                   /protein_id="ACD25620.1"
FT                   /translation="MKKMLSILLVALLAAGACGAALAAGGDVGQTAKQETNTTAIVLFA
FT                   LFVAGTLWITKWAAKRTRSAADFYTAGGGITGFQNGLAISGDYMSAASFLGISAAVMTS
FT                   GYDGLIYSIGFLVGWPIITFLMAERLRNLGKFTFADVAGYRFEQGPIRSFAAVGTLVVV
FT                   AFYLIAQMVGAGQLIKLLFGLDYWIAVVIVGALMMVYVLFGGMTATTWVQIIKACMLLA
FT                   GVTFMAIMVLAQYGFSLEALFAKAVQVKTAIAANAGKSPDEAAKIGLSVMAPGGFIKDP
FT                   ISAISFGMALMFGTAGLPHILMRFFTVPDAKEARKSVFWATTWIGYFYILIFIIGFGAI
FT                   TLVLTNPELSDVAKGVIKGGAGTANMAAVLVAKTVGGDVFYGFISAVAFATILAVVAGL
FT                   TLSGASAVSHDLYATVFKHGKANSADELKVSRITTLVLGVIAVLLGIAFEKQNIAFMVS
FT                   LAFAVAASANFPVLFLSMLWKGCTTRGAVIGGFLGLISSVGLTIVSPSVWEATLGYPKG
FT                   SAWFPYTSPALFSMTIGFVGVWLFSVLDSSVRAKNEKASFAAQQVRSETGLGAAGASGH
FT                   "
FT   sig_peptide     497784..497855
FT                   /locus_tag="Rpic_0465"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.994 at
FT                   residue 24"
FT   gene            499579..501405
FT                   /locus_tag="Rpic_0466"
FT   CDS_pept        499579..501405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0466"
FT                   /product="putative CBS domain and cyclic
FT                   nucleotide-regulated nucleotidyltransferase"
FT                   /note="PFAM: cyclic nucleotide-binding; CBS domain
FT                   containing protein; protein of unknown function DUF294
FT                   nucleotidyltransferase putative; KEGG: pna:Pnap_0480 cyclic
FT                   nucleotide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25621"
FT                   /db_xref="GOA:B2UGD4"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR005105"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR018821"
FT                   /db_xref="UniProtKB/TrEMBL:B2UGD4"
FT                   /protein_id="ACD25621.1"
FT                   /translation="MPSAFNFAVWPFDCLNQDEQRLVRDAVDIGYYPQGQSILDTGAAP
FT                   QHLFLIIKGHVAQYDGEELIASYGPDDCFDGRALVAGKASSRFVAAEEVVAYQVARQAV
FT                   RDLIAANATFGALLFSDLGSKLSAIAQRQSMETMQSLAVSHVSDAFIRPAHFVDADTDV
FT                   VSVVKLFQAQSTSNVLVRDGTASPPRVGIFTRSSLQRAVLQGTPLDRLPVGRMSQFSLI
FT                   TVPASAQIGDALTLMLRHRVHRLVVTRGDEILGLLESLDVFSFLANHSYLLTVQINLAQ
FT                   DLDALAQVAAQITRMVALLTRGGSRIDHVASLVREINACLFERAWQMIAPPELVENSCL
FT                   FVMGSEGRGEQLLKTDQDNALVLRDGYVPPPDLQRIVTRFSDALAAFGYPPCPGGIMLS
FT                   RPEWCMTASDFARRIREWLILPSPEGLMHLAIFFDAHAVCGDAALLKQLRRTLLELTID
FT                   NDAVLGRFAAAVEAFSAAPGWRDRLLGFGDPDPVLDVKKEGIFPIVHGVRSLALAHHIL
FT                   DETGTVPRLNALVRAEALDAHMAAELSESLHFLMTLRLKAGLAEIDAHQPVSCDVHLSR
FT                   LSSLERDLLKDALSAVKRFKALLRQRWRTEWM"
FT   gene            501422..502072
FT                   /locus_tag="Rpic_0467"
FT   CDS_pept        501422..502072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0467"
FT                   /product="Exonuclease RNase T and DNA polymerase III"
FT                   /note="PFAM: Exonuclease RNase T and DNA polymerase III;
FT                   SMART: Exonuclease; KEGG: dac:Daci_5959 exonuclease RNase T
FT                   and DNA polymerase III"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25622"
FT                   /db_xref="GOA:B2UGD5"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B2UGD5"
FT                   /protein_id="ACD25622.1"
FT                   /translation="MSGRLSDWLRALQRRRLLRRLRDPAFRFLFEVPPPDEWVALDCET
FT                   TGLDVRTDEIISIGAVRIVGNRILTSQRLELLIRPQGEMRPESICVHRLRNRDLDSGVS
FT                   IEQAVHTLLHFIGSRPLVGYYLEFDVAMLNRVVVPMLGIGLPQPKIEVSALYYDHQFAL
FT                   LPPYRQQGDPDLDLRFATVMKELDLPTWDAHDALNDAVMAALAFVKLRHLGEA"
FT   gene            complement(502081..502395)
FT                   /locus_tag="Rpic_0468"
FT   CDS_pept        complement(502081..502395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0468"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RSc0548 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25623"
FT                   /db_xref="GOA:B2UGD6"
FT                   /db_xref="InterPro:IPR019886"
FT                   /db_xref="UniProtKB/TrEMBL:B2UGD6"
FT                   /protein_id="ACD25623.1"
FT                   /translation="MSITPGTPARRRWIANMRWIAALLAVWFVVTFVVAFFARDLSQHF
FT                   FNSDWTFAYWVGAQGAPIVYVLITVLYAWRTNRAADAAAQHDEAAQRDPSESSHLPPSI
FT                   "
FT   gene            complement(502392..503987)
FT                   /locus_tag="Rpic_0469"
FT   CDS_pept        complement(502392..503987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0469"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; Two-component sensor kinase domain
FT                   protein; KEGG: rso:RSc0549 probable transmembrane sensor
FT                   histidine kinase transcription regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25624"
FT                   /db_xref="GOA:B2UGD7"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013727"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B2UGD7"
FT                   /protein_id="ACD25624.1"
FT                   /translation="MGDRLAWPWRRHRASLRERTDAVPGADGRDGRDGRDGRDGGGDLA
FT                   DTLPHLEDDATRPAARSLFGEILDWMLAPLLLLWPMSIAVTYLVAKSIANAPYDRALES
FT                   SAIVLSQQLREVNGRVTLQLPISAREILRADETDNIYYQVLGTNGEFVSGDRDLPLPPE
FT                   EDANAGGLVQLRDDHIHGAEIRVAYTFVQRPGSGGKPALVQVAETLDKRAQLANEIIKG
FT                   VILPQFVILPLAVILVWFGLSRGLAPLNAIQERIRARNPGDTSPIDEGAAPQELTPLVA
FT                   SFNDLLGRLEQSVHTQKRFIADAAHQMKTPLAGLRMQAELAQREQSPDELRRTLAHIAD
FT                   SSDRTAHLVKQLLSLARMENMGATDGMVPLDICALSRRVVADWLPKAWAKQIDLGFEEP
FT                   GPPVTISGNATMLAEMLNNLLDNAIRYTPDGGHVTVRVTTAPFEPFVFIDVDDTGPGIP
FT                   VAERERVMQRFYRILGTQAEGSGLGLAIVREIVQQHGGDIEVLDNVYQVSPRLAGARFR
FT                   ITLHRCSPSEEPNA"
FT   gene            complement(503980..504690)
FT                   /locus_tag="Rpic_0470"
FT   CDS_pept        complement(503980..504690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0470"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: rso:RSc0550 probable
FT                   response regulator transcription regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25625"
FT                   /db_xref="GOA:B2UGD8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B2UGD8"
FT                   /protein_id="ACD25625.1"
FT                   /translation="MRILIAEDDATLADGLTRSLRQAGYAVDQASDGATADAALSAQTA
FT                   QTYDLLILDVGLPRMSGLEVLKRLRSRGAMLPVLILTAADSVEERVKGLDLGADDYMAK
FT                   PFALSELEARVRALVRRGTGGGATLVRHGPLAFDQVGRIAYIHDQVVELSAREIGLLEI
FT                   LLARVGRLVSKEQLVDHLCGWGEEVSNNAIEVYIHRLRKKIEVEGIRIATVRGLGYCLE
FT                   RTATPTTTATAAHG"
FT   gene            504956..506014
FT                   /locus_tag="Rpic_0471"
FT   CDS_pept        504956..506014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0471"
FT                   /product="recA protein"
FT                   /EC_number="3.6.3.8"
FT                   /note="KEGG: rso:RSc0551 recombinase A; TIGRFAM: recA
FT                   protein; PFAM: RecA domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25626"
FT                   /db_xref="GOA:B2UGD9"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013765"
FT                   /db_xref="InterPro:IPR020584"
FT                   /db_xref="InterPro:IPR020587"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR023400"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2UGD9"
FT                   /protein_id="ACD25626.1"
FT                   /translation="MEDGKKAATMSAEKQKALAAALAQIEKQFGKGSIMKMGDAEVEPV
FT                   QVVSTGSLGLDVALGVGGLPRGRVIEIYGPESSGKTTLTLQVVAEMQKLGGTCAFIDAE
FT                   HALDVTYADKIGVSVPDLLISQPDTGEQALEIADALVRSGSVDLIVIDSVAALVPKAEI
FT                   EGEMGDALPGLQARLMSQALRKLTGTIKKTNCMVIFINQIRMKIGVMFGSPETTTGGNA
FT                   LKFYASVRLDIRRIGSIKRGDDVVGNETKVKVVKNKVAPPFREAIFDILYGQGVSREGE
FT                   IIDLGVEAKVVEKSGAWYSYGGERIGQGRDNCREYLRENPDLAREIENKVREQLGVTPM
FT                   GAVAVAEEVGEE"
FT   gene            506125..506604
FT                   /locus_tag="Rpic_0472"
FT   CDS_pept        506125..506604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0472"
FT                   /product="regulatory protein RecX"
FT                   /note="PFAM: regulatory protein RecX; KEGG: rso:RSc0552
FT                   recombination regulator RecX"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25627"
FT                   /db_xref="GOA:B2UGE0"
FT                   /db_xref="InterPro:IPR003783"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2UGE0"
FT                   /protein_id="ACD25627.1"
FT                   /translation="MPLPRQPLSLKARALGYLSRREHSRVELRRKLVPHAESAEEVDAL
FT                   LDWLEGENWLSNTRFAESMVHRRAGRYGTARLMQELKTHQLGEETLGEVKAQLQSTEAV
FT                   RAKALWEKRFGRPPADLAERAKQVRYMMARGFSRSVVSRIIAGADELLEDGDMSD"
FT   gene            506891..507517
FT                   /locus_tag="Rpic_0473"
FT   CDS_pept        506891..507517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0473"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RSc0553 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25628"
FT                   /db_xref="InterPro:IPR021312"
FT                   /db_xref="UniProtKB/TrEMBL:B2UGE1"
FT                   /protein_id="ACD25628.1"
FT                   /translation="MPLSAPLPRAMRHRRAITVEAYLREDGLWDIEARLTDIKPRDIPL
FT                   ASGGVRPEGEPLHDLWLRVTIDTRMNVVDAEACSDWVPYPTHCDTIGPAYRKLIGLNLM
FT                   KGFRKASRERLGGVAGCTHLTELCGVLPTAAIQAFAGDVFPVRDNANDLRPIEPGEKPP
FT                   YQLHGCHALHLEGEVVRKHYPRWFAYQPEAKIQPPPTELSPEPSS"
FT   gene            507584..508750
FT                   /locus_tag="Rpic_0474"
FT   CDS_pept        507584..508750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0474"
FT                   /product="succinyl-CoA synthetase, beta subunit"
FT                   /EC_number="6.2.1.5"
FT                   /note="KEGG: rso:RSc0554 succinyl-CoA synthetase subunit
FT                   beta; TIGRFAM: succinyl-CoA synthetase, beta subunit; PFAM:
FT                   ATP-citrate lyase/succinyl-CoA ligase; ATP-grasp domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25629"
FT                   /db_xref="GOA:B2UGE2"
FT                   /db_xref="InterPro:IPR005809"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013650"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017866"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2UGE2"
FT                   /protein_id="ACD25629.1"
FT                   /translation="MNIHEYQGKEILRKYNVPVPRGIPAFSVDEAIKAAETLGGPVWVV
FT                   KAQIHAGGRGKGGGVKVAKSIEQVKEYASSILGMTLVTHQTGPEGKLVKRLLIEEGADI
FT                   KKELYVSLVVDRVSQQVALMASSEGGMDIEEVAESHPEKIHTLLIDPQAGLQDAQADDI
FT                   ARKIGVPDASVPQARQALQGLYKAFWETDASQAEINPLILTGDGKVIALDAKFNFDSNA
FT                   LFRHPEIVAYRDLDEEDPAEIEASKFDLAYISLDGNIGCLVNGAGLAMATMDTIKLFGG
FT                   EPANFLDVGGGATTEKVTEAFKLMLKNPDVKAILVNIFGGIMRCDVIAEGVIAAAKAVS
FT                   LSVPLVVRMKGTNEDLGKKMLADSGLPIIAADTMAEAAEKVVAAAAGK"
FT   gene            508839..509720
FT                   /locus_tag="Rpic_0475"
FT   CDS_pept        508839..509720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0475"
FT                   /product="succinyl-CoA synthetase, alpha subunit"
FT                   /note="TIGRFAM: succinyl-CoA synthetase, alpha subunit;
FT                   PFAM: CoA-binding domain protein; ATP-citrate
FT                   lyase/succinyl-CoA ligase; KEGG: rme:Rmet_0470 succinyl-CoA
FT                   synthetase subunit alpha"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25630"
FT                   /db_xref="GOA:B2UGE3"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR005810"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017440"
FT                   /db_xref="InterPro:IPR033847"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2UGE3"
FT                   /protein_id="ACD25630.1"
FT                   /translation="MSILINKDTKVITQGITGKTGQFHTRGCRDYANGKNAFVAGVNPK
FT                   KAGEDFEGIPIYATVKDAKAQTGATVSVIYVPPAGAADAIWEAVEAELDLVVCITEGIP
FT                   VRDMMMVKDKMRKAGSKTLLLGPNCPGLITPDEIKIGIMPGHIHRKGRIGVVSRSGTLT
FT                   YEAVGQLTALGLGQSSAVGIGGDPINGLKHIDVMKMFNDDPETDAVVMIGEIGGPDEAN
FT                   AAYWIKDNMKKPVVGFIAGVTAPPGKRMGHAGALISGGADTAQAKLDIMEECGIKTTKN
FT                   PSEMARLLKAML"
FT   gene            509874..510569
FT                   /locus_tag="Rpic_0476"
FT   CDS_pept        509874..510569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0476"
FT                   /product="Integral membrane protein TerC"
FT                   /note="PFAM: Integral membrane protein TerC; KEGG:
FT                   rso:RSc0556 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25631"
FT                   /db_xref="GOA:B2UGE4"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="InterPro:IPR022301"
FT                   /db_xref="UniProtKB/TrEMBL:B2UGE4"
FT                   /protein_id="ACD25631.1"
FT                   /translation="MALTSSAFWFALGSIILTNIVLSGDNAVVIALAARNLPKRQQKQA
FT                   IFWGSAGAIVLRVVLTVLAVKLLALPYLKTIGALLLVYIGVKLLTEAEDEASDRHQQGG
FT                   LWPAIQTILIADFVMSLDNVVAVAAAAEKGPPGTTFLLLVLGLGLSVPLIVFGSTLLVG
FT                   VMARFPVIITLGAALLGYLAGDMLVTDPIDAAWFERAVPYADVVVGCVGALLVVCVGWW
FT                   LSRRTLRQA"
FT   sig_peptide     509874..509945
FT                   /locus_tag="Rpic_0476"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.744) with cleavage site probability 0.709 at
FT                   residue 24"
FT   gene            510755..511276
FT                   /locus_tag="Rpic_0477"
FT   CDS_pept        510755..511276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0477"
FT                   /product="putative type 4 fimbrial pilin signal peptide
FT                   protein"
FT                   /note="KEGG: rso:RSc0557 probable type 4 fimbrial pilin
FT                   signal peptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25632"
FT                   /db_xref="GOA:B2UGE5"
FT                   /db_xref="InterPro:IPR001082"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:B2UGE5"
FT                   /protein_id="ACD25632.1"
FT                   /translation="MVFKHSKGIKRRAGGFTLIELMIVVAIVGILAALAIPAYQDYTIR
FT                   SRVTEGLIIAVQAKALVVENAANAQSSLSLGAASLSATRNVASLDIDGSSGEISIGFTS
FT                   SVAGAGSNTLILTPYSGTASSTYANLSAGSAPPAVVMWACSANGKQMPPNVNRTGTPTL
FT                   DARYAPAECR"
FT   sig_peptide     510755..510862
FT                   /locus_tag="Rpic_0477"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.709) with cleavage site probability 0.550 at
FT                   residue 36"
FT   gene            511529..512038
FT                   /locus_tag="Rpic_0478"
FT   CDS_pept        511529..512038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0478"
FT                   /product="type 4 fimbrial pilin signal peptide protein"
FT                   /note="KEGG: rso:RSc0558 type 4 fimbrial pilin signal
FT                   peptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25633"
FT                   /db_xref="GOA:B2UGE6"
FT                   /db_xref="InterPro:IPR001082"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:B2UGE6"
FT                   /protein_id="ACD25633.1"
FT                   /translation="MKSMRRLNKRVQKGFTLIELMIVVAIVGILAAIAIPAYQDYTIRA
FT                   RVTEGLSLAAAAKVLVAENAANAQSDLSAGSTVFAATKNVNNLVVSGTDGHITITYGSA
FT                   VSTSNPTLTLTPYFTVGSTNSNLAQSSAPAAPVQWKCASASATAPTGVTVTLGSLPAKW
FT                   APAECR"
FT   sig_peptide     511529..511633
FT                   /locus_tag="Rpic_0478"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.972) with cleavage site probability 0.542 at
FT                   residue 35"
FT   gene            512110..513846
FT                   /locus_tag="Rpic_0479"
FT   CDS_pept        512110..513846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0479"
FT                   /product="O-antigen polymerase"
FT                   /note="PFAM: O-antigen polymerase; KEGG: rso:RSc0559
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25634"
FT                   /db_xref="GOA:B2UGE7"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="InterPro:IPR021797"
FT                   /db_xref="InterPro:IPR031726"
FT                   /db_xref="UniProtKB/TrEMBL:B2UGE7"
FT                   /protein_id="ACD25634.1"
FT                   /translation="MPQSRFLLWPLWFFAAVCFSAPFLVAPHTYPIPTFYAESASAWCW
FT                   IAFSLVVLGLSWRGRASSPSIALAPLALIVVLIVQLGIATPLNPFFSFAACICLLAAMV
FT                   VCGLGARCREMPGVLEAVAVGTILGGLATVAVEQVHLWRLVGIPDILIGLPPTGLGRRM
FT                   WGNLNQPNHVASYFAFGLAACLFLWQRVRSLGLRILLGIVVLAFLFGTALSVSRVAWLH
FT                   LIAVGLFAGWSWASQTTGRRRWFVFVTPVLALTIAYQLCNWLMDYGNVLWQWGLPTSLG
FT                   ERMQQGAGLRPLLWNHAWHMFIAHPWLGAGWGDYAWNQYVQTDVLGHVEMSMNAHNIVL
FT                   DLLAKVGLAGLFAVVLPAVGLISLLWKFRMTPPAAFLWSVVAVLTIHSMLEYPLYYLYF
FT                   LLPFAFALGYLDTRMLRFPSPSMTWVLSGVIVVCVSALSARMWIDYKSVERLYYAPAGL
FT                   SKELPVYQASGQMLLVPYATLAIAINSGITYEMAAVMAALERQATQFYPGAATSQRYAL
FT                   TLAFQGKTEEAVTQVRRLHNQYWTDYAAQSSLLTQSCLQKADDLKVFCDRLKSEGLLVG
FT                   VN"
FT   sig_peptide     512110..512172
FT                   /locus_tag="Rpic_0479"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.803) with cleavage site probability 0.683 at
FT                   residue 21"
FT   gene            514033..514557
FT                   /locus_tag="Rpic_0480"
FT   CDS_pept        514033..514557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0480"
FT                   /product="pilin subfamily protein"
FT                   /note="KEGG: bte:BTH_I0649 pilin (bacterial filament)
FT                   subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25635"
FT                   /db_xref="GOA:B2UGE8"
FT                   /db_xref="InterPro:IPR001082"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:B2UGE8"
FT                   /protein_id="ACD25635.1"
FT                   /translation="MQLHYQYNGRHQRGFTLIELMIVVAIVGILAAIAVPAYQDYVTRA
FT                   RVSEGLALAASAKTTVAENASAGVPFDEGFAADTKATRYVQAKGIVISQKTGEIQIKYT
FT                   DSVAKDGENVLLLKPTTYDEAMSGSSASSVRPTGPIRWDCYAKGAAVRAGTAELETKPS
FT                   LATNVAPAECR"
FT   gene            complement(514604..515080)
FT                   /locus_tag="Rpic_0481"
FT   CDS_pept        complement(514604..515080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0481"
FT                   /product="molybdenum cofactor biosynthesis protein C"
FT                   /note="TIGRFAM: molybdenum cofactor biosynthesis protein C;
FT                   PFAM: molybdopterin cofactor biosynthesis MoaC region;
FT                   KEGG: rso:RSc0560 molybdenum cofactor biosynthesis protein
FT                   C"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25636"
FT                   /db_xref="GOA:B2UGE9"
FT                   /db_xref="InterPro:IPR002820"
FT                   /db_xref="InterPro:IPR023045"
FT                   /db_xref="InterPro:IPR036522"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2UGE9"
FT                   /protein_id="ACD25636.1"
FT                   /translation="MSQLTHFDSAGQAHMVDVGDKAVTHRVAVATGTIRMLPETFALVR
FT                   DGNAKKGDVLGIARVAAIQGSKRTSDLIPLCHPLALTKVAVEFELNEAGHSVRCTVRAE
FT                   TRGQTGVEMEALTAVQVGLLTIYDMCKAVDRGMVIGDVRLMEKRGGKSGDWVAD"
FT   gene            515186..516895
FT                   /locus_tag="Rpic_0482"
FT   CDS_pept        515186..516895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0482"
FT                   /product="peptidase M48 Ste24p"
FT                   /note="PFAM: peptidase M48 Ste24p; Tetratricopeptide TPR_2
FT                   repeat protein; KEGG: rso:RSc0561 hypothetical signal
FT                   peptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25637"
FT                   /db_xref="GOA:B2UGF0"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:B2UGF0"
FT                   /protein_id="ACD25637.1"
FT                   /translation="MTLSLFRPRVRKLTAAVLLSTWLAPLPLPVLAQAVAVASSPPASV
FT                   NPGLGSAAAADQVQSNLNRSVQIGRQSPYLPKEPTVIDAPTYELPDMGDPSTASLSPEM
FT                   ERRLGDRVMRQIRRDPDFVPDPLITDYLNTIGYKLIEAARRQHVAGSTSASSFELFAVR
FT                   DPGINAFALPGGYIGVNTGTLVATDSESELASVLGHEIGHVLQRHIARGIDKSGESMWI
FT                   ALASILLAGLAATKSGDAAQALAMGGQAAAVSNQLAFSRGAEREADRVGFTLLTGAGYN
FT                   PDGMPDFFRRLQRVTNIADTGVIPGYARTHPLTGERIADMEDRARGLPHPRQPRRPEFG
FT                   FAKVRARVLQETSTSAYIDVRNAMRSQLSSTPDAPVEKRAALWYGVAVANQMAGRLDDA
FT                   EQALQEARRLYGNIPGITSGSVELDVTAIELARARNRAPEALTLARAALAAYPLSRAVG
FT                   ITYAQTLLSAGRTDDAIPYLKDKTREDTAQPIWWDMLARAYADKGRRVEQHRALAEKYA
FT                   RDGAWGSAVEQLKLARDAGDADFYTLSEVDARLHQMERQYREEKAEDKALPK"
FT   sig_peptide     515186..515284
FT                   /locus_tag="Rpic_0482"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.945 at
FT                   residue 33"
FT   gene            complement(516916..517497)
FT                   /locus_tag="Rpic_0483"
FT   CDS_pept        complement(516916..517497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0483"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RSc0562 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25638"
FT                   /db_xref="InterPro:IPR021332"
FT                   /db_xref="UniProtKB/TrEMBL:B2UGF1"
FT                   /protein_id="ACD25638.1"
FT                   /translation="MDDIVRQAMAKWPNVPNCFGWLALDRRGQWRMRNEYAQANKLSGE
FT                   PIRHTALIDFIVRNYAHDDTGRWFFQNGPQRVFVELDYTPWVARLSADCAPAAFTTTTG
FT                   AAFSPSGCFVDEHGSVLLSGRVGGCEAEETIAVLHDHDLEPFSSLAQWHADACGAALGT
FT                   LTLGDQAFDIEPIARAEVAKRYGFVARPAE"
FT   gene            complement(517490..518566)
FT                   /locus_tag="Rpic_0484"
FT   CDS_pept        complement(517490..518566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0484"
FT                   /product="alpha/beta hydrolase fold"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: rso:RSc0563
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25639"
FT                   /db_xref="GOA:B2UGF2"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR012020"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B2UGF2"
FT                   /protein_id="ACD25639.1"
FT                   /translation="MTHPSRHATPFELNLGALLAGPFEPHAFRSPWWLIGGNAQTIVPA
FT                   RLWRFPRIAYRRERWDTPDHDFIDLDWTTHETDAHAPLVVMFHGLEGDSRSHYARLLMD
FT                   ALRARRWQGVIPHFRGCSGEMNLAPRMYHCGDGAEIAWILERLYRTVCQPQSRKLLVVG
FT                   ISLGGNALLRYLGEHGTDARYVSAAATVSAPLDMRAGGAALSKGFNMVYTRMFLRTLKD
FT                   KANAKLDQHPGLYDRAAMMATRTLGQFDNLVTAPLHGFRDVLDYWTRASSKPVLREVRV
FT                   PVLVLNARNDPFLPGQHLPGMADVSPDITLDQPLHGGHVGFLLRHGKTGRVDWMPARVL
FT                   RFFDDVLGHQANAEDAHG"
FT   gene            complement(518601..519041)
FT                   /locus_tag="Rpic_0485"
FT   CDS_pept        complement(518601..519041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0485"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RSc0564 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25640"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:B2UGF3"
FT                   /protein_id="ACD25640.1"
FT                   /translation="MPRFARLFEAAEDILEAYRDALKRRDADGALKLWLDEDSVSFILP
FT                   DGQRLHGHEQLRGCLDALVEKNPVWIECLSQQVHSSLGVSIFEATEALRFSATATEADL
FT                   YVHTTYVLMQNHEGWRIAHVHSSQAAEERVAASIASVTHSLH"
FT   gene            complement(519067..520092)
FT                   /locus_tag="Rpic_0486"
FT   CDS_pept        complement(519067..520092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0486"
FT                   /product="lipopolysaccharide heptosyltransferase II"
FT                   /note="TIGRFAM: lipopolysaccharide heptosyltransferase II;
FT                   PFAM: glycosyl transferase family 9; KEGG: rso:RSc0565
FT                   probable ADP-heptose--lipopolysaccharide
FT                   heptosyltransferase II protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25641"
FT                   /db_xref="GOA:B2UGF4"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="InterPro:IPR011910"
FT                   /db_xref="UniProtKB/TrEMBL:B2UGF4"
FT                   /protein_id="ACD25641.1"
FT                   /translation="MMRKILVVAPNWIGDALMAQPLFAQLKARHPRAQIHAIAPKWVAP
FT                   VLARMPEIARVLPTELAHGKLQLGSRTMFAQQLKGETFDAAYVLPNSFKSALIPWLAGI
FT                   PLRIGYKGESRLGVLNVRYPNPPKNARPPMVQHYAALAFKPHAKLPDTLPDPKLDVDVQ
FT                   RVAATSAKFGIPGNARLIAFCPGAEYGPAKRWPAEHFAELAQMLRRSFPYAQIVALGSG
FT                   KDREMANAIVERAPFVRNLCGETSLDEAIELLARAEAAICNDSGLMHVTAALGRPQVAV
FT                   FGSSDPRHTPPLSPAASIMWLHLECSPCFARECPLGHLRCLRDIGPEMVFHELRRLLQP
FT                   Q"
FT   gene            complement(520142..520339)
FT                   /locus_tag="Rpic_0487"
FT   CDS_pept        complement(520142..520339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0487"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RSc0566 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25642"
FT                   /db_xref="InterPro:IPR019401"
FT                   /db_xref="UniProtKB/TrEMBL:B2UGF5"
FT                   /protein_id="ACD25642.1"
FT                   /translation="MTTQTAPTIEIGADDLPLHCPTAKTPAWNYHPRVFLDIADTGEAK
FT                   CPYCGTVYKLAPGVELKGHH"
FT   gene            520667..521461
FT                   /locus_tag="Rpic_0488"
FT   CDS_pept        520667..521461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0488"
FT                   /product="AzlC family protein"
FT                   /note="PFAM: AzlC family protein; KEGG: rso:RSc0568
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25643"
FT                   /db_xref="GOA:B2UGF6"
FT                   /db_xref="InterPro:IPR011606"
FT                   /db_xref="UniProtKB/TrEMBL:B2UGF6"
FT                   /protein_id="ACD25643.1"
FT                   /translation="MALVRWAAALQRRWAAIDPAERAGFFAGVRAYMPSMPPVLAWGLV
FT                   TGVAMSKSVLTIPQAIGMTIFVYAGSSQLAVLPLLAAGLPIWTALLTAFIVNVRFIIFS
FT                   AGLMQHFGHLPFMRRVVLGVFNGDLPFVLFTQQYPSAAPQAGKEGYYWGMVLLSFVGWQ
FT                   VSSILGIVAASLFPDAWGLALAGTLALIPVMVSTIRSRATLMAVAVAAVLALVAFKLPY
FT                   RLSLVIAVTGAMAAGLAADEVAARLQWQRRRAAHVAIDEDDA"
FT   gene            521458..521781
FT                   /locus_tag="Rpic_0489"
FT   CDS_pept        521458..521781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0489"
FT                   /product="branched-chain amino acid transport"
FT                   /note="PFAM: branched-chain amino acid transport; KEGG:
FT                   rso:RSc0569 probable transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25644"
FT                   /db_xref="GOA:B2UGF7"
FT                   /db_xref="InterPro:IPR008407"
FT                   /db_xref="UniProtKB/TrEMBL:B2UGF7"
FT                   /protein_id="ACD25644.1"
FT                   /translation="MSALEIWLVIAGMTVVTIVTRSLFLIVGNRMTLPTRVQHALRFAP
FT                   AAALVAIVLPDLLWNHGHFDASWTNPRLMAGIAATAFYVATRRMLGMIFVGMGVFTVLR
FT                   LWG"
FT   gene            521784..522680
FT                   /locus_tag="Rpic_0490"
FT   CDS_pept        521784..522680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0490"
FT                   /product="RarD protein, DMT superfamily transporter"
FT                   /note="TIGRFAM: RarD protein, DMT superfamily transporter;
FT                   PFAM: protein of unknown function DUF6 transmembrane; KEGG:
FT                   rso:RSc0570 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25645"
FT                   /db_xref="GOA:B2UGF8"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="InterPro:IPR004626"
FT                   /db_xref="UniProtKB/TrEMBL:B2UGF8"
FT                   /protein_id="ACD25645.1"
FT                   /translation="MSASNRNGVIFAFLAYTMWGLFPLYFKLLKAVSPVEILSHRVIWS
FT                   LAVMVVILLAKRHGAWLWALRTQPRVVGRYAVSTSLLAANWLTYIWAVNHDHVLEASLG
FT                   YFINPLVVVMLAALVLGERLRPVQWVSVALAAAGVSWLTWQAGTLPWIALALAFSFGFY
FT                   GLLRKTSPLGALEGLTLETLLLFPLALAYLGWLASQHQNAFLAASPGTQWLLALAGPLT
FT                   ALPLLLFGAGARRIPLSLLGLLQYVSPTLQLLLGVWLYNEPFAGPKVAGYVLIWAGLAV
FT                   YSAESWMQLRRRTPLPA"
FT   gene            522800..524011
FT                   /locus_tag="Rpic_0491"
FT   CDS_pept        522800..524011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0491"
FT                   /product="Phosphoglycerate kinase"
FT                   /EC_number="2.7.2.3"
FT                   /note="PFAM: phosphoglycerate kinase; KEGG: rso:RSc0571
FT                   phosphoglycerate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25646"
FT                   /db_xref="GOA:B2UGF9"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR015911"
FT                   /db_xref="InterPro:IPR036043"
FT                   /db_xref="UniProtKB/TrEMBL:B2UGF9"
FT                   /protein_id="ACD25646.1"
FT                   /translation="MPHVLRLSDLISEGKLAGKRVFIRADLNVPQDDAGNITEDTRIRA
FT                   SVPAVKAALDAGAAVMVTSHLGRPTEGEFKPEDSLAPVAKRLSELLGRDVKLVQNWVDG
FT                   VEVAPGQVVLLENCRVNKGEKKNSDELAQKMAKLCDVYVNDAFGTAHRAEATTHGIAKF
FT                   APIACAGPLLAAELDALGKALGQPARPLVAIVAGSKVSTKLTILKSLADKVDNLIVGGG
FT                   IANTFMLAAGLKIGKSLAEADLVGDAKAIIEMLAARGASVPIPVDVVCAKEFSATAAAT
FT                   VKDVADVADDDMILDIGPKTAAQLAEQLKTAGTIVWNGPVGVFEFDQFGNGTKVLAEAI
FT                   AASSGFSIAGGGDTLAAIAKYNIADKVGYISTGGGAFLEFLEGKTLPAVEILEQRAQNQ
FT                   AAGA"
FT   gene            524061..525500
FT                   /locus_tag="Rpic_0492"
FT   CDS_pept        524061..525500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0492"
FT                   /product="pyruvate kinase"
FT                   /EC_number="2.7.1.40"
FT                   /note="KEGG: rso:RSc0572 pyruvate kinase; TIGRFAM: pyruvate
FT                   kinase; PFAM: Pyruvate kinase barrel; Pyruvate kinase
FT                   alpha/beta"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25647"
FT                   /db_xref="GOA:B2UGG0"
FT                   /db_xref="InterPro:IPR001697"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="InterPro:IPR015793"
FT                   /db_xref="InterPro:IPR015795"
FT                   /db_xref="InterPro:IPR015806"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR036918"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:B2UGG0"
FT                   /protein_id="ACD25647.1"
FT                   /translation="MTRATKIVATLGPASSTQEVLTRMIAAGVDVVRLNFSHGAAQDHI
FT                   DRAKLVREVARSVGREVAIMADLQGPKIRVGKFENGKITLEPGDRFTLDARCELGNQER
FT                   VGLDYKELPRDVGPGDLLLLNDGLIVLQVERVVGEEIETIVKIGGDLSNNKGINRQGGG
FT                   LSAPALTAKDMEDIKTAMALGADYVAVSFPKNATDMEMARQLAAVAGAPHSHKTRMIAK
FT                   IERAEAIRPGVLEEILAASDGIMVARGDLAVEVGNAAVPALQKRMIKLARENNKLAITA
FT                   TQMMESMIVNPVPTRAEVSDVANAVLDGTDAVMLSAETAAGRYPVETIEAMAAICVEAE
FT                   KSQTVHLDADFLDQTFSRIDQSIAMGALFTAHHLQVKAIAALTDSGATALWMSRHGINI
FT                   PIYAMTPNVASQRKMALYRNVQSLPLANSADRDEALHQAEELLVARGVVQRGDFIVLTV
FT                   GEPMGQAGGTNTLKIVRVGMH"
FT   gene            525588..526652
FT                   /locus_tag="Rpic_0493"
FT   CDS_pept        525588..526652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0493"
FT                   /product="fructose-bisphosphate aldolase, class II, Calvin
FT                   cycle subtype"
FT                   /EC_number="4.1.2.13"
FT                   /note="KEGG: rso:RSc0573 fructose-1,6-bisphosphate
FT                   aldolase; TIGRFAM: ketose-bisphosphate aldolase;
FT                   fructose-bisphosphate aldolase, class II, Calvin cycle
FT                   subtype; PFAM: ketose-bisphosphate aldolase class-II"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25648"
FT                   /db_xref="GOA:B2UGG1"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR006412"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B2UGG1"
FT                   /protein_id="ACD25648.1"
FT                   /translation="MPLVSMRQLLDHAAENGYGLPAFNVNNLEQVQAVMEAAKEAGAPV
FT                   ILQASAGARKYAGESFIKHLIQAAVEAYPEIPLVMHQDHGQSPAICQGAIDLGFGSVMM
FT                   DGSLREDGKTPADFDYNVDVTRRVVEMAHKVGVTVEGELGCLGSLETGMAGEEDGHGAE
FT                   GKLDHSSLLTDPEEAAQFVKATQLDALAIAIGTSHGAYKFTRKPTGDILAISRVKEIHA
FT                   RIPNTHLVMHGSSSVPQELLAIINQYGGKMKETYGVPVEEIQEAIKYGVRKINIDTDIR
FT                   LAMTGAVRKFLAENPDKFDAREWLKPAREAAKQICKARYIQFGCEGQAGKIKPIGLSVM
FT                   AQKYQSGDLAQVVQ"
FT   gene            526789..527712
FT                   /locus_tag="Rpic_0494"
FT   CDS_pept        526789..527712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0494"
FT                   /product="phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase"
FT                   /EC_number="6.3.2.6"
FT                   /note="KEGG: rso:RSc0574
FT                   phosphoribosylaminoimidazole-succinocarboxamide synthase;
FT                   TIGRFAM: phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase; PFAM: SAICAR synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25649"
FT                   /db_xref="GOA:B2UGG2"
FT                   /db_xref="InterPro:IPR001636"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="UniProtKB/TrEMBL:B2UGG2"
FT                   /protein_id="ACD25649.1"
FT                   /translation="MSATPASSALYESSITSLPLLGRGKVRENYAVGDDKLLMVTTDRL
FT                   SAFDVILGQPIPDKGRVLAQMSDFWFNKLRHIVPTHETGIAPETVVAPNEVDQVRGRAI
FT                   VVKRLKPILVEAVVRGYLAGSGWKDYQATGAVCGVHLAPGLQNAQKLPEPIFTPAAKAE
FT                   MGEHDENISFDEVERRIGPDLAAQIRDVSIRLYKEASDFAATRGIIIADTKFEFGLDEN
FT                   GTLTLMDEALTADSSRFWPADSYQVGTNPPSFDKQFVRDWLEAVRIDGKPWPKTAPAPQ
FT                   LPADVIEKTADKYREALTRLTGESLR"
FT   gene            527728..528237
FT                   /locus_tag="Rpic_0495"
FT   CDS_pept        527728..528237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0495"
FT                   /product="phosphoribosylaminoimidazole carboxylase,
FT                   catalytic subunit"
FT                   /EC_number="4.1.1.21"
FT                   /note="KEGG: rso:RSc0575 probable
FT                   phosphoribosylaminoimidazole carboxylase catalytic subunit
FT                   protein; TIGRFAM: phosphoribosylaminoimidazole carboxylase,
FT                   catalytic subunit; PFAM:
FT                   1-(5-phosphoribosyl)-5-amino-4-imidazole-carboxylate (AIR)
FT                   carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25650"
FT                   /db_xref="GOA:B2UGG3"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:B2UGG3"
FT                   /protein_id="ACD25650.1"
FT                   /translation="MTAQQSAPLVGVVMGSSSDWEVMRHAVDMLTQFGIPFEAQVVSAH
FT                   RMPDDMFRYAEAARSRGLRAIIAGAGGAAHLPGMIAAKTIVPVFGVPVPSKYLRGEDSL
FT                   LSIVQMPKGIPVSTFAIGEAGAANAALAAIATIATTDSALADKLEAFRAQQTEVARGMT
FT                   LPVHGA"
FT   gene            528257..529492
FT                   /locus_tag="Rpic_0496"
FT   CDS_pept        528257..529492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0496"
FT                   /product="phosphoribosylaminoimidazole carboxylase, ATPase
FT                   subunit"
FT                   /EC_number="4.1.1.21"
FT                   /note="KEGG: rso:RSc0576 phosphoribosylaminoimidazole
FT                   carboxylase ATPase subunit; TIGRFAM:
FT                   phosphoribosylaminoimidazole carboxylase, ATPase subunit;
FT                   PFAM: ATP-dependent carboxylate-amine ligase domain protein
FT                   ATP-grasp"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25651"
FT                   /db_xref="GOA:B2UGG4"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005875"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR040686"
FT                   /db_xref="UniProtKB/TrEMBL:B2UGG4"
FT                   /protein_id="ACD25651.1"
FT                   /translation="MADDLNPRLAQAHTAESRALNVPNAILPDAWLGMLGGGQLGRMFT
FT                   HAAQAMGYKVCVLDPDPNSPAGTIAERHLCAGYTDEAALAEMAALCPAVTTEFENVPAQ
FT                   ALDKLEQLGAFVAPRANCVSIAQNRIAEKKFFALCAARTGIHPAPSWVIEHEADIEQLP
FT                   ADLLPGILKIARMGYDGKGQARVSTIEELRAAWGAMQHVPCVLEKMLPLAYEVSVLAAR
FT                   GADGSTATWPLAENVHRDGILFSTIMPSRSVSDDIATRTRAAAAMIAEEMGYVGVLCIE
FT                   FFVLQDGSLVANEMAPRPHNSGHITMDVCETSQFEQQVRAMARLPLGSTRQHSPGRMLN
FT                   VLGDVWFEYGLERTPAWHEVMGHSGAKVHLYGKADARPGRKMGHVNCVGTSPEVVDEAF
FT                   RHAAHVLGLQSD"
FT   gene            529506..530519
FT                   /locus_tag="Rpic_0497"
FT   CDS_pept        529506..530519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0497"
FT                   /product="Sua5/YciO/YrdC/YwlC family protein"
FT                   /note="TIGRFAM: Sua5/YciO/YrdC/YwlC family protein; PFAM:
FT                   SUA5 domain protein; SUA5/yciO/yrdC domain; KEGG:
FT                   rso:RSc0577 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25652"
FT                   /db_xref="GOA:B2UGG5"
FT                   /db_xref="InterPro:IPR005145"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR010923"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR038385"
FT                   /db_xref="UniProtKB/TrEMBL:B2UGG5"
FT                   /protein_id="ACD25652.1"
FT                   /translation="MPHRTTSPYTMPSAERLDEAARRLEAGELVAFPTETVYGLGADAE
FT                   SPSAIAKIYAAKGRPSNHPVIVHVVDGADISYWADDVPGIALQLIEAFWPGPLTLILKR
FT                   APHIPAAVAGGQDSIGLRCPSHPVAQALLSRFKRGRGGIAAPSANKFGQVSPTTAQHVR
FT                   DEFGDAVFVLEGDGVDVGIESTIIDLSRLDQGIGPVLLRPGAITPEDIERVTGELPAAP
FT                   DAAAPRASGTLKAHYAPRTPLYLLSAADVSARLAALPADKRIVWLGAPVALRDGCDQRV
FT                   APATPAAYANALYALLRELDRGGYDAIWVETLADTPAWAAVNDRLRRAAAAFETDL"
FT   gene            530665..531708
FT                   /locus_tag="Rpic_0498"
FT   CDS_pept        530665..531708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0498"
FT                   /product="lipolytic protein G-D-S-L family"
FT                   /note="PFAM: lipolytic protein G-D-S-L family; KEGG:
FT                   rso:RSc0580 putative lipase / esterase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25653"
FT                   /db_xref="GOA:B2UGG6"
FT                   /db_xref="InterPro:IPR001087"
FT                   /db_xref="InterPro:IPR008265"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:B2UGG6"
FT                   /protein_id="ACD25653.1"
FT                   /translation="MKFRQWMGVVASATLALSLAACGGESDQSGNPNVAKVQRMVVFGD
FT                   SLSDAGTYTPAAAAVGGGKFTTNPGPVWAETVAAQLGVALTPAVMGYANSVQNCPKPGC
FT                   FDYAQGGSRVTDPNGIGHNGGAGALTYPVKQQLANFYAASNNTFNGNNDVVFVFGGNND
FT                   IFYWAAAVATPNSGVTPAIATAQVQQAATDLVGYVKDMVSKNATQLYVFNLPDSSLTPQ
FT                   GVAGGAAGQALLHALVGTFNTTLQAGLAGTGARVIDFNSQLTAVIQNGAMFGFSNTSVP
FT                   ACDATKINALVPGAGGSSLFCSANTLVTAGADTAYLFADGVHPTTGGHRLISSNVLQRL
FT                   LADGVTH"
FT   sig_peptide     530665..530736
FT                   /locus_tag="Rpic_0498"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.924 at
FT                   residue 24"
FT   gene            complement(531983..532510)
FT                   /locus_tag="Rpic_0499"
FT   CDS_pept        complement(531983..532510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0499"
FT                   /product="molybdopterin-guanine dinucleotide biosynthesis
FT                   protein B"
FT                   /note="TIGRFAM: molybdopterin-guanine dinucleotide
FT                   biosynthesis protein B; PFAM: molybdopterin-guanine
FT                   dinucleotide biosynthesis MobB region; KEGG: rso:RSc0583
FT                   probable molybdopterin-guanine dinucleotide biosynthesis
FT                   protein B"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25654"
FT                   /db_xref="GOA:B2UGG7"
FT                   /db_xref="InterPro:IPR004435"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2UGG7"
FT                   /protein_id="ACD25654.1"
FT                   /translation="MSSRKSLLGITGTSGSGKTTLVEQLIARFVHDGRRVAAIKHTHHG
FT                   FDLDSPGKDSHRMREAGSAEVVLVGGERLVLMREYANALEPELDDVLALLSPATDLVIV
FT                   EGYKRSTFPKIEVFRPSLGRQPLWPEIGGVVAVATDSPAAVQPPEGVAVLDLNDVDAVY
FT                   RFAVQQLAKSAI"
FT   gene            complement(532507..534045)
FT                   /locus_tag="Rpic_0500"
FT   CDS_pept        complement(532507..534045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0500"
FT                   /product="D-alanyl-D-alanine
FT                   carboxypeptidase/D-alanyl-D-alanine-endopeptidase"
FT                   /EC_number="3.4.16.4"
FT                   /note="KEGG: rso:RSc0584 probable D-alanyl-D-alanine
FT                   carboxypeptidase signal peptide protein; TIGRFAM:
FT                   D-alanyl-D-alanine
FT                   carboxypeptidase/D-alanyl-D-alanine-endopeptidase; PFAM:
FT                   peptidase S13 D-Ala-D-Ala carboxypeptidase C"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25655"
FT                   /db_xref="GOA:B2UGG8"
FT                   /db_xref="InterPro:IPR000667"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:B2UGG8"
FT                   /protein_id="ACD25655.1"
FT                   /translation="MARIRPTRLLTLSRSALACAVLLTIAASPLAHAKKAKTQAAPRTT
FT                   AAQTRQAAHNPAGLPANVALAFARAHIPLDAVSVFVIRTGTATPILQWNADAGMNPAST
FT                   MKLLTTFAGLDLLGPDFRWKTTAYADSAPVNGTLNGNLYLRGQGDPKLIPEELVKLVTD
FT                   VRRAGVDELAGNIVLDRTYFEGDLSEAPPLDGDSARAYNVAPDALLYSFKTLTFTLSPD
FT                   AGNGAVNIDVSPPLAQLQIDNQLRTTRGGCGDWKTTSGANISTQTDGHVIASFDGRYAA
FT                   ACGERVFNIAALTHADFIWGGFLALWQQAGGTTRFTPGLREGKVPRQAVLLATHYGPPL
FT                   SEVVHDIDKYSNNVMARQLFLTIGAEIGRKPASVRQSTEVINRWLAKQNLTMPELVLEN
FT                   GSGLSRTERISARNMGRLLQQADANPNGGVLRDALPVVGVDGTMRNRLTRAGVAGNAEI
FT                   KTGTLNGVRAIAGYVEGEDGQRFVVVSMINHPNASGGQAAHDALLQWIYQGAPR"
FT   sig_peptide     complement(533944..534045)
FT                   /locus_tag="Rpic_0500"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.984 at
FT                   residue 34"
FT   gene            complement(534186..536777)
FT                   /locus_tag="Rpic_0501"
FT   CDS_pept        complement(534186..536777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0501"
FT                   /product="DNA ligase D"
FT                   /note="TIGRFAM: DNA ligase D; DNA ligase D,
FT                   3'-phosphoesterase domain protein; DNA polymerase LigD,
FT                   polymerase domain protein; DNA polymerase LigD, ligase
FT                   domain protein; PFAM: DNA primase small subunit; ATP
FT                   dependent DNA ligase domain protein; ATP dependent DNA
FT                   ligase; KEGG: psb:Psyr_3245 ATP-dependent DNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25656"
FT                   /db_xref="GOA:B2UGG9"
FT                   /db_xref="InterPro:IPR012309"
FT                   /db_xref="InterPro:IPR012310"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014143"
FT                   /db_xref="InterPro:IPR014144"
FT                   /db_xref="InterPro:IPR014145"
FT                   /db_xref="InterPro:IPR014146"
FT                   /db_xref="InterPro:IPR033651"
FT                   /db_xref="UniProtKB/TrEMBL:B2UGG9"
FT                   /protein_id="ACD25656.1"
FT                   /translation="MPRHLADYRSKRDFTQTQEPAGARRKADEQRDHGALHFVIQKHDA
FT                   TRLHYDFRLELDGTLKSWAVPKGPSLDPADKRLAVHVEDHPLDYADFEGHIPEGQYGGG
FT                   DVIVWDRGTWRPHGDPRKAYRDGKLKFDLHGEKLHGAWALVRTHLHGTGRHPKEQWLLI
FT                   KERDDQVRASSDYDVTQALPASVITGENVGAKPKAKADGRKTQRADPAQVQPPAGAVPG
FT                   TLPKTLEPQLATLVDAPPRQGEWNYEVKFDGYRILARIDGNTVRLFSRNGRDWTAKLPR
FT                   QARTLQALGLREAWLDGEVVVMGERGVPDFQALQNAFETAHAEHIAYYLFDIPFCNGMD
FT                   LRGVPLRERRALLERILDAAPGNLDREAVLFSGTFHAAPEDLLSSACSMSLEGVIGKRA
FT                   DAPYRAGRSPAWIKLKCGQRQEFVIGGYSAPKGSRSGFGALLLGVYDDAGKLRYAGRVG
FT                   TGFNETSLHALHHELTGLTVDTPPFANPPTGSDARDVQWVKPERVAEIAFAEWTREGIV
FT                   RQAVFQGLRDDKLARNIVREQAKPPSAAARKETRAVNAAERKVRPGAERIADVDVTHPD
FT                   RVIEKASGTTKADLARYYAGVAEWMLPHLRNRPTSLVRAPDGIDGERFFQKHSAALKLQ
FT                   GITQLDPSLDPGHPSLLAINSAEALVGAVQMGTVEFHTWNALADRIEQPDRIVFDIDPD
FT                   PALPFARVIEATQLMLAMLDELGLKAFLKTSGGHGMHVVVLLTRREAAGWDTLKTFAQA
FT                   VVQHMAATFPDRFVAKMGPQNRVGKIFIDYLRNNRGASTVAAYSVRARTGLPVSVPIRH
FT                   DELEGLQSSAQWTLRTLPERLAKLKGDPWAAYAGTRQSVTADMRKRVGADD"
FT   gene            complement(536796..537710)
FT                   /locus_tag="Rpic_0502"
FT   CDS_pept        complement(536796..537710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0502"
FT                   /product="Ku protein"
FT                   /note="TIGRFAM: Ku protein; PFAM: Ku domain protein; KEGG:
FT                   bxe:Bxe_A2329 putative membrane protein, Ku-domain"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25657"
FT                   /db_xref="GOA:B2UGH0"
FT                   /db_xref="InterPro:IPR006164"
FT                   /db_xref="InterPro:IPR009187"
FT                   /db_xref="InterPro:IPR016194"
FT                   /db_xref="UniProtKB/TrEMBL:B2UGH0"
FT                   /protein_id="ACD25657.1"
FT                   /translation="MPRVIWKGAVSFGLVHIPVALYPATRSDDLDFDWLDRRTMDRVGY
FT                   KRINKTTGKEVPREQIVRGYAYEKDRYVILTDEDIRAANPASTQTVDLLTFVDAAEIPF
FT                   LYLDTPYFLAPDRRGEKVYALLREALTRSQKIGVANVVLHTKQHLAALIPMGPVLVLHT
FT                   LRWSNEVRDWSELDVPEEGAKAAKLTAKEIDMAEKLIDDMSGTWDPAEYHDTFRDDILA
FT                   LVDRKVREGRTESVEPMEAETAAPRSGNVIDLTDLLRQSLAKRGEGKDASNDKAQEEPA
FT                   PRKRAPRKAASKTARKTTTRKRA"
FT   gene            537939..539048
FT                   /locus_tag="Rpic_0503"
FT   CDS_pept        537939..539048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0503"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   rso:RSc0585 putative transport transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25658"
FT                   /db_xref="GOA:B2UGH1"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2UGH1"
FT                   /protein_id="ACD25658.1"
FT                   /translation="MALFFANGATFATWGIHIPTVKARFGLSEASLSLAMFMVAAGAIV
FT                   AMKFAGQWAARVGTRRASVQGGVAFGVMTGLLMLMPSYPALLAVLLLFGITNAGFDVAI
FT                   NAQAATVEANHHKPIISSLHGMFSLGGMAGAAVGGVLLELGVPPAVHCGGMALVTMAAA
FT                   LCAGPFMLPDHVHAEGEPAHPTTGRTLFLLGVLAFLGLVGEGAMYDWTTVYMREIAQSP
FT                   EAIASAGYAAFSGGMALARFSGDLARGRWGNKHVLGASGVLATGGILLALLWPAPMAVL
FT                   TGFALMGVGAANMVPIFFITASRLSGVPAAEGIAAVARFAYVGLLIGPVIIGLIAHRSD
FT                   LRWGLSVVALTMALIAVMGPRAIRQPERR"
FT   gene            539256..539645
FT                   /locus_tag="Rpic_0504"
FT   CDS_pept        539256..539645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0504"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RSc0586 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25659"
FT                   /db_xref="UniProtKB/TrEMBL:B2UGH2"
FT                   /protein_id="ACD25659.1"
FT                   /translation="MPYKRLTLVAAVAVVAAIGTVAHAQTDQKKFDPYSQGAKVGDKFD
FT                   PYQQGAKAGDKFDPYSQGANKNDSTASALNPGAQPANVEKGKYDTYTQGAKAGEKFDPY
FT                   SQGAKAGGKFDPYSEGANKKDAPKQ"
FT   sig_peptide     539256..539330
FT                   /locus_tag="Rpic_0504"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 25"
FT   gene            539650..540480
FT                   /locus_tag="Rpic_0505"
FT   CDS_pept        539650..540480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0505"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RSc0587 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25660"
FT                   /db_xref="UniProtKB/TrEMBL:B2UGH3"
FT                   /protein_id="ACD25660.1"
FT                   /translation="MLNGFMKTLMHHPMHRRFSLWNAAAAVAAIALAWPVHAAGLCSAP
FT                   WVHDGSRVRLDGNGETPMIVEFTLHDVSRDMQDGCEIGLHIYAKSGLVALGGRPIETVQ
FT                   EHQLLVDEAGVVTRIVSINGRVFAQSEHADLVGTVSTAISGMFLYGAGLAPEAQMLPGD
FT                   TYESSFDFDVVSPRLGISVGRMRAERAKVEVSEREVGPPQPMNTVVGQLQCRPIRYTRT
FT                   ARLGVLRLGNETLEPDPTVAHITDWYCPEAAVVMRQEVEQHGQTQVIDVVELKR"
FT   sig_peptide     539650..539766
FT                   /locus_tag="Rpic_0505"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.984 at
FT                   residue 39"
FT   gene            complement(540470..541258)
FT                   /locus_tag="Rpic_0506"
FT   CDS_pept        complement(540470..541258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0506"
FT                   /product="protein of unknown function DUF1045"
FT                   /note="PFAM: protein of unknown function DUF1045; KEGG:
FT                   reh:H16_B1290 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25661"
FT                   /db_xref="InterPro:IPR009389"
FT                   /db_xref="UniProtKB/TrEMBL:B2UGH4"
FT                   /protein_id="ACD25661.1"
FT                   /translation="MEQARAPLSSSIPAAWRYALYLLPPEPWYGLGTRWLGRCARTNTA
FT                   ISADQREAFACEAGIDLATLDRWTEAPRQYGLHATFKPPFRLATDRTVDELDAALRRFA
FT                   QQQQAFAIEPALQTLRGFLAWRLRHGDPARDTLHQFADACVGEFDAFRAPPPPTELARR
FT                   RRTGLSDAQERHLQRWGYPYVFDTFTFHVTLTGRLDHAEQLACYRALEATRMVLPAAMP
FT                   IDHIALFSQAAPEAPFTVARVYRFDGSTEDFDAAQSALSA"
FT   gene            complement(541267..542442)
FT                   /locus_tag="Rpic_0507"
FT   CDS_pept        complement(541267..542442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0507"
FT                   /product="Amidohydrolase 3"
FT                   /note="PFAM: amidohydrolase; Amidohydrolase 3; KEGG:
FT                   reu:Reut_B4184 amidohydrolase:Amidohydrolase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25662"
FT                   /db_xref="GOA:B2UGH5"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR012696"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B2UGH5"
FT                   /protein_id="ACD25662.1"
FT                   /translation="MQSFSSSVGHVAGLISRRTLLAEGLAEAAVQFRDGQIAACDGNPT
FT                   RGMIDCGDLLVLPGIVDLHGDAFERAVMPRPGVAFPYETALADVDGQLLACGITTEFHG
FT                   VTYSWEGGLRGRAYAVRMLDTLDAMRPHLGAQHLMHLRFELHHADGVADALAWMDAGRV
FT                   HFLSFNDHLPMMRDKLGDARKLAQYADRAECDIDTFLSRLHAAAVNATRLAEVTGTLAR
FT                   AAQQRGICMASHDEPDIATRNTFHAHGCTVTEFPLTEDVAQAARAHGGHIVFGAPNVVR
FT                   GGSHHGAPNASAMVAAGLGTVLASDYYYPALLAAPFKLAERGVVPLAEAWALVAANPAE
FT                   AAGLTDRGVLAPGLRADAIVVDDRRPGLPRVVAAVVGGRLRHAAGQLPLIG"
FT   gene            542583..545336
FT                   /locus_tag="Rpic_0508"
FT   CDS_pept        542583..545336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0508"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC and GAF sensor(s)"
FT                   /note="KEGG: rso:RSc0588 hypothetical protein; TIGRFAM: PAS
FT                   sensor protein; diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; EAL domain protein; GAF domain protein;
FT                   PAS fold domain protein; SMART: PAS domain containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25663"
FT                   /db_xref="GOA:B2UGH6"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR012226"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B2UGH6"
FT                   /protein_id="ACD25663.1"
FT                   /translation="MVDILKKNPDMDATSAERPDRPGPDVIDQDSRRPLPLADDRYEAL
FT                   VRQMPDALYIVADDIIVFVNEAGVRLFGAQTARDIVGHELDEFVHDNSMHLARQRREWM
FT                   VSHGAGLPPVEQTLLRCDGTPVEVEVLSAPVQLGWRTAIQVVARDITQRKQAEQALRES
FT                   EANYRALAAETARAKELLRCEKTVLELSSRNVPLPDLLAEVCRLVEALLDDGAMCSVLL
FT                   SADGEHITQAVAPSLPCTLSQVLVGIAIGPSVGSCGTAMFLNKTVVVEDIDADPLWDGY
FT                   RDIVAPLGLRACWSTPIRGDNAQMIGAMGIYYDTPRAPTRDAMGLLDGITDIIGVAVQK
FT                   AHIARDLRESEERYRLAVDNLTEGIVVQTADGTILACNPSARRILRAGSVSPVGTSHLA
FT                   LMRRSLREDGSEIPVNERPTRVVLATGRPLLGLTVGLELVDGDVVWVHENVLPIVRPGD
FT                   NTPSAVLISFNDIGPARAAQQQLTFLAQRDALTGLYNRAYFSQRMQAVMEQAASQANEG
FT                   HQVAVLFLDLDGFKKVNDTAGHEAGDHLLRIVAQRLSACVRQSDTLARLGGDEFVVLLD
FT                   NVRSLGEAERLAKRIVHSIAQPFSTSGTEYYLGASIGIALYPEHGNDAATLLRCADAAM
FT                   YNAKQNGRNQHRVYTARLSQRAQRRFQLEYHLRRALTAGELSLRFQPIVDATSMDIVGA
FT                   EVLLRWHSTELGEVSPAEFIPVAEDAGLIGDIGEWVLAQACRQAAHWRATCMPEFFVAV
FT                   NLSPRQFGEGLVPTISRCLTEAGLPASALEMEITEGLLMRDTAAVMPMLDALTALGIRI
FT                   SIDDFGTGYSSLSYLQRFPIDNLKVDRSFVSGIPRHRDSVVISRAVVAMAASLDMTVTA
FT                   EGVETLEQAEFLQAAGCDKLQGFLFGPPMTAAAYESRLRRDRSARA"
FT   gene            545486..546898
FT                   /locus_tag="Rpic_0509"
FT   CDS_pept        545486..546898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0509"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; KEGG:
FT                   bxe:Bxe_A1954 methyl-accepting chemotaxis sensory
FT                   transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25664"
FT                   /db_xref="GOA:B2UGH7"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:B2UGH7"
FT                   /protein_id="ACD25664.1"
FT                   /translation="MKPFAWGRGPKASPDLVARIAEEAGRVGMGICEVSGNVEDVAVRL
FT                   RRQADVFDQLRNAADVTMRGNHDIAVAAQHARKVASHASEEVSGSRETVDASLRDIREL
FT                   AVGVASMEQQIAALREALIQVAQASEQISQIARQTNLLAINAAIEAARAGESGRSFAVV
FT                   AGAVKQLAGQTAEATQRIETTLADLSGQTDKLIGDSSANVARAQRVDAGTQAIGAVIGV
FT                   AGEAIARFDVEATSIAESTAAIEDECASLAREVEAMAEGVKQSSHNIDNAQRQLSGLLG
FT                   ASETLIRLTASTGVQSADTPFIEAVQTAAGKISALFESALARGDINEGDLFDRTYAPVP
FT                   NTDPPQHMTRFTTFTDRVLPAVQEPLLQLDPRVVFCAAVDTNGYLPTHNLKFSQPQGSD
FT                   PVLNAANSRNRRLFTDRTGLGAARNTEAFLLQTYRRDMGNGTFAMMKDVSAPIYVKGRH
FT                   WGGFRMGYKVAG"
FT   gene            complement(547462..548784)
FT                   /locus_tag="Rpic_0510"
FT   CDS_pept        complement(547462..548784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0510"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   rme:Rmet_1926 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25665"
FT                   /db_xref="GOA:B2UGH8"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2UGH8"
FT                   /protein_id="ACD25665.1"
FT                   /translation="MSQTQALPANPTDPTSQSIPSTELDVTYRRIAYRLVPFLVVLFIL
FT                   AWIDRVNVGFAKLSMLQDLQFSEAVYGLGAGIFFIGYFLFEVPSNLLLEKIGARKTLAR
FT                   ITILWGLASMAMIYVKTPTSFYVMRFLLGIFEAGFFPGVVLYLTYWFPSAHRARINGLF
FT                   MTSFAIAGVVGGPVAGFIMSRMEGVGHLANWQWLFLLEGIPSVLAGFAVLAWLPETPRQ
FT                   AKWLSAAEQDAVVRAVEAENRDPAKHASFGAALANARVWVCAAIYFCVVSGNATIAFWT
FT                   PSIIKELGVQGNFQIGLISAIPFIAGTIAMVWNGAHSDRTGERRMHCAIAALIASAGLV
FT                   ATGATLGSPFLALVSLTVAAIGILAAFPVFWSIPAVFLAGTAAAGGIALINSIGNLAGF
FT                   VAPYMIGWLKTSTGHLSAGLYFVAALELGAAVLVILGTRKH"
FT   gene            complement(548953..550311)
FT                   /locus_tag="Rpic_0511"
FT   CDS_pept        complement(548953..550311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0511"
FT                   /product="Amidase"
FT                   /note="PFAM: Amidase; KEGG: rso:RSc0589 amidase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25666"
FT                   /db_xref="GOA:B2UGH9"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:B2UGH9"
FT                   /protein_id="ACD25666.1"
FT                   /translation="MMTPRPNMIRALAAELAAGRTTSIALTEAALERAESHRAAGGAAY
FT                   VSIDVQAALAMARAADAARAAGNVPSLLAGLPVSIKDLFDVAGQVTAAGSRALADQPRA
FT                   TTDAAAVARLRAAGAVLLGRTNMSEFAFSGLGLNPHYGTPRTPADGARAAGGSTSGGAV
FT                   TVAGGMAVAALGTDTGGSIRIPSAFCNLTGFKPTARRVPMTGGVPLSTSLDSGGPLANS
FT                   VDCCAIVDAVLSGESGNDAFDTTAVPLAGLRFGITQDFVGADLDNTVAVAFERAVERLE
FT                   RAGAHIVRFEFPELLQLPEINSGGGFSAAESWAWHRSLLARAEVQYDPRVATRIRRGEQ
FT                   MSAAAYIDVINARARMIAAARKRLGNFDAWLMPTVAIVPPEVAPLEVDDAQFFRINALT
FT                   LRNPSVINFLDGCALTLPVHVAGELPVGLSLCGLANDDARILRVGRAVEAALR"
FT   gene            complement(550339..551016)
FT                   /locus_tag="Rpic_0512"
FT   CDS_pept        complement(550339..551016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0512"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rme:Rmet_1928 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25667"
FT                   /db_xref="GOA:B2UGI0"
FT                   /db_xref="InterPro:IPR021269"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:B2UGI0"
FT                   /protein_id="ACD25667.1"
FT                   /translation="MTTLHLNLIGHGPIDVTVDHLVIAGWTGRDAEAVEHHIAELEAIG
FT                   VARPARVPCFYRVSASLLTTDATVEIPGADSSGEAEFVLYSTPMGLLVGIGSDHTDRKV
FT                   EAYGVTVSKQMCAKPVSRDVWRFEALADHWDSLQMKTWRTRDGQTALYQEGGVTRMLDP
FT                   RDLIRRYTGNDTLQVGTAMFCGTQPIIGELGFGEAFDMALIDPVSGTELRHRYAVDTLP
FT                   VEG"
FT   gene            complement(551062..551778)
FT                   /locus_tag="Rpic_0513"
FT   CDS_pept        complement(551062..551778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0513"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR HTH; GntR domain
FT                   protein; KEGG: rme:Rmet_1929 transcriptional regulator,
FT                   GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25668"
FT                   /db_xref="GOA:B2UGI1"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2UGI1"
FT                   /protein_id="ACD25668.1"
FT                   /translation="MSRPIKLVSGAAKPAPAPFAVEPAAHAPKGAAMRELAYNEIKRRI
FT                   MACEFRPGEPLNEAQLGALLGLGRTPIHQALHRLEVEGLVQILPRKGVLVTPLSLNDVL
FT                   DMIEVRATNEILCVTLAAERAHPADFEAMRAIVEASPALIEHRDIAALAALDLKFHLAI
FT                   SAASRNRVLAELLRGLHEKQARFWFLSLSEPQHLQNVYDEHLAVLDALERRDVPAAREA
FT                   IREHIDEFRRTIIRTL"
FT   gene            551954..553219
FT                   /locus_tag="Rpic_0514"
FT   CDS_pept        551954..553219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0514"
FT                   /product="monooxygenase FAD-binding"
FT                   /note="PFAM: monooxygenase FAD-binding; KEGG: reh:H16_A0578
FT                   2-polyprenyl-6-methoxyphenol hydroxylase or related
FT                   FAD-dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25669"
FT                   /db_xref="GOA:B2UGI2"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B2UGI2"
FT                   /protein_id="ACD25669.1"
FT                   /translation="MKIAVIGAGIGGLTLALMAERQGFEVEVWEAVQTLRPLGVGINLL
FT                   PHAARQLCELGLEDTLSALAIRTSALAYYNRFGQPIWHEPRGLAAGYDWPQFSIHRGEF
FT                   QMTLADAVIERLGAGCIRLGHSFEAVQSTGEKGGPVRFTLRDRSNDTVVESSADVLIGA
FT                   DGIHSAVRRHFYPTGDAPRFAGRMLWRAVTDAAPYLDGRTMFMAGHQDQKFVAYPISEP
FT                   LRQQGRSRINWIAELRVPDEAPPRSDWNREVDRAIFRSAFADWKWDWIDIPALIDGAQA
FT                   VYEFPLVDKDPLPRWTFGRVTLLGDAAHPMYPIGSNGSAQAILDARALVDCLLATRDTG
FT                   VALREYEADRLPRTAGIVLRNRLNGPEQVMQLAHERAPQGFARIDDVIPRSELEGIAMR
FT                   YKKLAGFDPQSLRDQLPMPRRA"
FT   sig_peptide     551954..552013
FT                   /locus_tag="Rpic_0514"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.864) with cleavage site probability 0.837 at
FT                   residue 20"
FT   gene            553265..554398
FT                   /locus_tag="Rpic_0515"
FT   CDS_pept        553265..554398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0515"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   reh:H16_A0577 ABC-type transporter, periplasmic component:
FT                   HAAT family"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25670"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B2UGI3"
FT                   /protein_id="ACD25670.1"
FT                   /translation="MTIRRTLCAAAALLLATAAHAEIVVGVSLSTTGPSASLGITQKNS
FT                   LAFYPDTIGGEKLRLVVVDDASDPSTGTRLARKLVTEDHVDIIVGSSAVAPSIAIAEVA
FT                   TESHTPQLALAPVELKPGKGDWTYRLAQPISLMAEAIATRMEASGVKNVGFIGFADAYG
FT                   ESWLKDFTAAATPRGIKIVDVERYARADTSVTGQVAKLVSIKPDAILVAGAGTGAALPH
FT                   TALRDRGYAGPIYQTHGAATKDLIRIGGKAVDGAILPAGPVIVAEQLPDSHPSKKTALE
FT                   YVTRYEKANGPDTRTQFGAHTWDALQVLQRIVPVALKKAKPGTSEFRQALKNALESEHD
FT                   IVVSHGVLNYTATDHFGFDARGRVLLTIDHGKWKLLN"
FT   sig_peptide     553265..553330
FT                   /locus_tag="Rpic_0515"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 22"
FT   gene            554472..554987
FT                   /locus_tag="Rpic_0516"
FT   CDS_pept        554472..554987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0516"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; KEGG: rso:RSc0590
FT                   putative transcription regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25671"
FT                   /db_xref="GOA:B2U6G7"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2U6G7"
FT                   /protein_id="ACD25671.1"
FT                   /translation="MPRTPKADDLYPAVAPSGHFNPHLADVEYGALDGLVGYAVRRAQL
FT                   HIYEDFVRSLQTWHITPPRFSAMTVIAHNPNLKLTELANILGVARSGAVLLVDTLEDMG
FT                   MVERQPSPKDKRAFRLVLTAKGATTLDDITRAVTAHDARVTAHLSTDERYTLLALLNKL
FT                   ASGPDSAS"
FT   gene            complement(555070..555411)
FT                   /locus_tag="Rpic_0517"
FT   CDS_pept        complement(555070..555411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0517"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RSc0591 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25672"
FT                   /db_xref="UniProtKB/TrEMBL:B2U6G8"
FT                   /protein_id="ACD25672.1"
FT                   /translation="MTQDPTTQRKQQNDDDFALTRDAIRWLASLPDPVRPIELGRKFPR
FT                   IINTIAVKWADFIGCRRYLNSLQIDERGGRQGFPFEIVQEICALREYFDSLYPPDKDLW
FT                   QKAIDANKR"
FT   gene            555755..556975
FT                   /locus_tag="Rpic_0518"
FT   CDS_pept        555755..556975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0518"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="KEGG: rso:RSc0592 hypothetical protein; TIGRFAM:
FT                   metal dependent phophohydrolase; PFAM: metal-dependent
FT                   phosphohydrolase HD sub domain; SMART: metal-dependent
FT                   phosphohydrolase HD region"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25673"
FT                   /db_xref="GOA:B2U6G9"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR021812"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:B2U6G9"
FT                   /protein_id="ACD25673.1"
FT                   /translation="MKRIDASQLRVGMFVMKLGGSWLKHPFWRAQFQLSHQGQIDDIRR
FT                   AGITEIWIDPERGEDVMSETLMPAPAPAPAPAPEPLTRETLAARPPLTPTSLKEEWKHA
FT                   QQLMQNGKATLGHMFAEARMGRALETEKALLLVDDVSNSLARNSYALIALARLKNKDDY
FT                   TYLHSFAVCALMVALAKTLGLPEDEIRECGLGGLVHDIGKSAMPRTLLDKSTALTKDEL
FT                   ALLQTHAVGGHHLLQGTGQFSEIAREICLHHHERIDGSGYPDAQKADGISLWAKMGAIC
FT                   DVYDTLTSSSPYHHAWSPAQALKYMMARTDTQFDRTVFQAFTRSVGIYPVGTLVKLRTN
FT                   RLGVVVHQNDASALKPDVVVFYSGNTKTRVRPERISLGKSDDSIVTVEDATTWGLSDEE
FT                   VSDMCLV"
FT   gene            complement(556993..557154)
FT                   /locus_tag="Rpic_0519"
FT   CDS_pept        complement(556993..557154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0519"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ani:AN0757.2 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25674"
FT                   /db_xref="UniProtKB/TrEMBL:B2U6H0"
FT                   /protein_id="ACD25674.1"
FT                   /translation="MPTQPRRSETDTTQPASPKAQPEPAKRKPGEPLVPRDTRPNPAEQ
FT                   KEPPVEDF"
FT   gene            557384..558370
FT                   /locus_tag="Rpic_0520"
FT   CDS_pept        557384..558370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0520"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RSc0593 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25675"
FT                   /db_xref="UniProtKB/TrEMBL:B2U6H1"
FT                   /protein_id="ACD25675.1"
FT                   /translation="MNVSNLLHAASNWVVRSRAFNVTQSVAHHRTPSDALSHWKLDIWH
FT                   KSVPFLFEGGLAEPAHQLFPKHLAHAEWVDELHHHLAQLVGVRREHRKIDIRAVTGLAQ
FT                   SPCSVHSFPSMLVFAHQHCRRIPHSTDADFAANRRHVFRYADQANVFRAYDFAGGELFY
FT                   MNEWGAHHFAALALQARTQNRELLIDAEVRHARSALGLRRLLDGFYVIGARRQGQQRYG
FT                   TRLSEALASHQVPHRWMHGRREAEGFELCFLPKSDRFANCVGEQLVRDGWFDYGAWLAS
FT                   LHDATEVGAPAQRAEAARKTRSNWKRVPVPSLGVPTGLMPGFAHTRL"
FT   gene            558476..558892
FT                   /locus_tag="Rpic_0521"
FT   CDS_pept        558476..558892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0521"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RSc0594 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25676"
FT                   /db_xref="GOA:B2U6H2"
FT                   /db_xref="UniProtKB/TrEMBL:B2U6H2"
FT                   /protein_id="ACD25676.1"
FT                   /translation="MSGDIVRRHLRPTLRSFRSSFLHPRWLACLLAVFLLFGQQGALRH
FT                   ALSHWSEFGEAAGVEFNAAATAKPASAERSQPAQEHAACLQCAAYAALAAALPMLVALR
FT                   LAHTRRWHFPRIGFHAGAPVFPVAVCSRDPPFRL"
FT   sig_peptide     558476..558592
FT                   /locus_tag="Rpic_0521"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.652) with cleavage site probability 0.198 at
FT                   residue 39"
FT   gene            558979..561162
FT                   /locus_tag="Rpic_0522"
FT   CDS_pept        558979..561162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0522"
FT                   /product="TonB-dependent receptor"
FT                   /note="PFAM: TonB-dependent receptor; TonB-dependent
FT                   receptor plug; KEGG: rso:RSc0595 putative outer membrane
FT                   receptor signal peptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25677"
FT                   /db_xref="GOA:B2U6H3"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:B2U6H3"
FT                   /protein_id="ACD25677.1"
FT                   /translation="MIPFQPSKLVMALAAVLPSVASVSALAQEATPPAAAPSTPTTTAP
FT                   ATNVRDLSETRVTAKRLDAARNALSPDTGSSVYKFDTDDIARLPLGDATPLNQVLLQAP
FT                   GVVQDSYGQLHVRGDHSNLQYRINGVIVPEPISGFGQMLDTRFANQINVLTGALPAQYG
FT                   YRTAGIVDITTKGASTDEDGEPKAFGGEIGTVLGSNATHEVNAQIQGTKDRFSYYLSGV
FT                   FAENNLGIENPTGNRNATHDHTTQNKSFGMLSYLLDNDSRVSFMFGTSNGRFQIPTRPG
FT                   LTPKFTLDGAVPPASEALNANQREKTDFQILTYQQKVSPKLDYQVSVFRRVSRIDYMPD
FT                   PIGDLVYNGVAADITRRNEAYGVQGDASYKLTDKHTLRAGVFVQRERYVANNTASVFAA
FT                   DDSGAQTSTTPFTIVDNHSGSGTTLGVYLQDEWKPTDKLTVNYGARYDRVNTIVSEQQL
FT                   SPRLGLTYDLTPRTRVHAGYARYFTPPPTEKFDTTSVQAFAGTTNALPSDANTAVKSER
FT                   SNYFDLGISHQLTPHLTLGLDAYYRDVRHLQDEGQFGNALLYSAFNYERGRIYGLEGSA
FT                   NYRNGNFGAYLNLAVSRAQGKGIETGQFNFGANELAYINSHWVNLDHDQRLTASAGVSY
FT                   RYSGTTYTSDVLFGTGLRNGFVNTDHLPAYWQMNVGAARDFNLPTLGKFKTRLTVLNIF
FT                   DRSYQLRDGTGIGVGAPQFAPRRTFLLSVSKPF"
FT   sig_peptide     558979..559062
FT                   /locus_tag="Rpic_0522"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 28"
FT   gene            complement(561217..561849)
FT                   /locus_tag="Rpic_0523"
FT   CDS_pept        complement(561217..561849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0523"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bja:bll7411 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25678"
FT                   /db_xref="UniProtKB/TrEMBL:B2U6H4"
FT                   /protein_id="ACD25678.1"
FT                   /translation="MTRLRFSARTAAVVALVTAVLPLAASAQNTAAPTRVRATINAVHS
FT                   TAVDVTDTSGNKATVTLPVDLNITQVAPIEPSAIRAGSYIGTAAVKEPDGTLRALEVHV
FT                   FPEAMRGTGDGHRPYDLGPNSSMTNGTVEQAGAVTGAQGRTLSVKYKDGEQRIVVPPQV
FT                   PIVTFEPGRRDDLKAGAHVVMFVRADAQGTLVAQRVLVGKDGMVPPM"
FT   sig_peptide     complement(561766..561849)
FT                   /locus_tag="Rpic_0523"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.959 at
FT                   residue 28"
FT   gene            complement(561985..562572)
FT                   /locus_tag="Rpic_0524"
FT   CDS_pept        complement(561985..562572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0524"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_1390 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25679"
FT                   /db_xref="UniProtKB/TrEMBL:B2U6H5"
FT                   /protein_id="ACD25679.1"
FT                   /translation="MATSNLYRTGEAPAQTGKGHGTDALGPSDSSDSGSDVVGGPGLGS
FT                   DVEDRFDDDPAVHPHGNAANRTAGADLGDVNLDSDTDSTGTGERRAAGHEPVIREGGDL
FT                   MPDAIRDVHDPEVDTPIDDENFEHATGLAGENDDADAPDAVELDEAPIDPQPGSRDVPV
FT                   QSPTGGGTDWSDNMRRSRPTYKGKRVPGQHRS"
FT   gene            562744..563025
FT                   /locus_tag="Rpic_0525"
FT   CDS_pept        562744..563025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0525"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rso:RSc0596 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25680"
FT                   /db_xref="UniProtKB/TrEMBL:B2U6H6"
FT                   /protein_id="ACD25680.1"
FT                   /translation="MKQHAQQPHKPAAQAGEKAGQRKSESKKGEHNAQAQQARGVAKER
FT                   TSMQHGTDQSAKRPMRAPAEDGRAAAQEGQLPQNQQRLGQHQNSRKQP"
FT   gene            563022..563222
FT                   /locus_tag="Rpic_0526"
FT   CDS_pept        563022..563222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0526"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rso:RSc0597 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25681"
FT                   /db_xref="UniProtKB/TrEMBL:B2U6H7"
FT                   /protein_id="ACD25681.1"
FT                   /translation="MSATRKPRGDDQAEAPSGDAIRPVVPAIPSESGVGEEDPGDFENA
FT                   SIRSDDGKRPSVPPRKPGERG"
FT   gene            complement(563241..563579)
FT                   /locus_tag="Rpic_0527"
FT   CDS_pept        complement(563241..563579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0527"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RSc0598 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25682"
FT                   /db_xref="UniProtKB/TrEMBL:B2U6H8"
FT                   /protein_id="ACD25682.1"
FT                   /translation="MTTAAPTPKPEWLALGAGQTGLHWLAARTTLVALEGSLHLEPPSR
FT                   GTTEHYALGAGHAHVVEMSGWWHLHADTRSGAHLRVVAPALRTQRPAWPAMWRWVANWA
FT                   QPRGTLRG"
FT   gene            563794..565257
FT                   /locus_tag="Rpic_0528"
FT   CDS_pept        563794..565257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0528"
FT                   /product="transcriptional regulator, GntR family with
FT                   aminotransferase domain"
FT                   /note="PFAM: regulatory protein GntR HTH; aminotransferase
FT                   class I and II; KEGG: rso:RSc0599 putative transcription
FT                   regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25683"
FT                   /db_xref="GOA:B2U6H9"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2U6H9"
FT                   /protein_id="ACD25683.1"
FT                   /translation="MSVTELTPPPAQPLYRTLADHYLGAIRSGVLAPGERMPSVRMLMR
FT                   THAVSLSTALQVCRHLEAEGWLEARERSGYFVRQPRRALLAPVKEPEVSTPDPAAYVGV
FT                   HARVSAIVARGQQATVHVDLSGASGAAALYPAAALNRIASQVLRRYPLLLTQAVIPNGH
FT                   PELQTAVARRALDMGVQVAPDDVIVTHGCIEAVNLALRAVAQPGDTVAVESPTYYGLLQ
FT                   VLESLGMRAVEIPTSPRTGMSLEALEMAVQAYGNIRAVVVVPNLQNPLGSIMPDAAKRR
FT                   MAAFCDANRIALIEDDTYSALGDSPTPLRALKAWDRTGSVIYCASLSKVLAPGLRLGWM
FT                   AAGRWQGRVQMLKFAQSRPNDSWSQVLAGRFIASGAYDRHLRTLRQTLREQRERMAESI
FT                   AGCFPAGTRLSVPSGGLAMWVELPANVSSMELFDAALAQGIRIAPGTMFSNLNRFDHFF
FT                   RICFGLAPSANLEAALATLGQITQELAER"
FT   gene            complement(565267..565935)
FT                   /locus_tag="Rpic_0529"
FT   CDS_pept        complement(565267..565935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0529"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RSc0600 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25684"
FT                   /db_xref="InterPro:IPR005586"
FT                   /db_xref="UniProtKB/TrEMBL:B2U6I0"
FT                   /protein_id="ACD25684.1"
FT                   /translation="MMPMQTTMLSFSLRVAGGAALALLVGACASPEPTLHTLSARPEAT
FT                   DTSRFQRAFRLSGVRVPDRLDKPQIVLRTSDSEVVALEQQRWAAPFGSELRDALSANLA
FT                   ATLSAVDVGGAAAPAGVPLYRIGAEMRSYDARPGQGVTALVTWRVSRDAATQGASAAAL
FT                   TCQTTLALPVSGPSAAADSEAGVNAVVSSTQRLVQQWSQQIAQSVQGLEAPSAVPAWCR
FT                   "
FT   sig_peptide     complement(565846..565935)
FT                   /locus_tag="Rpic_0529"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.915 at
FT                   residue 30"
FT   gene            complement(565932..567575)
FT                   /locus_tag="Rpic_0530"
FT   CDS_pept        complement(565932..567575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0530"
FT                   /product="Mammalian cell entry related domain protein"
FT                   /note="PFAM: Mammalian cell entry related domain protein;
FT                   KEGG: rso:RSc0601 probable transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25685"
FT                   /db_xref="GOA:B2U6I1"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="UniProtKB/TrEMBL:B2U6I1"
FT                   /protein_id="ACD25685.1"
FT                   /translation="MTDPVDNENIPAPRRMKRKRWLPSLIWLVPIVALTVGATLMARVI
FT                   LARGAQVTVTFSSAEGIEAGKTRVKYKSVDIGVVKAVGLTDDRSGAVVLIELTHDGKAF
FT                   AASDTRFWVVRPRVAAGSISGLGTLLSGAYIGVDGGSSQEKKSTFKGLDTPPAISADAP
FT                   GKQFTLHAPDLGSLDIGAPVYFRRVRVGQVTAYDIDTDGKGVTLHIFVNAPFDKFVARG
FT                   TRFWNASGIDLKLDANGLKVDTQSLLTVALGGIAFQTPEEADHEPAASDAQFQLVRNET
FT                   AALKDPEHLSQTVVMYFHRSLRGLNVGAPVEFKGINVGEIKSIGIHYSKKRHEFVLPVT
FT                   ATLYPTRFGMDIRDDNPQHAAEDVRTQFDVLVKNGMRAQLKSASLLTGQQFVNLDFIDT
FT                   AEREKTAPRFGMRDRDGAYVFPTADNPTDDIEAQIAGIAKKLNKVPFEQIGQDVHRTLT
FT                   TLDATLKQTEQLAKTVNSDLAPQMKETLAEARRTLDSARQVFSDDAPLQRNARDTLEQV
FT                   AKAAASVRVLTDYLDRHPEALIRGKAKDAQ"
FT   gene            complement(567572..568309)
FT                   /locus_tag="Rpic_0531"
FT   CDS_pept        complement(567572..568309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0531"
FT                   /product="Paraquat-inducible protein A"
FT                   /note="PFAM: Paraquat-inducible protein A; KEGG:
FT                   rso:RSc0602 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25686"
FT                   /db_xref="GOA:B2U6I2"
FT                   /db_xref="InterPro:IPR007498"
FT                   /db_xref="UniProtKB/TrEMBL:B2U6I2"
FT                   /protein_id="ACD25686.1"
FT                   /translation="MNSATTPAPAQPGQEGRPLRAAAHGLVTCERCGLLARMPDSRAAT
FT                   QAVLTREYAPDDTAAAPVCPRCMSPMHVRKPDSLARCWALLIAAAAMYLPANLLPVMIT
FT                   DTLLGTQQDTIMSGIVYLWTSGSWHLAIIVFIASFLVPLAKLGILAVLCLSVQQRWRWN
FT                   PRLRTRLYALVEIIGRWSMLDVFVVTLLAGLVHLSTLAIIKPGPGVGPFAAVVVLTMFA
FT                   ARCFDPRLIWDVIDEPDPEETDV"
FT   gene            complement(568306..569085)
FT                   /locus_tag="Rpic_0532"
FT   CDS_pept        complement(568306..569085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0532"
FT                   /product="Paraquat-inducible protein A"
FT                   /note="PFAM: Paraquat-inducible protein A; KEGG:
FT                   rso:RSc0603 probable transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25687"
FT                   /db_xref="GOA:B2U6I3"
FT                   /db_xref="InterPro:IPR007498"
FT                   /db_xref="UniProtKB/TrEMBL:B2U6I3"
FT                   /protein_id="ACD25687.1"
FT                   /translation="MEPSNVKFPFPLPQSWRAAGDTPDAKAAPVALPLPGDPDAWIACE
FT                   HCDTLHRHEVIALDEEAHCTRCGVKLYRNQSERLSVLLPLVLTGIIVYVVANIFPIAEM
FT                   NGGGNRHATTLWGAIVALYDYDMLFAAVLVALTTVFFPLMYMSVLAPLLIARVRGRQHP
FT                   AAALVLRAAALIRPWAMVEIFMLGVVVALIKVARMVSLEADAGLWAFAALTVFLTVALS
FT                   IDLRPFWREIGLTLPPGSHIDAPTGMDAAARPGEDRP"
FT   gene            569323..569814
FT                   /locus_tag="Rpic_0533"
FT   CDS_pept        569323..569814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0533"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dre:794124 hypothetical protein LOC794124"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25688"
FT                   /db_xref="UniProtKB/TrEMBL:B2U6I4"
FT                   /protein_id="ACD25688.1"
FT                   /translation="MTYLRASSLVVALALAGGTAAAYAQTGGAPSNSTAGGGSMSAAGG
FT                   AGTDATASGMGDSTANGSSANSGRDTSRNRNATGKQGRSGNTRSGSSGSYGGSANDSTG
FT                   STTGGGSGGVGVGAPGAGAAMGGPGGGGGGAAGSGGAGAGAGGAGAGGAAGGSAGGGSR
FT                   "
FT   sig_peptide     569323..569397
FT                   /locus_tag="Rpic_0533"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.955 at
FT                   residue 25"
FT   gene            complement(569833..570696)
FT                   /locus_tag="Rpic_0534"
FT   CDS_pept        complement(569833..570696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0534"
FT                   /product="S-formylglutathione hydrolase"
FT                   /EC_number="3.1.1.1"
FT                   /note="KEGG: rso:RSc0604 probable hydrolase oxidoreductase
FT                   protein; TIGRFAM: S-formylglutathione hydrolase; PFAM:
FT                   putative esterase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25689"
FT                   /db_xref="GOA:B2U6I5"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR014186"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B2U6I5"
FT                   /protein_id="ACD25689.1"
FT                   /translation="MTIPVPALELLSEHACFGGVQRFYRHASTAIRLPMRFSVYLPPQA
FT                   LAGTSCPALFYLAGLTCTEETFAIKAGAQRVAAREGLILIAPDTSPRDANAPGETDSWD
FT                   FGIAAGFYLDATQAPWREHYRMESYIADELHHIARVVFPVAAGRIGIFGHSMGGHGALT
FT                   LALRHRERFASVSAFAPIAHPSVCPWGIKAFTGYLGDDRTAWAAHDATQLMRQASCPFP
FT                   RGILIDQGEADKFLAEQLYPDDFAAACAAAGQPLQLRRHPGYDHGYYFIETFIEDHLLH
FT                   HAAQLR"
FT   gene            complement(570719..571825)
FT                   /locus_tag="Rpic_0535"
FT   CDS_pept        complement(570719..571825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0535"
FT                   /product="S-(hydroxymethyl)glutathione dehydrogenase/class
FT                   III alcohol dehydrogenase"
FT                   /note="TIGRFAM: S-(hydroxymethyl)glutathione
FT                   dehydrogenase/class III alcohol dehydrogenase; PFAM:
FT                   Alcohol dehydrogenase zinc-binding domain protein; Alcohol
FT                   dehydrogenase GroES domain protein; KEGG: rso:RSp0069
FT                   probable bifunctional: glutathione-dependent formaldehyde
FT                   dehydrogenase and alcohol dehydrogenase class III
FT                   oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25690"
FT                   /db_xref="GOA:B2U6I6"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014183"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2U6I6"
FT                   /protein_id="ACD25690.1"
FT                   /translation="MKTKAAIAWKAGAPLTVEEVDLQGPRAGEVLVEIKATGICHTDYY
FT                   TLSGADPEGIFPAILGHEGAGVVLEVGAGVTSLKAGDHVIPLYTPECRQCKFCLSRKTN
FT                   LCQAIRATQGKGLMPDGTSRFSLDGKPLFHYMGTSTFANHIVVPEIALAKIRPDAPFDK
FT                   VCYIGCGVTTGVGAVVYTAKVEPGANVVVFGLGGIGLNVIQGAKMVGADKIIGVDLNPA
FT                   REAMARKFGMTHFINPSDVENVVDHIIQLTDGGADYSFECIGNTKVMRQALECCHKGWG
FT                   QSIIIGVAEAGAEISTRPFQLVTGREWKGSAFGGARGRTDVPKIVDWYMEGKLNIDDLI
FT                   THTLPLERINEGFELMKRGESIRSVVLY"
FT   gene            572030..573859
FT                   /locus_tag="Rpic_0536"
FT   CDS_pept        572030..573859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0536"
FT                   /product="methyl-accepting chemotaxis sensory transducer
FT                   with Cache sensor"
FT                   /note="PFAM: histidine kinase HAMP region domain protein;
FT                   Cache domain protein; chemotaxis sensory transducer; KEGG:
FT                   rso:RSc0606 putative methyl-accepting chemotaxis
FT                   transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25691"
FT                   /db_xref="GOA:B2U6I7"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:B2U6I7"
FT                   /protein_id="ACD25691.1"
FT                   /translation="MGVVVGNHTVLASIRTRILLTCVAIVVGALTFAGGLNYLVTRSYN
FT                   DESIRQNLQSVARGHIAGIDDWVASKTQMMVSLQDVAVSADPIPVFKAVHKAGGFINVY
FT                   VGYPDKSYKFSNPEGIPPTYDPTARPWYKQAVEAGKPVVTPPYVSASTGQLVVTFAVPI
FT                   LEGGALKGVIGGDVAMDSVIANVKAIHPTQASFGFLVNAAGKIVAHPNDKLTLKPATEL
FT                   AAGLNEATLASLAQAERPVEVTVDGASKLLYRQGVKGTDWGLVVALDKSDATAGMRSLV
FT                   MTSIGALVGVAIVAALIVGAMTARAFRRLSMIRDAMDDIGSGSGDLTKRLPSDGEDEVA
FT                   QIARSFNAFADKLTAVMQQIRLGSDSVRSAAQEIAAGNADLSQRTEEQASSLEETASSM
FT                   EELTSIVKQNADNARQASQLAVTASDVATRGGNVVGQVVQTMGGINESSKKIADIIGVI
FT                   ESIAFQTNILALNAAVEAARAGEQGRGFAVVASEVRSLAQRSAGAAKEIKALISDSVDR
FT                   VSNGTALVDQAGVTMAEIVDAVKRVTDIMGEISSASEEQSSGIEQVNQAVNQMDQVTQQ
FT                   NAALVEQAAAAAESLEEQAHNLNEAVGQFRLSH"
FT   gene            complement(573887..574555)
FT                   /locus_tag="Rpic_0537"
FT   CDS_pept        complement(573887..574555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0537"
FT                   /product="Glutathione S-transferase domain"
FT                   /note="PFAM: Glutathione S-transferase domain; KEGG:
FT                   bam:Bamb_5220 glutathione S-transferase, N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25692"
FT                   /db_xref="GOA:B2U6I8"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:B2U6I8"
FT                   /protein_id="ACD25692.1"
FT                   /translation="MPQDRHLTLYHSPRSRSRGARMLLEELGADYEVHAFDLTTGQHKS
FT                   PEFLAINPLGKVPTLCHGDAVITEQVAVYLYAAELYPEAGLSPAVGDPLRGAYLRRMAF
FT                   YGTCFEPAIVDRSMKREPAAYSMSPYGNFDTMLGTLTAQLEKGPYLLGERFTAADVLWG
FT                   AALGWTTMFKLIPETPLVRGYIDRVMARPAMQRAQAADVALAEAQDKAKAEATNAAPAP
FT                   "
FT   gene            complement(574809..576566)
FT                   /locus_tag="Rpic_0538"
FT   CDS_pept        complement(574809..576566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0538"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; histidine kinase HAMP region domain
FT                   protein; KEGG: bxe:Bxe_B2626 periplasmic sensor diguanylate
FT                   cyclase (GGDEF domain)"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25693"
FT                   /db_xref="GOA:B2U6I9"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:B2U6I9"
FT                   /protein_id="ACD25693.1"
FT                   /translation="MDRRFGASVAIVLVPVLSLSCWLLGYAWLAYGRADDSARSVQVLR
FT                   MTLLAMEKVSAERGPTNGVLGEDLPVPAERSAALQRMRAVSDEHVAQLLDALGPEHCPG
FT                   CEADIKAARRAQTHLAAARANIDRLTALPLRSRSSDDLADGVNRMIAVIPEFLPIVNAR
FT                   TANITRGDPDVLNCLTLARLSADLREYAGQLGSRFTGALAMHRMLTFDEQLAIERTQGR
FT                   IDQLRSMIETRVGAHSALNQHALATLGAQYFGDGLRYVAAVRAKASQPGGVDITPAAFA
FT                   ERYVPTMRATTDFRDIVLRLADDDIRQHRRAMLLVLIGSAGAVVSVLGALAWMMISFRR
FT                   NVVRPFVNATRLIDGIARGNLSVHIPTDFARREIRAMFDAIRVLRINSIERRRLEVERA
FT                   HLMQELSRMAETDPLTQLLNRRAFEDRAGAMCKSPQPKARLIALIMFDIDHFKRINDTY
FT                   GHAVGDEALRTVARLCRSEGPSADMVARIGGEEFAVMVWADSLAQARAVADHLRHRIAE
FT                   VTVPTGTDLPCSMTASFGVAAAPAADGPELEPLLRRADHLLYAAKLAGRNCVMADRPPA
FT                   SPDVALAAD"
FT   sig_peptide     complement(576504..576566)
FT                   /locus_tag="Rpic_0538"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.830) with cleavage site probability 0.559 at
FT                   residue 21"
FT   gene            complement(576906..577187)
FT                   /locus_tag="Rpic_0539"
FT   CDS_pept        complement(576906..577187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0539"
FT                   /product="Antibiotic biosynthesis monooxygenase"
FT                   /note="PFAM: Antibiotic biosynthesis monooxygenase; KEGG:
FT                   bam:Bamb_6274 antibiotic biosynthesis monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25694"
FT                   /db_xref="GOA:B2U6J0"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:B2U6J0"
FT                   /protein_id="ACD25694.1"
FT                   /translation="MAHIEILAGKQREFEAAVQQALPLFARAKGCHGAELHHIVERDTS
FT                   YVLLVRWNTVEDHMVDFRESDDFQEWRKLVGPFFAKAPEVVHSEVAVK"
FT   gene            577449..578498
FT                   /locus_tag="Rpic_0540"
FT   CDS_pept        577449..578498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0540"
FT                   /product="protein of unknown function UPF0118"
FT                   /note="PFAM: protein of unknown function UPF0118; KEGG:
FT                   bch:Bcen2424_3807 protein of unknown function UPF0118"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25695"
FT                   /db_xref="GOA:B2U6J1"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:B2U6J1"
FT                   /protein_id="ACD25695.1"
FT                   /translation="MDSGNDHQKFLYLLLFAVTLGLCWILSPFFGAVFWGVILAILFQP
FT                   VQRALVARMGKRRNLAALVTLALIILIVILPVIFVAATIVQEIGVAYQEIQSAQPNYSR
FT                   YLSEAVHALPTWVQQLLAKAGLTNIAGIQKKLADGAAQISQFAATKALSIGQNTFQFVV
FT                   GFGVMLYMVFFLLRDGTEIGRRVRRALPMDEEHKRLLLSKFTTVVRATVKGNIAVALVQ
FT                   GALGGLIFWILGIDGVVLWGALMAFLSLLPAIGASLVWIPVAVYFLMVGAIWKCVILVA
FT                   FCGGVIGLVDNLLRPLLVGKDTKMPDWVVLISTLGGMELFGITGFVIGPLVAALFMASW
FT                   DIFARGQNE"
FT   gene            complement(578529..579773)
FT                   /locus_tag="Rpic_0541"
FT   CDS_pept        complement(578529..579773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0541"
FT                   /product="Saccharopine dehydrogenase (NAD(+),
FT                   L-glutamate-forming)"
FT                   /EC_number="1.5.1.9"
FT                   /note="PFAM: Saccharopine dehydrogenase; KEGG:
FT                   bur:Bcep18194_C7476 putative saccharopine dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25696"
FT                   /db_xref="GOA:B2U6J2"
FT                   /db_xref="InterPro:IPR005097"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2U6J2"
FT                   /protein_id="ACD25696.1"
FT                   /translation="MPAPHYDVVVFGATSFVGQILTRYLAEHFSGDAETLRWAIAGRSE
FT                   AKLQEVKCSLGAAGESIPIIVADAANEAQLQALCAQTRVVVSTVGPYALYGEPLIKVCA
FT                   ESGTDYCDLTGETQWIRRMIGTYEATAQQSGARIVHCCGFDSVPSDMGVYFLQQHAMRQ
FT                   WGTPATQVKLRVKTLKGGASGGTIASLINVVQEAAADPALRKELADPYALCPKGHGFTA
FT                   RQRSVRGAAFDADFDAWIAPFVMAAINERVVHRSNALSGNAYGNPFLYDEAVITGHGLS
FT                   GRMKAMTMVAGLGAFMLGIVIKPARIVMQRFLLPKPGEGPTPAAQLAGRYDLRLFGRTD
FT                   QGNTLRVKVSGDRDPGYGSTGKMLGQAAASLALDHVKDGIKIGRPGGFWTPATMFDERF
FT                   IERLTRHAGLRFERI"
FT   gene            580184..581770
FT                   /locus_tag="Rpic_0542"
FT   CDS_pept        580184..581770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0542"
FT                   /product="isocitrate lyase and phosphorylmutase"
FT                   /note="PFAM: isocitrate lyase and phosphorylmutase; KEGG:
FT                   bch:Bcen2424_4447 isocitrate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25697"
FT                   /db_xref="GOA:B2U6J3"
FT                   /db_xref="InterPro:IPR006254"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR039556"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:B2U6J3"
FT                   /protein_id="ACD25697.1"
FT                   /translation="MAQYQDDIKAVAGLKETHGSAWNAINPEYAARMRAQNKFKTGLDI
FT                   AKYTAKIMRADMAAYDADPSKYTQSLGCWHGFIGQQKMISIKKHFNSTERRYLYLSGWM
FT                   VAALRSEFGPLPDQSMHEKTSVSALIRELYTFLRQADARELGGLFRELDAAKDANAKAA
FT                   IQAKIDNHVTHVVPIIADIDAGFGNAEATYLLAKQFIEAGACCIQIENQVSDEKQCGHQ
FT                   DGKVTVPHEDFLAKIRAIRYAFLELGVDDGIIVARTDSLGAGLTKQIAVTNTPGDLGDQ
FT                   YNAFLDCEELSADQLGNGDVVIKRDGKLLRPKRLPSNLFQFRAGTGEARCVLDCITSLQ
FT                   NGADLLWIETEKPHIAQIGGMVKEIRKVIPNAKLVYNNSPSFNWTLNFRQQVYDAMKEA
FT                   GKDVSAYERGQLMSTEYDDSELAKLADEKIRTFQADASREAGIFHHLITLPTYHTAALS
FT                   TDNLAKEYFGDQGMLGYVAGVQRKEIRQGIACVKHQNMSGSDIGDDHKEYFSGEAALKA
FT                   AGKDNTMNQFH"
FT   gene            582045..583340
FT                   /locus_tag="Rpic_0543"
FT   CDS_pept        582045..583340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0543"
FT                   /product="metabolite/H+ symporter, major facilitator
FT                   superfamily (MFS)"
FT                   /note="TIGRFAM: metabolite/H+ symporter, major facilitator
FT                   superfamily (MFS); PFAM: General substrate transporter;
FT                   major facilitator superfamily MFS_1; KEGG:
FT                   bch:Bcen2424_6665 metabolite/H+ symporter, major
FT                   facilitator superfamily (MFS)"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25698"
FT                   /db_xref="GOA:B2U6J4"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2U6J4"
FT                   /protein_id="ACD25698.1"
FT                   /translation="MHPPSSLSTGQSKAAAVFRVTAGNFLEQFDFFLFGFYATQIANVF
FT                   FPTESEFASLMMTFAVFGAGFLMRPLGAVVLGAYIDDVGRRKGLIVTLSIMASGTVLIA
FT                   FVPGYATIGLLAPALVLLGRLLQGFSAGAELGGVSVYLAEMATPGRKGFFTSWQSASQQ
FT                   VAIVVAAGLGFALNQGLSAPAIAAWGWRVPFFVGCMIVPFIFVLRRNLEETQEFKARKH
FT                   RPSMKDVLSTLVQNWGVVIAGMMLVAMTTTSFYLITVYAPTFGKTVLHLSTADSLLVTL
FT                   CVGVSNFVWLPIGGALSDRIGRRPLLIGMTVLTIATAYPALSFLAHAPSFMNMLLVLLW
FT                   LSFMYGIYNGAMIVALTEVMPVQVRVAGFSLAYSLATAVFGGFTPAISTAAIHMTGDKA
FT                   APGYWMSLAAVCALLATLTLYRRRAVTLAPAH"
FT   gene            583397..584179
FT                   /locus_tag="Rpic_0544"
FT   CDS_pept        583397..584179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0544"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: bch:Bcen2424_6664 extracellular solute-binding
FT                   protein, family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25699"
FT                   /db_xref="UniProtKB/TrEMBL:B2U6J5"
FT                   /protein_id="ACD25699.1"
FT                   /translation="MKTLFLKLCAAALVATSAAAAHVQAAELHVMSSGGFTAAYKVLGP
FT                   KFAAQTGNTLNTALGPSMGKSPEAIPNRLARGEPADAVIMVGYALDDLIKQGKVIPESR
FT                   VELADSRIGMVVRDGAAKPDISSPEALMQVLLHAKSIAYSDSASGVYIERELFKKLGIE
FT                   EQVKAKAKMIPRIPVASVVATGDYEIGFQQVSELLPVQGATFVGKIPESLQSVTRFAAG
FT                   IPVGAPHPKEAKALLDYLASPGAQADVKSTGLDSVLAR"
FT   sig_peptide     583397..583474
FT                   /locus_tag="Rpic_0544"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.914 at
FT                   residue 26"
FT   gene            complement(584216..585133)
FT                   /locus_tag="Rpic_0545"
FT   CDS_pept        complement(584216..585133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0545"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bam:Bamb_5626 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25700"
FT                   /db_xref="GOA:B2U6J6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2U6J6"
FT                   /protein_id="ACD25700.1"
FT                   /translation="MGINFDLTDLQAFRAVVELGNFRKAAEAISISQPALSRRIDKLES
FT                   ALGVPLFERTTRSVTLTTVGRVFARSAEQLLDDLDVALLGIRDVSSSRLGQVTIACVPS
FT                   VAYYFLPNLIATYHRRFPRIRVKLLDASANEVLGAVISGEADFGVSFMGSQEPEIEFKM
FT                   LLQERFVAACRRDHPLARKKRVTWNELYEHEYVSVDKTSGNRLLLDQALSAVAPRAPSV
FT                   CETRHVTTMLGLVEAGLGVAAVPSMAMPGHEHPILTSVPLVEPVVNRRVGIVKRRGRAL
FT                   TPAAEEFHRMIIEAKRSGMMASDA"
FT   gene            complement(585332..586831)
FT                   /locus_tag="Rpic_0546"
FT   CDS_pept        complement(585332..586831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0546"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; KEGG: bch:Bcen2424_6666 diguanylate
FT                   cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25701"
FT                   /db_xref="GOA:B2U6J7"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:B2U6J7"
FT                   /protein_id="ACD25701.1"
FT                   /translation="MHLRPLARRLATSAGHHPFVVGALGTLLTFIVLAISVLTLWANRE
FT                   TAIEHAHDTSKNVAAVLASHISRTVESADQSLQTLIGALDKPGIRNLDPQVRHDLLFSP
FT                   TASARYVTGMGVTDDKGQLVDGCCSLTHRWDFSDRDYFIVHREHANLGLYVSGVYKARS
FT                   RAGVEAIALSRRMNRQDGTFAGTALVAIDLDYFRQLLERLDVGPRGITAIVRTDGTLMA
FT                   RNPPGAARAFNLSKSLTFPRMVNQESGFYVAPSASDGVVRLYTFQRVPGTPFIAVVAPA
FT                   MSDALAAWQRLSWIVGLSSLSVSLAFCAGVWLLAFALRGRVMAENHLRELTQTDPLTGL
FT                   KNRRALDVALENEWDRLQRNDSRLSVLFIDADHFKRYNDAHGHAQGDVALQYLAQCISK
FT                   HARRRGDLAARYGGEEFVVLLPDTDEAGATRIAEAIRAEVEGAGASVGDAGLAPFTVSV
FT                   GCATARRASFPSLNALTKAADDALYEAKRKGRNRIDYATVG"
FT   gene            complement(587072..587935)
FT                   /locus_tag="Rpic_0547"
FT   CDS_pept        complement(587072..587935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0547"
FT                   /product="NmrA family protein"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; TrkA-N domain
FT                   protein; NmrA family protein; KEGG: bam:Bamb_6340 NmrA
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25702"
FT                   /db_xref="InterPro:IPR008030"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2U6J8"
FT                   /protein_id="ACD25702.1"
FT                   /translation="MTILVTGATGRVGRQVVHQLANRGADVRALVRDPSKADFPASVNV
FT                   VQGDMLDLDSLRRAFVGVRTLFLLNAVAGDEFTQALIALNVARESGVERVVYLSVMHAE
FT                   RFVNVPHFAVKSGAERMIEQMGFSATILRPAYFMDNEHMVKDVIVNHGVYPMPIGSKGV
FT                   AMVDTRDIAEVAAIELIRRDAAPGKLPVETINLVGPDTLTGPELASIWTETLRRPVAYG
FT                   GDDPTAFESNLTNFLPKWMAYEMRLMAERYVSDGMVPQAGDVERLTSILGRPLGTYRDF
FT                   AAALAQ"
FT   gene            588039..588938
FT                   /locus_tag="Rpic_0548"
FT   CDS_pept        588039..588938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0548"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bam:Bamb_6341 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25703"
FT                   /db_xref="GOA:B2U6J9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2U6J9"
FT                   /protein_id="ACD25703.1"
FT                   /translation="MDLLALADFNLVARHGSFGEAARATGRPKATLSRRVSELEGSLEL
FT                   RLFERGSRGLKLTQEGHALYERTGTLLTEIAETAAAIASGSERPRGRLRISAPMLFSQT
FT                   AMGKLVATFALKYPEVLLEVTTEDRGVDMIEEGYDLVIRVNPDPDESLIGRVFMRDRLV
FT                   VVAKPGLERPTGKALAPAVLRGAGTGNAAWDITGPEGKSRIAIRPVAHLSSLIMVRDTV
FT                   RLGVGAACLPVSLVAHDLEAGTLVHWGDVDGPDIALWALYPSRRLLSARVSAFLEHLKD
FT                   AFPTGTPQELAAYMHSSP"
FT   gene            complement(588979..589062)
FT                   /pseudo
FT                   /locus_tag="Rpic_0549"
FT   gene            589224..589403
FT                   /pseudo
FT                   /locus_tag="Rpic_0550"
FT   gene            complement(589473..589757)
FT                   /locus_tag="Rpic_0551"
FT   CDS_pept        complement(589473..589757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0551"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RSc2698 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25704"
FT                   /db_xref="UniProtKB/TrEMBL:B2U6K0"
FT                   /protein_id="ACD25704.1"
FT                   /translation="MDAYPTCRYKGFDVYPLIYLFDPPREWHERRPDRSYSASVLICQE
FT                   GEPPSTERSRIFPLPATQWDNIGTAKRAAAKMAEDIIDGFVPGRSMHSQ"
FT   gene            complement(589817..590197)
FT                   /locus_tag="Rpic_0552"
FT   CDS_pept        complement(589817..590197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0552"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: reu:Reut_B5732 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25705"
FT                   /db_xref="UniProtKB/TrEMBL:B2U6K1"
FT                   /protein_id="ACD25705.1"
FT                   /translation="MTHASNKTSFLCTLPGAAKSMAYSITVGFIRDGQPNCVQFTSFVG
FT                   EGRRSFRVLASAPDLASAAMASVETLCRLAIGQVIRDSLHAKTAQGDHTLDMRVQPWEG
FT                   ELRPAGSRSTLKPPRPHLVVRG"
FT   sig_peptide     complement(590129..590197)
FT                   /locus_tag="Rpic_0552"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.976) with cleavage site probability 0.970 at
FT                   residue 23"
FT   gene            complement(590285..590569)
FT                   /locus_tag="Rpic_0553"
FT   CDS_pept        complement(590285..590569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0553"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RSc2700 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25706"
FT                   /db_xref="UniProtKB/TrEMBL:B2U6K2"
FT                   /protein_id="ACD25706.1"
FT                   /translation="MNASPSATYKGFDLYPLVYRTEAVQSWPRKRLDRTFNASVVICRA
FT                   GHQPGAEHSRVFQMTPTAWENVGTARRGALKFGEDVINGLIPGESVASL"
FT   gene            complement(590661..590987)
FT                   /locus_tag="Rpic_0554"
FT   CDS_pept        complement(590661..590987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0554"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RSc2701 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25707"
FT                   /db_xref="UniProtKB/TrEMBL:B2U6K3"
FT                   /protein_id="ACD25707.1"
FT                   /translation="MLDLVAFTKPVLDEITGQDVRTWHSGPSVLAANWQVPEFDSRIWR
FT                   VRTLTIAFTHDVMNQLMHADQQDLCQLQCMLDRFLRAQLGMHAQADRGDRMLVITVDHL
FT                   GVAS"
FT   gene            complement(591537..591671)
FT                   /locus_tag="Rpic_0555"
FT   CDS_pept        complement(591537..591671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0555"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25708"
FT                   /db_xref="UniProtKB/TrEMBL:B2U6K4"
FT                   /protein_id="ACD25708.1"
FT                   /translation="MQAWSAWANQFLLMSYATMGKANALVHAYKCMAQAIGNEVTVLA"
FT   gene            591699..591929
FT                   /locus_tag="Rpic_0556"
FT   CDS_pept        591699..591929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0556"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: reu:Reut_A0600 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25709"
FT                   /db_xref="UniProtKB/TrEMBL:B2U6K5"
FT                   /protein_id="ACD25709.1"
FT                   /translation="MNKVDSPYTVSVYPIEQEPGVWFATYLINEYRDGTERLLANVSMR
FT                   HNVHGTEALARNAARLAGRAAIARLTHRHKN"
FT   gene            592011..592265
FT                   /locus_tag="Rpic_0557"
FT   CDS_pept        592011..592265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0557"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RSc2703 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25710"
FT                   /db_xref="UniProtKB/TrEMBL:B2U6K6"
FT                   /protein_id="ACD25710.1"
FT                   /translation="MFASEEWEELHLTPEGWKDGSYRHVPGDPVMIEPPANDVLTVRRH
FT                   VAAVYGGPSRVTEDRTPRTDDMGQIEQLLLKYGAPVFGV"
FT   gene            592367..592579
FT                   /locus_tag="Rpic_0558"
FT   CDS_pept        592367..592579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0558"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RSc2704 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25711"
FT                   /db_xref="UniProtKB/TrEMBL:B2U6K7"
FT                   /protein_id="ACD25711.1"
FT                   /translation="MTLCRACLAIEVHRLGASGHAFLRITDTQRIKASKTAAVTVSTFA
FT                   CRTCGASWTYREGKNVPNPGWSLDH"
FT   gene            592748..593498
FT                   /pseudo
FT                   /locus_tag="Rpic_0559"
FT   gene            complement(593755..594462)
FT                   /locus_tag="Rpic_0560"
FT   CDS_pept        complement(593755..594462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0560"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; KR domain protein;
FT                   KEGG: bch:Bcen2424_6299 short-chain dehydrogenase/reductase
FT                   SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25712"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2U6K8"
FT                   /protein_id="ACD25712.1"
FT                   /translation="MPTRPAPQAAAARHAIVTGASSGIGRAIAERLLADGWRVTGLCRT
FT                   APAEPVEGLEIAQVDVTDFARLGKVCDSLGAVDALVHAAGFMRTAPLGELCAADGEAMW
FT                   RVHVDAAAFLADRLVQRMPAGGRILLIGSRTANGAPTRSQYAATKAALVGMARSWAAEL
FT                   APRGITVNVIAPGATDTPFLHDPARAHTPPRMPPIGRFIAPEEVAAMAAFLAGEYGGAI
FT                   TGQQIVMCGGASL"
FT   gene            complement(594465..595229)
FT                   /locus_tag="Rpic_0561"
FT   CDS_pept        complement(594465..595229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0561"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="PFAM: regulatory protein DeoR; KEGG:
FT                   bch:Bcen2424_6298 transcriptional regulator, DeoR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25713"
FT                   /db_xref="GOA:B2U6K9"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:B2U6K9"
FT                   /protein_id="ACD25713.1"
FT                   /translation="MKVTKRREAMLKAVLGGMNDVATLCEHFGMSEATVRRDLRALASD
FT                   RRILRTYGGAAAVGSHEPEAPLEERRSSAREQKEAIARLAQAHIADGDTIFLDGGTTTA
FT                   ALARHLSGKQIHVVTNNLMVVTSLAAGGIPVTLIGGDVRPSSMSTLGPLAQLSLGRVSV
FT                   DKAFLSADGVVATNGLCEASADQAYLKECVIRQAAQVIVLATADKLGRATQQHWTPIER
FT                   PWTLITDNGASPDQLDPFHERDEVDVEIAPLD"
FT   gene            complement(595293..596468)
FT                   /locus_tag="Rpic_0562"
FT   CDS_pept        complement(595293..596468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0562"
FT                   /product="glycosyl hydrolase BNR repeat-containing protein"
FT                   /note="PFAM: glycosyl hydrolase BNR repeat-containing
FT                   protein; KEGG: bch:Bcen2424_6297 glycosyl hydrolase, BNR
FT                   repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25714"
FT                   /db_xref="GOA:B2U6L0"
FT                   /db_xref="InterPro:IPR011040"
FT                   /db_xref="InterPro:IPR036278"
FT                   /db_xref="UniProtKB/TrEMBL:B2U6L0"
FT                   /protein_id="ACD25714.1"
FT                   /translation="MTATLPSYAAFDSNVRAAYTDAERREAFLPTPCVQNHAANLHALP
FT                   NGDLLCVWFGGTQEGIPDVSIYLSRLAAGTSEWQPATKLSEDTTRSEQNPVLFTTPTGE
FT                   LWLIYTAQLSGHQNTAIVRRRISTDGGRSWGPIDTLFDQAGTFVRQPIVVLPDGAWACP
FT                   VFLCRTQPGERWVGNDDISAVMISEDQGRTWSRHDVPDSIGCVHMNVQTLADGSLLALY
FT                   RSRWADHIYASRSQDGRTWSAPQPTTLPNNNSSIQFVALRNGHLALVYNESDASHSTGR
FT                   RTSLYDDIEDAEDHGELRDQQASTRGTAFWGAPRAPLSLAISEDGGQTWRRRNIEIGDG
FT                   YCMTNNSADQRNREYSYPSIVQGNDGALHIAFTYFRQRIKYVTVDESWVRG"
FT   gene            complement(596503..597933)
FT                   /locus_tag="Rpic_0563"
FT   CDS_pept        complement(596503..597933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0563"
FT                   /product="Na+/solute symporter"
FT                   /note="PFAM: Na+/solute symporter; KEGG: bch:Bcen2424_6296
FT                   Na+/solute symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25715"
FT                   /db_xref="GOA:B2U6L1"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:B2U6L1"
FT                   /protein_id="ACD25715.1"
FT                   /translation="MTSFSTWDTTMIIAMVVVYIVVTSVASIRLRSRTSEQFMVAGRSM
FT                   PAVVVAVLLMSEYIGAKSTIGTSQEAFSVGIAASWSVISAAIGFLLFGLFMAKRLYASG
FT                   QFTISGFIAKKYGNTAKLVVSAVMIYALFLVNVGNYVSGAAAISTVMHIDLPIAALITA
FT                   AVSTIYFVWGGLKSVAYLTIVHSAVKVVGIGIIVAVAWKLSGGIAPMAQAMPEHYFTWK
FT                   GALSGGTIGAWIIGSAGAIFSTQFIIQAISSTKSPEAARSASLMAAVLCVPISIALGFI
FT                   GVAAKYLYPGIKSLYALPVFLQHMHPLLAGVVTTSLVASIFVSVCTVALAIASLIVTDF
FT                   YVPRYRPSAEQEMRMTRWISLAVGVLPLVFVLFVPQILALSFFTRALRLSVSIVALIGI
FT                   YLPFFNSSRGAVSGLILAAIATTIWYLLGNPFGVDNMYIALVTPALVLVVEKLLFRAAE
FT                   PAQASAPVANIKPNNAAH"
FT   gene            complement(598044..600356)
FT                   /locus_tag="Rpic_0564"
FT   CDS_pept        complement(598044..600356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0564"
FT                   /product="4-hydroxythreonine-4-phosphate dehydrogenase"
FT                   /EC_number="1.1.1.262"
FT                   /note="KEGG: bch:Bcen2424_6295
FT                   4-hydroxythreonine-4-phosphate dehydrogenase; TIGRFAM:
FT                   4-hydroxythreonine-4-phosphate dehydrogenase; PFAM:
FT                   Pyridoxal phosphate biosynthetic protein PdxA; type III
FT                   effector Hrp-dependent outers"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25716"
FT                   /db_xref="GOA:B2U6L2"
FT                   /db_xref="InterPro:IPR005255"
FT                   /db_xref="InterPro:IPR010737"
FT                   /db_xref="InterPro:IPR031475"
FT                   /db_xref="InterPro:IPR037051"
FT                   /db_xref="InterPro:IPR042213"
FT                   /db_xref="UniProtKB/TrEMBL:B2U6L2"
FT                   /protein_id="ACD25716.1"
FT                   /translation="MNTSAHTAPKLLILADDLSGAADCAVAGVRAGLRSAVMLRADVGH
FT                   PIGYPTSADVLALDTDTRRANAVDAAATQVAAWHALARPATRLYKKIDSTLRGNVAAEV
FT                   AALAPLAGLAIVAPAFPAAGRTTRDGRQWLHGVAVEDTEVWRNESIGGRADLRVMLERQ
FT                   GLQTAVLTLDDIRAGAAALAGRLAALQADGVQAVVCDAQTDDDLAHIAETSVRLAHVFW
FT                   VGSAGLAPALIRAAGLGSANAAVEGDAATAIAGPVLTVVGSMSSVSHAQASELKAAAGA
FT                   RLLSLELPVEELDTPQADITQTVIDALCEGRDVLVTLSQTTRGNSADGLHFCRRLATLL
FT                   APALPHAGGLIATGGETARAVLSTAGIDALRLCDEIESGMPLLHAQLTGVGGVLPVVTK
FT                   AGGFGTPGSLHAAWRRLIETAASTPPKGTHAMTYRPVIGITMGDAAGVGPEIIMKALTH
FT                   RAVYEQCRPLVIGDTARLRDAAQRTGAALEVRSIERPADAAFRYGVVDCIDLGLIPADL
FT                   PYGKLSPIAGDAAYQYIARTVELTSAGELDAICTAPLNKEALHAGGHIFPGHTEMLAHL
FT                   TGIDEVSMMLVAPNLRVIHVTTHIGLLDAIRRIEPGLVQRTIERAHATLVRAGIENPRI
FT                   GVCGINPHAGENGLFGHGEEEQKIIPAVQVLQARGWRVEGPLPADTLFFRAGRGDFDVV
FT                   VAMYHDQGHGPVKVMGLEAGVNVTVGLPVIRTSVDHGTAFDIAGKGIADERSMLEAFRQ
FT                   ACELATRHDDPQAVRAA"
FT   gene            complement(600353..601522)
FT                   /locus_tag="Rpic_0565"
FT   CDS_pept        complement(600353..601522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0565"
FT                   /product="iron-containing alcohol dehydrogenase"
FT                   /note="PFAM: iron-containing alcohol dehydrogenase; KEGG:
FT                   bch:Bcen2424_6293 iron-containing alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25717"
FT                   /db_xref="GOA:B2U6L3"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:B2U6L3"
FT                   /protein_id="ACD25717.1"
FT                   /translation="MSSTYHFQTVKHIVHGAGSLALLPEKLALLDVPVKRIALITQPVM
FT                   EQNGVIGRVVQALAARDIEARIVRGVEPEPTIENVETVFREQIAPFAPDAILSIGGGSV
FT                   LDAAKLFAVRLTNEQPLREWLGIDLIKRPGIPLVLVPTTAGTGSEVTPNAIVTLPDEEL
FT                   KVGIVSRHLLPQLVILDAELTFDLPKPITAATGIDAFVHSLESYISTKANPVSDMFAME
FT                   SMRLIGANLVEAYQNGRSVKAREAMMLGSMYGGLALTAAGTAAVHALAYPLGGMFGITH
FT                   GVANAMLLPHVMSFNKDAIVGRLANVARALDISSHDSDDETAADALIERLTEWTDVVQI
FT                   PQDLRQFGVSETHLDVLAEAASKVKRLLGNNPKPLSHADIKAIYQRLLP"
FT   gene            complement(601556..602452)
FT                   /locus_tag="Rpic_0566"
FT   CDS_pept        complement(601556..602452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0566"
FT                   /product="dihydrodipicolinate synthase"
FT                   /note="TIGRFAM: dihydrodipicolinate synthase; PFAM:
FT                   dihydrodipicolinate synthetase; KEGG: bch:Bcen2424_6292
FT                   dihydrodipicolinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25718"
FT                   /db_xref="GOA:B2U6L4"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR005263"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B2U6L4"
FT                   /protein_id="ACD25718.1"
FT                   /translation="MTASFKGIVPALITPMTPTEDVDENGLRVLIDRLIDAGVHGLFVL
FT                   GTNGEFIALSEEEKLRIARITVEQARGRVPVVAGTGAYATRDVIALNHKMQDVGVDAVS
FT                   VITPYFNGATQPELFAHYEQIARATSLPILLYTIPAKAGVTLTVDTVRRLADIPNIRAI
FT                   KDSGGDFDRLLQLINLRRDDFAVFTGTDSMILWTLIAGGDGAVAATTNAVPHVVMSIWN
FT                   QFQAGNIPAARAAQESLRALRDAFALGTMPVVLKTAAEMLGMPAGPARSPAKPLDEKSR
FT                   ERLAEALAIYRAALNVA"
FT   gene            complement(602820..602999)
FT                   /locus_tag="Rpic_0567"
FT   CDS_pept        complement(602820..602999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0567"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25719"
FT                   /db_xref="UniProtKB/TrEMBL:B2U6L5"
FT                   /protein_id="ACD25719.1"
FT                   /translation="MPPAGKVVTRSPRRRVGLIACPWLLSTPISPDKEVVVEASVTSAP
FT                   RYYFGMHAAIFPKG"
FT   gene            complement(603180..603426)
FT                   /pseudo
FT                   /locus_tag="Rpic_0568"
FT   gene            603519..603797
FT                   /locus_tag="Rpic_0569"
FT   CDS_pept        603519..603797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0569"
FT                   /product="protein of unknown function DUF156"
FT                   /note="PFAM: protein of unknown function DUF156; KEGG:
FT                   bpd:BURPS668_A2846 protein containing"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25720"
FT                   /db_xref="GOA:B2U6L6"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="InterPro:IPR038390"
FT                   /db_xref="UniProtKB/TrEMBL:B2U6L6"
FT                   /protein_id="ACD25720.1"
FT                   /translation="MSHTIREKQKLLNRVRRIRGQLDAIERALEEEQGCAPVLQQITSC
FT                   RGAMNGLLAVVLEDHIRTHLTEVDDEHEHADGSAKEQLIEVVHSYFR"
FT   gene            603805..605109
FT                   /locus_tag="Rpic_0570"
FT   CDS_pept        603805..605109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0570"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /note="TIGRFAM: cation diffusion facilitator family
FT                   transporter; PFAM: cation efflux protein; KEGG:
FT                   bpl:BURPS1106A_A2694 cation diffusion facilitator family
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25721"
FT                   /db_xref="GOA:B2U6L7"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="UniProtKB/TrEMBL:B2U6L7"
FT                   /protein_id="ACD25721.1"
FT                   /translation="MSNFYDTPFHASHDHVFLGEGHEKNERKTWAVIVLCTLMMAAEII
FT                   GGSVFGSLALVADGLHMSTHAGAMLIAALAYTYARRHANDPRFVFGTGKLGDLAGFTSA
FT                   IILAMVALLIGYEAVVRFFSPVPIHFSEAIPIAVVGLLVNIASAWLLSGGDHGGHSHGH
FT                   SHHHGHAHGHDHGAAGLGDTHPHGREVQHIEAPGGVFALSIFEDGVPPVFRLAGETAPL
FT                   PGDVATVTTIRPDGSRQEFLLVRKANYLESTTEIPEPHAFTAVLGIGGQEYSVAFDEHD
FT                   HDHADGHGAHHRDHNMRAAYVHVLADAAVSVLAIIGLLLARTFGWLWMDPLAGVVGAVV
FT                   IANWAYGLMRDTGGILVDVTPDKHIGRRIKTALESDGDTLLDLHVWRIGPGHLGAVVSV
FT                   STGQAHRGPQFYHQRLRRLQALSHITVEVHASPGK"
FT   gene            605235..606191
FT                   /locus_tag="Rpic_0571"
FT   CDS_pept        605235..606191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0571"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nha:Nham_4399 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25722"
FT                   /db_xref="UniProtKB/TrEMBL:B2U6L8"
FT                   /protein_id="ACD25722.1"
FT                   /translation="MYGPSAFVRICAAALALAACGVPGPSRAHGIAGNRFFPGTLNFDD
FT                   PAVADEFSITAGAVKHPDDAGNVTDRAATISFARLLTPEVSIGFDTGFIRRDWGSMRQP
FT                   GATGSDVVLKSRLYEDDLNETLIAGSLIYGLPHTGAKRLGANTSATIAPSLYIGQGFGA
FT                   LPDAWSWLRPFAITAGVSVAVPTGKTSGNLSYDPTTRQFNSVNTANVTTVHWGFALEYS
FT                   TLYLTDRFVPGVLPKEEPLHQWIPLVEFAFDSPRGQRTRGTVNPGIAYVKDTWQVAAEL
FT                   VLPATHGSTRGVGATIQVLFFLDDFLPLLFGKPILAR"
FT   sig_peptide     605235..605321
FT                   /locus_tag="Rpic_0571"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.983 at
FT                   residue 29"
FT   gene            606387..606803
FT                   /locus_tag="Rpic_0572"
FT   CDS_pept        606387..606803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0572"
FT                   /product="Domain of unknown function DUF1924"
FT                   /note="PFAM: Domain of unknown function DUF1924; KEGG:
FT                   pna:Pnap_1532 mono-heme class I cytochrome c"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25723"
FT                   /db_xref="GOA:B2U6L9"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR015170"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:B2U6L9"
FT                   /protein_id="ACD25723.1"
FT                   /translation="MPISKFPPVACLHSVLALALAAAAPLAHAQAPAQLLDQYRAQAGA
FT                   PSDPSRGQEFFTSKHGREWSCASCHGNPPTQTGRHAATGKSIAPLAPAFNPERFTDAAK
FT                   TEKWFRRNCNDVVGRECTVAEKADVLSWLMTLGK"
FT   sig_peptide     606387..606476
FT                   /locus_tag="Rpic_0572"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.995 at
FT                   residue 30"
FT   gene            606837..607343
FT                   /locus_tag="Rpic_0573"
FT   CDS_pept        606837..607343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0573"
FT                   /product="multihaem cytochrome"
FT                   /note="PFAM: multihaem cytochrome; KEGG: bmu:Bmul_5868
FT                   multihaem cytochrome"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25724"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR018588"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:B2U6M0"
FT                   /protein_id="ACD25724.1"
FT                   /translation="MRSIQMSGRFVVTGRAARACLAIAGLGLSFLAAAEEGPGMRAAPL
FT                   LPKYRQECASCHIAYPPGALPASSWQRILGNLQHHYGTDASLDPATVKQLDQWLTANAA
FT                   DRSRSIPPPPEDRITRSAWFARTHDEVPTAVWRRPAIKSASNCAACHTKADQGDFNEHN
FT                   VRIPR"
FT   sig_peptide     606837..606941
FT                   /locus_tag="Rpic_0573"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.991 at
FT                   residue 35"
FT   gene            607315..608046
FT                   /locus_tag="Rpic_0574"
FT   CDS_pept        607315..608046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0574"
FT                   /product="cytochrome B561"
FT                   /note="PFAM: cytochrome B561; KEGG: bvi:Bcep1808_6299
FT                   cytochrome b561"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25725"
FT                   /db_xref="GOA:B2U6M1"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:B2U6M1"
FT                   /protein_id="ACD25725.1"
FT                   /translation="MNTMSASRAEAMKTDSITRRILVWDAPTRLFHWLLALSFLGAYLT
FT                   AESEQWRLVHITLGYTMAALVGFRLVWGMVGTRYARFSSFVRSPAAALRYLTSILRGRP
FT                   EHHIDHNPAGALAIIALLLMACGLAGTGWATYNDVGGDWLGELHEGFANAMLALVGIHV
FT                   LAVFASSWLHRENLVGAMISGRKTGLPNEGIRRAWSSVAGLMLVAVLGFWWTQWQSAPP
FT                   AGVTDRPAASAKHHDADRDDY"
FT   gene            608078..608752
FT                   /locus_tag="Rpic_0575"
FT   CDS_pept        608078..608752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0575"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: bmu:Bmul_5866 two component
FT                   transcriptional regulator, winged helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25726"
FT                   /db_xref="GOA:B2U6M2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B2U6M2"
FT                   /protein_id="ACD25726.1"
FT                   /translation="MRILLVEDDPLLGDGIRAGLQQQGFQVDWVRDGEAAWRELRTDAY
FT                   VAAILDLGLPRMDGVDVLRKVRGAGIAVPILVLTARDAIPDRVRGLDLGADDYIVKPID
FT                   LHELSARLRALVRRAHGHPTEQLRARGIVLEPASRTVFCNGRAVALSTREFDLLHALML
FT                   NAGRVLSREQLEQCLYPWGQEVGSNSVEVHIHHLRVKLGSDLIVTVRGVGYMLPRDNAE
FT                   AP"
FT   gene            608749..610125
FT                   /locus_tag="Rpic_0576"
FT   CDS_pept        608749..610125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0576"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; KEGG: bmu:Bmul_5865 integral
FT                   membrane sensor signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25727"
FT                   /db_xref="GOA:B2U6M3"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013727"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B2U6M3"
FT                   /protein_id="ACD25727.1"
FT                   /translation="MTRPRSLQGRLVLLVLGAVAGLWLITALITWYDAQDEIDQLLDSH
FT                   LAQAGALLVMQHAQAVDEDDEPSHDLPVQHRYAPKVAFQVFHEGKLGIHSANAPNQPMV
FT                   APGERTASGFSTVQIGGNAWRVFVAQGVYKDIQVYVGERIDSRTAILSALLRNMLWPMA
FT                   LALPLLALAVWWAVKRGMLPLRRLGNALAERDPRALDPVRMPHAPVEMTPMLDALNALF
FT                   ARIQTMLDAERRFTADAAHELRTPIAAIKAQAQVAMAAEEDAMRRHALVGTLEGCDRAA
FT                   HLVDQLLLLSRLEANAGISIEPIDLGALARQVMADIAPIAFGKKQRIALENPERCMVAG
FT                   NRALLASLVRNLIDNAIRYSPAEAQIVVTVAHRNGSAALCVEDSGPGLPAAEQHRLGER
FT                   FFRVEGTDQSGSGLGWSIVHRIAAVHGASVTVDRSPGLGGLRVDVIWSNLTSSGSGTHQ
FT                   "
FT   gene            610320..611246
FT                   /locus_tag="Rpic_0577"
FT   CDS_pept        610320..611246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0577"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /note="TIGRFAM: cation diffusion facilitator family
FT                   transporter; PFAM: cation efflux protein; KEGG:
FT                   reu:Reut_B5170 cation efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25728"
FT                   /db_xref="GOA:B2U6M4"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR027470"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:B2U6M4"
FT                   /protein_id="ACD25728.1"
FT                   /translation="MQQIKEIDLEIAADSEDSVAKQAAARRSTLVSVAVNLGLTIAQVA
FT                   AGMLAGSQALIADAIHSLSDLISDFVVLFASHHSQKGPDQTHHYGHQRFENAASLVLGL
FT                   LLLAVGVGMLWNAVLKLEHAEAIQPVRLIGLWVALGALAAKELLFRYMLAVAERVRSSM
FT                   LVANAWHARSDAASSLVVALGIVGNVLGYRLLDPVAALVVGLMVTRMGWQFGWEALHDL
FT                   MDRAVDEETVEAIHQVMLATTGVLGVHDVKTRRMGDMILVDAHLEVDARVSVREGHDIA
FT                   LEARRRVMERRDVLNLMTHVDPVDVPL"
FT   gene            611980..612270
FT                   /locus_tag="Rpic_0578"
FT   CDS_pept        611980..612270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0578"
FT                   /product="chaperonin Cpn10"
FT                   /note="PFAM: chaperonin Cpn10; KEGG: rso:RSc0641
FT                   co-chaperonin GroES"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25729"
FT                   /db_xref="GOA:B2U6M5"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/TrEMBL:B2U6M5"
FT                   /protein_id="ACD25729.1"
FT                   /translation="MNLRPLHDRVIVKRLDNETKTASGIVIPDAAAEKPDQGEVLAVGP
FT                   GKKDDKGNAIALDVKVGDRVLFGKYAGQGVKVDGQEVLVMREEDIMAVVAK"
FT   gene            612375..614018
FT                   /locus_tag="Rpic_0579"
FT   CDS_pept        612375..614018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0579"
FT                   /product="chaperonin GroEL"
FT                   /note="TIGRFAM: chaperonin GroEL; PFAM: chaperonin
FT                   Cpn60/TCP-1; KEGG: rso:RSc0642 chaperonin GroEL"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25730"
FT                   /db_xref="GOA:B2U6M6"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/TrEMBL:B2U6M6"
FT                   /protein_id="ACD25730.1"
FT                   /translation="MAAKDVVFGDAARAKMVEGVNILANAVKVTLGPKGRNVVLERSFG
FT                   GPTVTKDGVSVAKEIELKDKLQNMGAQMVKEVASKTSDNAGDGTTTATVLAQSIVREGM
FT                   KYVAAGMNPMDLKRGIDKAVGAAVEELKKISKPTTTSKEIAQVGAISANSDESIGQRIA
FT                   EAMDKVGKEGVITVEDGKSLADELDVVEGMQFDRGYLSPYFINNPEKQVVQLDNPFVLL
FT                   FDKKVSNIRDLLPILEQVAKAGRPLLIIAEDVEGEALATLVVNNIRGILKTAAVKAPGF
FT                   GDRRKAMLEDIAILTGGQVIAEEVGLTLEKATLNDLGQAKRVEIGKENTTIIDGAGDAR
FT                   NIEARVKQVRAQIEEATSDYDREKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDA
FT                   LHATRAAVEEGIVAGGGVALLRARALISGLKGANADQDAGIKIVLRAMEEPLRQIVTNA
FT                   GDEASVVVANVIAGQGNYGYNASTGEYGDLVEMGVLDPTKVTRTALQNAASVASLMLTT
FT                   DCAVAELPKDDAAPAMPGGMGGMGGMDGMM"
FT   gene            614249..615322
FT                   /locus_tag="Rpic_0580"
FT   CDS_pept        614249..615322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0580"
FT                   /product="protein of unknown function DUF898 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF898
FT                   transmembrane; KEGG: rso:RSc0643 probable transmembrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25731"
FT                   /db_xref="GOA:B2U6M7"
FT                   /db_xref="InterPro:IPR010295"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B2U6M7"
FT                   /protein_id="ACD25731.1"
FT                   /translation="MNDIARESVLGSAPAPAAPQPLRLRFIGSGSEYFRIWIVNLLLTI
FT                   VTLGIYSAWAKVRTLQYFYRNTQLAGSSFDYHGSPIAILKGRAIIFVLAFAFNLLGHSS
FT                   PLLGLALLIVMAAAFPWLLVRSLRFRMANSSYRGLRFAFTGKDAEGYMVFLVWPILSVL
FT                   SLYLLAPLAHQRFKRFQHKNTRFGTAQFDFSGTPGNFYGVYLRTFGLAILALVVASCLA
FT                   LLLGVSLHRAPGVGQIFGFILIGLFMYAAMLFLTPYFLSRLQNVVWNHTTLGAHRFQSQ
FT                   VGAGKLFWIFVSNAVLILITIGLFTPFARVRTARYKLDSVTMIAAGSLDTFVAGETTNV
FT                   GALGDATVDWYDIDIAL"
FT   gene            615350..616435
FT                   /locus_tag="Rpic_0581"
FT   CDS_pept        615350..616435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0581"
FT                   /product="peptidase M48 Ste24p"
FT                   /note="PFAM: peptidase M48 Ste24p; KEGG: rso:RSc0644
FT                   putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25732"
FT                   /db_xref="GOA:B2U6M8"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:B2U6M8"
FT                   /protein_id="ACD25732.1"
FT                   /translation="MILATYFDGRTSRAQPVRLAVEAGEAVLFEPEGTVLRRAPLATLR
FT                   VSERVKHAPRLITFEDGAFCEITDPAEQTSLNALLHRTGYREGWVVRAQNSWKLALGSL
FT                   LAMVVVLALGYRYGLPWGAKVMAGMVPQRAEAQLGRSTLKAMDERWLRPSKLPAALQDR
FT                   IRARFAALHKPPQATHTYHIVFRDADIGANAFALPGGDIVVTDALVKLVGEGDGLTGVL
FT                   AHEAGHVEYRHGLRQVIQSSAIGATAALLFGDVSTILSGVPAALLTLRYSRDYERDADR
FT                   YAALLLQENGLSVAAFADVLQALEDTHGGTRKADAAKKTDAASDDDAAAFFSSHPLTRE
FT                   RIDTLRRFDRTHGGSDNNDAD"
FT   gene            616635..617000
FT                   /locus_tag="Rpic_0582"
FT   CDS_pept        616635..617000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0582"
FT                   /product="GtrA family protein"
FT                   /note="PFAM: GtrA family protein; KEGG: rme:Rmet_0658
FT                   GtrA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25733"
FT                   /db_xref="GOA:B2U6M9"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="UniProtKB/TrEMBL:B2U6M9"
FT                   /protein_id="ACD25733.1"
FT                   /translation="MMVIRVFRFGVSGVAATGMHVAIATTLINGFSASQVTANGVAFVC
FT                   ANVCSYLLNALWSFSAKPGRANFLRFYAVSLLCLALTLAISWLAQTLGLSYWVGLAVIL
FT                   SVVPPLTFLMHRFWTFR"
FT   sig_peptide     616635..616709
FT                   /locus_tag="Rpic_0582"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.954) with cleavage site probability 0.942 at
FT                   residue 25"
FT   gene            617222..618466
FT                   /locus_tag="Rpic_0583"
FT   CDS_pept        617222..618466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0583"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: reu:Reut_A2655 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25734"
FT                   /db_xref="GOA:B2U6N0"
FT                   /db_xref="InterPro:IPR028087"
FT                   /db_xref="UniProtKB/TrEMBL:B2U6N0"
FT                   /protein_id="ACD25734.1"
FT                   /translation="MRTHTKQRERGAVLPMVGLMLAVLLGMAGLVIDLSGLFVAKTELQ
FT                   SAVDSCALSAAQELDGASDALTRATNAGVTAGNANRVVYQASSASLANADVTFSTALNG
FT                   TYSAAGVASSSSSYVKCKHSKSGITARLIKFVGGANSYAVAALAVATRVHAQSTCPIPV
FT                   ALIPKTGGTAPNYGFQVGEWVSMLYSGGSTTPGEMGWYNLDGSTNANETKTEMDQGYCN
FT                   SKIGDQLGTPGAKVSVDDNWNARFGIYKNKSNASQLQPDFTGYSYTSTNWTNTVPQNAY
FT                   SGTPASGSDKSAANFKNKRLAYANYDDTGTSVSGGDKITGLNVKGGYKNLATSGSSGDL
FT                   ATYGVNRRVVLVPVISSASKIIDYACMLMLQPIDGVHNTPQFEFLGNAGSASSPCSPSG
FT                   LAGGSKGPLVPALVQ"
FT   sig_peptide     617222..617308
FT                   /locus_tag="Rpic_0583"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.925) with cleavage site probability 0.844 at
FT                   residue 29"
FT   gene            618476..618973
FT                   /locus_tag="Rpic_0584"
FT   CDS_pept        618476..618973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0584"
FT                   /product="TadE family protein"
FT                   /note="PFAM: TadE family protein; KEGG: reu:Reut_A2654
FT                   TadE-like"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25735"
FT                   /db_xref="GOA:B2U6N1"
FT                   /db_xref="InterPro:IPR012495"
FT                   /db_xref="UniProtKB/TrEMBL:B2U6N1"
FT                   /protein_id="ACD25735.1"
FT                   /translation="MKTRQRQHGVALVELAIMLSLLLAITFGITEFGRAIYTYNTLAKA
FT                   TRDATRYLSTQAAGNATSYATATNLAVYGTPTVGSKQAPLVPGLTSSMVSICDASNTSC
FT                   TSNIAQGTNPAINTVTVTISGYTFNPVIDMMAFLRFYAGGKGSITSFPFGNISVTMRQS
FT                   YE"
FT   gene            618966..619412
FT                   /locus_tag="Rpic_0585"
FT   CDS_pept        618966..619412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0585"
FT                   /product="TadE family protein"
FT                   /note="PFAM: TadE family protein; KEGG: reu:Reut_A2653
FT                   TadE-like"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25736"
FT                   /db_xref="GOA:B2U6N2"
FT                   /db_xref="InterPro:IPR012495"
FT                   /db_xref="UniProtKB/TrEMBL:B2U6N2"
FT                   /protein_id="ACD25736.1"
FT                   /translation="MNKHQKGTTAVEFAIVVALFLTVLLGILDFGRILFTWNAVGEATR
FT                   WGARQAVVCGQGSTSVLGKMQTILPTLTSANVSVQWYDTSGAVSTSCDATSCGGVAVSV
FT                   TGMTVAPYSPATWIGFSRLAVPGFSTYLPREIMGQDPNSSSVCS"
FT   gene            complement(620247..621209)
FT                   /locus_tag="Rpic_0586"
FT   CDS_pept        complement(620247..621209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0586"
FT                   /product="type II secretion system protein"
FT                   /note="PFAM: type II secretion system protein; KEGG:
FT                   rme:Rmet_0639 type II secretion system protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25737"
FT                   /db_xref="GOA:B2U6N3"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:B2U6N3"
FT                   /protein_id="ACD25737.1"
FT                   /translation="MQALYSNQYFILVLIFVAAFGGALGLLHLFSPNRARGRIQQIGGQ
FT                   TVGADLAGGPDHAWVEKLATWAKPVSQLSLPKDGWENSQLRIRFMNAGWRQPWAPSLYF
FT                   AVKTVLAILLPLAALLVLSSRPEHHDQEVVLAVLGLLSAIGYYLPNAALARKVEHRQRD
FT                   VFEEFPDMLDLLTVCVEAGLGLDAAMMRVSDELALRCPVMAEEMELTLLELRSGFPKEK
FT                   ALTNLALRTGVEDVDRFASMLIQADRFGTSLADSLRVLSDMLRTKRRMRAEEQAAKIAL
FT                   KLLFPLIFFIFPTLLLVLLGPAFIQIYRVLLPTMTASGG"
FT   gene            complement(621275..622252)
FT                   /locus_tag="Rpic_0587"
FT   CDS_pept        complement(621275..622252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0587"
FT                   /product="type II secretion system protein"
FT                   /note="PFAM: type II secretion system protein; KEGG:
FT                   reh:H16_A0710 flp pilus assembly protein TadB"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25738"
FT                   /db_xref="GOA:B2U6N4"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:B2U6N4"
FT                   /protein_id="ACD25738.1"
FT                   /translation="MNEIFYAFAILLFAAVVLCIEGVYQWWNNYHGPEAKRVDARIRAL
FT                   SAGGHIGTEQLSILKKRLLSESPQFQRWLMSLPRVSTIDRWLEQSGSAWSVAQLLGYTI
FT                   LTGAGVLAVGALLPVPFGIVTACALLMSALPVLHIASQRRKRLKKLEAQLPDAVDMIAR
FT                   ALRAGHSFASALGMVGQEIKEPMGPEFHTTFEEINYGVSLDEALTNLAKRVPVNDLRYF
FT                   VIAVLIQRESGGNLAEILDTIGNLVRERLKLYDKIRVLSAEGRLSAWILGLLPFCTAGM
FT                   ILLVNPDFMKVLWTDPMGLKMIGLALFNMVMGLIWMRKIIRIRV"
FT   gene            complement(622317..623681)
FT                   /locus_tag="Rpic_0588"
FT   CDS_pept        complement(622317..623681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0588"
FT                   /product="type II secretion system protein E"
FT                   /note="PFAM: type II secretion system protein E; KEGG:
FT                   rme:Rmet_0641 type II secretion system protein E"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25739"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2U6N5"
FT                   /protein_id="ACD25739.1"
FT                   /translation="MSIREQLSRPEHGPLSMNGHAPHHHNVAGHPAYRDFKKTVHEVVL
FT                   DRVDLERLARFPIEQVRHEIGTLVNNIIDEEKLLLNDTERRQMTTDVYDEMFGFGPLEP
FT                   LLQDPTVSDILVNTAKQVYVERRGKLELTDVTFYDDAHLMKVIEKIVSRVGRRIDETSP
FT                   MVDARLPDGSRVNAIIPPSAIDGPLLSIRRFATNPLQVSDLIDLKTLTPPMAKLMQALS
FT                   QAKVNVLVSGGTGSGKTTLLNILSGFIPADERMVTIEDAAELQLRQPHVLRLETRPPNI
FT                   EGKGEITQRALVRNALRMRPDRILLGEVRGGEALDMLNAMNTGHEGSLTTVHANTPRDA
FT                   LTRMENMVNMAGLNLPPKTIRQQIASAITVIIQVARLTDGRRKVISIQEITGMEGDVIN
FT                   MQEIFTFQRTGIAQDGSVKGHFRATGVYPKFAERLRVFGVGLPDETFDPQRHFEV"
FT   gene            complement(623721..624929)
FT                   /locus_tag="Rpic_0589"
FT   CDS_pept        complement(623721..624929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0589"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   reh:H16_A0712 flp pilus assembly ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25740"
FT                   /db_xref="GOA:B2U6N6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2U6N6"
FT                   /protein_id="ACD25740.1"
FT                   /translation="MLKILIASEDGERLADLARLVAAAGSYQVMHLHAAPGSLSTHACQ
FT                   LRGADALIIDQPSGGPSQMLSIELLRQQFADLPCILVTQTQERDDLIRALRAGVSDILT
FT                   WPLERAQLTTALTRLETNHTPRTREEARVIAFISSKGGAGSSFIASNVGYTLAAHEHKR
FT                   VLLIDLNTQFSDTHFLVSNKTPPATLSEVCAQVDRLDDAFLEACLTRVAKDFDVLAGAS
FT                   DPIKAGEIKKDKIEYVLSLVSPIYDFILVDVGQAINPLSIAVLDHCDQICVVVQPTIAF
FT                   ARTGRRLLDILHGLHYPPEKLRILVNRHGKRDELPRSTLEQVFGQKLFHVLPEDAAAVD
FT                   DSICQGMPIAQHHRSSAMTKALMALGNVFATARENDRHASQEKGFSLSKFFSRAKTSSP
FT                   NIA"
FT   gene            complement(625046..625384)
FT                   /locus_tag="Rpic_0590"
FT   CDS_pept        complement(625046..625384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0590"
FT                   /product="putative lipoprotein"
FT                   /note="KEGG: rme:Rmet_0646 putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25741"
FT                   /db_xref="UniProtKB/TrEMBL:B2U6N7"
FT                   /protein_id="ACD25741.1"
FT                   /translation="MNTNLKYLQRAALVILACQALTACMTTTPNWDKHFGEAVTSVKQA
FT                   QVINPDAPAGLPALDGYDGKAAVAAMSNYDRSMTRFPAGGTGTGSGGYGGFGGSGYGGS
FT                   GMSGSFSR"
FT   sig_peptide     complement(625313..625384)
FT                   /locus_tag="Rpic_0590"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.891) with cleavage site probability 0.626 at
FT                   residue 24"
FT   gene            complement(625410..627401)
FT                   /locus_tag="Rpic_0591"
FT   CDS_pept        complement(625410..627401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0591"
FT                   /product="type II and III secretion system protein"
FT                   /note="PFAM: type II and III secretion system protein;
FT                   transport-associated; KEGG: rme:Rmet_0647 type II and III
FT                   secretion system protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25742"
FT                   /db_xref="GOA:B2U6N8"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR032789"
FT                   /db_xref="UniProtKB/TrEMBL:B2U6N8"
FT                   /protein_id="ACD25742.1"
FT                   /translation="MKTNQKTNGANVTLRGVQVLGSTRMLILASAAGAMLCMPTHATAQ
FT                   AAMEAGAVAKSTTAPVVMQSRAGASAPVQMTISMNPALATAPVADVRGPNCTGAVRGES
FT                   SVVVPVGKSSLISLPEPVRNRTLGNPAVVQATMVSPQSMYLLGRSVGTTNMIVQGRSGA
FT                   CSIVNVVVNADAGGLQTSLAQLMPGENKIRVMTAADSLVLAGNVSSAQAAQQAMEIAHA
FT                   YAASAQSGADKGGGAAGALGGGGAAGGANVINMMIVDTPQQVMLEVKVAEVSKTLLNQL
FT                   GSALNVQGGFGSWSGGLLTSLLTGSSTGFFANKANNRPFQVELDAQKNDSLVKILAEPN
FT                   LVTLSGQEASFLAGGKIYIPVAQSSSSGGAPTITLQEEEYGVGLKFTPTVMANGRINLK
FT                   VAPEVSELSPTGATVTGANTNGQTILPLITTRRASTTVQMRDGESFAIGGLLQDNARGS
FT                   LKALPGAGEIPVLGTLFRSTQFQHDLTELVIVITPRLVQPMQTASYPLPTDSFSTPNEL
FT                   AVYLTGNMEGSGAKNRAAKPATAAAPATAPQVPAQVPSAPAAPSSQAPMPAPVAPAPVA
FT                   PVIPAPRTEVSIAPPTQPANGAPEKPAAAQPVWETAPVTTSATAPTDDNAARVARIEAT
FT                   AARLAQARTKTQGRQTAVADTTTTPQTR"
FT   sig_peptide     complement(627267..627401)
FT                   /locus_tag="Rpic_0591"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.522 at
FT                   residue 45"
FT   gene            complement(627517..628368)
FT                   /locus_tag="Rpic_0592"
FT   CDS_pept        complement(627517..628368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0592"
FT                   /product="Flp pilus assembly protein CpaB"
FT                   /note="TIGRFAM: Flp pilus assembly protein CpaB; PFAM: SAF
FT                   domain protein; KEGG: reh:H16_A0718 flp pilus assembly
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25743"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="InterPro:IPR017592"
FT                   /db_xref="InterPro:IPR031571"
FT                   /db_xref="UniProtKB/TrEMBL:B2U6N9"
FT                   /protein_id="ACD25743.1"
FT                   /translation="MKNARAIVMLIVALVAGIAAVVSASRWLSQQSTSSVKQVVVAASD
FT                   MDLGQPLGNEQLRTVSWPAGSLPPGTFDDPKALQGRVVRASLQKGEPILENKLAPIGTK
FT                   GGLSAVIAEGKRAITVRVNDVVGVAGFALPGNLVDVIVNTNEDAKSASNNNNSISKIVL
FT                   EKILVLAVAQQVSRDDTQPKVVNAVTLEVTPDQAEKLDVARSVGTLSLVLRNQVDVAAT
FT                   ATGGATKGTLLGTPAAEPAPKVVMVSTTRATAKVRHVASGPIRQRDCIGVLAGVQGSME
FT                   CF"
FT   sig_peptide     complement(628294..628368)
FT                   /locus_tag="Rpic_0592"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.558 at
FT                   residue 25"
FT   gene            complement(628418..629917)
FT                   /locus_tag="Rpic_0593"
FT   CDS_pept        complement(628418..629917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0593"
FT                   /product="ATPase with chaperone activity"
FT                   /note="KEGG: reh:H16_A0719 predicted ATPase with chaperone
FT                   activity"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25744"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2U6P0"
FT                   /protein_id="ACD25744.1"
FT                   /translation="MRDLHIWARTSYSLSQMVMKMIGDQKIEHTEFGHAQHAPRSLEAV
FT                   PSPTGLDAARREPAAPWHILPRTVAETGLDISLLLGLLMKVAYLHRSATLVMLMDTIKL
FT                   PAMVINEVAAYAVRERMLEVAHRGANDLDVRFHLTDAGYVRAAEFTARCSYVGAAPVTL
FT                   EAYVESVQRHSIQFASLSKTDVTAAFSTFVMPPDLLDDVGVALNTSRALMLYGPAGGGK
FT                   TYLAQHLGMLLPGTVPVPYAITIAGEIIQIFDPLVHVAQEDEDGPVARRPLDRRWQMCH
FT                   RPAVLSGGELTLEMLELRYDGTTGFYQAPPHMKANCGIYIVDDLGRQQVGVSELLNRWI
FT                   VPLDRRVDMFSLRNGVRFSVPFDVWPVFSTNLEPAQLGDDAFLRRLGSKLYVGPLSVAD
FT                   YREVYLRAAQDLGLQNADAAFDYLREALHEVSGKPLLACIPRDLLRLVASAVQYHGGPS
FT                   EVTAEALRRAWDIYFCSHTDFKATDSMSAGMGWRQDKQAHT"
FT   gene            complement(629917..630462)
FT                   /locus_tag="Rpic_0594"
FT   CDS_pept        complement(629917..630462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0594"
FT                   /product="peptidase A24A prepilin type IV"
FT                   /note="PFAM: peptidase A24A prepilin type IV; KEGG:
FT                   rme:Rmet_0650 peptidase A24A, prepilin type IV"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25745"
FT                   /db_xref="GOA:B2U6P1"
FT                   /db_xref="InterPro:IPR000045"
FT                   /db_xref="UniProtKB/TrEMBL:B2U6P1"
FT                   /protein_id="ACD25745.1"
FT                   /translation="MNDATLLSSMIGPVAMGVALIAAAIDAQHRRIPNWLTFGAWLAAL
FT                   PLQVAVHGFGNGALEWTCGWLTGLAIFLPFYLLRGMAAGDVKLMAAVGAWLGAFMAFEI
FT                   AMATFVIGGIWALLFTLRHKRMAQLRRNLRDVLLTSGQVSREAGAPTPQADASWSVGTL
FT                   PYGVAIAAGTIAVLFASA"
FT   sig_peptide     complement(630388..630462)
FT                   /locus_tag="Rpic_0594"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.931) with cleavage site probability 0.578 at
FT                   residue 25"
FT   gene            complement(630552..630722)
FT                   /locus_tag="Rpic_0595"
FT   CDS_pept        complement(630552..630722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0595"
FT                   /product="Flp/Fap pilin component"
FT                   /note="PFAM: Flp/Fap pilin component; KEGG: rme:Rmet_0651
FT                   Flp/Fap pilin component"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25746"
FT                   /db_xref="GOA:B2U6P2"
FT                   /db_xref="InterPro:IPR007047"
FT                   /db_xref="UniProtKB/TrEMBL:B2U6P2"
FT                   /protein_id="ACD25746.1"
FT                   /translation="MHKPINPRKWLRDDQGVTSIEYALLGSLIAIVILGSVVALGSGVK
FT                   SLYEMIAAAIP"
FT   gene            complement(630769..630939)
FT                   /locus_tag="Rpic_0596"
FT   CDS_pept        complement(630769..630939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0596"
FT                   /product="Flp/Fap pilin component"
FT                   /note="PFAM: Flp/Fap pilin component; KEGG: rme:Rmet_0652
FT                   Flp/Fap pilin component"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25747"
FT                   /db_xref="GOA:B2U6P3"
FT                   /db_xref="InterPro:IPR007047"
FT                   /db_xref="UniProtKB/TrEMBL:B2U6P3"
FT                   /protein_id="ACD25747.1"
FT                   /translation="MNRYSTLLQQFLYDEQAVTAIEYGLIAALIAVVIIASVQLVGTNL
FT                   STVFSNIAAAL"
FT   gene            complement(631088..631255)
FT                   /locus_tag="Rpic_0597"
FT   CDS_pept        complement(631088..631255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0597"
FT                   /product="Flp/Fap pilin component"
FT                   /note="PFAM: Flp/Fap pilin component; KEGG: rme:Rmet_0653
FT                   Flp/Fap pilin component"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25748"
FT                   /db_xref="GOA:B2U6P4"
FT                   /db_xref="InterPro:IPR007047"
FT                   /db_xref="UniProtKB/TrEMBL:B2U6P4"
FT                   /protein_id="ACD25748.1"
FT                   /translation="MNYLNALKQFARDEDGVTAIEYGLIAALIAVVIIASVKLVGQNLS
FT                   TVFSNIAAAL"
FT   gene            632221..633492
FT                   /locus_tag="Rpic_0598"
FT   CDS_pept        632221..633492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0598"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rme:Rmet_0654 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25749"
FT                   /db_xref="GOA:B2U6P5"
FT                   /db_xref="InterPro:IPR018584"
FT                   /db_xref="UniProtKB/TrEMBL:B2U6P5"
FT                   /protein_id="ACD25749.1"
FT                   /translation="MSQRSVRLPATRSAAAAIRATVEHAAGHWIDLARVRAYSGALLVL
FT                   FCVLLLGWAWTSNGFTDVTMARPGTDFSAFWGASYLALTQGPLQAYDVRQLTAVIAEHG
FT                   TLGRGAELILPWLYPPTFLLMVLPLSLLPLTLSYLLFLAGTGLVYFKSIGMLTGAQHPW
FT                   RQGLWLPVLAAPATLITILAGQNSLLTAGVAGAAVYHLNKRPVLAGVLIGLLAIKPQLA
FT                   VLFPLALVISRAWKALASALLTTVVFASVSVLVCGWRTVPAFLANAQWVRASFIEGGAN
FT                   LWWGMPTPIAAARLAGASVTGAYAVQVLTALAMAAAMAYVWRRTTAFELRAAALAIATL
FT                   MVSPYLRDYELTWLGLAIAGLVGDGVRDDSANGLSSGDRALLVVAWLLPLYEHANPYLK
FT                   LPQFGPAVLIAMMALVVRRVATRA"
FT   gene            633500..634816
FT                   /locus_tag="Rpic_0599"
FT   CDS_pept        633500..634816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0599"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rme:Rmet_0655 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25750"
FT                   /db_xref="GOA:B2U6P6"
FT                   /db_xref="InterPro:IPR018584"
FT                   /db_xref="UniProtKB/TrEMBL:B2U6P6"
FT                   /protein_id="ACD25750.1"
FT                   /translation="MAVALNLLKHRAPEATTAPPETAPGARHWLGPDRVRVYSMAALAC
FT                   YVAYFVIWAVRASVLKVAGVFPLGGDFLVFWSAAQLVLQGHPPAAYDVAVLHNVELATV
FT                   PLVATTQGLLPWFYPPTFLPFIAPFGLLPYWLAVLVFLSMSVGCFLWVVGRIVLWRQAW
FT                   LPCAAFPGIAVVLATGQNALLLAACAGLALTLLHSPRPKRPPSPIAAGMLLALLTVKPQ
FT                   LAVMFPVALMCAGAWKTLIAMALTSLALAVLALAAFGPQSFIAFLHNAALARSAVEAGA
FT                   VHLERMPTLFAMVKMLHGSVMLAYVLHLIGGFTACAAVAYAWSRPCSFALRAAAVLTAS
FT                   MLASPYLYDYDLAFLGLAIAWLASYALRDGWLPGEREGLILLWLLPLGGMLLIDRLGFQ
FT                   LMPLVLLLALAHIARRIHLERTRNASRSRVPRRLGRGEQ"
FT   gene            634816..635829
FT                   /locus_tag="Rpic_0600"
FT   CDS_pept        634816..635829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0600"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   rme:Rmet_0656 glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25751"
FT                   /db_xref="GOA:B2U6P7"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B2U6P7"
FT                   /protein_id="ACD25751.1"
FT                   /translation="MLDYKRNQLLSLVVPFYNEGEALESFFARVVPILESVEFMQFEIV
FT                   CVNDGSKDDTLQKLIAVSRMDERVRVIDLTRNFGKEAALTAGIDEALGDAVIPIDADLQ
FT                   DPPELIPTLVAHWQKGAEVVLAQRASRACDTFLKRVTAAAYYRVHNTLSDLKLPENVGD
FT                   FRLMDRAVVNALKQLPERHRFMKGLFAWVGFNTVIVPYEREARSAGQSKFSGWRLWNFA
FT                   LEGITSFSTWPLRSWTYIGLAIASLAFVYGSYIIARTMVLGVDVPGYASLLSLLLFFGG
FT                   LQLIGLGVVGEYIGRIYDEAKGRPIYLVKRRYQERRLRNRLTGERRVIQMVRGQRG"
FT   gene            complement(636086..637147)
FT                   /locus_tag="Rpic_0601"
FT   CDS_pept        complement(636086..637147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0601"
FT                   /product="acyltransferase 3"
FT                   /note="PFAM: acyltransferase 3; KEGG: azc:AZC_3119 putative
FT                   acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25752"
FT                   /db_xref="GOA:B2U6P8"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:B2U6P8"
FT                   /protein_id="ACD25752.1"
FT                   /translation="MRTTVTSLEGLRGVAALFVVFHHMCYAPPHRQFDSAYLCVDLFFV
FT                   LSGFVICRAYGGQLTSRTQLRTFAIRRVGRLWPAHIATSALAIAFAYRVPSVGEVLALV
FT                   TMSQGLNLFPNGVGNLVGWSISDEMFVYLAFGALCFLLQGKARIAGFAALALIGYALAV
FT                   WITLSIDRCMLTGKCLGMTFNFGWTRCLAGFFIGALICEFRDRVAALARGRAIQLTASA
FT                   ASLSMVMFANDLPGSALFAPLVFATLIGSLLADRGPIANLLQTRPAQYLGKVSYALYLG
FT                   HGVWFLQMLSATTGTGLNDRLIPYALFLFWTFGIAHLLHKYVEVPFRDRFNRWAQSSAQ
FT                   ATPVYSQIKEPQQ"
FT   gene            complement(637157..638257)
FT                   /locus_tag="Rpic_0602"
FT   CDS_pept        complement(637157..638257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0602"
FT                   /product="acyltransferase 3"
FT                   /note="PFAM: acyltransferase 3; KEGG: azc:AZC_3119 putative
FT                   acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25753"
FT                   /db_xref="GOA:B2U6P9"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:B2U6P9"
FT                   /protein_id="ACD25753.1"
FT                   /translation="MNRSFEGLRGIAALFIVVHHMFCAWPHPLSANAYLAVDLFFVLSG
FT                   FVISSACGPQLSNLASLRTFMIRRIGRLWPTHIATTVLALIVARHLPAFGETLALATMS
FT                   QGLNVFQAGIGNAVSWSAGDEMYVYLLFGAGCILMRGRTRMVVFAALALTAWPLAAWIE
FT                   IDRACLLQGGCLSKLVHQFGWLRCIAGFFIGALIYEFRDRLIPWASHPVFQVTAFSAAL
FT                   FLLISADALPGSALTAPLTFGALIGALISDRGPVSRILQTPAAQYLGKVSYPLYLTHGV
FT                   MLPLVVSMPADVGLKQQLVTYALFLFWAFASTSLLHNYVELPFRNRFNRWAQAMPGAAI
FT                   PTAQGVAGVRLHEHQHSVIGNQNKQA"
FT   gene            complement(638254..639582)
FT                   /locus_tag="Rpic_0603"
FT   CDS_pept        complement(638254..639582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0603"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rme:Rmet_0657 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25754"
FT                   /db_xref="GOA:B2U6Q0"
FT                   /db_xref="InterPro:IPR018584"
FT                   /db_xref="UniProtKB/TrEMBL:B2U6Q0"
FT                   /protein_id="ACD25754.1"
FT                   /translation="MSVSQQGTARVDPAPKSRGGGWQGSRRLYVYGGALLFLEYFLLGV
FT                   WWWGHHILQNTTIPSPGWDLAVFWSAANLAITHGATTAYDWGLLRATEAAILPPDIFGP
FT                   FSYPPTFLLLIYPIGVLSFGAATVAFSGCGIALYLGMLNKTLRSVPGALRLPWLIPALA
FT                   FPGVWVTLVTGQNSLFTAAAAGAALVLLRRSPVAAGACIAMLCIKPQLGILFPLYLLCE
FT                   RQWRTLAAAAFFSTLTLAVSWLAFGTATFVAAARSMAMFRHAIVENGGVILYGAPTVFG
FT                   TLRSAGYSTTVSYAAHAGVAMLVIAVCVWLWRSACRFELRAASLPVATLMVQPYLIYYD
FT                   LAWLALPMAWLAVDFVRYSSNRFENAVLLAAWLVPAQGLFAVLSHRTGQWAPIVLVALL
FT                   AIIVRRARAPQRVIAPHESFDAATPPVAAIGAHASNPARGTTA"
FT   gene            complement(639628..641007)
FT                   /locus_tag="Rpic_0604"
FT   CDS_pept        complement(639628..641007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0604"
FT                   /product="sigma54 specific transcriptional regulator, Fis
FT                   family"
FT                   /note="PFAM: sigma-54 factor interaction domain-containing
FT                   protein; helix-turn-helix Fis-type; SMART: AAA ATPase;
FT                   KEGG: rme:Rmet_0659 sigma54 specific transcriptional
FT                   regulator, fis family"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25755"
FT                   /db_xref="GOA:B2U6Q1"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2U6Q1"
FT                   /protein_id="ACD25755.1"
FT                   /translation="MNAYINRPLLYVSLRHDATRCRYLAQQGWQLLFANNRRDLEALNL
FT                   CEESVLGGLLDLDCGYSDTELEELEPWLARQNIGWIGVVGNGDMLSDPMRKLLGLYFVD
FT                   YYNIPCDSAELAHALGHAVGMAHLRPAATLTRDTLRPDGMIGNCLAMQGLFRGIEKVSK
FT                   WDTPVLVSGESGTGKELAARAIHCASRRAGQPFIAVNCAAIPPTLLMSELFGYERGAFT
FT                   GAVKRKPGRIEMAHGGTLFLDEIGDMPLESQTSLLRFLETGCIERLGGTESVAVDVRVI
FT                   SATHVDLEAAIAAERFRGDLYHRLCVLRVKQPALRERDTDILLLAEHILNSVRSHSPEH
FT                   IKGFSPTALRALSVHTWPGNVRELINRIRHAAAMCEDGIIKPADLDLQPPVEPSRPPTL
FT                   AEAREAAERCAVKEALQRNHERLIDVAEELGISRVTLFRMMREHKLQIRKGELGMVCVQ
FT                   G"
FT   gene            complement(642134..642658)
FT                   /locus_tag="Rpic_0605"
FT   CDS_pept        complement(642134..642658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0605"
FT                   /product="protein of unknown function DUF477"
FT                   /note="PFAM: protein of unknown function DUF477; KEGG:
FT                   rso:RSc0662 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25756"
FT                   /db_xref="InterPro:IPR007621"
FT                   /db_xref="UniProtKB/TrEMBL:B2U6Q2"
FT                   /protein_id="ACD25756.1"
FT                   /translation="MASTTRHHHGARRALTHLLTTSSHARRAFPPADLQKLEAAVREGE
FT                   QHHRGEVRVVIESSLPVRDAWAGMSPRHRARTLFGLLEVWNTREHVGVLLYINLADHAV
FT                   EILADHGIAAKVDAHAWRTICATITRGFAQRVTMAPVLDALAQINDLLAAHVPSDGTPR
FT                   TNELSDRPVVL"
FT   gene            complement(642674..643537)
FT                   /locus_tag="Rpic_0606"
FT   CDS_pept        complement(642674..643537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0606"
FT                   /product="protein of unknown function DUF477"
FT                   /note="PFAM: protein of unknown function DUF477; KEGG:
FT                   rso:RSc0663 putative glycine rich transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25757"
FT                   /db_xref="GOA:B2U6Q3"
FT                   /db_xref="InterPro:IPR007621"
FT                   /db_xref="UniProtKB/TrEMBL:B2U6Q3"
FT                   /protein_id="ACD25757.1"
FT                   /translation="MSMRARACFTLLLTVALWLATALPARAQSDMVAVPPLAARVTDLT
FT                   GTLSAEQKSALEQVLADYEQQRGSQIFVLMVPSTAPEPIEAYGIRVADAWKAGRKGVDD
FT                   GAIILIAKDNPASLRKMRIEVGRGLEGALTDAQSKRVLQDVMAPHFRQGDFYGGLSAGI
FT                   SAIQTVIALESLPPAERAKRQQSGGGIGDWLPVLFPLAIIVFFVLSAAMRSGGRVTGSL
FT                   PGRPGSRVVMGNRGWGPGTIGGLGGGLGGGWGRGGGDFGGGGGGGGGFSGGGGGDFGGG
FT                   GASGNW"
FT   sig_peptide     complement(643454..643537)
FT                   /locus_tag="Rpic_0606"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.993 at
FT                   residue 28"
FT   gene            complement(643551..644177)
FT                   /locus_tag="Rpic_0607"
FT   CDS_pept        complement(643551..644177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0607"
FT                   /product="LemA family protein"
FT                   /note="PFAM: LemA family protein; KEGG: rso:RSc0664
FT                   probable lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25758"
FT                   /db_xref="InterPro:IPR007156"
FT                   /db_xref="InterPro:IPR023353"
FT                   /db_xref="UniProtKB/TrEMBL:B2U6Q4"
FT                   /protein_id="ACD25758.1"
FT                   /translation="MTPALTFRSTRFSVLRWLALSLAVLAAPFLSACGYNDFQAKDEAT
FT                   KAAWAEVVNQYQRRADLIPNLVNTVKGYASHEKDTLEAVTKARAAATSFQITPEVLNDP
FT                   AAFQKFQQVQGELSSALSRLMAVSENYPQLKADQSFRDLQSQLEGTENRITVARQRYIK
FT                   SVQDYNVLTRSFPTNLTAKVMGYQVKPNFTVENEKGISTAPAVKF"
FT   sig_peptide     complement(644079..644177)
FT                   /locus_tag="Rpic_0607"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.796 at
FT                   residue 33"
FT   gene            complement(644283..644486)
FT                   /locus_tag="Rpic_0608"
FT   CDS_pept        complement(644283..644486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0608"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25759"
FT                   /db_xref="UniProtKB/TrEMBL:B2U6Q5"
FT                   /protein_id="ACD25759.1"
FT                   /translation="MSNVSVNRCSVAHLTEQRSGQTSGCLVAFLARASVDTTDRLKAGA
FT                   VQIDEEREITRMEIVKKVSIPY"
FT   gene            644579..645487
FT                   /locus_tag="Rpic_0609"
FT   CDS_pept        644579..645487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0609"
FT                   /product="dihydrodipicolinate synthase"
FT                   /note="TIGRFAM: dihydrodipicolinate synthase; PFAM:
FT                   dihydrodipicolinate synthetase; KEGG: rso:RSc0665 probable
FT                   dihydrodipicolinate synthase-related transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25760"
FT                   /db_xref="GOA:B2U6Q6"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR005263"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020625"
FT                   /db_xref="UniProtKB/TrEMBL:B2U6Q6"
FT                   /protein_id="ACD25760.1"
FT                   /translation="MLENSSTNLSTNERPSYAGIWVPIVTPFADDAARSVDYGALYTLV
FT                   MRYRALGAAGFVACGSTGEAAALTDQEQADVLDTVRAAADGLPVVMGVSGSALASVRER
FT                   MLRLAEHRPAAFLIPAPSYIRPSQRGIIEYFTALADASPVPVLLYDIPYRTGAHIDTET
FT                   LLALAAHPNIHGIKDCGGDADKTQRLIADGRLQVLAGEDAQVFGTLCAGGVGAIIAAAH
FT                   VRTELFVEMARAVQEQRLNDARRLHHALAPVIRLLFAETNPGPLKAWLAAEGLIRNVLR
FT                   APMMMASEGLGRELVGVVGRV"
FT   gene            complement(646030..647331)
FT                   /locus_tag="Rpic_0610"
FT   CDS_pept        complement(646030..647331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_0610"
FT                   /product="glutamate-1-semialdehyde-2,1-aminomutase"
FT                   /note="TIGRFAM: glutamate-1-semialdehyde-2,1-aminomutase;
FT                   PFAM: aminotransferase class-III; KEGG: rso:RSc0666
FT                   glutamate-1-semialdehyde 2,1-aminomutase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ACD25761"
FT                   /db_xref="GOA:B2U6Q7"
FT                   /db_xref="InterPro:IPR004639"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2U6Q7"
FT                   /protein_id="ACD25761.1"
FT                   /translation="M