(data stored in ACNUC1104 zone)

EMBL: CP001069

ID   CP001069; SV 1; circular; genomic DNA; STD; PRO; 1302238 BP.
XX
AC   CP001069; AAWK01000000-AAWK01000028;
XX
PR   Project:PRJNA17631;
XX
DT   08-MAY-2008 (Rel. 95, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 4)
XX
DE   Ralstonia pickettii 12J chromosome 2, complete sequence.
XX
KW   .
XX
OS   Ralstonia pickettii 12J
OC   Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales;
OC   Burkholderiaceae; Ralstonia.
XX
RN   [1]
RP   1-1302238
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Meincke L., Brettin T., Detter J.C.,
RA   Han C., Kuske C.R., Schmutz J., Larimer F., Land M., Hauser L.,
RA   Kyrpides N., Mikhailova N., Marsh T., Richardson P.;
RT   "Complete sequence of chromosome2 of Ralstonia pickettii 12J";
RL   Unpublished.
XX
RN   [2]
RP   1-1302238
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Meincke L., Brettin T., Detter J.C.,
RA   Han C., Kuske C.R., Schmutz J., Larimer F., Land M., Hauser L.,
RA   Kyrpides N., Mikhailova N., Marsh T., Richardson P.;
RT   ;
RL   Submitted (01-MAY-2008) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; f7c844b02be3e388d03eafb1940adf9b.
DR   BioSample; SAMN02598396.
DR   EnsemblGenomes-Gn; EBG00001117894.
DR   EnsemblGenomes-Gn; EBG00001117895.
DR   EnsemblGenomes-Gn; EBG00001117896.
DR   EnsemblGenomes-Gn; EBG00001117897.
DR   EnsemblGenomes-Gn; EBG00001117898.
DR   EnsemblGenomes-Gn; EBG00001117899.
DR   EnsemblGenomes-Gn; EBG00001117900.
DR   EnsemblGenomes-Gn; EBG00001117901.
DR   EnsemblGenomes-Gn; EBG00001117902.
DR   EnsemblGenomes-Gn; Rpic_R0059.
DR   EnsemblGenomes-Gn; Rpic_R0060.
DR   EnsemblGenomes-Gn; Rpic_R0061.
DR   EnsemblGenomes-Gn; Rpic_R0062.
DR   EnsemblGenomes-Gn; Rpic_R0063.
DR   EnsemblGenomes-Gn; Rpic_R0064.
DR   EnsemblGenomes-Gn; Rpic_R0065.
DR   EnsemblGenomes-Tr; EBT00001708471.
DR   EnsemblGenomes-Tr; EBT00001708472.
DR   EnsemblGenomes-Tr; EBT00001708473.
DR   EnsemblGenomes-Tr; EBT00001708474.
DR   EnsemblGenomes-Tr; EBT00001708475.
DR   EnsemblGenomes-Tr; EBT00001708476.
DR   EnsemblGenomes-Tr; EBT00001708477.
DR   EnsemblGenomes-Tr; EBT00001708478.
DR   EnsemblGenomes-Tr; EBT00001708479.
DR   EnsemblGenomes-Tr; Rpic_R0059-1.
DR   EnsemblGenomes-Tr; Rpic_R0060-1.
DR   EnsemblGenomes-Tr; Rpic_R0061-1.
DR   EnsemblGenomes-Tr; Rpic_R0062-1.
DR   EnsemblGenomes-Tr; Rpic_R0063-1.
DR   EnsemblGenomes-Tr; Rpic_R0064-1.
DR   EnsemblGenomes-Tr; Rpic_R0065-1.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF01051; c-di-GMP-I.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01695; C4.
DR   RFAM; RF01734; crcB.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP001069.
DR   SILVA-SSU; CP001069.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4003028
CC   Source DNA and bacteria available from Terry Marsh (MARSHT@msu.edu)
CC   Contacts: Terry Marsh (MARSHT@msu.edu)
CC             David Bruce (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1302238
FT                   /organism="Ralstonia pickettii 12J"
FT                   /chromosome="2"
FT                   /strain="12J"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:402626"
FT   gene            complement(23..1618)
FT                   /locus_tag="Rpic_3761"
FT   CDS_pept        complement(23..1618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3761"
FT                   /product="peptide chain release factor 3"
FT                   /note="TIGRFAM: peptide chain release factor 3; small
FT                   GTP-binding protein; PFAM: protein synthesis factor
FT                   GTP-binding; elongation factor Tu domain 2 protein; KEGG:
FT                   rso:RSp1662 peptide chain release factor 3"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3761"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28877"
FT                   /db_xref="GOA:B2UH26"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004548"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR032090"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR038467"
FT                   /db_xref="InterPro:IPR041732"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH26"
FT                   /protein_id="ACD28877.1"
FT                   /translation="MSTLQQEIRRRRTFAIIAHPDAGKTTLTEKLLWFGGAIQMAGAVR
FT                   ARKANRHATSDWMEMEKQRGISVTSSVMQFPYRNEGGDYIVNLLDTPGHEDFSEDTYRT
FT                   LTAVDSAVMVIDSVNGVEAQTIKLLNVCRLRSTPILTFINKLDREGRAPIELLDEIESV
FT                   LQIQCAPMTWPIGMGKSFKGVYHLVNDTVQLFDPNADSEKGATAGLIQGLDNPELDRVL
FT                   GSQAEELRIDIELVRGASHTFDKEAFLAGKQCPVYFGSAVNNFGVQSLLDALVDQSPEP
FT                   LARPTETREVKPMEEKFTGFVFKIQANMDPKHRDRIAFVRVCSGRFERGMKLLQVSTGK
FT                   TVAINNAITFMAQDRNTTEEAFAGDIIGVPNHGTIRLGDAFTEGEALKFTGIPSFAPEF
FT                   FRRARLNNPLRLKQLQKGLQQLAEEGATQMFRPLASNDLVLGAVGILQFDVVAHRLEHE
FT                   YGVDAIFEPHECSTARWLRGKQEDIDKLIDKAGHNVALDGAGDYVYLAPSQVNLRLTQE
FT                   RFPDIQFMETREIV"
FT   gene            1899..2207
FT                   /locus_tag="Rpic_3762"
FT   CDS_pept        1899..2207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3762"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rso:RS02222 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3762"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28878"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH27"
FT                   /protein_id="ACD28878.1"
FT                   /translation="MKLPYCGGRRESCFAIRKDVKKEGVQIVRSRTPVDPAVQRILETT
FT                   RKAWQLDAESVRAARQQRAANRRKRIKALPQDSLQALAALALQAEIWAVRKTVVTVG"
FT   gene            2330..2632
FT                   /locus_tag="Rpic_3763"
FT   CDS_pept        2330..2632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3763"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pol:Bpro_3432 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3763"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28879"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH28"
FT                   /protein_id="ACD28879.1"
FT                   /translation="MTEPIPTPSTTGSHGATITALHPQIDHTAQRVKDATAEGIDRLAG
FT                   VISTALTQFDKRTEQLKHLHANVSEQASGSVRQHPVLTIGLAFVAGMLLEQLTRD"
FT   gene            complement(2647..3636)
FT                   /locus_tag="Rpic_3764"
FT   CDS_pept        complement(2647..3636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3764"
FT                   /product="ribonuclease BN"
FT                   /note="PFAM: ribonuclease BN; KEGG: rso:RS02223 putative
FT                   ribonuclease RNase BN (RBN) transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3764"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28880"
FT                   /db_xref="GOA:B2UH29"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH29"
FT                   /protein_id="ACD28880.1"
FT                   /translation="MRLAGSFLDRDVFRRTARILLGAAQQWSAHRAASKGAALSFYTLF
FT                   SMAPVLVLVISIAGLFFGEQAARGEIFGQIQGLVGAQGAAAVETILAATKRSGHGLFAA
FT                   VMALALLVVGATTAFSELKDSLDELWDVPPRQQPGLWGLLRSRLLSFSLVLVLAFLLLV
FT                   SLIINAALAVLERFWGAIWESAGLFAPIAEAFSSVFSFAVVSLLFGTIFKMLPETRVAW
FT                   RDVALGAVVTALLFTLGKHLIGLYLGNSAVASSYGAAGSVVALMLWIYYSAQIFFFGAL
FT                   VTRQYALQFGSRQHETAGPGAQAALLNPALAANLASGSGTGPGVREGR"
FT   gene            complement(3721..4026)
FT                   /locus_tag="Rpic_3765"
FT   CDS_pept        complement(3721..4026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3765"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RS02224 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3765"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28881"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH30"
FT                   /protein_id="ACD28881.1"
FT                   /translation="MELSETNPFPKSDGHGNLIRDDVAQAAERVKATTAQAIDRTADAA
FT                   ATALDEAAVKREQWRASQQRLMSDAAECMRTHPLATIGLAFGAGFLLSRLLGGRDD"
FT   gene            complement(4080..4247)
FT                   /locus_tag="Rpic_3766"
FT   CDS_pept        complement(4080..4247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3766"
FT                   /product="protein of unknown function DUF1328"
FT                   /note="PFAM: protein of unknown function DUF1328; KEGG:
FT                   rso:RS02225 probable transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3766"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28882"
FT                   /db_xref="GOA:B2UH31"
FT                   /db_xref="InterPro:IPR009760"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH31"
FT                   /protein_id="ACD28882.1"
FT                   /translation="MLRYALIFFIIAVIAAVLGFGGIAAGAASIAKILFMIFVVLFVVS
FT                   LIWGLVAGRG"
FT   sig_peptide     complement(4164..4247)
FT                   /locus_tag="Rpic_3766"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.415 at
FT                   residue 28"
FT   gene            complement(4367..5773)
FT                   /locus_tag="Rpic_3767"
FT   CDS_pept        complement(4367..5773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3767"
FT                   /product="two component, sigma54 specific, transcriptional
FT                   regulator, Fis family"
FT                   /note="PFAM: response regulator receiver; sigma-54 factor
FT                   interaction domain-containing protein; helix-turn-helix
FT                   Fis-type; ATPase associated with various cellular
FT                   activities AAA_5; SMART: AAA ATPase; KEGG: rso:RS02226
FT                   probable sigma-54 interacting response regulator
FT                   transcription regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3767"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28883"
FT                   /db_xref="GOA:B2UH32"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH32"
FT                   /protein_id="ACD28883.1"
FT                   /translation="MPHILIVEDDANARAALGELVGAEGFTTALAGSLRDARIQMSRHS
FT                   PDAVLIDLILPDGNGMDLMEDIAPHSGTEIIVMTGHASVETAVEALRMGAADYLVKPVN
FT                   FQRLKSVLARIPRPGDLKAEIGNLRGELRRLGLFGQMLGNSTVMQTLYDQVSRVAPTEA
FT                   TVLLIGESGTGKELAAQTIHDLSLRRKQPFLPVNCGAISPNLIESEMFGHERGSFTGAD
FT                   RQHKGYFERANGGTLFLDEITEMPIELQVKLLRVLETGVFMRVGTNREIDSDVRVIAAT
FT                   NRDPEEAVADGKLRADLYHRLNVFPLQLPPLRERGKDVELLAQHFLDQLNAQSNTKKAF
FT                   LPPAMETLRAYNWPGNVRELRNYVQRAYILSDDAGIDTANVPLQVSSTQTGSGGSTLTI
FT                   PVGTSLASADKKIILATLEQCGGVKKRAAELLGISLKTLYNRLEEYNSNSDADDGGDDT
FT                   GPGRAHITEA"
FT   gene            6310..7407
FT                   /locus_tag="Rpic_3768"
FT   CDS_pept        6310..7407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3768"
FT                   /product="sigma54 specific transcriptional regulator, Fis
FT                   family"
FT                   /note="PFAM: sigma-54 factor interaction domain-containing
FT                   protein; helix-turn-helix Fis-type; ATPase associated with
FT                   various cellular activities AAA_5; SMART: AAA ATPase; KEGG:
FT                   rso:RS02227 probable sigma-54 interacting transcription
FT                   regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3768"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28884"
FT                   /db_xref="GOA:B2UH33"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH33"
FT                   /protein_id="ACD28884.1"
FT                   /translation="MSLSEAFADEHATTAGRLPCPPSLTDMAEFDDVDPAAAQAIAIAE
FT                   PDFGHLYGRSPVMRALYNQIGKVSGTLATVLIIGESGTGKELIARTVHDMSPRADQAFI
FT                   AVNCGAISPNLIESELFGHEKGSFTGATQRHTGYFEHACGGTIFLDEITEMPVEMQVKL
FT                   LRVLETGVFMRVGGTEPIQTRARIIAATNRNLMEAVADGAFREDLMYRLAVVPLHVPPL
FT                   RDRGDDIEELALHFLAQFNAAHQTDKVFSRTALTVLHNHGWPGNVRELRNAVQRGYILG
FT                   EKTVDLDNPISSPRGPTRPTVKEGVLNLSVGVTLAEAQRAMILATLEHFHGDKRQAAKT
FT                   LGVSLKTLYNRLDLYQGAAAAGMAA"
FT   gene            complement(7630..7950)
FT                   /locus_tag="Rpic_3769"
FT   CDS_pept        complement(7630..7950)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3769"
FT                   /product="conserved hypothetical signal peptide protein"
FT                   /note="KEGG: rso:RS02229 hypothetical signal peptide
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3769"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28885"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH34"
FT                   /protein_id="ACD28885.1"
FT                   /translation="MHSRTLIAAIASAALTFGTTVAVAQSTTPPAPAADGQSAVPAAGA
FT                   AEAHASTGKPMHRKSRHHKTSKAKGGANSAGDMSHSGVQSGGNEAATTTGNSQPATSRQ
FT                   DQ"
FT   sig_peptide     complement(7876..7950)
FT                   /locus_tag="Rpic_3769"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.974 at
FT                   residue 25"
FT   gene            8263..9765
FT                   /locus_tag="Rpic_3770"
FT   CDS_pept        8263..9765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3770"
FT                   /product="RNA polymerase, sigma 54 subunit, RpoN"
FT                   /note="TIGRFAM: RNA polymerase sigma-54 factor, RpoN; PFAM:
FT                   sigma-54 factor; sigma-54 factor core-binding region;
FT                   sigma-54 DNA-binding domain protein; KEGG: rso:RSp1671 RNA
FT                   polymerase factor sigma-54"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3770"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28886"
FT                   /db_xref="GOA:B2UH35"
FT                   /db_xref="InterPro:IPR000394"
FT                   /db_xref="InterPro:IPR007046"
FT                   /db_xref="InterPro:IPR007634"
FT                   /db_xref="InterPro:IPR038709"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH35"
FT                   /protein_id="ACD28886.1"
FT                   /translation="MVKAALEMRAKQHLALTPRLQQSVKLLQLSATEFAQEMQEALASN
FT                   PFLEEVEQEAGAQPDATRANDLPGPADLDGSGTDHTPSEALPLETTTSAIETDPALATA
FT                   DEFPADFGTYYSHGGAHHGDGEDSDIGEWVHATPSLREHLHQELRSYRLSQRDCLLGQT
FT                   VIEALDDDGYLRQLLSELIPLAPVEPPPTEKEMQIALALVQSLDPPGVAARDLSECLRL
FT                   QIEARPADTEAEERIQEVAHDIVRSHLPRLAKREFTQMRRALGCTEDELRDACALIRML
FT                   DPRPGLRFSQAHAGYIVPDVIVAKIRGKWIAVTNPAVAPCARINKVYAELFAQTRGYHR
FT                   TPLAHQLQEARWLIRNAQQRFATIQRVAEAIVAHQKHFLEYGEVAMKPLVLRDVAEELG
FT                   LHESTISRATGNKYMATPRGIFEFKYFFSRQLATDTGGACSAASVRALLKEMIEAEDAD
FT                   APLSDVSLAKMLAEQGVIVARRTVAKYRGLMRIAPAEMRRQV"
FT   gene            9819..10991
FT                   /locus_tag="Rpic_3771"
FT   CDS_pept        9819..10991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3771"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   eba:ebA6934 conserved hypothetical protein, predicted
FT                   glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3771"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28887"
FT                   /db_xref="GOA:B2UH36"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH36"
FT                   /protein_id="ACD28887.1"
FT                   /translation="MNDAAEASLHLADVTMFWAAESGGVKRYLRAKHDFLRSTHWRHTL
FT                   VVPGIAEDATNAIAVVPGVPLPLSHGYRIPLRAGPAERALCALSPDLIEAGDPYRLSWA
FT                   ALRAGARLGVPVAAFCHSDLPAFFRRLGGAPAEHFAAAYARRLYPHFDTVFAPSRYVAQ
FT                   KVAELGVQQVELQPLGVDTRLFHPARRSLRWRAQLGLPRDARVLLYVGRYAPEKNLHVL
FT                   CDAVDRLDDGTLLVTIGSGPTPPRGRHVRALPYEGDAQQLAAAMASADAFVHAGDQETF
FT                   GLVALEAMASGLPVVACAAGGLGELVDEHVGYAVPRCSADDFAQALHALRRRDPVALAH
FT                   AARRHAMHYDWRAVLPQLLRRYLALLGRQASAASDPLHVTRVRPRTARIR"
FT   gene            11010..11804
FT                   /locus_tag="Rpic_3772"
FT   CDS_pept        11010..11804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3772"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RS02231 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3772"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28888"
FT                   /db_xref="GOA:B2UH37"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR018763"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH37"
FT                   /protein_id="ACD28888.1"
FT                   /translation="MSRYLILAMHDVTPATWPACKVLLNALDEVCRVPKSLLVIPNFYR
FT                   GPTARNSDRFCRLMSECLAEGDELVLHGYAHLDDQPPGGILDQLIRTRYTAGEGEFAAI
FT                   PLAAARHRIEAGAAWFAANGWPLHGFVAPAWLMNAATWQALDGLPLRYTTTLRRFFLLH
FT                   PTRALAAPCLTYSVRTPARRLVSRYYLQWLARQHANLPVLRLGLHPADAAHRDVIRHWQ
FT                   ELLASSLETRTPVTKNGFAQVFTQAWMSGPETASAGHPQTSY"
FT   gene            complement(11811..12347)
FT                   /locus_tag="Rpic_3773"
FT   CDS_pept        complement(11811..12347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3773"
FT                   /product="phosphoesterase PA-phosphatase related"
FT                   /note="PFAM: phosphoesterase PA-phosphatase related; KEGG:
FT                   eba:ebA6940 conserved hypothetical protein, predicted
FT                   phosphatidic acid-phosphatase related phosphoesterase
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3773"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28889"
FT                   /db_xref="GOA:B2UH38"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH38"
FT                   /protein_id="ACD28889.1"
FT                   /translation="MATHVWPDWKRWRERDRRLAVALNNVAGDPSVMRFYRGVSRLGDG
FT                   MLWYALMAALPVVGGDTGWECAKQMGLTGLLSLVIYIVLKRGVCRPRPYLSCEEIHLCG
FT                   RVLDQFSFPSGHTLHAVSFSIVMAAYYPRMALALAPFTLMVALSRVILGLHYPSDVLAG
FT                   AGLGVLIGGLSVWLF"
FT   gene            complement(12325..13497)
FT                   /locus_tag="Rpic_3774"
FT   CDS_pept        complement(12325..13497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3774"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   eba:ebA6942 glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3774"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28890"
FT                   /db_xref="GOA:B2UH39"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH39"
FT                   /protein_id="ACD28890.1"
FT                   /translation="MRIAYVTETWPPELNGVSLTAARTVAFLRAREHDVMLVRPRQRVI
FT                   DTGQPPLSGGTLRVRGMPIPRYPALRMGLPARRGLVRAWRAYRPDLVHVATEGPLGWSA
FT                   IRAARQLGVPVTSDFRTRFDEYGRHYAWDGAAALVRAYLRAFHNRTDRTFVPTRELQRQ
FT                   LRALAFERLSISTRGVDARQFAPHHRSEALRAQWHAADDAPVVLTVGRLAVEKNLGVAL
FT                   DAFDAIRHNVPGARLVMVGDGPLRRVLQQRCPEAVFAGMQQGQALAAHYASADLFLFPS
FT                   LTETFGNVVVEAMASGLPVVAFDTAAAGMHVRSGENGLLVPVGDAGAFVRAATELAADA
FT                   ALCCRLGGAARQTAQTLDWPRVLERFEAALMAVHHAAVAGGAYHGDPRLA"
FT   gene            complement(13506..13937)
FT                   /locus_tag="Rpic_3775"
FT   CDS_pept        complement(13506..13937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3775"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RS02233 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3775"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28891"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH40"
FT                   /protein_id="ACD28891.1"
FT                   /translation="MIPHRDAVVCGANQRDATSAGASPPRPPAAEREECVDAVLGKPEQ
FT                   DIPERRTADRPPHARDERLEAQRSGPRADIEQAARDIDSGQLDTDLHNTPGVERVVREH
FT                   HAANREDPDRRVANRSADDLADKRNEAGRPGPSRAERKP"
FT   gene            complement(14139..15458)
FT                   /locus_tag="Rpic_3776"
FT   CDS_pept        complement(14139..15458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3776"
FT                   /product="protein of unknown function UPF0118"
FT                   /note="PFAM: protein of unknown function UPF0118; KEGG:
FT                   aav:Aave_2002 protein of unknown function UPF0118"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3776"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28892"
FT                   /db_xref="GOA:B2UH41"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH41"
FT                   /protein_id="ACD28892.1"
FT                   /translation="MPRPRGTGRTTFLAMSDPLPTHSTQAPPGPGPAPQPTLLTGLQQP
FT                   AWRLAMVLVAIGGTLVFLQWARVFLVPLTFGVVLAFALNPLVVRLQHWYVPRPVAAAVI
FT                   VLGLWLAGGAVVFGMQDGVSAVAERVPLAAERMAESVDRVRDRLSGAVDKMRQVTTAVE
FT                   HATEGVPAKPPSQPARRPAAAAPPAPHDTLPVLPLREFVWTGSASLFALAGQLVVVSFL
FT                   VYFLLASGQALKRKWVRAVGRTLSEKKRAVRMMAGIGTQIQYSLLVLFASNIMLGILTA
FT                   VAFALLGMDDATVWGLAAAVLHFVPYLGSVVMVVASGIGAYLQMGTWADALIVAGTTLV
FT                   FATLVGTLLMTWLQSRASKLDPCVVYIGLLLWGWLWGVWGLLLGTSVTAMIKVVCDHVE
FT                   RLRPLGVLLGTTDAPAGVWQRLLDRLRGRPTRRRQGAPRR"
FT   gene            complement(15460..17844)
FT                   /locus_tag="Rpic_3777"
FT   CDS_pept        complement(15460..17844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3777"
FT                   /product="PAS/PAC sensor hybrid histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="KEGG: rso:RS02235 probable composite two-component
FT                   regulatory (sensor kinase and response regulator hybrid)
FT                   transcription regulator protein; TIGRFAM: PAS sensor
FT                   protein; PFAM: response regulator receiver; ATP-binding
FT                   region ATPase domain protein; histidine kinase A domain
FT                   protein; PAS fold-3 domain protein; PAS fold-4 domain
FT                   protein; PAS fold domain protein; SMART: PAS domain
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3777"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28893"
FT                   /db_xref="GOA:B2UH42"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH42"
FT                   /protein_id="ACD28893.1"
FT                   /translation="MSTSVSGLLAPAHRVPQARVVFFGGKLLDVFWIDDPLTGTRLHVS
FT                   AAAQTWGVRAESLCGDREQWLAHVHPDDHAALRAAWDGLARGQDFVLEYRWIGVDHREQ
FT                   RVRERGYLMPSPNGGPAHAVGVIEDVTQRQQTLTALTESEFQLQWLTESVPFPLVQIDP
FT                   EHRVRFANRAYAQRFGMLPDAVVGSHLRAVMGEAAYARILAHLGEGFAGRRVDFEIELP
FT                   YPEDIGSRFVHAAYSPQQGPDGSVQALVCLEEDITERKEAERERYRHQREFVTLVENAP
FT                   DVIARLDRDLHCVYVNCAVIHAFGVTPAAMTGRTLSASPLPATVAGPLDAAARLAFTTG
FT                   AEQTLTLHLDAGERRTGIAHYNVRVIPEEDRTGTIESAMLIVYDVTERTEAERERDALL
FT                   LREQTARAHAEAATLARDQFLAVVSHELRSPLNGIQNWTYVLENQLSDGSPLVQRALAG
FT                   IKTGVEQQVRLIEDLLDATRVMSGKLRLTREPFVLSLAIERALNSVRALAAERGITLHV
FT                   ASLLEAHEIDGDADRVEQIVWNLLTNAIKFTHEGGDVWLSADLVGEVARIVVRDNGRGI
FT                   GPAFLPYLFDPFRQADGAHTRRTGGLGLGLALVKRLTELHGGRVHAHSDGERSGAVFTV
FT                   YLPLHAGAELTPPLAEDLARSGPLPSLAGLRVLLVDDQQDARDALATLLAQVGADVASV
FT                   GSGQEAMTQLDTWGVPARPRAVVCDIALPDEDGYAILQKIRTWERLHVPAGASPIAAIA
FT                   LTAFAQPDDRARALASGFQEHLVKPVSPYDLVRTLRNLAAP"
FT   gene            complement(17929..18711)
FT                   /locus_tag="Rpic_3778"
FT   CDS_pept        complement(17929..18711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3778"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bch:Bcen2424_4033 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3778"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28894"
FT                   /db_xref="InterPro:IPR025510"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH43"
FT                   /protein_id="ACD28894.1"
FT                   /translation="MKMQIKKIAAVLLLGSLGMLAACGGGSDDIGQIIGTSSPQYRTMH
FT                   VNPFIGNVDFGVNGTTRIANVGFKNVSNYFGIDAVATTATVSNAGSATPLASANFNPAN
FT                   GHRYTALAIVGATASATSLAIIDDPYDKSILSDKARVRTFNAAYNAPNVDVYVTAPNAD
FT                   ISAVPPTMGGAAYGSASPASTQDSIYVDGGTYEIRVTTAGTKSVIFASQPFSLANNADW
FT                   LITTLPAGGAGTVTPNAIRVLVAQANGASQTASELPAQ"
FT   sig_peptide     complement(18637..18711)
FT                   /locus_tag="Rpic_3778"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.908 at
FT                   residue 25"
FT   gene            19004..20287
FT                   /locus_tag="Rpic_3779"
FT   CDS_pept        19004..20287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3779"
FT                   /product="putative proline-rich protein"
FT                   /note="KEGG: rso:RS02236 putative proline-rich protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3779"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28895"
FT                   /db_xref="GOA:B2UH44"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH44"
FT                   /protein_id="ACD28895.1"
FT                   /translation="MFDPRPANAAPLPHHAASQADPQAFALERERVQAWLDARASGARA
FT                   VGASTLSQYRVEADRVCWYARTVGKPIAAWQREDALTYLRFLQDPPPWAISARGIDRSD
FT                   VNWTPLRGALSARSTRQCSIIAANLCGWLQRAGYLRANPFLDDDAIVITVPPPEAGTGT
FT                   ATEASIAGATPTQPQSRLSAADMGLIVDAVRARVALGREARLRQARDHFLAVLLAHASL
FT                   RVAELVAARMGDVALHAVPPADAAPDASLPASVWLLRAGSGRSQRWLPCDAIMGALREY
FT                   RTAFGLSPLPLPNEATPLLLSVRRRSPRRADGSIIDSPSLRRDFGERKGLASRSQLLLI
FT                   VKAMLSEAVDYARAMGQPDAAARLAHASLRGVRTAHLRERLAAGEAAADVARALGLAAL
FT                   PAVAVRAREADLAASIADAARKLATPSA"
FT   gene            complement(20561..21865)
FT                   /locus_tag="Rpic_3780"
FT   CDS_pept        complement(20561..21865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3780"
FT                   /product="Xanthine/uracil/vitamin C permease"
FT                   /note="PFAM: Xanthine/uracil/vitamin C permease; KEGG:
FT                   rso:RS02237 probable transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3780"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28896"
FT                   /db_xref="GOA:B2UH45"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR026033"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH45"
FT                   /protein_id="ACD28896.1"
FT                   /translation="MTWLTRFFKLKEHQTDVRTEVLAGLTTFLTMAYIVFVNPNILADA
FT                   GMPHDAVFVATCIAAATGTIIMGMYANYPIAMAPGMGLNAYFAYAVVKGMGFTWQAALG
FT                   AVFISGCLFLLVSVFRIREMIVNGIPHSIRVAITAGIGLFLGIVSLRGAGLVVGNPATL
FT                   VSLGDVHQPSVILAVIGFFLIVALDHLRVKGAILIGILAVTAASFFFAGNTFHGVVSMP
FT                   PSLTPTLLQLDIMGALSVGILNVVLVFFLVELFDATGTLMGVANRAGLLKQGKMDRLNK
FT                   ALLADSTAIMAGSLLGTSSTTAYIESASGVQAGGRTGLTALTVAVLFLLCLFFSPLAGV
FT                   VPAYATAPALLYVSCLMLRELVDLNWEDTTEAVPAVLTALMMPFTYSIANGVAFGFITY
FT                   SGLKLFTGRAREVPIIVWIISAVFLFRFFYLSGGH"
FT   gene            23271..24344
FT                   /locus_tag="Rpic_3781"
FT   CDS_pept        23271..24344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3781"
FT                   /product="plasmid encoded RepA protein"
FT                   /note="PFAM: plasmid encoded RepA protein; KEGG:
FT                   rso:RSp0001 probable RepA replicase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3781"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28897"
FT                   /db_xref="InterPro:IPR006881"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH46"
FT                   /protein_id="ACD28897.1"
FT                   /translation="MVTKRLTPNGKPEDAAPGRIIVPSGGQVIAAPEKFQRLFDEAQAM
FT                   EREDAWQSGEVGFLSRASVQVTLPYRAPKGSPPVWTRSSGNISLMIQPGYFTQQRSERA
FT                   SNGRQRIVSETVSFGYPYGSYPRLMLAWIGKEIMAKKKRGEFQGTVEDRRISLGNSLSE
FT                   FMYNLGIPMATGGKRGTMTLVRQQMIRLFSATIAIVQNKSAPNQNQNQEPLSIDRIGYL
FT                   LADQLSTWWDPMQPGQGSMFESFVVLSEPFFNELVNRPVPVDMRALKALKQSPFALDVY
FT                   SWLTYRFFTIQKRTEIPWEALQMQFGTETESERKFRALFRKALKDVLVVYPDAKVDADS
FT                   SKALILQPSRTSVRKLA"
FT   gene            complement(24421..24624)
FT                   /locus_tag="Rpic_3782"
FT   CDS_pept        complement(24421..24624)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3782"
FT                   /product="cold-shock DNA-binding domain protein"
FT                   /note="PFAM: Cold-shock protein DNA-binding; SMART: Cold
FT                   shock protein; KEGG: rso:RSp0002 probable cold shock-like
FT                   transcription regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3782"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28898"
FT                   /db_xref="GOA:B2UH47"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH47"
FT                   /protein_id="ACD28898.1"
FT                   /translation="MATGTVKWFNETKGFGFITPDGGGADLFAHFSEIQGSGFKTLKDG
FT                   QKVSFEVKQGPKGLQASGIRPE"
FT   gene            25030..25698
FT                   /locus_tag="Rpic_3783"
FT   CDS_pept        25030..25698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3783"
FT                   /product="Cobyrinic acid ac-diamide synthase"
FT                   /note="PFAM: Cobyrinic acid ac-diamide synthase; KEGG:
FT                   rso:RSp0003 probable partition protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3783"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28899"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH48"
FT                   /protein_id="ACD28899.1"
FT                   /translation="MSAKIVTVFNQKGGCGKTTVSMHIAGTLGLRGNKTLLVDMDEQGT
FT                   ATRWAAQAPDEKPFPASVIGLAPSGGAMHREVRKFVADYDYIVIDCPPAVHSPSSSSAL
FT                   LISDIAFIPVVPSPPDLWAAVAAKALAQQAQVTNETLRIRVLANMVQRRVSLAKQAIEI
FT                   LGDDGDIPLMESMIGSRSAFRECQAIGATVHGVSGAREAVSEVDIMVDEVLQLLQEERV
FT                   "
FT   gene            25695..26702
FT                   /locus_tag="Rpic_3784"
FT   CDS_pept        25695..26702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3784"
FT                   /product="parB-like partition protein"
FT                   /note="TIGRFAM: parB-like partition protein; PFAM: ParB
FT                   domain protein nuclease; KEGG: rso:RSp0004 putative
FT                   partitioning protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3784"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28900"
FT                   /db_xref="GOA:B2UH49"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH49"
FT                   /protein_id="ACD28900.1"
FT                   /translation="MSGKLKSLKAGMLAGIAAEKTKAAPVDRFALAEQAIVSHPRGLLG
FT                   QPAAPTFSAESAESANTSERRVIKIPLDRLHENPLNARRIYDPQTVQERAASIATHGQQ
FT                   TPGLAAPHPSKPGWYVLIDGHYRKRALAAAGKAEMDCFVEEGLSDIDFYRLSFVLNEQR
FT                   SGQSVLDNAIAWRQLLDEGKVKKEEDICEITGVSAGTVNKTLALLKLPDSVLDVMKERP
FT                   AGIGIATGYELTLYCKSAGEERTRELVHRVLEEGLSSRDVEQIRKIAQEGRTRKVKEVS
FT                   RQYKIRNSEGDLLGTIKEWDSGRVMLDVKLSDRAARESLVEALKSRFGLDVALL"
FT   gene            27001..27837
FT                   /locus_tag="Rpic_3785"
FT   CDS_pept        27001..27837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3785"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RS01977 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3785"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28901"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH50"
FT                   /protein_id="ACD28901.1"
FT                   /translation="MARPALHFSNEQQQRILEAIRRLDIAFPHDNAVFLDELIDAVHAV
FT                   TRRIYGARRYSQWLAEAGVTRRPSNMTLQKAVNRAHGRSGRGLGGTPDTVEPWPIPWTA
FT                   AETGTPVMSSAHASREERDRVASRAIGAPGAGAEWMEARIRAEVAERALEHEAARNRQL
FT                   QAAMADLERRLGEALATAPAVSPKLTDSTLERIEQTIETVARLEGAASALAGTERFLRL
FT                   QNDAVRQQTQNEAEQLRQRIRTLEAEVAQLRTQLDAYRRMPERAAPVSRGWVKPAS"
FT   gene            28088..29041
FT                   /locus_tag="Rpic_3786"
FT   CDS_pept        28088..29041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3786"
FT                   /product="UTP-glucose-1-phosphate uridylyltransferase"
FT                   /note="TIGRFAM: UTP-glucose-1-phosphate
FT                   uridylyltransferase; PFAM: Nucleotidyl transferase; KEGG:
FT                   rso:RSp0006 probable UTP--glucose-1-phosphate
FT                   uridylyltransferase UDP-glucose pyrophosphorylase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3786"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28902"
FT                   /db_xref="GOA:B2UH51"
FT                   /db_xref="InterPro:IPR005771"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH51"
FT                   /protein_id="ACD28902.1"
FT                   /translation="MNEKITKAVFPVAGLGTRFLPATKASPKEMLPIVDKPLIQYAVEE
FT                   AAAAGITEMIFITGRAKRAIEDHFDKAYELETELAAKNKQALLDMVQSIKPAGVECFYV
FT                   RQPETLGLGHAVLCAQKLVRDEPFAVILADDLLDHEPPVMQQMTELYDHYRCSIVGVET
FT                   IAPEATRSYGVVAGREWDDRLVKLDGIVEKPAPSEAPSNLGVVGRYILTPRIFDHLRNL
FT                   RPGAGGELQLTDAIQSLLAEEQILAYRYRGQRFDCGSKFGYLQATVEFALRHPEVRADF
FT                   ETYLNERLGRAPDQATPLGKSDRRLREDTIALSVAA"
FT   gene            29300..30646
FT                   /locus_tag="Rpic_3787"
FT   CDS_pept        29300..30646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3787"
FT                   /product="General substrate transporter"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1; KEGG: rso:RSp0007 putative
FT                   alpha-ketoglutarate permease transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3787"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28903"
FT                   /db_xref="GOA:B2UH52"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH52"
FT                   /protein_id="ACD28903.1"
FT                   /translation="MTQPQAGTMPGEFSPAQAPARDRDTPQDVRRRLRSIFSGSIGNLV
FT                   EWYDWYVYSAFALYFAKSFFPKGDQTAQLLNTAAVFAVGFLARPVGGWLMGIYADRYGR
FT                   KRALFFSVVLMCLGSLIIALTPSYAAIGVAAPVLLVLARLLQGLSVGGEYGTSATYLSE
FT                   VANKEHRGFYSSFQYVTLIAGQLTALALLIVLQQFVLSPAQLDAWGWRIPFFVGALCAL
FT                   VAMRMRSHMEETQSFTAAKENKKRGTLAELAKHPRAVAIVVGLTLGGTVAFYTYSIYMQ
FT                   KFLANTVGLSKSQATLVSGATLLLFALLQPIVGGLSDRIGRRPILIAFGVLGTLLTVPI
FT                   MTGISHTTNPWSAFFLIMAALVIVSGYTSINAVVKAELFPAEVRALGVGLPYALTVSIF
FT                   GGTAEYIALWLKQAGHESLFYWYVTGTIFLSLLVYVFMRDTREHSRIEH"
FT   gene            30651..32558
FT                   /locus_tag="Rpic_3788"
FT   CDS_pept        30651..32558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3788"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; KEGG: rso:RSp0008
FT                   probable C4-dicarboxylate transport sensor kinase
FT                   transcription regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3788"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28904"
FT                   /db_xref="GOA:B2UH53"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR017055"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH53"
FT                   /protein_id="ACD28904.1"
FT                   /translation="MPPSDGHADLPHPARGRGWRMAVALAMAACCAAAGWGAYAIALQR
FT                   YVAARAEEAGQRTTFYAQSLRSTLARYESLPRLAALEHVLHAALQANHPPGDAVARGAA
FT                   NAYLKEVQAATDLSAAYLLDTTGLTLAASNWDLPSSFVGQNYAFRPYFAEAMREGLGRF
FT                   YGVGNTTGETGYFLAAPVRDGSRPIGAVVVKINLDAFEATLSRSGDTVLLVDRYGVIFL
FT                   SSVPALKYRTLGTLSVDQRAALDATRQYAPHTLVPVDPRAGSVPFSADQPPQAVRVALP
FT                   GKSASVLRVQYRPVGLLGWQVAVLIDPRDEQRTALVAGASASFAMALAFAVLVALRLRT
FT                   RRREEQRRARAALREVQRDLEARIAQRTAELTSANTALASKVEALDAAQRILRETRDAA
FT                   VQAGKLAVLGQMAAGITHELNQPLTALTTLSDNANQLAERGRIDEVRGNLTHISQLANR
FT                   MGRIVSHIKAFSRKGDAARAAVSVDEAIRQALMLVETRRRQVGVTVTAPSVPADLAVWA
FT                   NAVRLEQVLVNLIRNAIDASAETPQPRSATVHVSVEPVEKWVRITVRDFGPGIPADVLP
FT                   RLFEPFFTTKVDGQGLGLGLAISLAIIEDFGGRLEGRNADDEGGGAAFIIELERAVNPA
FT                   "
FT   gene            32555..33913
FT                   /locus_tag="Rpic_3789"
FT   CDS_pept        32555..33913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3789"
FT                   /product="two component, sigma54 specific, transcriptional
FT                   regulator, Fis family"
FT                   /note="PFAM: response regulator receiver; sigma-54 factor
FT                   interaction domain-containing protein; helix-turn-helix
FT                   Fis-type; ATPase associated with various cellular
FT                   activities AAA_5; SMART: AAA ATPase; KEGG: rso:RSp0009
FT                   probable response regulator of the C4-dicarboxylate
FT                   transport two-component regulatory system transcription
FT                   regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3789"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28905"
FT                   /db_xref="GOA:B2UH54"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH54"
FT                   /protein_id="ACD28905.1"
FT                   /translation="MTEHATPDMSSIDHAPVFLIEDDDVVRLGCEQALALADVPVQSFA
FT                   DAESALAALAAQTPAVVVTDVRLPGRDGLAVLREMLQHDRQLPVILITGHGDVTMAVAA
FT                   MRAGAYDFMEKPFHSERLVDVVRRALEKRRLTAENLRLREALQGRQAYPLIGQSAAMQN
FT                   VRRLVAALAPTDADILVTGETGSGKEVLARAIHEGSRRRGPFVALNCAALPESVFESEM
FT                   FGHEAGAFTGANRRRIGKMEYANGGTLFLDEIESMPLALQAKLLRALQERSIERLGSNA
FT                   SVPIDCRVVAAAKVDLKEASDRGAFRADLYYRLNVVSIALPPLRQRAEDIPLLMAYFLQ
FT                   QAAVRYDRPVPDWSAQDMMRWQHHDWPGNVRELKNVAERFCLGLDDGLMASEASQHSLA
FT                   GRMMAVERATIEEALRATEGNVARTADLLAVPRKTLYDKLNRHGIEPDRFRSS"
FT   gene            complement(33910..34710)
FT                   /locus_tag="Rpic_3790"
FT   CDS_pept        complement(33910..34710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3790"
FT                   /product="putative lipoprotein transmembrane"
FT                   /note="KEGG: rso:RS01982 putative lipoprotein
FT                   transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3790"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28906"
FT                   /db_xref="GOA:B2UH55"
FT                   /db_xref="InterPro:IPR011397"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH55"
FT                   /protein_id="ACD28906.1"
FT                   /translation="MPSVPPLALAAHALAALLIAGVPIGAWLWLRRRFDLAWRDIGVGA
FT                   GVFVLFALILERTLHVYLLRLNPVTAQWLRVPALFIIYGALMAGLFEECGRWLGLRHLT
FT                   RTPSDAATPVAYALGHAGAEAWLVGAASQAQMVMFGVAANQGQLDARLAASGAQSMSGA
FT                   IHAMLAQLSPWLAAGAVVERIAAMLIQFTLTLLVWHAVRQRRLLPVILAVLLHAVADLP
FT                   AALYQVHVMPLAVTESVYAVIAVLLAATCWPPQGGRRVGESSLR"
FT   sig_peptide     complement(34633..34710)
FT                   /locus_tag="Rpic_3790"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.683) with cleavage site probability 0.569 at
FT                   residue 26"
FT   gene            34823..35263
FT                   /locus_tag="Rpic_3791"
FT   CDS_pept        34823..35263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3791"
FT                   /product="conserved hypothetical signal peptide protein"
FT                   /note="KEGG: rso:RS01983 hypothetical signal peptide
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3791"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28907"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH56"
FT                   /protein_id="ACD28907.1"
FT                   /translation="MAGQTVVKRMMWRWIWVCGFSMGILGVMTSAHAARWHEYLKTTSV
FT                   SASIERGSLRSSRAGHKTFLARTVLKRGERRAHGTRYRPGTMILSRQEIDCRRQRIRLV
FT                   DYVVRGPDGATLDTDTAAGAHWMRIRPGTLAARSAAYVCARR"
FT   sig_peptide     34823..34924
FT                   /locus_tag="Rpic_3791"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.989 at
FT                   residue 34"
FT   gene            35376..38057
FT                   /locus_tag="Rpic_3792"
FT   CDS_pept        35376..38057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3792"
FT                   /product="diguanylate cyclase with PAS/PAC sensor"
FT                   /note="KEGG: rso:RS01984 probable transmembrane protein;
FT                   TIGRFAM: PAS sensor protein; diguanylate cyclase; PFAM:
FT                   GGDEF domain containing protein; histidine kinase HAMP
FT                   region domain protein; PAS fold-3 domain protein; PAS
FT                   fold-4 domain protein; PAS fold domain protein; SMART: PAS
FT                   domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3792"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28908"
FT                   /db_xref="GOA:B2UH57"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH57"
FT                   /protein_id="ACD28908.1"
FT                   /translation="MKPTLKSQAAIMATVISVTLVSLFGWSQREPIRREMMAQIQAQQT
FT                   ALVRESADDLRQRLDIYLGVLERTARQMHTVRFDTPEQEATLFRSIRPASGLFDGVFLA
FT                   TSAGKVTATSAHRPGVVGLDITDRDYFKQIMVRGQPTISAPLRNRIGGEPIVIMAAPVH
FT                   DNDGRLVGLIGAALYLLKPNFLGLLRDMRIGKTGHVYLITQGQHPIFVVHPDPDKVLAP
FT                   LDADPAVAAALRSDPSASPERGGDVVTMQDVVATGWTLGAVLPGAEANRQLFAMHQRFR
FT                   LSLVLLAVLIGASVWAAMLWLLRPLARLHAAMSQLSTTDLRDAPPLELPDASAEIDAVS
FT                   TAFRKLMDEVARQRAELEAVNDASPLGLFRADVEGRIVYANEAYRRLLGLTHEEALADV
FT                   WLTRQHPNDREAAMTGWHEAIRRGTVYTAEQRVLVPGEGERLMVVNTAPVRVDGEVIGH
FT                   VGTMEDITVRARAQQASRVLTKILDSTTDFVAQTDVHGNVTYMNPAGRRFVGIALDQDI
FT                   RGMTVADFYPPATMDWLREVAVPAAVRDGVWIGETTVRGQQRVAVPVNHMLIAHRDPAG
FT                   HMEYFSSIMRDITQDRAAKEALQRSRETLQTVTDAMPALVAFIDVDERFRFLNAAYEKA
FT                   YGQPTAAMLGKTVCEVAGDESYRSVRDALHRALAGETIVFEREQRNREAYRCEEINYLP
FT                   QFDAHGRVAGVHSVTLDITERKKQELRLRALTTTDHLTGLLNRAGFEARLSAALDQGRV
FT                   SDTAGALLLIDLDGFKAVNDTYGHTMGDALLRTVAQRLVRAVRPSDGVARFGGDEFAVI
FT                   LENLSQPDDAKAVAASILGVCNRPFRLGERAVQVGVSIGIAGFDARTLAQGVVFEAADE
FT                   ALYEAKSRGKGLFVSADELPTG"
FT   sig_peptide     35376..35459
FT                   /locus_tag="Rpic_3792"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.918) with cleavage site probability 0.691 at
FT                   residue 28"
FT   gene            38492..39652
FT                   /locus_tag="Rpic_3793"
FT   CDS_pept        38492..39652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3793"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   rso:RS01985 probable amino acid-binding periplasmic (PBP)
FT                   ABC transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3793"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28909"
FT                   /db_xref="GOA:B2UH58"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH58"
FT                   /protein_id="ACD28909.1"
FT                   /translation="MQKTIKRLLVTAAAAGAAIATGTTFAAQDIKIGVAEALSGGAAQY
FT                   GVAIRNGFQLAADEINAAGGINGSKIALVIEDEQGKKEEAINVFKKLIFQDKVAMVFGP
FT                   TLSNSAQAADPIAQGAKTVVFGTSNTADGVTSIGDFVFRNSVTEADVLPATIQTVVKKA
FT                   GVKKVAVLYGNDDVFTKSGYDNFKKALEDLKIPVTTTETFAKGDVDFKAQLTKIKATNP
FT                   DAIVLSALIAEGGPIMVQARQLGLNVPIIGGNGMNSVKVFDLAKDKSDNLWVGSPWSIE
FT                   NHTAENSKFITAYTAKYKAAPDQFAAQAYDAMYIASKALKTVKFSGKLEADRKAIRDAL
FT                   PGVKHIGATGAFAFRQVTARGKPAGYDAVQTPIVSVTKNGKYTIEK"
FT   sig_peptide     38492..38572
FT                   /locus_tag="Rpic_3793"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 27"
FT   gene            39749..40630
FT                   /locus_tag="Rpic_3794"
FT   CDS_pept        39749..40630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3794"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG: rso:RS01986
FT                   probable amino-acid transmembrane lipoprotein ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3794"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28910"
FT                   /db_xref="GOA:B2UH59"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH59"
FT                   /protein_id="ACD28910.1"
FT                   /translation="MLEQQLVNALSLGCVYALFALGFTLVFGILGVINLSHGAVFMLGA
FT                   YAALQVVTHFELPLWAALAVGFVVSGVAGLIIDVLLLRPLRRRNAPHLIPMIGTIGAGI
FT                   AINNAMQGVFGAENLRFPAGLVSDASLDLGGIHLMPLELGIIVLSFALMAGLMLLLKRT
FT                   QLGRALRAIAESPKAAALLGINVEGLFLLTSFAAAALGGLSGVLIGLYSNAVFPLMGQP
FT                   MLHKGIAVIILGGLGDIRGAMLGGLFLGFAEVLSVAYIGSTMRDAVAFGLLFLILLVRP
FT                   QGLFGKVLERKA"
FT   gene            40644..41552
FT                   /locus_tag="Rpic_3795"
FT   CDS_pept        40644..41552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3795"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG: rso:RS01987
FT                   probable amino-acid transmembrane ABC transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3795"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28911"
FT                   /db_xref="GOA:B2UH60"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH60"
FT                   /protein_id="ACD28911.1"
FT                   /translation="MEWFDNFWSVYSNLVLTLGINALLALSIYLTLSCGLLAMANAAFM
FT                   GIGAYTAALLTMNAEMPFSVALLGGMVAPAVVAVVIGRPTLRLSGVYLAMATLGFGEVV
FT                   RVLILNTEDWTGGALGLNGIPQLTEWWHVALAVALTMFVLARMRRSKVGRAFEAIKEDE
FT                   TAAGLMGINVAGTKLLAFTLGAVIAGLAGALNAHLTFFIGPNEFGFDRGVEILTMTILG
FT                   GTNGLTGPVLGSLILSLLPELLRAFKDFRLVVNGVILMVIVLFLPKGIWDPARFARWFG
FT                   IKRGGTMPGTGNTPAASNESH"
FT   gene            41560..42357
FT                   /locus_tag="Rpic_3796"
FT   CDS_pept        41560..42357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3796"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: rso:RS01988 probable amino-acid ATP-binding ABC
FT                   transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3796"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28912"
FT                   /db_xref="GOA:B2UH61"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH61"
FT                   /protein_id="ACD28912.1"
FT                   /translation="MLKLTSISKRFGGLSVLQDVNIEVPQGTIFGLIGPNGAGKTTVFN
FT                   LITGLLAPTGGSLTFNGENLVGKKPHQITQMGIARTFQNIRIFKEMTLLENVVVGMHRH
FT                   LDYGAPGLLLSLPKYRAAERRARDRALELLSWVKLDHKAHDIADNLSYGDQRKLELARA
FT                   LATEPKLLLLDEPVAGMNTGEKVDLMAEIENIKARGYTIFMIEHDMRFVMGLCERIAVL
FT                   NFGRIIAEGPPEAIRNNPQVIEAYLGRDDDEADGSAAAEKETA"
FT   gene            42354..43079
FT                   /locus_tag="Rpic_3797"
FT   CDS_pept        42354..43079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3797"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: rso:RS01989 probable amino-acid ATP-binding ABC
FT                   transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3797"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28913"
FT                   /db_xref="GOA:B2UH62"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030660"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH62"
FT                   /protein_id="ACD28913.1"
FT                   /translation="MTTLLEVKGLQVSYGHIAAVKGIDFALKAGEITSLVGANGAGKST
FT                   TLLALSGLIPKSQGDVRGQILFEGDDVSQWSAHKRVERGIVQVAEGRATLTTMTVRENL
FT                   ELGAYTRKDRSQIASDLERVFHLFPRLKERIDGMAGNLSGGEQQMLAIGRALMARPRVL
FT                   LLDEPSMGLAPIIVQEIFRILRTINAEGLTIFLVEQNVRQALKIAQHGYVLETGQIVLA
FT                   DSGRNLLGNPRVLEAYLGG"
FT   gene            complement(43153..44049)
FT                   /locus_tag="Rpic_3798"
FT   CDS_pept        complement(43153..44049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3798"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: rso:RS01990 probable
FT                   transcriptional regulator transcription regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3798"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28914"
FT                   /db_xref="GOA:B2UH63"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH63"
FT                   /protein_id="ACD28914.1"
FT                   /translation="MTADPSTSLQWDDVRYFLVLAREGSLSAAARRLGVEHTTVARRAD
FT                   ALEQSLGVRLFDRLPRGWRLTAEGSALAERAERMEQEAASFARAAAGAGSLRGTVRISA
FT                   PPTVASHVIAPNLTLLRKQWPGIDLVLLGEKRNANLMAHEADLAVRLSRPTASTLAARP
FT                   LGSLGYGLYATPEVLAQPEAQWQFIGYDERLRHVPQQRWLDDYAGARRVVLRCSDLSAM
FT                   HQAALAGVGVAALPHLLGAPAETGTLLRRVPVDDPALHREIWLAIHPDVRRSPRVRAVA
FT                   DALIALFDAQRHVLAGH"
FT   gene            44225..45223
FT                   /locus_tag="Rpic_3799"
FT   CDS_pept        44225..45223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3799"
FT                   /product="Alcohol dehydrogenase zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   bam:Bamb_4057 alcohol dehydrogenase, zinc-binding domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3799"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28915"
FT                   /db_xref="GOA:B2UH64"
FT                   /db_xref="InterPro:IPR002364"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH64"
FT                   /protein_id="ACD28915.1"
FT                   /translation="MHARLIQLGEPGPALGLQPADQMLPPPGANVLTVRHTAVGVNFVD
FT                   VYHRTGLYPVPAFPAVLGVEGVGVVEAVGTDVRGFVVGQRVAWAGLMDGAPGGYASHRN
FT                   IPANRAIALPDALDDETVAATLLRGITAHMLLTRVRQVGVGDTVLVHAAAGGLGVLLVQ
FT                   WAKRLGARVIGTVGSEAKAATALGHGADHVVLHRQQDVREAVLQLTAGEGVDYVIDGVG
FT                   GPMLQTSLAVTRPFGMVASIGQAGDVSNVQTSAVDLAALGPSRSIALARPGVFRYMTDL
FT                   SRYRVGAQAALQRMLEGVRVPVGGIYALADAAAAHAALEGGRTSGALLLRP"
FT   gene            45319..45636
FT                   /locus_tag="Rpic_3800"
FT   CDS_pept        45319..45636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3800"
FT                   /product="YCII-related"
FT                   /note="PFAM: YCII-related; KEGG: rso:RS01991 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3800"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28916"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH65"
FT                   /protein_id="ACD28916.1"
FT                   /translation="MLYLILFTYRAPLSEMERVLPAHRAHLDAHYASGHFLMSGPFFPR
FT                   EGGGILAQAGSRDEIDAIVMRDPFVLENLVEVRLIAWGPNRRSADVPQAWLPDATVAMP
FT                   T"
FT   gene            45689..47083
FT                   /locus_tag="Rpic_3801"
FT   CDS_pept        45689..47083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3801"
FT                   /product="Chloride channel core"
FT                   /note="PFAM: Chloride channel core; KEGG: rso:RS01992
FT                   putative voltage-gated ClC-type chloride channel ClcB"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3801"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28917"
FT                   /db_xref="GOA:B2UH66"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH66"
FT                   /protein_id="ACD28917.1"
FT                   /translation="MTDTPPPSPPPLPRPAWWQRVAARLPFGRVHLVFVFAGLIGCAGA
FT                   FSTILFRECLRQLQWWISGTDQGLVATARALPWWARLLVPTVGGILAGLTLQFGLKWIP
FT                   RKGSEDYMEAIAVGDGVLSARQSLVRSASSLCSVASGASIGREGPMVQLSAMCGSLLGR
FT                   ALRRVMPVSVEQLRLLVACGAAAGITSAYNAPIAGAVFVCEIVFGVITTATLGPLLVAA
FT                   VTADIVLRQFFGYGAVYEMPHFDFVSGWEVLTYLGLGLAAGMAGPLLLGLIDRARDAFS
FT                   RTKLPLTLRLAVGGLIVGVLSTRVPEVWGNGYSVVNGFLHEPWLWQTVALVLICKVAAT
FT                   AASAGSGAVGGVFTPTLFCGAALGLLYGTGMHALLPGAAPVPISYAVVGMGALLAATTH
FT                   APLMSILMIFEMTLSYQVVLPLMLACITGYVTAHATGAPSVYARALARNRDDAQHLPSA
FT                   SEATQK"
FT   gene            47353..49581
FT                   /locus_tag="Rpic_3802"
FT   CDS_pept        47353..49581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3802"
FT                   /product="TonB-dependent siderophore receptor"
FT                   /note="TIGRFAM: TonB-dependent siderophore receptor; PFAM:
FT                   TonB-dependent receptor; TonB-dependent receptor plug;
FT                   KEGG: reu:Reut_A2876 TonB-dependent siderophore receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3802"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28918"
FT                   /db_xref="GOA:B2UH67"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH67"
FT                   /protein_id="ACD28918.1"
FT                   /translation="MNRRTPVASALLALFATPPVALAQQAPSSPIAATTTLPEAVVRAT
FT                   APRDDYNAAKSSISKLPENLRDVPQSVTVVPKALTDAQGGSSLADALRNVPGITIGAAE
FT                   GGQIGNNINLNGFSARTDIYLDGFRDRGQYYRDLFALDSVEVLMGPSSMLFGRGSTGGV
FT                   INQVTKKPKLKAATEITGSVTTNGLVRATADVNTPTSDTSAFRIAAMAQNGKTSTRDEM
FT                   TAQDFGIAPSWRFGIGTPTEVTLSALLQHNRDMPDYGVPNLNGHPVNVSPKTYYGYTDD
FT                   RTTQDVASFSANIDHKFSPNLRLRNQTQFNYVQTDARETAPNAVGTVNSSGVFTALTNS
FT                   NLPLSALSVRLQSHDRRIRDYSLFNQTELTAKFDTGSVKHTLLVGTEFGHDGYDNQNYY
FT                   RNGSCNGTPLAQSSMTSGFVSCEPLVSPSYTTSPASTPSSLGNLQGGSANTVAAYFNDS
FT                   IEFTKQWKAVAGLRYDRYVASISNSLNSANTPASAKITALPYAQQSVNFVSTRLGGIWQ
FT                   PTDWQSYYVSYGTSFNPSLEQLVGTTGQQGLDPEKNKSYEAGGKWDLLNGDLSVSSALF
FT                   QITKDNARTQIDSTTYTSAGKIRVRGARLGATGHVTDKLQIFAGYTYLDAQIVNGIAAG
FT                   TQGMTPANTPKHSATVWTSYAFVPNWEVGAGAFYMSQRYANNTNTVQTGGFVRWDAMLA
FT                   YHQPKYDVRLNLFNVFNKTYYDALIPSDGGRAVPGTGRAAMLSVVYRM"
FT   sig_peptide     47353..47424
FT                   /locus_tag="Rpic_3802"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 24"
FT   gene            49630..50316
FT                   /locus_tag="Rpic_3803"
FT   CDS_pept        49630..50316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3803"
FT                   /product="2OG-Fe(II) oxygenase"
FT                   /note="PFAM: 2OG-Fe(II) oxygenase; SMART: Prolyl
FT                   4-hydroxylase alpha subunit; KEGG: reu:Reut_A2877 putative
FT                   hydroxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3803"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28919"
FT                   /db_xref="GOA:B2UH68"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR006620"
FT                   /db_xref="InterPro:IPR023550"
FT                   /db_xref="InterPro:IPR041097"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH68"
FT                   /protein_id="ACD28919.1"
FT                   /translation="MLVCIPNVFTAAQVAALRDLLDSAGDAWVDGRVSAGYSGAPVKVN
FT                   QQIDEGAEVALQCQQLILSVLERHPRFISAALPNVVYPPMFNRYGEGMTFGAHVDGSVR
FT                   IHPHNGTKLRTDISATLFLSDPASYDGGELQIEDTYGMHSVKLNAGDLVIYPATSLHQV
FT                   TPITRGVRVASFFWIQSLIRDDAQRAMLFDLDNAIQMLNQTDADATARRTLIGVYHNLM
FT                   RQWSET"
FT   gene            complement(50377..50523)
FT                   /locus_tag="Rpic_3804"
FT   CDS_pept        complement(50377..50523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3804"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RS01993 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3804"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28920"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH69"
FT                   /protein_id="ACD28920.1"
FT                   /translation="MNTVALQAAPASRLARFWQILRREASRAVALHVESCGMMAELYRR
FT                   SGH"
FT   gene            complement(50648..53176)
FT                   /locus_tag="Rpic_3805"
FT   CDS_pept        complement(50648..53176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3805"
FT                   /product="Pyruvate, water dikinase"
FT                   /EC_number="2.7.9.2"
FT                   /note="PFAM: pyruvate phosphate dikinase
FT                   PEP/pyruvate-binding; PEP-utilising protein mobile region;
FT                   KEGG: nmu:Nmul_A1613 pyruvate, water dikinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3805"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28921"
FT                   /db_xref="GOA:B2UH70"
FT                   /db_xref="InterPro:IPR002192"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH70"
FT                   /protein_id="ACD28921.1"
FT                   /translation="MHKLVLDWTDAAAAGAAVAGGKGWQLGRMATLGVPVPEGFVLAAQ
FT                   ASHGRAYGDAVPPAVLDVLTRALADRGWQDTPLAVRSSAPQEDASQHSFAGIHETRLNV
FT                   IGTHALAQAVQAVWDSAHAPHALAYRERFGIDAADREMAVVIMPLLLTVAAGIAFTSDP
FT                   LSGRDDHIVINAHWGLGEALVGGQADGDTFRIEVSAESDSLHVIERRIGQKTRMTRTLA
FT                   EGGTSLCDTAAQDVRRAVLDDAQLIALATLAHDTASALDFAQPRYDIEWVWDGQRFWIV
FT                   QARPITTRGRHVYAALQDQPTFWTRGNTREVFPAPLSPIDWTLYGHAANRMLTLAYALA
FT                   GYPLMPGLDRTALFRGRLYLNVSLMQWEAFDAFGIAPAAINRMLGGSQPEISVPRITWP
FT                   QRAARAARLARYLLNAGSARRQAQRDLNRARQEAAQWRDGEWPDNAVELAGCLHARFMT
FT                   ARRADSLFFLQGSAGGAVSGLVDFIDKQCHGEGHALTAALMAGAEPSVTAQQSYDLMAL
FT                   AQTAAADTEALAWLRADTRTGTLWAQQLPAHSPFRQQFGAFLERYGHRAIEESYFRHAR
FT                   WREQPDYLLDLIAGLVGSHAQTVRQRQQVAASRAWQRVPFWMRPVVRAMLKGAVRDSNQ
FT                   REAARSALVAYLEALRIGLLRLAEKLCPAGALDQSEDIFNLTLDECLRAAQGTLAPRFV
FT                   AQRARDRRQLLSRWATESEADIVSEHDEAPIAPALPVATGADVWTGTAVGAGAAQGRTR
FT                   LVDHAAAGTALQAGDILVAPSTDPAWTPLFLKAGALVMETGGYLSHGAIVAREFGIPAV
FT                   VNVPGIRAQLKDGETIRVDGNAGTISRVAA"
FT   gene            complement(53176..53805)
FT                   /locus_tag="Rpic_3806"
FT   CDS_pept        complement(53176..53805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3806"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG:
FT                   bch:Bcen2424_3720 transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3806"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28922"
FT                   /db_xref="GOA:B2UH71"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH71"
FT                   /protein_id="ACD28922.1"
FT                   /translation="MPSSPMPIETGRRERKRSQTLDHLAATAFALFEAHGYDAVTMEQI
FT                   AAQADVSKGTLYNHFPVKEALLAHQFHAELAAGGMQLRAQIEAQPDFASRMAVLLSASA
FT                   DWCQARRPYLAAYFRYRFASADLASRNRDADKRSGLEAVFAMLIDAGQRSGELDAQLDA
FT                   EHLAGLFEYLYLGALMRWLARPDTDLHEGFSVIIDLFLRGIGRTEA"
FT   gene            53925..54878
FT                   /locus_tag="Rpic_3807"
FT   CDS_pept        53925..54878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3807"
FT                   /product="proline iminopeptidase"
FT                   /EC_number="3.4.11.5"
FT                   /note="KEGG: reh:H16_B2515 prolyl aminopeptidase; TIGRFAM:
FT                   proline iminopeptidase; PFAM: alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3807"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28923"
FT                   /db_xref="GOA:B2UH72"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR002410"
FT                   /db_xref="InterPro:IPR005944"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH72"
FT                   /protein_id="ACD28923.1"
FT                   /translation="MSELRTLYPPIEPYETGMLDVGDGHTIYYERVGTPGAKPAVFLHG
FT                   GPGGGISPDHRRVFDPARYDVMLFDQRGCGRSTPYAGLEANTTWHLVADIERLRAMVGA
FT                   ERWLVFGGSWGSTLALAYAQKSPERVSELVLRGVYTVTQAELRWYYQYGVSEMFPEKWA
FT                   RFQAPIPEAERGDMIAAYRKVLTGEDRARQIEAARAWSVWEGETITLLPDPGNSAKHAD
FT                   DHFALAFARLENHYFTHQCWLEEGQLLREAQRLAGIPGVIVHGRYDMPCPVRYAYALHQ
FT                   AWPDADFYLIEGAGHAWTEPGILDQLVAATDRFADR"
FT   gene            54933..57359
FT                   /locus_tag="Rpic_3808"
FT   CDS_pept        54933..57359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3808"
FT                   /product="multi-sensor hybrid histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="KEGG: bte:BTH_II0144 sensor protein EvgS precursor;
FT                   PFAM: response regulator receiver; ATP-binding region
FT                   ATPase domain protein; histidine kinase A domain protein;
FT                   Hpt domain protein; SMART: extracellular solute-binding
FT                   protein family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3808"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28924"
FT                   /db_xref="GOA:B2UH73"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH73"
FT                   /protein_id="ACD28924.1"
FT                   /translation="MKGIVAAYALVASVLLCLMPGAGQAASASAFTAEERAWIAAHPVV
FT                   RTCVDAHWRPFEFVEDGKIVGIVPSFLDAVSDISGLQFEYVDGACWHGSVEALKSGRID
FT                   MSPDWSSDEDTARYRQGFIASTPYFVGTISIVTAERENLFGGSQQLAGKRVAIKGGGGL
FT                   ELAMRHNGVPVTLLTFQDESDALEAVAAGKADAALGTDASILPQLQRQFKGRLFLSGSI
FT                   WDSPYALTMVTRKDNPVLASILDKSLTAISASDADAIRHRWLETTDYGAPSLASILHYR
FT                   WRQVVAMSAVLLAFAVLAYVLWRARVAAVRSERDKAMFVAFISHEIRTPMHTILSSLEL
FT                   LQRSQLNGQQASRAVAAISASETLLALLDDVLEYSRLESRSVKLAPQPTAIGPWAQQSI
FT                   DMVRWRSDEKKLALSLDLACAPDLFIDIDSMRVRQIVLNLLVNAIKFTASGSVVLRVDY
FT                   LPAKRRGGGTLVLEVRDTGIGIPPERQRKVFEPYERVEGLGHRGASGSGLGLSICRELV
FT                   NLMRGVITVSSNPEIGTVFTVMLPVREPQADARPEGVAAAPWPQARARATKQPSPLPIE
FT                   GPLILVVDDHEAVQHAIQHQLDALGCRTAIAVTGEAALEQFRPSAFDMVLLDCDLPGID
FT                   GYTVAQRMRNMEQQQGQRTPIIAISASTDDTHRVRCFDSGMDGVLAKPLRLAALREMID
FT                   LWCAHGNAVPSATPSSEAVASAALLAIYQESMTADLKSLAHGVMTRDIAQARHAAHRIA
FT                   GAAAVVDRLRTRDLAAELERRLSAPSGEVTPDVHALLAELQSAHAADMLDHSRQP"
FT   sig_peptide     54933..55010
FT                   /locus_tag="Rpic_3808"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.753 at
FT                   residue 26"
FT   gene            57801..58388
FT                   /locus_tag="Rpic_3809"
FT   CDS_pept        57801..58388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3809"
FT                   /product="Fimbrial protein"
FT                   /note="PFAM: Fimbrial protein; KEGG: pfl:PFL_3922 type I
FT                   pilus biogenesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3809"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28925"
FT                   /db_xref="GOA:B2UH74"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH74"
FT                   /protein_id="ACD28925.1"
FT                   /translation="MKAKLFLAGVAMSTLSAAAMAQTTPTSVDGVINFQGTILSDTCKV
FT                   SSLTGDAGTINVDMGTIAADDIGTLTAPKSLANGAGSANIDVVCKTGAKVSMKFAGKTA
FT                   ELSADKKTLRVNNGNTGAGFAQGVSIAVYEGTGAGANAFDLSGGNLLAQTTVPSTGGAV
FT                   NVRFAAAYVAADPTKIKPGIANASLPFTLTYE"
FT   sig_peptide     57801..57866
FT                   /locus_tag="Rpic_3809"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 22"
FT   gene            58473..59216
FT                   /locus_tag="Rpic_3810"
FT   CDS_pept        58473..59216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3810"
FT                   /product="Pili assembly chaperone, N-terminal"
FT                   /note="PFAM: Pili assembly chaperone, N-terminal; Pili
FT                   assembly chaperone, C-terminal; KEGG: pfo:Pfl_3043 pili
FT                   assembly chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3810"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28926"
FT                   /db_xref="GOA:B2UH75"
FT                   /db_xref="InterPro:IPR001829"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016147"
FT                   /db_xref="InterPro:IPR016148"
FT                   /db_xref="InterPro:IPR036316"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH75"
FT                   /protein_id="ACD28926.1"
FT                   /translation="MKAKRCAAGAALACALAASASHASISLSTTRLIFDGKNKETSVVV
FT                   NNDGADALIQAWLDPLDEGANSQLPFAITPPLAKVAAKQQQLLRVLYEGVGMPTDRESA
FT                   FWLNVQEVPQTAHNDNVLQLAVRQRIKVFYRPAGLNADPQKAPASLQWQLNQDGGKAML
FT                   RLSNPSLYHVTVVDAKVHGGSAEESVIDAKMVAPNSTVTLPVKLPTNAAAPELRYDVIN
FT                   DYGGRQSYRVTLHGSQPSTPVSTGN"
FT   sig_peptide     58473..58544
FT                   /locus_tag="Rpic_3810"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.991 at
FT                   residue 24"
FT   gene            59300..61927
FT                   /locus_tag="Rpic_3811"
FT   CDS_pept        59300..61927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3811"
FT                   /product="fimbrial biogenesis outer membrane usher protein"
FT                   /note="PFAM: fimbrial biogenesis outer membrane usher
FT                   protein; KEGG: pfo:Pfl_3044 fimbrial biogenesis outer
FT                   membrane usher protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3811"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28927"
FT                   /db_xref="GOA:B2UH76"
FT                   /db_xref="InterPro:IPR000015"
FT                   /db_xref="InterPro:IPR018030"
FT                   /db_xref="InterPro:IPR025885"
FT                   /db_xref="InterPro:IPR025949"
FT                   /db_xref="InterPro:IPR037224"
FT                   /db_xref="InterPro:IPR042186"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH76"
FT                   /protein_id="ACD28927.1"
FT                   /translation="MTAPRFTKLEASIAMSTCQTTQAFSRKTNGKAVAARPSATPLYLA
FT                   VCLAMMNTARAAEGETLVAQVDPTLLAYNTSFLQGQGRPADLSAVLSSGSSVPPGTYRV
FT                   EVQVNGNLVGRRDIDFYQDSDKAKLRPCLTAKMLQDFGVSLSSITPPLDINSHACLDLP
FT                   HVLDQASADFDAGRLQLNLSIPQAFLSRAARGYVDPALWDEGVTAGYVNYQFSGNYGHS
FT                   GTGNDSSSYFIGLQNGVNIGRWRLRNESTVSGSNSGQTRFKSNRTLVQRDVDAIKGQLT
FT                   LGEQYSDATLFDSVRFRGVQIGSDDAMLPDSERGYAPVVRGQAATNAVVEVRQSGYVLY
FT                   RANVPPGPFQLTDIFPSGSNGDLEITVIEADGTRRVTHQAFSSLPLMLRKGRLKYNFAA
FT                   GKYDGDQGPSPNLLSGSLVYGLTDNSTVAGGLQVSKDFQAVNVGVGTNTPIGALSVDLT
FT                   QSSSRVRGERDTGQSVRILYAKTFTSTNTNFTLAAYRYSTSGYRTFNDHVNDLSNNAGN
FT                   AWFNATGFQAGRSRSRIDLTTSQDLGGIERQYGSVYLNVSQQTFWNQPGSSRSISLGYG
FT                   NNWKQLSYNLSLSQTNDTRFSGSGNSTQVMLTMSIPLGSKLHSPRAYTNISNTNNGGTT
FT                   VQSGLSGFVNDNTSYAMQAGYTGSGRGATGGASLTRDTDMGQLNANVNVARDYQSASVG
FT                   ATGSVVVHRGGVNLGRTVGDTFALMKVEGIKGVDMKTDAGVSVGRNGYAVITYAQPYRL
FT                   NALSPDTHNLGADVELEDTVKQVVPRRGAIVQATFKGYSGQRAQFAFQQPDGKPVPFGA
FT                   SVEEAPTGRHLGITDPNGNAFVLLRQEQGTLTVKWKDNQCQAPYALGQAEPGRNYRKQT
FT                   LRCR"
FT   sig_peptide     59300..59470
FT                   /locus_tag="Rpic_3811"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.830) with cleavage site probability 0.793 at
FT                   residue 57"
FT   gene            62518..63093
FT                   /pseudo
FT                   /locus_tag="Rpic_3812"
FT   gene            63341..63622
FT                   /pseudo
FT                   /locus_tag="Rpic_3813"
FT   gene            63686..63982
FT                   /locus_tag="Rpic_3814"
FT   CDS_pept        63686..63982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3814"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein; KEGG:
FT                   rme:Rmet_6073 transposase IS3/IS911"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3814"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28928"
FT                   /db_xref="GOA:B2UH77"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH77"
FT                   /protein_id="ACD28928.1"
FT                   /translation="MTSKTKRAQYTLEFKLEAVRLVKSGQSMAVVSATLGIRAQTLHNW
FT                   VKAEREGKLTGAGMKPVSPEQMELARLRAEVARLKMERDILKKAAAYFAKESV"
FT   gene            63979..64872
FT                   /locus_tag="Rpic_3815"
FT   CDS_pept        63979..64872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3815"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG:
FT                   rme:Rmet_6074 integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3815"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28929"
FT                   /db_xref="GOA:B2UH78"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH78"
FT                   /protein_id="ACD28929.1"
FT                   /translation="MRYAFIERNRRYWPVSVLCELLGVSPSGYHQRKQRTVSTDRPDRG
FT                   RLSDDALLAHIKAIHAGVKGEYGWPRMWKELLARGVRVGKERVRKLMALHGIRARHKRK
FT                   YIATTNSNHDLPVAPNLLQRDFSPAAPNQVWTSDITYVATAEGWLYLVVIIDLFSRQVV
FT                   GWSMQPHMKAELVTDALRMAWFRRRPEAGVIVHTDRGSQYCSHLFQDALKAYGMRSSMS
FT                   RRGDCWDNAPTESLWGSLKVARLHGRQFATRRAAMDEVIDWLGFYNASRLHSTLGYVSP
FT                   MTFEKNWSAAQQHRAA"
FT   gene            64884..65552
FT                   /locus_tag="Rpic_3816"
FT   CDS_pept        64884..65552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3816"
FT                   /product="Fimbrial protein"
FT                   /note="PFAM: Fimbrial protein; KEGG: rme:Rmet_4253 fimbrial
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3816"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28930"
FT                   /db_xref="GOA:B2UH79"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH79"
FT                   /protein_id="ACD28930.1"
FT                   /translation="MGFVEQGQGQSVNIADMTQATTTWEIDGASTTYWSVTGPLLLRIK
FT                   KIGQVGADASVPCCVLGYHTVDNQITPLTYKTSNTSTVATRSCKTPSVTVKMGDQNEVR
FT                   GFQGVGTSLSPVSFSIALKECPEGLNKVSYQLNPNSAIVDASRSVVALDAGSTAKGVGV
FT                   QLLNSAGNPVALKTKLQFAQYDKQGGNFNIPLQAAYYQTANQIVPGTANTSVAFVMGYN
FT                   "
FT   gene            complement(65778..65862)
FT                   /locus_tag="Rpic_R0059"
FT                   /note="tRNA-Leu6"
FT   tRNA            complement(65778..65862)
FT                   /locus_tag="Rpic_R0059"
FT                   /product="tRNA-Leu"
FT   gene            66041..66868
FT                   /locus_tag="Rpic_3817"
FT   CDS_pept        66041..66868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3817"
FT                   /product="Beta-lactamase"
FT                   /EC_number="3.5.2.6"
FT                   /note="PFAM: penicillin-binding protein transpeptidase;
FT                   KEGG: rso:RS02005 probable oxacillin hydrolase (class-D
FT                   beta-lactamase) signal peptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3817"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28931"
FT                   /db_xref="GOA:B2UH80"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH80"
FT                   /protein_id="ACD28931.1"
FT                   /translation="MMKLRHAATGALLAALATFAHAEHPICTIVADAATGTVVLHEGKC
FT                   DERVTPASTFKLALAVMGFDHGFLKDEHTPVEHFRRGDPDWGGEAWHQPIDPALWLQYS
FT                   VVWYSQRITHAMGAQTFQAYVRKLGYGNMDVSGDPGKHNGMDRSWITSSLKISPQEQVD
FT                   FMRRIVNRQLPVSAHTYEMVDRTVQTWQVPGGWAVQGKTGTAGPAPGNTSPDGTWDQAH
FT                   AYGWFVGWAKKGDKTYVFANLIQDDKVEPTSGGIRSRDALLARLPEVLAFAGH"
FT   sig_peptide     66041..66109
FT                   /locus_tag="Rpic_3817"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.990 at
FT                   residue 23"
FT   gene            complement(66878..67603)
FT                   /locus_tag="Rpic_3818"
FT   CDS_pept        complement(66878..67603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3818"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: regulatory protein ArsR; KEGG: bpt:Bpet1842
FT                   transcriptional regulator, ArsR-family"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3818"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28932"
FT                   /db_xref="GOA:B2UH81"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH81"
FT                   /protein_id="ACD28932.1"
FT                   /translation="MSHPNSFSGTAFLLADPARAAMLTALLDGHALPAGELAHAAGITA
FT                   QTASTHLAKLLDGGLVVVETEGRHKYFRLAGEHVAQALEHLAAITPSAVVRRTTPSPTA
FT                   RELGFCRCCYDHLAGQVGVAVTQALQSHGYLLPMPDKQYEITPAGIAWFGDVGLNVQDI
FT                   RPTRRGLARQCLDWTERAHHLAGPLGVHFLRRLCDAGWMLRARNSRAVLVTPKGWQELH
FT                   QRLGVDEATVRSDAGHRHA"
FT   sig_peptide     complement(67541..67603)
FT                   /locus_tag="Rpic_3818"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.809) with cleavage site probability 0.803 at
FT                   residue 21"
FT   gene            67725..69101
FT                   /locus_tag="Rpic_3819"
FT   CDS_pept        67725..69101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3819"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bvi:Bcep1808_5026 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3819"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28933"
FT                   /db_xref="GOA:B2UH82"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH82"
FT                   /protein_id="ACD28933.1"
FT                   /translation="MDAVTMQPTHADTVPRKWLVLCVLSMAVLVAQIDTAVVNLAVRPI
FT                   GQFFHADVGPLQWVIDAYNLAYAALLLSGGLLADLCGRRRAFVTGAAVFSVASVLCALA
FT                   ASIGWLIGARAMAGVGASLLLPASLAILRVVWRDPAERAHALGVWAACNGLAMAIGPTA
FT                   GGLLVTHFGWRAVFWVVVPVSVAIMVLAVRVVPESADAAHRRFDALAQVLGAIALGGFA
FT                   FAAIEAYHAPTVGGGVFVLALAALAWFVRVEARHGSAALVPLDLFSVREFRGAITATAG
FT                   MTFGMYGALFLLPLMWQSTGRFTVVGAGIALMPMALVFMAVSPTSGTVARRVGTRMATA
FT                   GGVGIIALGLLVLAGFGGAVSIVPLAIGLALTGLGMGFATGPLMGAAVGAVGPERSGTA
FT                   SALVNVARMSGATLGVAMLGAVYAACGSGAAGLRVAMLCGGLVQLACAAVAWRHGEQPG
FT                   "
FT   gene            69918..70097
FT                   /locus_tag="Rpic_3820"
FT   CDS_pept        69918..70097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3820"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: azc:AZC_1023 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3820"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28934"
FT                   /db_xref="GOA:B2UH83"
FT                   /db_xref="InterPro:IPR021741"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH83"
FT                   /protein_id="ACD28934.1"
FT                   /translation="MKFLLALPFIGLLWVPFYNQELPSLFGFPFFYWYQFLWVPITSLL
FT                   IWIVFKNGQSQGEE"
FT   gene            70097..71605
FT                   /locus_tag="Rpic_3821"
FT   CDS_pept        70097..71605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3821"
FT                   /product="Na+/solute symporter"
FT                   /note="PFAM: Na+/solute symporter; KEGG: azc:AZC_1022
FT                   monocarboxylic acid permease"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3821"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28935"
FT                   /db_xref="GOA:B2UH84"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH84"
FT                   /protein_id="ACD28935.1"
FT                   /translation="MDGQINWTALAVFVFFFALVTVMGFIASRWQRGQSDKGAHIEEWG
FT                   LGGRNFGTWITWFLVGGDFYTAYTVIAVPALVYAVGAYGFFALPYTILVYPIVFLIMPK
FT                   LWKVAHAKGHVTAADAVYGRYGSRPLEFAVALTGVVATMPYIALQLIGMEVVIKALGLT
FT                   GELPLAAAFVILALYTYSAGLRAPALIAFVKDIMIYIVVLVAVVLVPAKLGGYGAVFAH
FT                   AHDAFAVKGGATGLTLKPAQFLPFATLAIGSALAAFMYPHTLTGIFAARSADTIRKNAV
FT                   FLPAYTVLLGLIALLGFMAYAAGVKVTNNNDVVPALFNALFPSWFTGFAFSAIAIGALV
FT                   PAAVMSIGAANLFTRNFWKPYVAPDLSHAGEEKVAKVISLIVKAGALVFILFLPTKFAL
FT                   DLQLLGGVWIVQTFPSVVFGLFKLSNRFRAPALLAGWAAGMIGGSWLAFTDGIKPVHTF
FT                   VIGGDKYTIYTGLAALAFNIVVAVVVQLIFGKRGEEAPALRQAG"
FT   gene            71890..72288
FT                   /locus_tag="Rpic_3822"
FT   CDS_pept        71890..72288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3822"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: reu:Reut_B5732 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3822"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28936"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH85"
FT                   /protein_id="ACD28936.1"
FT                   /translation="MRDLPGHKMIPTPEKTSFLCTLPGPKRDMAYSITVGFIDPTHPNC
FT                   VQFTSFVGEGRRSFRVLASEEDVPSAARCSIESLCRMAIGQVMRDSLYAMTAVGDHRLD
FT                   LHAPPWEGELKPAGARSAPRSPGQRSPG"
FT   gene            72406..72690
FT                   /locus_tag="Rpic_3823"
FT   CDS_pept        72406..72690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3823"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RSc2698 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3823"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28937"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH86"
FT                   /protein_id="ACD28937.1"
FT                   /translation="MDAYPICRYKGFDVYPLVYLFDPPREWHERRPDRSYNASVLICQA
FT                   GEQPSLEHSRIFRLSATPWENIGTAKRAAAKMAEDIIDGFAPGLSMAVV"
FT   gene            complement(72842..73264)
FT                   /locus_tag="Rpic_3824"
FT   CDS_pept        complement(72842..73264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3824"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   bur:Bcep18194_C6566 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3824"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28938"
FT                   /db_xref="GOA:B2UH87"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH87"
FT                   /protein_id="ACD28938.1"
FT                   /translation="MSPLVLRLASPQDFAAIRALLVEAGLPVEDVRPERIPHVVVASDD
FT                   AGLQGCVALEQLGSAALLRSLAVRRTARRRGLGRMLVARAESDARAMGVDQLFLLTTSA
FT                   SGYFETLGYAVVDRDAVPDAMKASSQFAALCLGKIL"
FT   gene            complement(73316..74386)
FT                   /locus_tag="Rpic_3825"
FT   CDS_pept        complement(73316..74386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3825"
FT                   /product="arsenical-resistance protein"
FT                   /note="TIGRFAM: arsenical-resistance protein; PFAM: Bile
FT                   acid:sodium symporter; KEGG: bmu:Bmul_5709
FT                   arsenical-resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3825"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28939"
FT                   /db_xref="GOA:B2UH88"
FT                   /db_xref="InterPro:IPR002657"
FT                   /db_xref="InterPro:IPR004706"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH88"
FT                   /protein_id="ACD28939.1"
FT                   /translation="MHLSNVAPPNNVIAKPAINFFERYLTVWVALCIVVGMALGQVFPG
FT                   VFQRIGRMEYAQVNLPVGLLIWVMIIPMLVKVDFGALHEVRQHIRGIGVTLVVNWLVKP
FT                   FSMAFLGWLFIKQLFAPMLPAAQLDSYIAGLILLAAAPCTAMVFVWSRLTGGDPLFTLS
FT                   QVALNDSIMVIAFAPLVGLLLGMSAITVPWATLLTSVVLYIVIPVLLAQALRKALLAKG
FT                   QPALDAVMARIGPWSITALLATLVLLFAFQGEAILKQPLVIALLAVPILIQVLFNSALA
FT                   YWLNRAVGEKHSVACPSALIGASNFFELAVAAAISLFGFHSGAALATVVGVLIEVPVML
FT                   LVVRIVNQSKGWYERA"
FT   gene            complement(74460..74963)
FT                   /locus_tag="Rpic_3826"
FT   CDS_pept        complement(74460..74963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3826"
FT                   /product="protein tyrosine phosphatase"
FT                   /note="PFAM: low molecular weight phosphotyrosine protein
FT                   phosphatase; KEGG: rso:RSp1128 putative arsenate reductase
FT                   (arsenical PUMP modifier) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3826"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28940"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH89"
FT                   /protein_id="ACD28940.1"
FT                   /translation="MADHTTNVLILCTHNSARSVLSEGMLNHWARTLGKDVRAYSAGSA
FT                   PSGRINPFAVEALEQAGVDTTGYRSKSWDEFVADGAPQMRIVITVCDSAAAETCPYWPG
FT                   SPVKVHWGYPDPSNAQGGDAGKRQAFELTRQAIGYRMLQLLMLPLDTLDNAALQAHLDR
FT                   ISQS"
FT   gene            complement(74974..75456)
FT                   /locus_tag="Rpic_3827"
FT   CDS_pept        complement(74974..75456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3827"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: reh:H16_A2179 lactoylglutathione
FT                   lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3827"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28941"
FT                   /db_xref="GOA:B2UH90"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH90"
FT                   /protein_id="ACD28941.1"
FT                   /translation="MKRFHVHVHVDDLSKSIAFYSKLFAAEPTRVESDYAKWMLDDPRI
FT                   NFAISTRGSTPGVDHLGFQVDDAAELAELKARAEAADMALLDEGETTCCYARSDKHWIT
FT                   DPQGIAWEHFHSLANIPVFSEGTQEAAPAEASACCAPRAPGGKPVGIAVKSGSSCC"
FT   gene            complement(75468..75722)
FT                   /locus_tag="Rpic_3828"
FT   CDS_pept        complement(75468..75722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3828"
FT                   /product="putative transcriptional regulator, ArsR family"
FT                   /note="SMART: regulatory protein ArsR; KEGG: rso:RSp1129
FT                   putative arsenical resistance operon repressor
FT                   transcription regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3828"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28942"
FT                   /db_xref="GOA:B2UH91"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH91"
FT                   /protein_id="ACD28942.1"
FT                   /translation="MLVVAGPTGMTPGALAEQLDVPGATLSFHLKELMNARLVTQERDG
FT                   RNLIYRAAYDHMAALLGFLTANCCQGAACLEPSTTDCKC"
FT   gene            76071..76991
FT                   /locus_tag="Rpic_3829"
FT   CDS_pept        76071..76991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3829"
FT                   /product="putative exonuclease RdgC"
FT                   /note="PFAM: putative exonuclease RdgC; KEGG: rso:RSc0618
FT                   recombination associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3829"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28943"
FT                   /db_xref="GOA:B2UH92"
FT                   /db_xref="InterPro:IPR007476"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH92"
FT                   /protein_id="ACD28943.1"
FT                   /translation="MWFKNLQLHRLPAPWAVTPDQIEQWLAPHAFRPGNSLDMQSAGWA
FT                   SPRDDGALVYSTNRQMLLVFRAEKKLLPASVVNQVTRARAVELEEQQGFKVGRKQMREL
FT                   KEQVTDELLPRAFAIRRDTRVWIDPVNGWLVIDAAAQGVADDVRSLLVKSIDRLPITSV
FT                   QVARSPVAAMTDWLLSGEAPGGFTVDQDAELRSTGEGGATVRYVGHALEADDMRRHIEA
FT                   GKQCTRLAMTWDNRISFLLTPSLTIKRVTPLDVIKEAADATAQNDDERFESDVALMTGE
FT                   LGRMLTDLVESLGGDRHEAMHQAAA"
FT   gene            complement(77049..77726)
FT                   /locus_tag="Rpic_3830"
FT   CDS_pept        complement(77049..77726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3830"
FT                   /product="putative periplasmic ligand-binding sensor
FT                   protein"
FT                   /note="KEGG: rme:Rmet_4026 putative periplasmic
FT                   ligand-binding sensor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3830"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28944"
FT                   /db_xref="InterPro:IPR018648"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH93"
FT                   /protein_id="ACD28944.1"
FT                   /translation="MSPQEQQALETFLAQLTQARAGTKDPQAEARILDAVARQPDAAYL
FT                   LVQRAMLLDQALASAQAQIATLQSQLQAAQAGRSTSFMDAASNWGSHANGATPAPGYTP
FT                   QQAAPASMPTAAQPMPSQPARGGFLSGGLGSTLGSIATTAAGVAGGALLFQGIENLFHH
FT                   NSGGGFFGQQPMLGGPSETIINNIYEGDSGRSSNLDTSSRDDGLLDTDFSDSDYSDDDS
FT                   TLI"
FT   gene            77993..80371
FT                   /locus_tag="Rpic_3831"
FT   CDS_pept        77993..80371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3831"
FT                   /product="NADH:flavin oxidoreductase/NADH oxidase"
FT                   /note="PFAM: NADH:flavin oxidoreductase/NADH oxidase;
FT                   monooxygenase FAD-binding; KEGG: rso:RS02007 salicylyl-CoA
FT                   5-hydroxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3831"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28945"
FT                   /db_xref="GOA:B2UH94"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH94"
FT                   /protein_id="ACD28945.1"
FT                   /translation="MKIVCIGGGPAGLYFALLMKLQDPSHDITVVERNRPYDTFGWGVV
FT                   FSDQTLGNLQRADAKSAAQILDAFNHWDDIEVHIRGQVVRSGGHGFCGIGRKRLLNILQ
FT                   ARCEEEGVKLVFETDVQDQDLENDGAYVDADLIIASDGLNSRIRTKYAATYQPDIDTRR
FT                   CRFVWLGTHKLFEAFTFAFEETEHGWFQAHAYRFDDETSTFIVEAPEEVWRAAGLETME
FT                   KEEAIAYCERLFAKYLDGNKLISNATHLRGSAQWIRFPRVVCRHWVHTNAHGTPVVLMG
FT                   DAAHTAHFSIGSGTKLALEDSIELARSIGQHPGDLRAALEHYEAVRSVEVLRIQNAARN
FT                   STEWFENVDRYANLPTEQFAYSLLTRSQRISHENLRQRDKRYLEQFEDWIAEQAGAPRG
FT                   PQHGPVPPMFTPFTVRDVTLKNRVVVSPMAQYSCEDGQPADYHLVHLGARAMGGAGLVM
FT                   AEMTCVSPDARITPGCPGLWNTDQRDGWARIVQFVHANSDAKLGIQLGHAGAKGSTRVA
FT                   WEGIDLPLEDGQNWALISASPQQYLDGVSQWSRAMTRDDMDRVRDDFVHAARLAAEAGF
FT                   DWLELHCAHGYLLSSFISPLTNQRNDEYGGTLDNRLRFPLEVFHAVREVWPSNKPMSVR
FT                   ISAHDWVEGGITPDDAVEIARVFKAAGADMIDCSSGQVSKKEQPVYGRMFQTPFADRVR
FT                   NEAGIATIAVGAISEADHVNSIIAAGRADLCAVARPHLANPAWTLNEAARIGYLDMPWP
FT                   KQYRAGKLQLERNLERERAMAAQAAGLSPLEQANRMQGV"
FT   gene            80373..81155
FT                   /locus_tag="Rpic_3832"
FT   CDS_pept        80373..81155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3832"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; KR domain protein;
FT                   KEGG: rso:RS02008 probable oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3832"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28946"
FT                   /db_xref="GOA:B2UH95"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH95"
FT                   /protein_id="ACD28946.1"
FT                   /translation="MATPAMLTGHHAVVTGAGRGIGAAIAAQLAAHGATLTLMGRNADV
FT                   LHATAKTLPDSARAQVVTCDVTDEASVSAAFESARAGLGPISILVNNAGQAESASFAKT
FT                   TLDQWQRMLAVNLTGTFLCTQAALPDVQASGRGRIVNIASTAGQRGYAYVSAYVAAKHG
FT                   VIGLTRSLALELAARGVTVNAVCPGYTETDIVRESIDRIVARTGRSEEEARAELVKGNP
FT                   QGRLITPDEVANAVVWLCSDGASSITGQAISVSGGEVM"
FT   gene            81152..81736
FT                   /locus_tag="Rpic_3833"
FT   CDS_pept        81152..81736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3833"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; KEGG: rso:RS02009
FT                   putative transcription regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3833"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28947"
FT                   /db_xref="GOA:B2UH96"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH96"
FT                   /protein_id="ACD28947.1"
FT                   /translation="MSTERTRRKTALATRASGHHAVVQALGDQHIGLEARAHVDDHMDV
FT                   KIWLRLLACSTQIEQQIRQRLRTRFNTTLPRFDYLAQLDRHPDGLRMNVLSRYLMVTGG
FT                   NVTGLTDQLEKEGLVKREADPDDRRSFRVLLTDAGRRHFAEMAAEHERWLIEMFDGLGI
FT                   ANKDALYAQLGHLRVHLAQREQELDAREDQP"
FT   gene            81754..82614
FT                   /locus_tag="Rpic_3834"
FT   CDS_pept        81754..82614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3834"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   rso:RS02010 enoyl-CoA hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3834"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28948"
FT                   /db_xref="GOA:B2UH97"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH97"
FT                   /protein_id="ACD28948.1"
FT                   /translation="MTDPNHHVDPALLAGNRRPLAGYQAKHFLWSVEGGVATITLNRPE
FT                   RKNPLTFDSYAELRDLFHQLKWADDVKAIVLAGASDNFCSGGDVHEIIGPLVQLKAPEL
FT                   LMFTRMTGELVKAMRACPQPIVAAIDGVCAGAGAILAMSSDLRLGTARSKTAFLFNRVG
FT                   LAGCDMGACAILPRIIGQGRASELLYTGRSMNGEEGERWGFFNRLCEPAQVLSQAQALA
FT                   ADLAAGPTFANGITKTMLHQEWTMTIEQAIEAEAQAQAICMLTEDFSRAYHAFVAKQKP
FT                   VFEGN"
FT   gene            82616..83791
FT                   /locus_tag="Rpic_3835"
FT   CDS_pept        82616..83791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3835"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase type 2 domain; KEGG: rso:RS02011
FT                   probable acyl-CoA dehydrogenase oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3835"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28949"
FT                   /db_xref="GOA:B2UH98"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH98"
FT                   /protein_id="ACD28949.1"
FT                   /translation="MSDKDYLQWPFFDDKHRQLEAELDAWATKHIAHDHGPDVDAECRA
FT                   LVKLLGQGGWLRHAVGGTAHGGAGETIDTRAICLIRETLARHSGLADFAFAMQGLGSGA
FT                   ISLHGTPEQRERYLTKVAHGEAISAFALSEPDAGSDVAAMASAAREDGNDYVLDGEKTW
FT                   ISNGGIADFYVVFARTGEAPGSRGISAFIVEAGTPGFEIAERINVIAPHPLARLRFTNC
FT                   RIPASQRVGAAGEGFKVAMRTLDVFRTSVAAAALGFARRALDEALARATTRKMFSGVLA
FT                   DFQLTQAKLAQMATAIDSAALLTYRAAWQRDQGRNVTREAAMAKLTATENAQQVIDAAV
FT                   QMWGGLGVVSEQPVERLYREIRSLRIYEGATEVQQLIIARELLRAAAPAKS"
FT   gene            83828..85444
FT                   /locus_tag="Rpic_3836"
FT   CDS_pept        83828..85444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3836"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   rso:RS02012 probable acetyl-coenzyme A synthetase
FT                   (acetate--CoA ligase) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3836"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28950"
FT                   /db_xref="GOA:B2UH99"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH99"
FT                   /protein_id="ACD28950.1"
FT                   /translation="MPSAHIDTFARDRLPPAELQPVYRFDLPALQFPPQLNCATELLDR
FT                   RVAAGEGGRLCIQATGIRWTYADLQAHANRIANVLVNEMGVVPGNRVLLRSPNSPMLAA
FT                   CWFAVMKVGAIAVTTMPLLRAKELGQILGKGEIGFALCDARLVDELRDAVTQAAKPVQL
FT                   LCFHDDTPEGLEAAMVRQPATFTNVDTAADDTCLLAFTSGTTGVPKATMHFHRDILAIC
FT                   ACWPPHVLQPRADDIFIGSPPMAFTFGLGGLLLFPMSVGASTVLLEKASPNDLVDGIRT
FT                   FGATVLFTAPTTYRIIAARGDELRATPLRRCVSAGEALPVATRTLWKDATGIELIDGIG
FT                   ATEMLHIFISAADADVRPGATGKAVPGYVAQVVDDAGNPVPPGTVGRLAVQGPTGCRYL
FT                   ADDRQRAYVRNGWNLTGDAYVMDEEGYFHYHSRTDDMIISSGYNIAAPEVEDALMQHPA
FT                   VAECGVIGEPDEERGQIVKAFVVLHPGHSAGPEMVKTLQDFVKQTVAPYKYPRAIEFRT
FT                   SLPRSEVGKLLRYRLREHDKS"
FT   gene            85441..85872
FT                   /locus_tag="Rpic_3837"
FT   CDS_pept        85441..85872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3837"
FT                   /product="putative 4-hydroxybenzoyl-CoA thioesterase
FT                   protein"
FT                   /note="KEGG: rso:RS02013 putative 4-hydroxybenzoyl-CoA
FT                   thioesterase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3837"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28951"
FT                   /db_xref="GOA:B2UHA0"
FT                   /db_xref="InterPro:IPR008272"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHA0"
FT                   /protein_id="ACD28951.1"
FT                   /translation="MSDYHFERAARIRFAHCDPAGIVYFPQYLVLFNGLVEDWFTDGLG
FT                   VSYAQMLGPRRIGLPIVKLHCEFSAISRMGDDVQFKLKLERLGNASLTLALDCWAGNEQ
FT                   RVQSQQVLVFTDLNTHRAIAVPPDVRQAIEASVQQSQSN"
FT   gene            85886..86278
FT                   /locus_tag="Rpic_3838"
FT   CDS_pept        85886..86278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3838"
FT                   /product="Endoribonuclease L-PSP"
FT                   /note="PFAM: Endoribonuclease L-PSP; KEGG: rso:RS02014
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3838"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28952"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHA1"
FT                   /protein_id="ACD28952.1"
FT                   /translation="MEVLLPPNWPRPKGYANGVSARGRMVFVAGMIGWDAQGVFHTDDL
FT                   AGQVRQALQNIVEVLAAGDAKPEHIVRMTWYVTDKKAYVAAYPEIGQAFRELIGSFSIA
FT                   MTAVEVAALVEDRAKVEIEVTAVVPD"
FT   gene            complement(86584..87660)
FT                   /locus_tag="Rpic_3839"
FT   CDS_pept        complement(86584..87660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3839"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="SMART: helix-turn-helix- domain containing protein
FT                   AraC type; KEGG: rme:Rmet_1732 transcriptional regulator,
FT                   AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3839"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28953"
FT                   /db_xref="GOA:B2UHA2"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR032687"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHA2"
FT                   /protein_id="ACD28953.1"
FT                   /translation="MPYLVRSASLTGYAEAARAGGLDPFRMLAEVGLPADSLSDVDLKI
FT                   PADKVGRLLELSAQRSGIETFGLRMAETRRASNLGPLILLVRDEPTLRQALQAMARYGH
FT                   LHNEAIFLHVEEEDGIAVIRDEVLASDVGSLKQATELVVGVLFRLLRFFLGDDWHPKTV
FT                   LFAHAAPKDRSVHARVFGSNVEFGHAFSGIVCNASDLDLPLPSADPVMARYVRRYLNDL
FT                   DPEGGKRMSDEVRQMVIMLLPSGRATVDHIARHLGVNRRTIHRHLTQEGTTFSSILDAV
FT                   RSELAVRYLDQGERQCAEISGFLGFSEPSAFTRWFRGTFGCSPTQFKVSKASAFDKGMI
FT                   SRSHAGDQKKKTRRSRLS"
FT   gene            87800..88195
FT                   /locus_tag="Rpic_3840"
FT   CDS_pept        87800..88195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3840"
FT                   /product="Carboxymuconolactone decarboxylase"
FT                   /note="PFAM: Carboxymuconolactone decarboxylase; KEGG:
FT                   reu:Reut_B4714 carboxymuconolactone decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3840"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28954"
FT                   /db_xref="GOA:B2UHA3"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHA3"
FT                   /protein_id="ACD28954.1"
FT                   /translation="MTTNAPIDPSATPVCDSMRATGNWNPNWEPFAELDPAWTEKFMAM
FT                   GVMPHRVLDPKTLEFLAIAVDASCTHMYAPGVRRHIRKALELGATKEEITAVLQAVSVL
FT                   GIHSMSLGAPILLEELAARENTTATVE"
FT   gene            88231..89280
FT                   /locus_tag="Rpic_3841"
FT   CDS_pept        88231..89280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3841"
FT                   /product="protein of unknown function DUF849"
FT                   /note="PFAM: protein of unknown function DUF849; KEGG:
FT                   reu:Reut_B4715 protein of unknown function DUF849,
FT                   prokaryotic"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3841"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28955"
FT                   /db_xref="GOA:B2UHA4"
FT                   /db_xref="InterPro:IPR008567"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHA4"
FT                   /protein_id="ACD28955.1"
FT                   /translation="MQFFDDSMLPENQEPLVIQVAPFGPQFLPSDSDDIAVSMDAQIQK
FT                   AVDCYNAGATVLHVHVREEDGKGSKRLSKFNEMLTRLREAVPNMVLQVGGSISFAPEDE
FT                   GAAAKWLSDDTRHMLAELSPRPDQVTIAINTNQMNVTELLTHDDCAGTSMAEPAYFQAY
FT                   KEMWIPSGPTFVEEHLKRLQASGIQPHFMLADVGQLETVERLIRRGHYTGPVVLNWVAI
FT                   GGGADGPNPRNMMEFINRCPQGAVLTIESLMRHVLPLNTMAIAMGLHVRVGIEDNLWGK
FT                   KGERMTSVQQVEQMVRIARELHRDVASGTDARRIYKIGEHYNGIDETLAAVGYEPNRKP
FT                   GQRGFQLAA"
FT   gene            89396..90217
FT                   /locus_tag="Rpic_3842"
FT   CDS_pept        89396..90217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3842"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: bxe:Bxe_A3610 putative dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3842"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28956"
FT                   /db_xref="GOA:B2UHA5"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHA5"
FT                   /protein_id="ACD28956.1"
FT                   /translation="MKLDKKVAVVTGAAGGLGKAIALAYADAGAKLVVCDINTTALEVT
FT                   RAEIESRNAECLALHCDVGSSSAVANLFEQVDAHFGTVHVLVNNAAVIPSQPVDEQRRL
FT                   QHYAYLTTPQPRHTLGFTSSMTDDDWHRFWDVNVHGVFYCTREALKRMEPQGDGKVINI
FT                   ASIAGLAALSAHSPHYSATKGAVVAFTRSVAAEVAGANIFVNAIAPGGVHTDHFEALLQ
FT                   GIGEEKRNQLFQLVPLGRLGTPEEYASLAVYLAADGHYIAGQIISPNGGMF"
FT   sig_peptide     89396..89464
FT                   /locus_tag="Rpic_3842"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.905) with cleavage site probability 0.380 at
FT                   residue 23"
FT   gene            90335..91618
FT                   /locus_tag="Rpic_3843"
FT   CDS_pept        90335..91618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3843"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   reu:Reut_B4716 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3843"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28957"
FT                   /db_xref="GOA:B2UHA6"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHA6"
FT                   /protein_id="ACD28957.1"
FT                   /translation="MFQKRPMIALIALLFIHTLAHIDRNMLLGFSSQVIADLGLSNAQY
FT                   GFLVGAVWVLSFGVMAVFLGTLADRFSRTRVIAGGLLVWSACTAASGFAQNFEQMAAAR
FT                   FLVSSGEAALVPAAVAMLGELFPEKQRGTAIGLFFMGIPAGIGFSFLLAGTFGAAHGWR
FT                   STFQVLGVVGVLIAVSLACVQEAPWNVGTQQRGAPVLAQIRGALRVLGANPTLLAVTVG
FT                   FVLVHMVFAGLSFTQLWLVRERGLDAATIARTIGALQLIVGTLGSVAGGMVGDRLARRM
FT                   PGGHVGFMVLLVAICGPLMIAYRFAPPGSALFYVGMCAGFFLPLALYGPTNTVILSQVP
FT                   VHMRATISGFSMLLINVFAITLGNLAVGLLSDRLARTGASAPLTFVLLGTDVLAVMSGM
FT                   CFLVAARVGLRTNAALGPACPVASQLHG"
FT   sig_peptide     90335..90397
FT                   /locus_tag="Rpic_3843"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.813) with cleavage site probability 0.807 at
FT                   residue 21"
FT   gene            complement(92176..93480)
FT                   /locus_tag="Rpic_3844"
FT   CDS_pept        complement(92176..93480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3844"
FT                   /product="metabolite/H+ symporter, major facilitator
FT                   superfamily (MFS)"
FT                   /note="TIGRFAM: metabolite/H+ symporter, major facilitator
FT                   superfamily (MFS); PFAM: General substrate transporter;
FT                   major facilitator superfamily MFS_1; KEGG: rso:RSp0075
FT                   putative alpha-ketoglutarate permease transmembrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3844"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28958"
FT                   /db_xref="GOA:B2UHA7"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHA7"
FT                   /protein_id="ACD28958.1"
FT                   /translation="MDTTATPHAVDPHDTRRRIFAIVGASSGNLVEWFDFYVYAFCSLY
FT                   FAPAFFPSGDRTTQLLNTAGVFAAGFLMRPIGGWLFGRIADKHGRRAAMMISVLMMCGG
FT                   SLVIAVVPTYAQIGALAPFILLLARLFQGLSVGGEYGTSATYMSEVALKGRRGFFASFQ
FT                   YVTLIGGQLCALLVLVVLQQLLTTAELKAWGWRIPFAVGALTALVSLYLRKSLQETQTV
FT                   ASRTAKGAGTIRGAWQHKGAFLRVIGFTAGGSLIFYTFTTYMQKYLVNTAGMNTKVASN
FT                   VMTAALFVYMVLQPVFGALSDRIGRRTSMLFFGVLSVLGTVPLMHALATVSSPYAAFGL
FT                   ITVALAIVSFYTSISGLIKAEMFPPEVRAMGVGLSYAIANAVFGGSAEYVALWFKKAGT
FT                   EPTFYWYVTALCALSLVVTYFMPDPSKEGYLRNEP"
FT   gene            complement(93664..94884)
FT                   /locus_tag="Rpic_3845"
FT   CDS_pept        complement(93664..94884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3845"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   rso:RS05543 probable transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3845"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28959"
FT                   /db_xref="GOA:B2UHA8"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHA8"
FT                   /protein_id="ACD28959.1"
FT                   /translation="MSASPASPTPSATTAPAATHSDTQGLIRLLTAGAGISVACIYLNH
FT                   PLLGLISRDLNIAPNALGVLPTLTAAGYASGIFFFGPLGDRYDRRLVILWKAVLLTLAL
FT                   IGSCLAPNLPLLAAAGFAIGLSATIAQDFVPSAAAISTDHNRNRNIGTVMTGLLIGIVS
FT                   SRVFSGIVADHFGWRAAFGVSAVAIVGLAIAVRASHFGVTPATRQPYFTLLRSLGTLFM
FT                   QHPRLRASALTQAFIGIAFSGFWSTVALHLTRSLGLSTGQAGLLGLAGAAGALGASIAG
FT                   RLSGRVAPGRIAAGGALLMAVTFASMAMFPQSLIAIVIGTLVFDVGVQAALVSHQTIIY
FT                   ALAPEARSRINAVFMTALFIGMSVGAYGASLAWNAGRWSGLMTFCASASLVALGLRALF
FT                   NARLGAH"
FT   gene            complement(94984..95820)
FT                   /locus_tag="Rpic_3846"
FT   CDS_pept        complement(94984..95820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3846"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR HTH; UbiC
FT                   transcription regulator-associated domain protein; KEGG:
FT                   rso:RS05542 putative DNA-binding transcriptional regulatory
FT                   transcription regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3846"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28960"
FT                   /db_xref="GOA:B2UHA9"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHA9"
FT                   /protein_id="ACD28960.1"
FT                   /translation="MPDAVVPLYHQIYVVLRQQILEGKFGDGPMPGEIELARQFGASRV
FT                   TMRRVFDYLVKEGLVRRHRGMGTFVVKPDDPAAQGSAGQTLLQNIIDVGERTSAVVVEF
FT                   EDVLAPPDEAKCLEVAPGTPVKKLVRVRHLEDTPMALITTWLPLDVTSKLTLDRLANQS
FT                   LLRLIEGSGVRIDRASQVVSARLADVATAQYLDVAVGAPLLSVQRIVREMSGRPVQLLQ
FT                   GLYRPDRYEYRMELSRVGEDRARLWIDNAGHDVLGGHSEDVEDVPTPAAAGRIEHS"
FT   gene            complement(95985..96536)
FT                   /locus_tag="Rpic_3847"
FT   CDS_pept        complement(95985..96536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3847"
FT                   /product="transcriptional regulator, HxlR family"
FT                   /note="PFAM: helix-turn-helix HxlR type; KEGG: rso:RS05541
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3847"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28961"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHB0"
FT                   /protein_id="ACD28961.1"
FT                   /translation="MKTPETLSTTPASDLVPSMDPPCSIAAAVSIVGEKWTLLVLREAF
FT                   SGVTRFDEFLRRTGCSSAILSSRLKALVTYGILRRVPYQEPGDRVRDAYKLTRAGVDLL
FT                   PAIVALMQWGDRYLTPDGEGPILLRDRESGTPIHVALVNALGEPVAPKNSMREPNPRYG
FT                   HGNDPASTAPAPADTSAADE"
FT   gene            96670..97248
FT                   /locus_tag="Rpic_3848"
FT   CDS_pept        96670..97248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3848"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   rso:RS05540 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3848"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28962"
FT                   /db_xref="GOA:B2UHB1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHB1"
FT                   /protein_id="ACD28962.1"
FT                   /translation="MLYTIHRYPAEWIDRWTMHDGSVATVRPILPQDAPLEAALVEGLS
FT                   SESRYARFLVGGGRLSDEMLSAYTQIDYVSHMALVVSVARPDGTGEDLIADGRFVIEDG
FT                   VAEFAMLVADAWQGKGVGRRLFATLVRAARVSGAREVFGEVLATNRRMIGLARDAGFRL
FT                   ANVPGDATVCTVRLPLAQAEAAVTPFVFV"
FT   gene            97487..97921
FT                   /locus_tag="Rpic_3849"
FT   CDS_pept        97487..97921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3849"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: bxe:Bxe_B2073
FT                   glyoxalase/bleomycin resistanceprotein/dioxygenase
FT                   superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3849"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28963"
FT                   /db_xref="GOA:B2UHB2"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHB2"
FT                   /protein_id="ACD28963.1"
FT                   /translation="MSDVTPVLAPFHLAFPVHDIAAARAFYGGVLGCPEGRSAPDWVDF
FT                   NFYGHQIVAHLAPEEAGHRKTSAVDGDAVPVRHFGVVLSMPEWDAAANKLRAAGVDFII
FT                   EPHIRFKGEVGEQATMFFLDPSGNALEIKAFANMASLFAK"
FT   gene            97972..98844
FT                   /locus_tag="Rpic_3850"
FT   CDS_pept        97972..98844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3850"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: reu:Reut_B4146 regulatory protein,
FT                   LysR:LysR, substrate-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3850"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28964"
FT                   /db_xref="GOA:B2UHB3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHB3"
FT                   /protein_id="ACD28964.1"
FT                   /translation="MLRELKTFIAVARHGTFAGAGERIGLTQSAVSAQIQRLEASLGFQ
FT                   LFDRTGRSATLNAAGRDALAQAEQIVTLYDRLGDQASGNEQRGLVRIGAIASVQASFLI
FT                   DALVRFRLEFPHCRTRIVPGVSLDLLGLVDAGEIDMAVLIRPPFGVPADLEWRTLVAEP
FT                   FVLLVPDSVPGDDWRVLLGHQPFIRYDRRSFGGRRVDQFLRDQHITTHDVIELDELQGM
FT                   TQLVARGQGVALAPQTAAQGAWPPGVRAIDLGNDTFTREIGLIERPRHSRQPIAGRLAD
FT                   CIDEAARAP"
FT   gene            98945..99730
FT                   /locus_tag="Rpic_3851"
FT   CDS_pept        98945..99730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3851"
FT                   /product="molybdenum ABC transporter, periplasmic
FT                   molybdate-binding protein"
FT                   /note="TIGRFAM: molybdenum ABC transporter, periplasmic
FT                   molybdate-binding protein; PFAM: extracellular
FT                   solute-binding protein family 1; KEGG: rso:RSp0106 putative
FT                   molybdate-binding periplasmic signal peptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3851"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28965"
FT                   /db_xref="GOA:B2UHB4"
FT                   /db_xref="InterPro:IPR005950"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHB4"
FT                   /protein_id="ACD28965.1"
FT                   /translation="MPCFSLRFAFRAPMRAAGWVAALSLGLAAPAHAADLVVSAAASLT
FT                   NAFKAIAQQYEAQHPDTKVVLNFGASDVLMQQIARGAPADVFASADQQAMDKAVAEKLI
FT                   KPESRHDFVANQLVLIVPATGTVPVHALADLTRPEVKRVAIGNPASVPVGRYAKRALDA
FT                   AQLWEPVSAKAVLAQNVRQALDYVSRGEVEAGLVFSTDAAIAADKVKVASAVPLNVPLT
FT                   YPIAVTSGTKQPQQATDFVAFVMSPAGQAVLAKYGFLKP"
FT   sig_peptide     98945..99046
FT                   /locus_tag="Rpic_3851"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 34"
FT   gene            complement(99735..101033)
FT                   /locus_tag="Rpic_3852"
FT   CDS_pept        complement(99735..101033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3852"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   rso:RS03015 putative transport transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3852"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28966"
FT                   /db_xref="GOA:B2UHB5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHB5"
FT                   /protein_id="ACD28966.1"
FT                   /translation="MQRLARLIAPRFHYSWIALAVVFLILLCAAGTRATPSVMMLPLEH
FT                   EFGWSRSTISLAISIGIALYGLTGPFAAASMQYFGIRPTVLGALAVLVSGTALSAMMHE
FT                   PWQMVLLWGVMVGGGTGVAAITLGATVVNRWFTSHRGLAMGILTASSATGQLVFLPMMA
FT                   AVVEHYGWRPVVLIVAGALALLLPIVALLLPESPRSVGLRTYGEPADAPETSQGPRANP
FT                   ISLAMQTLVQAMRKRDFWLLFASFFICGASTNGYIGTHFIAMCADHGFSEVKGASLLAA
FT                   MGIFDLVGTTLSGWLSDRYNSRVLLFWYYGLRGLSLIYLPYAFGFEFFGLPVFAIFYGL
FT                   DWIATVPPTVRLTNDVFGKAAAPIVFGWIVAGHQLGAAFATLGAGMMRASLGNYTLSSM
FT                   ISGGLCVAGAFLVLRIHRTPKQDAGRAGQPATA"
FT   sig_peptide     complement(100929..101033)
FT                   /locus_tag="Rpic_3852"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.983) with cleavage site probability 0.953 at
FT                   residue 35"
FT   gene            101195..101836
FT                   /locus_tag="Rpic_3853"
FT   CDS_pept        101195..101836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3853"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: rso:RS03014
FT                   putative transcription regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3853"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28967"
FT                   /db_xref="GOA:B2UHB6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHB6"
FT                   /protein_id="ACD28967.1"
FT                   /translation="MAARGPRTVSTVEQPKPGPRRISGEDAHASLLEAARQLFYYEGVR
FT                   AVGVEAVVEKAGVNKMSLYRQFKSKDDLVLAYLERSDESFWGYFDNSMAKHPDDARAQL
FT                   LQFFIDVSERASRPGYRGCPFVNVAAEFPDLSHAARQFVQRNKARLLARLRERAEAAGA
FT                   ADPDALADDLAFLIEGAYTASQTFGTDAPRLIKCLPRTARVLLDANIPAR"
FT   gene            101968..102939
FT                   /locus_tag="Rpic_3854"
FT   CDS_pept        101968..102939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3854"
FT                   /product="ATPase associated with various cellular
FT                   activities AAA_3"
FT                   /note="PFAM: ATPase associated with various cellular
FT                   activities AAA_3; ATPase associated with various cellular
FT                   activities AAA_5; SMART: AAA ATPase; KEGG: rso:RS03013
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3854"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28968"
FT                   /db_xref="GOA:B2UHB7"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011703"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHB7"
FT                   /protein_id="ACD28968.1"
FT                   /translation="MTPNQVPLSPVRTAPAAGMQPSSLPAALLQAQRALDRIVLGKPLQ
FT                   IRLALACLLSRGHLLLEDLPGVGKTTLAHALARTLGLQYQRVQFTSDLLPADLIGVSIY
FT                   VKEKGAFEFHPGPLFAQVVLADEINRATPKAQSALLEAMAEGQVTHDGATYPLPEPFFV
FT                   IATQNPLNQIGTHPLPESQLDRFTMRLSLGYPDQHSERALYLGGGARQDIEPVLTAAQV
FT                   VALQAGADAVHAAPALVDYVLALVNATRTDAQVQMGLSPRAGLALLAAARAWALVDGRD
FT                   AVLPEDVQAVFTAVAAHRLLPTGGTLSATALAQRLLDTVAIP"
FT   gene            102952..104025
FT                   /locus_tag="Rpic_3855"
FT   CDS_pept        102952..104025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3855"
FT                   /product="protein of unknown function DUF58"
FT                   /note="PFAM: protein of unknown function DUF58; KEGG:
FT                   rso:RS03012 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3855"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28969"
FT                   /db_xref="GOA:B2UHB8"
FT                   /db_xref="InterPro:IPR002881"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHB8"
FT                   /protein_id="ACD28969.1"
FT                   /translation="MARVASVLAVPLRALGAGLAALPGVRLARTRVQRFLQRPRTPREG
FT                   RIRLDRNHVYILPTGAGASFALLLIVMLLTSLNYNVSLGFLLTFVLAGVAASAMWQTHR
FT                   NLVDLEVRGAVGEAVFAGHALNVSVALANVTSWARVGVDVSAREAAAVETSLDARDAIV
FT                   AALSFAGQPRGWFRLPRLTVSTRFPLGLFRAWSYADAPLTLLIYPAPEPAAPPLPANFV
FT                   PDPGEEPSATTPRTHVEDAVDQLRPYRPGDPLRSIAWKHSARLDTWMSRTGQQVHHAQC
FT                   VLAWDALPASMHVEQRLSRLCAWVLAAEQGMAGEAPEYTLSLPGITLGPSRGPAHRDAC
FT                   LRALALWGKPAMPEDAS"
FT   sig_peptide     102952..103038
FT                   /locus_tag="Rpic_3855"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.775) with cleavage site probability 0.289 at
FT                   residue 29"
FT   gene            104022..106046
FT                   /locus_tag="Rpic_3856"
FT   CDS_pept        104022..106046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3856"
FT                   /product="transglutaminase domain protein"
FT                   /note="PFAM: transglutaminase domain protein; KEGG:
FT                   rso:RS03011 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3856"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28970"
FT                   /db_xref="GOA:B2UHB9"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR021878"
FT                   /db_xref="InterPro:IPR025403"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHB9"
FT                   /protein_id="ACD28970.1"
FT                   /translation="MSLATGTPLFGPTRALTHREHGWLIAQLAIVLAPLLRALPLVTCA
FT                   VFGVLLLLRTLLWVRRAPLPGKWVLGLTGLATLLVTLALALRTGGNIGRDLSVALLGAF
FT                   LVLKLMESHTVRNGILVTQLCCFLLLSQVLFDQPPWLAATMLATAALLLRNWLLLLHPQ
FT                   ARLRVSPVRVLIRLVAMGLPCAAVLFLLFPRLDHPLWSLPRSAETGTSGISDRMAPGSI
FT                   GQLILSDELAFRADFSGTPPPLDTLYWRGMVLWRFDGQAWTAVSIRQRPARGGVPDSAD
FT                   SAGAVPDAVNYNITLEATHQRWLFALDRGVSIDARDDIGRSIDSEFISKQPLDQRMRYH
FT                   ARSRLPDRNRVDDAQPLDPFTQQLALALPPGNPQARALAAQWAGLPPAERVSAALRLFG
FT                   RAPFAYTLQPEPLQGQQIDDFLFRTHRGFCEHYAGSFVFLMRAAGVPARVVVGYLGGEV
FT                   NAMSGDIIVRQSDAHAWAEVWLAGRGWVRVDPTAAVAPQRVERGLAAAVPASEFRSRRV
FT                   EEPTWLRSVRWGLDGLISGWNRWVLGYDRTRQAQLFAWLGLDAADPRAVLWGVSAIFLL
FT                   AALPLLWQQRKPRLDPVQAQWQRLCDRLARHGCARGPAEGPIAYAERAAAQFPAAAPAL
FT                   RQAAAGYVALRYGRDDGDARARAQRFTEWRTALARVRLR"
FT   gene            106559..107629
FT                   /locus_tag="Rpic_3857"
FT   CDS_pept        106559..107629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3857"
FT                   /product="putative lipoprotein"
FT                   /note="KEGG: rso:RS03006 putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3857"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28971"
FT                   /db_xref="InterPro:IPR031929"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHC0"
FT                   /protein_id="ACD28971.1"
FT                   /translation="MKTKHRGALLSATLAGLLILGGCASSGSGDMSGTSGSSGDGSSAS
FT                   SGGGSGSTGSGGTATTASNTPTGTVAYKSGGVLTASGGAISSLGSTIGSSNVPSASALG
FT                   NVVGGVGSTVSALGTGVQSGLGSMGTNPNPVGTTVSSTGNVVTEAGKTVEATGSLVSGV
FT                   GSGPLQPLSPVTTPVGGGVSQVGQAVANAGGTLGTALSTGPVEQVTQQVSSAVVPLTSQ
FT                   VTTATQTLGNSTGLGTPAKNLLEMVGDDVANAGTSLTATNAPVVSGLGGVVTATGNTVG
FT                   ALGGLLAGGSTSGSPLAPITNALGGAPTAGGTAPIGSLVTSVGTSVTSTGASTPLAPVT
FT                   GTVGGALTTIGGALPH"
FT   sig_peptide     106559..106639
FT                   /locus_tag="Rpic_3857"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.369 at
FT                   residue 27"
FT   gene            complement(107724..108911)
FT                   /locus_tag="Rpic_3858"
FT   CDS_pept        complement(107724..108911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3858"
FT                   /product="AcnD-accessory protein PrpF"
FT                   /note="TIGRFAM: AcnD-accessory protein PrpF; PFAM: protein
FT                   of unknown function DUF453; KEGG: rso:RS03003 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3858"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28972"
FT                   /db_xref="GOA:B2UHC1"
FT                   /db_xref="InterPro:IPR007400"
FT                   /db_xref="InterPro:IPR012709"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHC1"
FT                   /protein_id="ACD28972.1"
FT                   /translation="MSHPAQVKIPATYMRGGTSKGVFFRLQDLPPAAQQPGAARDALLM
FT                   RVIGSPDPYGKQIDGMGGATSSTSKTVILSKSTRPDHDVDYLFGQVSIDKPFVDWSGNC
FT                   GNLSAAVGPFAISNGLVDASRVPQNGTAIVRIWQANIGKTIIAHVPITNGAVQETGDFE
FT                   LDGVTFPAAEVQLEFLDPAAEEDGDGGGAMFPTGNLVDDLDVPGVGTLKATMINAGIPT
FT                   IFINAEAIGYTGTELQDAINGDAKALAMFETIRAHGAVRMGLIKSIDEAATRQHTPKVA
FT                   FVAPPKDYVASSGKQVGAGDVDLLVRALSMGKLHHAMMGTAAVAIGTAAAIPGTLVNLA
FT                   AGGGERGAVRFGHPSGTLRVGAEAKLVDGEWTVTKAIMSRSARVLMEGWVRVPGA"
FT   gene            complement(108908..111505)
FT                   /locus_tag="Rpic_3859"
FT   CDS_pept        complement(108908..111505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3859"
FT                   /product="2-methylisocitrate dehydratase, Fe/S-dependent"
FT                   /EC_number="4.2.1.3"
FT                   /note="KEGG: rso:RSp0120 aconitate hydratase; TIGRFAM:
FT                   2-methylisocitrate dehydratase, Fe/S-dependent; PFAM:
FT                   aconitate hydratase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3859"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28973"
FT                   /db_xref="GOA:B2UHC2"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR006249"
FT                   /db_xref="InterPro:IPR012708"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHC2"
FT                   /protein_id="ACD28973.1"
FT                   /translation="MNTTHRKPLPGTKLDYFDAREAVEAIKQGAYDKLPYTSRVLAENL
FT                   VRRCDPATLTDSLKQLIERKRDLDFPWFPARVVCHDILGQTALVDLAGLRDAIADQGGD
FT                   PAKVNPVVPVQLIVDHSLAVECGGFDPDAFAKNRAIEDRRNEDRFHFIDWTKLAFKNVD
FT                   VIPAGNGIMHQINLEKMSPVIQAHDGVAYPDTCVGTDSHTPHVDALGVIAIGVGGLEAE
FT                   NVMLGRASWMRLPDIVGVELTGQRQPGITATDIVLALTEFLRKQKVVGAYLEFYGEGAS
FT                   KLTLGDRATISNMAPEYGATAAMFSIDDNTLDYLRLTGRTDEQVKLVETYAKTAGLWSD
FT                   TLKHAEYERVLRFDLSSVVRNMAGPSNPHARVATTDLAAKGIAGKWEETPGQMPDGAVI
FT                   IAAITSCTNTSNPRNVIAAALLARNANRLGLTRKPWVKSSLAPGSKAVELYLEEAGLKH
FT                   ELEKLGFGIVAFACTTCNGMSGALDPKIQQEIIDRDLYATAVLSGNRNFDGRIHPYAKQ
FT                   AFLASPPLVVAYAIAGTVRFDIERDSFGTDANGKPILLKDLWPTDEEIDAIVRASVKPE
FT                   QFRTVYIPMFEQRSESTAKVSPLYNWRPQSTYIRRPPYWEGALAGERTLKGLRPLAVLG
FT                   DNITTDHLSPSNAILASSAAGEYLAKMGLPEEDFNSYATHRGDHLTAQRATFANPTLIN
FT                   EMAVVDGAVKKGSLARIEPEGKVTRMWEAIETYMDRKQPLIVIAGADYGQGSSRDWAAK
FT                   GVRLAGVEAIVAEGFERIHRTNLIGMGVLPLEFKPGTTRLTLSIDGTETYDVIGERKPR
FT                   ADLTLVIHRKNGERVEVPVTCRLDSDEEVSIYEAGGVLQRFAQDFLESSKEAA"
FT   gene            complement(111821..112990)
FT                   /locus_tag="Rpic_3860"
FT   CDS_pept        complement(111821..112990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3860"
FT                   /product="2-methylcitrate synthase/citrate synthase II"
FT                   /EC_number="2.3.3.5"
FT                   /note="KEGG: rso:RSp0121 methylcitrate synthase; TIGRFAM:
FT                   2-methylcitrate synthase/citrate synthase II; PFAM: Citrate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3860"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28974"
FT                   /db_xref="GOA:B2UHC3"
FT                   /db_xref="InterPro:IPR002020"
FT                   /db_xref="InterPro:IPR011278"
FT                   /db_xref="InterPro:IPR016142"
FT                   /db_xref="InterPro:IPR016143"
FT                   /db_xref="InterPro:IPR019810"
FT                   /db_xref="InterPro:IPR024176"
FT                   /db_xref="InterPro:IPR036969"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHC3"
FT                   /protein_id="ACD28974.1"
FT                   /translation="MSEADNSTPNAGAFKPKKSVALSGVTAGNTALCTVGRTGNDLHYR
FT                   GYDILDLAAACEFEEVAHLLVHGKLPNKAELAAYKTKLKALRGLPANVKAALEWVPASA
FT                   HPMDVMRTGVSVLGTVLPEKDDHNTPGARDIADRLMASLGSMLLYWYHYSHNGKRIEVE
FT                   TDDDSIGGHFLHLLHGVEPPKSWVDAMHVSLNLYAEHEFNASTFTGRVIAGTGSDIYSA
FT                   ITGAIGALRGPKHGGANEVAFEIQKRYDTPDEAEADIRRRVEAKEVVIGFGHPVYTVSD
FT                   PRNKVIKEVAKKLSKEASNTKMFDIAERLETVMWDIKKMFPNLDWFSAVSYHMMGVPTA
FT                   MFTPLFVIARTSGWAAHIIEQRIDNKIIRPSANYTGPDDLKFVPISKRP"
FT   gene            complement(113027..113923)
FT                   /locus_tag="Rpic_3861"
FT   CDS_pept        complement(113027..113923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3861"
FT                   /product="methylisocitrate lyase"
FT                   /note="TIGRFAM: methylisocitrate lyase; KEGG: rso:RSp0122
FT                   2-methylisocitrate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3861"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28975"
FT                   /db_xref="GOA:B2UHC4"
FT                   /db_xref="InterPro:IPR012695"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018523"
FT                   /db_xref="InterPro:IPR039556"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHC4"
FT                   /protein_id="ACD28975.1"
FT                   /translation="MSTTHRHPTSAGAKFRAAVAESQPLQVVGAITAYAAKMAEQTGFK
FT                   AVYLSGGGVAANSLGIPDLGISTMEDVLIDARRITDAVQIPLMVDIDTGWGGAFNIART
FT                   IRSFIKAGVAAVHLEDQVGQKRCGHRPGKEVVSTDEMVDRVKAAVDARTDDDFVIMART
FT                   DAAASEGIDAAIERAVAYVEAGADMIFPEAMKTLDDYRRFKAAVKVPILANLTEFGSTP
FT                   LFTTDELRSANVDIALYCCGAYRAMNAAALNFYQTVMRDGTQKAAVETMQSRADLYQYL
FT                   GYHAYEDKLDALFAAKK"
FT   gene            114117..116063
FT                   /locus_tag="Rpic_3862"
FT   CDS_pept        114117..116063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3862"
FT                   /product="proprionate catabolism activator, Fis family"
FT                   /note="KEGG: rso:RSp0123 putative propionate catabolism
FT                   operon regulatory transcription regulator protein; TIGRFAM:
FT                   propionate catabolism operon regulatory protein PrpR; PFAM:
FT                   sigma-54 factor interaction domain-containing protein;
FT                   helix-turn-helix Fis-type; Propionate catabolism activator
FT                   domain protein; ATPase associated with various cellular
FT                   activities AAA_5; SMART: PAS domain containing protein; AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3862"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28976"
FT                   /db_xref="GOA:B2UHC5"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010524"
FT                   /db_xref="InterPro:IPR012704"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHC5"
FT                   /protein_id="ACD28976.1"
FT                   /translation="MSPTAPDLTDRPRIWACGISRLSDLFLDIAAEYNDRAELRVITRG
FT                   FEDIVREIDAAGAERPDVVVAGGSNGAYLKPRLSLPVVVINPTGFDVMHALARARRDAE
FT                   SVALVTHGDTPEEVRRFVAAYGMDVVFASYTSRQGAESCVLDLRDRGVGVVVGPGLVTD
FT                   LATQAGMNAVFLYSRDSVRAAFDTALEVVQATRRETLRRQRLDNLLQHLRDGVVALDAQ
FT                   GRVEAINQRLATALGIEAKQAIGQPLLSIAPNLLGLLPDTDGDTLGTVQGVNYVIHRGP
FT                   LTSTGTGAAEGTVFTFQESRAVERLDRTLRSRQRPQQFSARYRLEDLVGESLAMERVRT
FT                   LIRRYAKSDATVLVLGESGTGKEMVAQGMHQLSARRDFPFVAINCGAFPEALLESELFG
FT                   YEEGAFTGARKGGKTGLIEAAHRGTLFLDEIGEMPLPLQSRLLRVLQEREVVRLGSTEP
FT                   TRVDIRVVAATHRALTDAVQAGTFRADLYYRLNILSIALPPLRERPDDVMPLAVELLVQ
FT                   AARRDPRLLLRIADTEEAARVLAGVAEPLRRYAWAGNVRELQSVVERIAVELAYTEDAS
FT                   AITQDVLRLIAPEVFAHATPGKPAVLTLRERSRGVEAEEIRAALAAHGGDRDAVCAALG
FT                   ISKTTLWRRLQMG"
FT   gene            116177..116872
FT                   /locus_tag="Rpic_3863"
FT   CDS_pept        116177..116872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3863"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="PFAM: metal-dependent phosphohydrolase HD sub
FT                   domain; SMART: metal-dependent phosphohydrolase HD region;
FT                   KEGG: reu:Reut_B4062 metal-dependent phosphohydrolase, HD
FT                   subdomain"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3863"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28977"
FT                   /db_xref="GOA:B2UHC6"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHC6"
FT                   /protein_id="ACD28977.1"
FT                   /translation="MAQQSRPHIILASLTLAGGSRYPSALGHLVRTAAVAAYLANVLEL
FT                   DDAEQRHIYLVAPVHDIGKLGIPDDVLLKPAALTDAEHEIMQRHSNIGADLLAGTADPI
FT                   LQLAASVARHHHEHFDGSGYPAGLAGEDVPLAARIVAVADAFDAMLEPRVYREGMSEDD
FT                   AVGAVADQSGRYFDPTLVECFLKNVLGVRRARAAAESLVQQYGDVSGVIRFYGARDQSP
FT                   AFLRYIQTL"
FT   gene            117113..118459
FT                   /locus_tag="Rpic_3864"
FT   CDS_pept        117113..118459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3864"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; KEGG: rfr:Rfer_0005 diguanylate
FT                   cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3864"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28978"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHC7"
FT                   /protein_id="ACD28978.1"
FT                   /translation="MIENNPSETARHALKLLASRRLAPTPDNFASIYYEIAGNKPDADP
FT                   PDAERMALVRELREQLARTVECCLPVLGEDDASIGPAAWALIRACRSEFEGLGSLNGKL
FT                   STFNHWLSLAAEDQSEIRRALLSLLQLVFENIAELSLDDRWLRGQIEALMKASEAPVSL
FT                   RRLDDLRRRLMEVIQKQSSLKSKSIEAQEEMKRLLAAFMERLSVAAETSGEHHRQMEAC
FT                   AKKIESANSIAEIAPAIQDALSATRWMSLESARNRDVLSAMKVKAEEAAAEVAQLRKAL
FT                   DMASASARHDLLTGALNRKGLEEALEREVARAARQNTALCIAFLDIDDFKAINDTHGHS
FT                   FGDDALSHLAQVARESMRPQDTLARFGGEEFVILMPDTSLEEGVQTIVRLQRALTQRFF
FT                   AAGDTRLFITFSAGVAEVGKNEPPMAAIQRADRGMYQAKRAGKNKVVSV"
FT   gene            complement(118482..119051)
FT                   /locus_tag="Rpic_3865"
FT   CDS_pept        complement(118482..119051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3865"
FT                   /product="isochorismatase hydrolase"
FT                   /note="PFAM: isochorismatase hydrolase; KEGG:
FT                   reu:Reut_B4618 isochorismatase hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3865"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28979"
FT                   /db_xref="GOA:B2UHC8"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHC8"
FT                   /protein_id="ACD28979.1"
FT                   /translation="MSTFALVPKQTALLVMHYQTDIMALFPSVAPALLANTRKLCDAAR
FT                   ATGISVYFAKFHFSPGYPEISPLNKNGQGVKQLGLFVEDRISPELGRQPDESIIIAHRA
FT                   SVFYGTDLQVRLSARGIDTLIMVGVASTGVMLSSIAHASDADYRLFTVKDCCYDPDPIV
FT                   HEHLFATAFESRTTVLSLADALSMLG"
FT   gene            119260..120567
FT                   /locus_tag="Rpic_3866"
FT   CDS_pept        119260..120567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3866"
FT                   /product="Chloride channel core"
FT                   /note="PFAM: Chloride channel core; KEGG:
FT                   bur:Bcep18194_A4091 Cl-channel, voltage gated"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3866"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28980"
FT                   /db_xref="GOA:B2UHC9"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHC9"
FT                   /protein_id="ACD28980.1"
FT                   /translation="MFSPLHIADRSARRARRLWANYGIFWLGAVLVGLVSVAYAKLIDV
FT                   GFELFRNMVSHALWLPIVITPVGAALAIWLTRQFFRGAEGSGIPQVIATLEDGRLSSSL
FT                   LSLRIMFGKIVVSFLGILCGFTIGREGPTVQIGASLMYAMRRGYRRSSKHIERQLTLAG
FT                   AAAGLAAAFNTPLAGVVFAIEELTRSFVARNSGTLITAIIFSGVVALGLQGNYLYFGRI
FT                   QAIGQFHLALVPVVIAASAICGVAGGVFCWLLLNIPRWMPARLVDLRQAQPVWFAFLCG
FT                   VAIALIGLVSGGITFGSGYAEARGLLETHQALSPFYAVLKFCALIASYLSGIPGGIFAP
FT                   SLAIGAGLGNIMSLVTSAIPLPSLAALCMVGYLAAVTQSPITSFVIVMEMIDGHEMVLP
FT                   LMAVALLSSQVSKALTPSFYHTLAHRFRALVSRPAA"
FT   sig_peptide     119260..119382
FT                   /locus_tag="Rpic_3866"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.769) with cleavage site probability 0.755 at
FT                   residue 41"
FT   gene            complement(120619..121098)
FT                   /locus_tag="Rpic_3867"
FT   CDS_pept        complement(120619..121098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3867"
FT                   /product="3-demethylubiquinone-9 3-methyltransferase"
FT                   /note="PFAM: 3-demethylubiquinone-9 3-methyltransferase;
FT                   KEGG: reu:Reut_B4637 3-demethylubiquinone-9
FT                   3-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3867"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28981"
FT                   /db_xref="GOA:B2UHD0"
FT                   /db_xref="InterPro:IPR009725"
FT                   /db_xref="InterPro:IPR028973"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHD0"
FT                   /protein_id="ACD28981.1"
FT                   /translation="MVSKNTICLWYDRDALDAANFYAQTFPDSNVTAVHRAPGNYPAGQ
FT                   EGDVLTVEFTVAGIPCLGLNGGPQFKHSEAFSFQIATDDQAETDRLWDAIVSNGGQESA
FT                   CGWCKDKWGVSWQITPRALTAAYTDPDRAAAKRAFDAMMTMRKIDIAAIEAARRG"
FT   gene            121339..121479
FT                   /pseudo
FT                   /locus_tag="Rpic_3868"
FT   gene            complement(121558..122412)
FT                   /locus_tag="Rpic_3869"
FT   CDS_pept        complement(121558..122412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3869"
FT                   /product="putative lipoprotein transmembrane"
FT                   /note="KEGG: rso:RS02998 putative lipoprotein
FT                   transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3869"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28982"
FT                   /db_xref="GOA:B2UHD1"
FT                   /db_xref="InterPro:IPR018718"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHD1"
FT                   /protein_id="ACD28982.1"
FT                   /translation="MPYRFRPLSVLCAAVSIAAALAACSSAPTPLYQQEQFDATASPYA
FT                   RTFHAKSDATCEAARRALLSQGYVSSSPRPDTIDGSKNFQPSNDSHVVISFHVVCAEAN
FT                   ADGTSSTAYVNAVQDRYTLKKTSTSASVGLSILGSVSLPIGSGDDSMVKVASETIPAGV
FT                   FYERYFNLVDHFLKIDPARQDRKVAKAAEKDHVAPLPEPAPTPQGEPMKMTTPVVPTPA
FT                   APPVPVAAPASAPAATPAPKAPAEAAPASAPAVTTPPAPAPAAAPSPAPASEPASSTTG
FT                   GAS"
FT   sig_peptide     complement(122311..122412)
FT                   /locus_tag="Rpic_3869"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.344 at
FT                   residue 34"
FT   gene            complement(122635..122958)
FT                   /pseudo
FT                   /locus_tag="Rpic_3870"
FT   gene            123313..124284
FT                   /locus_tag="Rpic_3871"
FT   CDS_pept        123313..124284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3871"
FT                   /product="DNA topoisomerase type IA zn finger domain
FT                   protein"
FT                   /note="PFAM: restriction endonuclease; DNA topoisomerase
FT                   type IA zn finger domain protein; KEGG: reu:Reut_A0538
FT                   restriction endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3871"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28983"
FT                   /db_xref="GOA:B2UHD2"
FT                   /db_xref="InterPro:IPR007560"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR013498"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHD2"
FT                   /protein_id="ACD28983.1"
FT                   /translation="MGRRRKQASTSDVLLALPWWMLALGAAASYLIFHNILPAAFSANP
FT                   LLSGVGMLARGLAWMPALLLGFFAVLSYLRERSQQADARLGPPRTEPTGRSRPPKAPPQ
FT                   PARNAAGSITPNPPHPTRNTPTPPQAATPAEPAPPQSWTLEAIHALEWKRFELLCVQYY
FT                   EQMGFTVKTVPHGADGGIDATLYMAGQSAPVAVVQCKAWSKPVKVEQVRALGGSMLAHK
FT                   VKRGVFWSLSGYVGNPVQEYSELAGIQLLDGPAVLERIRALAEDKQAALLAKVFEGDSR
FT                   TPSCPACGVKLVARNGKSGAFWGCSNFPKCWNRLEMKHGVSM"
FT   sig_peptide     123313..123399
FT                   /locus_tag="Rpic_3871"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.855) with cleavage site probability 0.453 at
FT                   residue 29"
FT   gene            124391..125287
FT                   /locus_tag="Rpic_3872"
FT   CDS_pept        124391..125287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3872"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="PFAM: DEAD/DEAH box helicase domain protein; SMART:
FT                   DEAD-like helicases; KEGG: ses:SARI_00228 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3872"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28984"
FT                   /db_xref="GOA:B2UHD3"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHD3"
FT                   /protein_id="ACD28984.1"
FT                   /translation="MKTELPNEHGLSDGSLRHLLFYQDGKPSLSDIQHQGLVAGVARDT
FT                   SMLVVSPTSTGKTQLAVWAIAKGIENDCRTVYLVTHRALAKQKFDDFKSLFLSNFLSGN
FT                   PASLVLATGDSVEDSEGEFPPEPLKASLLVATYEKYLAMLSASGVPRDMSNTVVVCDEI
FT                   QLIGDKNRGQNVEILLTLLRNAGWRQFVGLSAVLPSRDAHDLADWLGVQLIMKATREKH
FT                   LSYRTAFSVTLCHPGVDPSVAPVVAACGRLCVVESVDLGEALLRYCEGSLSNDQLYRWL
FT                   ATPGQALAADLPFVERV"
FT   gene            125450..125953
FT                   /locus_tag="Rpic_3873"
FT   CDS_pept        125450..125953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3873"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3873"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28985"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHD4"
FT                   /protein_id="ACD28985.1"
FT                   /translation="MGYHSFVDEFERICREHIREGRARAFAFIFYNMTHGLVRRALKST
FT                   NGFQVLNSASGKDLTVFYLHSGAVDGLSDNFNEKFLRILRVDEQITPPCIVFFRVNGEN
FT                   IEDLDFRAIDDEVGDSHLIVEELRRYISEYIDRINEQGNLSGISWIATEMLSGLLKKAL
FT                   LHAW"
FT   gene            complement(126085..127125)
FT                   /locus_tag="Rpic_3874"
FT   CDS_pept        complement(126085..127125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3874"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hch:HCH_06818 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3874"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28986"
FT                   /db_xref="InterPro:IPR041229"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHD5"
FT                   /protein_id="ACD28986.1"
FT                   /translation="MSAQSTSTYLISLEFKNFSRDMEDHYKTIDPSIEAFWHKASKILR
FT                   QCEYTHNDCTITIDVGWQRMANRIRRDNDLLRPVRIGTPLDKKWFSKVSRPLKITAKVN
FT                   TINKNKYSDYKWYPSFFIEAFIHEFFLIANLSTPGSANFRSLFINSGNESRSTEVRLSS
FT                   FCFENGWVESLDGGWPTVEALPIEDVREWFQAISIGYKQRASTGIEKALYVLLHMAKDE
FT                   TRIDSVIWIFNGLEALVSTRVGESVSGLVRRLGMILDLDLPAQKKLNKEIRSLYDLRSS
FT                   FVHGGYAVPHPIHSEVIDRALDDDATKLYQLHQFGASLLISTIQALIKKKIINLRFDEF
FT                   MTVEKI"
FT   gene            127550..127828
FT                   /locus_tag="Rpic_3875"
FT   CDS_pept        127550..127828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3875"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RSc3434 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3875"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28987"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHD6"
FT                   /protein_id="ACD28987.1"
FT                   /translation="MNVDDNLLYAQGALAAKEYLHKARMDMKMHRKFEPQTLRCHKQVY
FT                   VKDKALEFQAGFMDAIGAFILSSLDGVTVDLFRWDVLHVLARANKQK"
FT   gene            complement(128171..128317)
FT                   /pseudo
FT                   /locus_tag="Rpic_3876"
FT   gene            128323..128469
FT                   /pseudo
FT                   /locus_tag="Rpic_3877"
FT   gene            complement(128552..129622)
FT                   /locus_tag="Rpic_3878"
FT   CDS_pept        complement(128552..129622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3878"
FT                   /product="putative transmembrane protein"
FT                   /note="KEGG: rso:RS02986 probable transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3878"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28988"
FT                   /db_xref="GOA:B2UHD7"
FT                   /db_xref="InterPro:IPR006726"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHD7"
FT                   /protein_id="ACD28988.1"
FT                   /translation="MSISIRAPRNVKHPAPFLSLLRLVRDPHRRYRHARYIHGTRVGLG
FT                   VLLSIAVTSGLGWPHGEWATISLLIVIAGLQHHGNIRKRAAERAWGTLIGAVAGLLLIV
FT                   QQTWLGHLPLTYALTAIACGVCAYHAIGKGGYIALLAAITLVIVVGHGDNNLLDGAWRT
FT                   LNVLVGIAIALLFSFALPLYATYSWRYRLAEALRECARAVAGLGQPGEASSERSKHLGK
FT                   LNTLLVQLRSLMPSVSKEIDVPLERLEDIQRSLRICISTLELLNATRGTLGAAPAGALP
FT                   DVGARRTRDTLIGMSRALRFGTLARLARPRAADSAEVSHAYGTPTVESALADGFANEIE
FT                   NLRQQLLAIAPQWNIG"
FT   gene            129908..132079
FT                   /locus_tag="Rpic_3879"
FT   CDS_pept        129908..132079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3879"
FT                   /product="PTS system, lactose/cellobiose family IIC
FT                   subunit"
FT                   /note="TIGRFAM: PTS system, lactose/cellobiose family IIC
FT                   subunit; PFAM: EAL domain protein; phosphotransferase
FT                   system EIIC; KEGG: dsy:DSY1020 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3879"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28989"
FT                   /db_xref="GOA:B2UHD8"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR004501"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHD8"
FT                   /protein_id="ACD28989.1"
FT                   /translation="MTTQALSPWLRLLSAAERFDRGPYFIAIRRGLALSLPLIMVGAVA
FT                   LLLRNPPTAGMRHLLLEAFGTRLDAFCDSVLAGTIGIGSLVALFGFADVLAQLHNQRAG
FT                   HRVVNPTVAAVVVVSCFFTLIAPAANASLMAWLSLGQGLFGALVVASLGGSLFLKLCSI
FT                   RRLRIPSHHLSNDLLVGDVLSVVPAGMLTILTFALLKAGMAWAGWLHFMAIVDPLLAWP
FT                   YSAVSNSLLFGLGYETAAQVLWLFGIHGPNALYTVHQHILEPAAQANAAAVASGGQPPF
FT                   IFTYHFFAVFARMGGSGGTLSLILALLISRRMQRGRKMALVVMLPALFNVNEPLLFGLP
FT                   LVLNPVYAIPFLLTPVVQILIAYAATVADLMPKTSYPVAWTTPALFSGYAATGSVWGAV
FT                   VQLIGLVVGAAIYLPFVRMADVLSARRSQDVLASLLQIAESAEVSLKGRRCLDLPGDEG
FT                   RMAVALASDLEDAIKREGQIFLEFQPQVDCSTGRVFGAEALLRWQHPVLGRVASPIVVA
FT                   LADDIGQIDQLGLRILSLACQQRAAWRDVLPDDFVVAVNLSPRQLLDCRLYRNVLDILH
FT                   REGLSPTQLELEITESTMLLPDITAIGNLKQLREAGVKVALDDFGMGHTSLHYLRELPL
FT                   DTVKIDRSLADVSAGSVNEHIVRSIASLSRTLNLSTVVEGVETEQQLERLSALGCERFQ
FT                   GYFFSRPLAPSVCQQFVLDANLRPLVHAL"
FT   gene            complement(132095..132694)
FT                   /locus_tag="Rpic_3880"
FT   CDS_pept        complement(132095..132694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3880"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: afm:AFUA_6G06670 conserved hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3880"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28990"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHD9"
FT                   /protein_id="ACD28990.1"
FT                   /translation="MEAPLTDAPQTEALQAEVLQAGTLQAEAPMPEAPQAQASSSEPAP
FT                   RAEPVVKVEQSYWAAEGLSARMRKARAITLYLMDPAMASLKAVDEAQLKDAGCEYSTED
FT                   AALIANFAESVESASVRSNSFALQFEPREAVYLAVGGGSEMKLLFEKPYPNQSEVLGQI
FT                   NGQPVTVNKSLVEGLYRWAAKVGRVRRCESFVGKYR"
FT   gene            133388..133783
FT                   /locus_tag="Rpic_3881"
FT   CDS_pept        133388..133783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3881"
FT                   /product="putative transcriptional regulator"
FT                   /note="TIGRFAM: addiction module antidote protein; KEGG:
FT                   pen:PSEEN3939 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3881"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28991"
FT                   /db_xref="GOA:B2UHE0"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR014057"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHE0"
FT                   /protein_id="ACD28991.1"
FT                   /translation="MAEFLSAALETGDAAFIAESIGVIARAKGIAQIAEETGLGRTSLY
FT                   KALRAEGNPAFSTVLQVMKALGLHLQAKPAVSKENVESGKRGANAKAKGAKVSASRNGG
FT                   ANKPTSKKPATRTKRGSATGHGKVIPT"
FT   gene            133925..134842
FT                   /locus_tag="Rpic_3882"
FT   CDS_pept        133925..134842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3882"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: bur:Bcep18194_C6931 protein of unknown
FT                   function DUF6, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3882"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28992"
FT                   /db_xref="GOA:B2UHE1"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHE1"
FT                   /protein_id="ACD28992.1"
FT                   /translation="MPHTTTPASSHVTDLALLLTLSTLWGASYTFIRVGVETIPPLTFI
FT                   AARTLIAATLLLAWMRSRNIRMPRDRQVWMRFGVQSLLNSVVPFTLIAWAERSVGASLA
FT                   TVLNSTSPVMVFVATAFVTRHESVSLRKLVGVIAGFVGTCFVIGPSAFDGLGGQLVAQL
FT                   AILAATACYAGAAIYGRSFKGLHPAAPATGSLLMGALVLTPTSLLVDHPWALQPSARSL
FT                   MALVALAVFSTALAFAIYFRLIQTLGAIGTTAQAYLRVPIGVAIGVVFLGESLPPSAWI
FT                   GLACVVVGVAAMSMPARATQVLRA"
FT   gene            complement(134874..135800)
FT                   /locus_tag="Rpic_3883"
FT   CDS_pept        complement(134874..135800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3883"
FT                   /product="putative transmembrane protein"
FT                   /note="KEGG: rso:RS02988 probable transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3883"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28993"
FT                   /db_xref="GOA:B2UHE2"
FT                   /db_xref="InterPro:IPR033424"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHE2"
FT                   /protein_id="ACD28993.1"
FT                   /translation="MTETLDMQRGLLLNLSPGRRTYWMAQAVAILSLVVLVSAVPFAKV
FT                   QLAQLPSFVPIYESALILNDLITAALLFGQFAITRSRAMLALASGYLFTAATAVGHLLS
FT                   FPGLFASGGLLGAGPQSTAWIYMFWHTGFPLFVIAYAVLKSREEREPGRFPVHTLTRQT
FT                   ALATVAAVLGASIACVLLATVGDHLLPTIMAANRYTRTMGIVAGGTWCFCVAALVALWR
FT                   SRPHLTLDVWLMVVLCVWICDVALSAVFNGGRYDLGFYAGRMFGLLGASFVLLLLLIEN
FT                   TVLHSRLAAARAELKRLAASHVADGER"
FT   gene            136065..136883
FT                   /locus_tag="Rpic_3884"
FT   CDS_pept        136065..136883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3884"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   rme:Rmet_3470 enoyl-CoA hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3884"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28994"
FT                   /db_xref="GOA:B2UHE3"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHE3"
FT                   /protein_id="ACD28994.1"
FT                   /translation="MQPHSTTAATATPATNDALVLRDDHDGVVTLRLNRPLQFNALSEA
FT                   MLDALQRVLDDIAQDATVRCVVLGAEGKAFCAGHDLREMRGTPELAYYRALFARCSVVM
FT                   QAIQALPVPVIARVHGVATAAGCQLVGSCDLAIASDAARFAVSGINVGLFCSTPAVALS
FT                   RNVLAKRAFDMLVTGRFIDAATAADWGLINEAVPAADLDDAVARKVADIVSKSPTAIRY
FT                   GKAMFYRQRQMPLADAYAYAGDVMARNMMDEDAGEGIDAFLEKRPARWRS"
FT   gene            complement(136993..137907)
FT                   /locus_tag="Rpic_3885"
FT   CDS_pept        complement(136993..137907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3885"
FT                   /product="alpha/beta hydrolase fold"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG:
FT                   bch:Bcen2424_4182 alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3885"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28995"
FT                   /db_xref="GOA:B2UHE4"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHE4"
FT                   /protein_id="ACD28995.1"
FT                   /translation="MRTDTFDGMYPYAPRFTDAPGFPMHYVDEGPADGEVVLCLHGEPT
FT                   WGFLFRHLIAVLRGTHRMVVPDHMGFGKSGTPPSRSYWLQDHIDNLERFVLALDLRDIT
FT                   LVMHDFGGPVGMGLASRHPDRVRRIVSVNGPTPFGQATLGERLAANAAVSPWFQWIVRA
FT                   ESEGRIEAVLGELGFNILSTLKLNGFEDHRLINDAWLQAYGARFATPADCVGAIGWAKG
FT                   FATGAHRFELPDAAARRAIVTKPAMAIWGMADRTLHAEHFLPLFSELFPDAPVHRLPGV
FT                   GHYSLEDAPDAIADRIATFLGQT"
FT   gene            138017..138508
FT                   /locus_tag="Rpic_3886"
FT   CDS_pept        138017..138508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3886"
FT                   /product="transcriptional regulator, HxlR family"
FT                   /note="PFAM: helix-turn-helix HxlR type; KEGG:
FT                   bch:Bcen2424_4183 transcriptional regulator, HxlR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3886"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28996"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHE5"
FT                   /protein_id="ACD28996.1"
FT                   /translation="MQMVKRTSHADSLCGVARPLDAIGDGWSLLIVRDAFDGLRRFGEF
FT                   QRSLGLSKNILAVRLRNLVAHDILETVPASDGSAYQDYVLTEKGRALFPLLVALRQWGE
FT                   AFCFAPDEAHVVLVDKATGKPVPRLELRAQDGRALAPEDTVVVHPSAIRPTKRQRAKAS
FT                   "
FT   gene            complement(138553..138697)
FT                   /pseudo
FT                   /locus_tag="Rpic_3887"
FT   gene            complement(138768..138926)
FT                   /locus_tag="Rpic_3888"
FT   CDS_pept        complement(138768..138926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3888"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3888"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28997"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHE6"
FT                   /protein_id="ACD28997.1"
FT                   /translation="MDTREMLAIVGVTLAVITAYSLARDLTDEPLGLHAPQTGLMHVQA
FT                   QVSAPHR"
FT   sig_peptide     complement(138855..138926)
FT                   /locus_tag="Rpic_3888"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.987) with cleavage site probability 0.986 at
FT                   residue 24"
FT   gene            complement(139069..140004)
FT                   /locus_tag="Rpic_3889"
FT   CDS_pept        complement(139069..140004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3889"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; ThiJ/PfpI domain protein; KEGG:
FT                   bur:Bcep18194_C6950 transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3889"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28998"
FT                   /db_xref="GOA:B2UHE7"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHE7"
FT                   /protein_id="ACD28998.1"
FT                   /translation="MAHRIAVLIFPDFQLLDAAGPVAAFEVASRYRDDHYALRTVAAQA
FT                   GLVRSSSGARWDADALPPASQVDTLLIAGGDGVDAAMADARTRRFVQRCAARGARVASV
FT                   CSGSLLLAATGLLNGRRATTHWSRSEQFARAFPQVQLEPDHIYVNDGPIWTSAGISAGI
FT                   DLALALIADDLGERLARAVARQLVVYYRRPGGQSQFSALNEMDSARGRFKPLLDHVRRN
FT                   LGAPHRVGDLAEHACMSPRHFARAFQVETGLTPAKAVEKLRVEAARAALESGAVSMQRV
FT                   ATECGFGDTERMRRSFQRLLGVPPSSLRAR"
FT   gene            140105..140791
FT                   /locus_tag="Rpic_3890"
FT   CDS_pept        140105..140791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3890"
FT                   /product="ThiJ/PfpI domain protein"
FT                   /note="PFAM: ThiJ/PfpI domain protein; KEGG:
FT                   bur:Bcep18194_C6949 ThiJ/PfpI family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3890"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28999"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHE8"
FT                   /protein_id="ACD28999.1"
FT                   /translation="MTTSPFIVVFALYNRVTQLDFTGPHEVFWRLPGAQCVVASAAGGE
FT                   IHADGGLTISNVQRLADIPHADLICVPGGFGVIEAMEDAEFVRQVRRLADGARYVTSVC
FT                   SGSLVLGAAGLLQGKRAACHWAWRNLLPAFGATVDEARVVRDGNLITGGGVTAGIDMAL
FT                   TVMADIAGAEHAQAVQLGIEYAPAPPFDCGRPERAAPEILEAVTSRLDRLRADRHDAVQ
FT                   RAAQRL"
FT   gene            140827..141666
FT                   /locus_tag="Rpic_3891"
FT   CDS_pept        140827..141666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3891"
FT                   /product="Adenosylhomocysteine nucleosidase"
FT                   /EC_number="3.2.2.9"
FT                   /note="PFAM: purine or other phosphorylase family 1; KEGG:
FT                   rso:RSc3374 5'-methylthioadenosine/S-adenosylhomocysteine
FT                   nucleosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3891"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29000"
FT                   /db_xref="GOA:B2UHE9"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010049"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHE9"
FT                   /protein_id="ACD29000.1"
FT                   /translation="MTSFDVSTLQTGAAFCMNTPSSQPNARGPIGIVAALHEEINELLT
FT                   WLSDAQCIHIGSRDFWTGELDGQTVVVVLSRVGKVAAASTTAVLITQFNVRAVVFAGVA
FT                   GALAPGVAVGDVVVSEELLQHDVDASPLFPRWEIPLTGMARFPADAALASGLLESAGAV
FT                   LADPHALLGPDVMRAFGIAAPQAHRGLIVSGDRFVCTSAESAVLRTALPDALAVEMEGA
FT                   AVAQVCHEWGVPFAAIRTISDRADDAASVDFAQFITQVDSRYAVAILRKWLSTAAGA"
FT   gene            complement(141672..142127)
FT                   /locus_tag="Rpic_3892"
FT   CDS_pept        complement(141672..142127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3892"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eca:ECA0765 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3892"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29001"
FT                   /db_xref="InterPro:IPR009739"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHF0"
FT                   /protein_id="ACD29001.1"
FT                   /translation="MNTLTTLKTLALPVAVVLLTHSAGTFAAESLANGIKRRAPQGIST
FT                   KLYACVDKAPDNADAIGACLSAEKAAQNERLDRTYKTLLGTLNSKANDALVSSEQAWQD
FT                   FHTRTAAFETAIYGKGKLDDLQRLENEIFRLSERANALDKYLAAKGH"
FT   sig_peptide     complement(142044..142127)
FT                   /locus_tag="Rpic_3892"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 28"
FT   gene            complement(142231..142605)
FT                   /pseudo
FT                   /locus_tag="Rpic_3893"
FT   gene            142862..143722
FT                   /locus_tag="Rpic_3894"
FT   CDS_pept        142862..143722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3894"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rme:Rmet_4636 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3894"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29002"
FT                   /db_xref="GOA:B2UHF1"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHF1"
FT                   /protein_id="ACD29002.1"
FT                   /translation="MKNWLATIAGWTLCACAAFGNAAHAADAPDDGATLSVNIGTEHRT
FT                   LSRDALLHDPHLTSVTVEDQNLKHRLTFKAIPVTALFRGQTVSPEASATTAASDGYVSH
FT                   LPMRLLLGDRADGPRAWLAVEDPAAPWPTLKGQDIGPFRLIWTAPPAKASVVNESLWTY
FT                   SIVRIDIAALPGERFAAIRPAAGLPADGPVMRGFATFQRVCFSCHTLNRAGDANLGPDL
FT                   NVPYSPVEYLGDEKLRHLIRDPQSLRWWPNARMSAIDEKTLSDAQLNDLLAYFHHMTKR
FT                   KSAAQ"
FT   sig_peptide     142862..142939
FT                   /locus_tag="Rpic_3894"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 26"
FT   gene            complement(143739..144248)
FT                   /locus_tag="Rpic_3895"
FT   CDS_pept        complement(143739..144248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3895"
FT                   /product="protein of unknown function DUF1697"
FT                   /note="PFAM: protein of unknown function DUF1697; KEGG:
FT                   bja:bll4334 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3895"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29003"
FT                   /db_xref="InterPro:IPR012545"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHF2"
FT                   /protein_id="ACD29003.1"
FT                   /translation="MPSYIAFLRAVNVGGTGKLPMAELRAMCESIGLTGVRTYIASGNV
FT                   VFQSRLAETTVKAKLERCLEDYAGKPVGVLVRTGAELAAVLEGNPFKTAAPSRTVAIFL
FT                   DTPPPADALAAATGRRTEEMALGTREIYVHYGDGMADSKLKIPAAKTGTARNMNTIATL
FT                   VDWATE"
FT   gene            144448..144876
FT                   /locus_tag="Rpic_3896"
FT   CDS_pept        144448..144876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3896"
FT                   /product="putative transmembrane protein"
FT                   /note="KEGG: rso:RSc3150 putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3896"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29004"
FT                   /db_xref="GOA:B2UHF3"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHF3"
FT                   /protein_id="ACD29004.1"
FT                   /translation="MLKKIAPALIVATLAGLTALPAAADDLRNALGGALGGAGGAAVGG
FT                   ALGGQTGSIVGGAIGGGAGGALTANGRERKGAIVGGALGGGVGAAAGNAMGGHTGGIVG
FT                   AGLGGGAGAALGGNVQRNSYSDRDDRGYRRHGKHHHHH"
FT   sig_peptide     144448..144522
FT                   /locus_tag="Rpic_3896"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.992 at
FT                   residue 25"
FT   gene            145064..146443
FT                   /locus_tag="Rpic_3897"
FT   CDS_pept        145064..146443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3897"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; pyridine nucleotide-disulphide
FT                   oxidoreductase dimerisation region; KEGG: rso:RS02078
FT                   mercuric reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3897"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29005"
FT                   /db_xref="GOA:B2UHF4"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHF4"
FT                   /protein_id="ACD29005.1"
FT                   /translation="MTQRFDAIIIGTGQAGPPLAARLSGAGLKVAIVERGRFGGTCVNT
FT                   GCIPTKAMVASAYAARMAQRAAEYGVVIDGGVTVDMRRVKARKDEISGRSSHGVEQWVR
FT                   GLEHGTVFQGHARFESARAVRVGDELLEAERIFINVGGRALVPPMPGLDQVPFLTNSTM
FT                   MDVDFLPEHLVVIGGSYVGLEFGQMFRRFGSRVTIVEKGPRLIAREDEDVSQAVREILE
FT                   AEGIDVQVNADCLSVRRDGAGVVVGLECGSGAREVSGSHLLMAVGRVPNTDDLGLDKAG
FT                   VEIDKRGNIRVDEQLRTNVPGIWAMGDCNGRGAFTHTSYNDYEIVAANLLDSDPRKVSD
FT                   RIQAYAMYIDPPLARVGMSLTEAKQSGRTLLVGNRPMTRVGRAVEKGESQGFMRVVVDA
FT                   QTHEILGASILGVGGDEAVHSILDVMYAKAPYTTISRAMHIHPTVSELIPTLLQSMEPE
FT                   Q"
FT   gene            complement(146521..147603)
FT                   /locus_tag="Rpic_3898"
FT   CDS_pept        complement(146521..147603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3898"
FT                   /product="sodium/calcium exchanger membrane region"
FT                   /note="PFAM: sodium/calcium exchanger membrane region;
FT                   KEGG: reu:Reut_B4399 sodium/calcium exchanger membrane
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3898"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29006"
FT                   /db_xref="GOA:B2UHF5"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHF5"
FT                   /protein_id="ACD29006.1"
FT                   /translation="MALSSNKLPPWTVAAPLLAWVVLAGGAFMTPPGWLIALMALALAS
FT                   AVFAAVHHAEVVAHKVGEPFGTLVLAIAVTVIEVALIVSVMLSSGPEKAGLARDTVFAA
FT                   VMLICNGIVGVCLFVGGLRHREQAFQAPGATAALAVLAALVTLTMVLPNYTSSTPGPVM
FT                   TSSQLAFAGVTSLVLYGCFVIVQTIRHRDYFLVDSANEDVHAPPPPARVAALSAVLLMV
FT                   SLVAVVGLAKVLSPSVEAAILNAGAPPATVGIVIAALVLLPECLAALRAANADRIQTSL
FT                   NLALGSALASIGLTIPTVAAVFIWIGRPLELGLGPKEMVLLFLTLIVSSLTLGKGRTTI
FT                   LHGVVHLAIFAAYLFLSIVP"
FT   sig_peptide     complement(147454..147603)
FT                   /locus_tag="Rpic_3898"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.940) with cleavage site probability 0.307 at
FT                   residue 50"
FT   gene            complement(147727..148581)
FT                   /locus_tag="Rpic_3899"
FT   CDS_pept        complement(147727..148581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3899"
FT                   /product="conserved hypothetical signal peptide protein"
FT                   /note="KEGG: rso:RS01997 hypothetical signal peptide
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3899"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29007"
FT                   /db_xref="InterPro:IPR021986"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHF6"
FT                   /protein_id="ACD29007.1"
FT                   /translation="MKTIQTGGRSPAFATLAVASPMGNAKRRFARAACAAFALVSGALM
FT                   GAPHASAEALLVPSYIYPSGTGATQWGALATAATSVPTTVILNPNSGPGTTQDANYVAA
FT                   VAKVHAAGGKVIGYVSSSYANRSLSAVVQDINTYQALYQVDGFFIDEMTADSTTAHIQF
FT                   YQSVYNYIKGLSPNYTVTGNPGTNVPEIYASLPVADQLVVFEDSAKHYASYAPLAWQAN
FT                   YPTARFAHIVYAASATQMQTFVRNASSKGAAAVFITNKTLPNPYGALPTYWSQEVSATA
FT                   VAP"
FT   sig_peptide     complement(148423..148581)
FT                   /locus_tag="Rpic_3899"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.983) with cleavage site probability 0.605 at
FT                   residue 53"
FT   gene            149036..149491
FT                   /locus_tag="Rpic_3900"
FT   CDS_pept        149036..149491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3900"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3900"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29008"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHF7"
FT                   /protein_id="ACD29008.1"
FT                   /translation="MNIRSNVLVIRIVLLTVVSLIASLAATAALAAPPATVASCDGIKD
FT                   AYPILGTQCANHYAKINHAPATAAERRETYSARIAVLDIFRKALLCNGMYGASKPAQQR
FT                   FSSGEAGHLQALANLNAAMTIAGDPNVPVLYTASDLSDVSINKSQCK"
FT   sig_peptide     149036..149131
FT                   /locus_tag="Rpic_3900"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.980 at
FT                   residue 32"
FT   gene            149515..149694
FT                   /pseudo
FT                   /locus_tag="Rpic_3901"
FT   gene            complement(149713..150606)
FT                   /locus_tag="Rpic_3902"
FT   CDS_pept        complement(149713..150606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3902"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bch:Bcen2424_3766 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3902"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29009"
FT                   /db_xref="GOA:B2UHF8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHF8"
FT                   /protein_id="ACD29009.1"
FT                   /translation="MNNLRRLDLNLLVTLDVLLTEHNVTRAAERLNFSQPSVSVHLAKL
FT                   RDIFGDPLLLPGPRGMRPTARAESLREPLRLALEALEQAVAPASPFDPAHATNTWRVAA
FT                   TDYGESTIALPVLNTLRTSAPGTRLAMLGLVPTRIEKQAEQGEIDLAFHTTDGAPPGLR
FT                   RRALFTERYVLIGRAGHPRLKRRPTLAQFCTLDHVIVSPDGGGFFGVTDEALAAAGATR
FT                   RVVLSVPHFLFVMTAVASTDMVAMLPERLVRGASALQAVEPPVEVPGYEMSMLWHERVH
FT                   RDPGHQWLRDVIAGAV"
FT   gene            150693..151469
FT                   /locus_tag="Rpic_3903"
FT   CDS_pept        150693..151469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3903"
FT                   /product="Ribosyldihydronicotinamide dehydrogenase
FT                   (quinone)"
FT                   /EC_number="1.10.99.2"
FT                   /note="PFAM: NAD(P)H dehydrogenase (quinone); KEGG:
FT                   spe:Spro_2460 ribosyldihydronicotinamide dehydrogenase
FT                   (quinone)"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3903"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29010"
FT                   /db_xref="GOA:B2UHF9"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHF9"
FT                   /protein_id="ACD29010.1"
FT                   /translation="MNVLIVYAHPEPKSLNGALKDFAVQRLEAAGHTVQVSDLYAMQWK
FT                   AALDASDSTVGPVGPHFHPSLDSKHAFENGLQADDIAAEQAKLQWADAVILQFPLWWFS
FT                   MPAILKGWVERVYAYGFAYGVGEHSDTHWGDRYGEGTLAGKRAMLIVTTGGWESHYSPR
FT                   GINGPIDDILFPIQHGILYYPGFEVVPPFVSYRTGRMDDARFAQTTQALGQRLDTLFTT
FT                   APIPFRPQNAGEYEIPSLTLRAEIAPEKSGFAAHLA"
FT   gene            151579..152361
FT                   /locus_tag="Rpic_3904"
FT   CDS_pept        151579..152361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3904"
FT                   /product="protein of unknown function DUF81"
FT                   /note="PFAM: protein of unknown function DUF81; KEGG:
FT                   rso:RS04702 probable transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3904"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29011"
FT                   /db_xref="GOA:B2UHG0"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHG0"
FT                   /protein_id="ACD29011.1"
FT                   /translation="MTSHAVFTGLINLLLGMGLGVAGGLLGIGGGLIAIPLLGYLYGMD
FT                   QHLAQGTALVMIAPNVLIGFWRYHQRHPVHVRSVALICVFSMGATYVAARFAAGLDANL
FT                   LHTAFAVFLIVLAVYFASQLKEKPNAAGAAHAVPHTMPAAALPLMGIASGAMSGIFTVG
FT                   GGLVVVSALVTFFGMPQTRAQGMALALVVPGSLIALAAYAHAGHVDWGTGIPLAAGGVV
FT                   SVSWGVALAYRFSARRLRLAFCAVLLGTALMMLLVKPA"
FT   sig_peptide     151579..151647
FT                   /locus_tag="Rpic_3904"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.721) with cleavage site probability 0.568 at
FT                   residue 23"
FT   gene            152394..152789
FT                   /locus_tag="Rpic_3905"
FT   CDS_pept        152394..152789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3905"
FT                   /product="Carboxymuconolactone decarboxylase"
FT                   /note="PFAM: Carboxymuconolactone decarboxylase; KEGG:
FT                   bam:Bamb_5410 carboxymuconolactone decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3905"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29012"
FT                   /db_xref="GOA:B2UHG1"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHG1"
FT                   /protein_id="ACD29012.1"
FT                   /translation="MSEQDKQAGRARRAQVMGDAFVERAMSGLDAFSAPLQDWLNEHAW
FT                   GSTWQRDGIDLKTRSLCTCAMLAALGRSTELKGHVRGAINNGATAVEIREVLLHSAIYA
FT                   GAPAAIEAFRSAREVLNELGIHIEEPR"
FT   gene            152811..153029
FT                   /locus_tag="Rpic_3906"
FT   CDS_pept        152811..153029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3906"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3906"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29013"
FT                   /db_xref="GOA:B2UHG2"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHG2"
FT                   /protein_id="ACD29013.1"
FT                   /translation="MLTGLTQVAWLGSLPYSRRITFLVDGDKLAYRDAGRKRLTPLGWV
FT                   LVAIFAAPAALCYWWFKQQFAALGYAG"
FT   gene            153042..153851
FT                   /locus_tag="Rpic_3907"
FT   CDS_pept        153042..153851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3907"
FT                   /product="alpha/beta hydrolase fold"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: rle:RL1292
FT                   putative arylesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3907"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29014"
FT                   /db_xref="GOA:B2UHG3"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHG3"
FT                   /protein_id="ACD29014.1"
FT                   /translation="MDTFDDDLTRFAAHGAEPLPPAVEQGHVEHDGARIWYATFGAGTP
FT                   VILLHGGLGHGGNWGYQVPALMTAGYRPIVIDSRGHGRSTRDAQPYAYTRMASDVRAVM
FT                   DALRIDRAAFIGWSDGACVALTLAMQTPERAIGVFFFGCNMDPSGAKPFAPTPVIDRCF
FT                   GRHLKDYTALSSTPDDFDAFVEAVTEMMQTQPNATAEELAATRVPVTIAQSEHDEFIWP
FT                   EHAHYLARTLPEAQFVLLPGVSHFAPLQRPAVFNDAVRAFLHGICQT"
FT   gene            complement(153991..154494)
FT                   /locus_tag="Rpic_3908"
FT   CDS_pept        complement(153991..154494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3908"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   rso:RS05225 probable acyl-CoA thioester hydrolase-related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3908"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29015"
FT                   /db_xref="GOA:B2UHG4"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR033120"
FT                   /db_xref="InterPro:IPR040170"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHG4"
FT                   /protein_id="ACD29015.1"
FT                   /translation="MNTQSHQLSMTVLMTPDMANFSGNVHGGHILKLLDQVAYACASRY
FT                   AGRYVVTLSVDQVVFRQPIHVGELVTFLASVNYTGRTSMEIGIKVVTENIRNQVVRHTN
FT                   SCYFTMVAVDDDGKPADVPPLAPANAEERERFEAAQQRRALRQEMEARHKAIKATYSTP
FT                   VSGG"
FT   gene            154540..155064
FT                   /locus_tag="Rpic_3909"
FT   CDS_pept        154540..155064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3909"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: har:HEAR1579 hypothetical protein; putative
FT                   signal peptide"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3909"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29016"
FT                   /db_xref="GOA:B2UHG5"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHG5"
FT                   /protein_id="ACD29016.1"
FT                   /translation="MGTQQADIVPRSTHLVLHCVKFDGIALHYRFARQTIFSPLLLSMH
FT                   RFLTRLLLWLVVLALPLQGLAATTMMARGGALDDTTVAVAMLDDGAVMSDACHEHEDAM
FT                   ATGAESKAPAQSHCKTCPICAACSLGSVVPLAASLGVPLIKLPAAAPRGLAVSFRSFIP
FT                   EALQRPPSIRV"
FT   gene            155161..155502
FT                   /locus_tag="Rpic_3910"
FT   CDS_pept        155161..155502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3910"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bmu:Bmul_6293 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3910"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29017"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHG6"
FT                   /protein_id="ACD29017.1"
FT                   /translation="MLFTRWFVAAALLALAPPWVLAQGAGSAPAASPPDPLNADAAVPA
FT                   VAAPRTFDSYHAYRDTGPAPWRETNAAVSSKSDASADGGHAGHVIPASAPAATSNKPAG
FT                   ESMPGMHHH"
FT   sig_peptide     155161..155229
FT                   /locus_tag="Rpic_3910"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.688 at
FT                   residue 23"
FT   gene            155512..156924
FT                   /locus_tag="Rpic_3911"
FT   CDS_pept        155512..156924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3911"
FT                   /product="outer membrane efflux protein"
FT                   /note="PFAM: outer membrane efflux protein; KEGG:
FT                   bvi:Bcep1808_3978 outer membrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3911"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29018"
FT                   /db_xref="GOA:B2UHG7"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHG7"
FT                   /protein_id="ACD29018.1"
FT                   /translation="MLKPSTRRLALCALAGTLLLLGGCATITQDSGFKTVADVARDRLG
FT                   KDATWHRSPEARDSAAQRTRELLAQPLTMDSAVQIALLNNRGLQASYAELGLSEAALVQ
FT                   ASRLPNPGFSFKRTRSGDDLSIERTFSLSFLNLLTLPMATRIEGRYFEQTKLLVANQML
FT                   QVATDTRRAYINAVAAEQSARYAEQVQQAAEAGAEFAKRLASAGNFSKLDRAREHAFYA
FT                   EATATLARTRQQAQAEREALIRLLGVWGTDTGFKLPERLPDLPKDRPELQQIEAYALRN
FT                   RLDIQAGRLQVDGLASSLGLTQATRFINVLDLGYVRNSKSNEPRETGYEIGIEIPLFDW
FT                   GGARVARAQSIYMQAADQLADTAVRARSEVRESYVRYQTAYDLTRHYRDEVVPVRKRIS
FT                   DEMLLRYNGMLVSVFELLADAREQVNAVNGYIDALRGYWIAQTDLQMALGGRLPPAEAN
FT                   AATTAPNPPQGH"
FT   sig_peptide     155512..155598
FT                   /locus_tag="Rpic_3911"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.623 at
FT                   residue 29"
FT   gene            156927..158225
FT                   /locus_tag="Rpic_3912"
FT   CDS_pept        156927..158225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3912"
FT                   /product="multicopper oxidase type 3"
FT                   /note="PFAM: multicopper oxidase type 1; multicopper
FT                   oxidase type 2; multicopper oxidase type 3; KEGG:
FT                   bpd:BURPS668_A0714 multicopper oxidase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3912"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29019"
FT                   /db_xref="GOA:B2UHG8"
FT                   /db_xref="InterPro:IPR002355"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHG8"
FT                   /protein_id="ACD29019.1"
FT                   /translation="MVSRRQFLGGTGAAMLGAAMVSRAGAASLPEAPLQTKPATQPPLA
FT                   PPNGRPYNPVVTLNGWTLPWRMRGGWKEFHLVAEPVEREFAPGMTGHLWGYNGQSPGPT
FT                   IECVEGDRVRIFVTNKLPEHTTVHWHGMILPAGMDGVGGLSQPHIPPGKTFVYEFEMKK
FT                   SGTFMYHPHSDEMVQMAMGMMGLIVVHPKDPAQHRADRDFVFLLAAYDIDPGSYTPRVA
FT                   EMTNFNMWTWNSRVFPGIDPLPVRLGDRVRIRMGNLTMTNHPMHLHGHTFEVAGTDGGW
FT                   VQPSARWPEVTTDIAVGQMRAIEFIADNPGDWAFHCHKSHHTMNAMGHNVPTMIGVQQK
FT                   DLAKKMNALVPDYMGMGQAGMADMGEMEMPLPDNTLPMMTGQGPFGPIEMGGMFTVMKV
FT                   RRDLPRNSYADPGWYKHPKGTVAYEYTGTSIDD"
FT   sig_peptide     156927..157007
FT                   /locus_tag="Rpic_3912"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.945 at
FT                   residue 27"
FT   gene            158267..158755
FT                   /locus_tag="Rpic_3913"
FT   CDS_pept        158267..158755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3913"
FT                   /product="blue (type 1) copper domain protein"
FT                   /note="PFAM: blue (type 1) copper domain protein; KEGG:
FT                   pna:Pnap_1260 blue (type 1) copper domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3913"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29020"
FT                   /db_xref="GOA:B2UHG9"
FT                   /db_xref="InterPro:IPR000923"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHG9"
FT                   /protein_id="ACD29020.1"
FT                   /translation="MQRNLLRSTFLAALMSMAAIAHASGNHAGGHDHGDAAIGEPGDAA
FT                   RITRMVHVDMTDTMRFTPAQITVQRGETIRFEVVSSGQVRHEMTLGTPADLLAHAEQMR
FT                   RHPEMEHADANAVTVDPGQRGEIVWHFTHAGSVEFACLQPGHFEAGMRGAVQVRGNKS"
FT   sig_peptide     158267..158338
FT                   /locus_tag="Rpic_3913"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.935 at
FT                   residue 24"
FT   gene            158791..159117
FT                   /locus_tag="Rpic_3914"
FT   CDS_pept        158791..159117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3914"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bmu:Bmul_6290 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3914"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29021"
FT                   /db_xref="InterPro:IPR021647"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHH0"
FT                   /protein_id="ACD29021.1"
FT                   /translation="MFRHALMLTALLVGTPLVHAAEDTAPAPAPAATTPAAMSEGEIRK
FT                   IDTVAGKLTIKHGPLDNLGMEPMTMVFRVQDPAMLTKVQVGSKVHFVAEKVNGALTVTA
FT                   LDVQ"
FT   sig_peptide     158791..158853
FT                   /locus_tag="Rpic_3914"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 21"
FT   gene            159508..160515
FT                   /locus_tag="Rpic_3915"
FT   CDS_pept        159508..160515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3915"
FT                   /product="lipopolysaccharide-modifying protein"
FT                   /note="SMART: lipopolysaccharide-modifying protein; KEGG:
FT                   ftw:FTW_1815 lipopolysaccharide core biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3915"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29022"
FT                   /db_xref="InterPro:IPR006598"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHH1"
FT                   /protein_id="ACD29022.1"
FT                   /translation="MRHLKYRLSRVSAKKFWYYFSNASNHFLARATKNGKAETLLKRKS
FT                   GQRRTQDVFDRLSYYNSISEAFDTSCNAVEYSNFLLKSSTSTIVDKHCEIGSTYFYDLV
FT                   DLMDYFGPGYSFDYDCGDVTVEPNHPAFVKSRPIKNSSHNGILLKLDAIRHFSLARDPI
FT                   DFQDKKPMAVFRGPCHQEHRRAFVERCHDLANVNIGDTRKSELGKATYKSPMTIAEQLQ
FT                   YKFIVSVEGNDVATNLKWIMASNSLCFMRRPRYETWFMEGRLIPDVHYVLLKDDYSDLQ
FT                   EKIEHYRKYPGDALAIVRNANRWVAQFMNRDQERLLGLMVIAKYFRLSGQQSFW"
FT   gene            160642..161433
FT                   /locus_tag="Rpic_3916"
FT   CDS_pept        160642..161433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3916"
FT                   /product="Phytanoyl-CoA dioxygenase"
FT                   /note="PFAM: Phytanoyl-CoA dioxygenase; KEGG: rso:RS05217
FT                   probable hydroxylase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3916"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29023"
FT                   /db_xref="GOA:B2UHH2"
FT                   /db_xref="InterPro:IPR008775"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHH2"
FT                   /protein_id="ACD29023.1"
FT                   /translation="MSASAPTATHAHPLSDEQQAFFKEHGYVVLRGFASQQVSAALLAA
FT                   AQDGLASAAAPVELETDVGYAGAPTSREAEGGQTVRRLLDADSRGTPYTEWARDPRVAA
FT                   AIAQLIGGPVHLSLAHHNCVMTKHPAFGTATHWHRDSRYWSFARNELVSSWLALVEETV
FT                   DNGCLWVIPGSHTLDLPADRFDAKLFLRQEQPENRALIDTARPVPLLPGDVLLFHCNTF
FT                   HAARANQTAAVKFSAVFTYYGPDNYPLPGTRSSARPDPLVG"
FT   gene            161531..161752
FT                   /locus_tag="Rpic_3917"
FT   CDS_pept        161531..161752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3917"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RS05216 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3917"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29024"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHH3"
FT                   /protein_id="ACD29024.1"
FT                   /translation="MPIQEVTHGAHVIFVDPLQRDDHRWTARFQICRAGHIICDWENVE
FT                   MPEGFISAQLALSASVLLADHRLSSLPH"
FT   gene            161976..162416
FT                   /locus_tag="Rpic_3918"
FT   CDS_pept        161976..162416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3918"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RS05215 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3918"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29025"
FT                   /db_xref="InterPro:IPR018673"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHH4"
FT                   /protein_id="ACD29025.1"
FT                   /translation="MSAMFALPRVALALMLATLAASVSAATLTVVVEGAQGRQGAVRAA
FT                   LFRDAAGWLKPDSAIRADIAALDSVSGASVTFVYPDLPAGRYALSVFHDTNNDGKLGTN
FT                   PAGIPVEPYGFSRDARGRFGPPAFDDAAIDVQGDQRVTIHLH"
FT   sig_peptide     161976..162053
FT                   /locus_tag="Rpic_3918"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.990 at
FT                   residue 26"
FT   gene            162436..163962
FT                   /locus_tag="Rpic_3919"
FT   CDS_pept        162436..163962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3919"
FT                   /product="Carotenoid oxygenase"
FT                   /note="PFAM: Carotenoid oxygenase; KEGG: rso:RS05214
FT                   probable dioxygenase signal peptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3919"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29026"
FT                   /db_xref="GOA:B2UHH5"
FT                   /db_xref="InterPro:IPR004294"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHH5"
FT                   /protein_id="ACD29026.1"
FT                   /translation="MQRRSFIAALGAAPFGLTLTDVMAATPDPWAAGFAAARAQYPWLA
FT                   GYQGVSADMPTRALKVEGRFPPALHGAFYRNGPARHEIGGVRYHHLFDGDGMIQRYDIS
FT                   EQGVTHRGVFVRTDKFVADTAAGRPLRATFGTANPDMEPVASPDSINVANTSLVMHGDE
FT                   MLALWEGGSATRVDPDSLRTLGVQTWRDDYKGMPFSAHPKVEPDGTLWNFGVSSAAGLL
FT                   TVYCVGADAALKRVESVNVPDVAMVHDFAVTQRHLVFLLPPFVYDVERSHAGMSFLDSH
FT                   VWRPELGMRVLVLDKDDITRMRWLKLPEGFVFHLGNAWSSPDGQEIHLDYLRSDDASVV
FT                   ITSLRELMRGQIRPSPGARLTQVQLNLRTGRAEQFSTAHVAEFPKIDTRRTAQRHRALF
FT                   MVAHTAPLSNGSPHALHGFDTVMRVDTDSGQAEQYRFGHRTLVEEHVFVPASASAREGE
FT                   GWLIGTVFDVDAGCTRLTAFDAQHVAAGPVATASLNGVAPLGLHGLFRAA"
FT   sig_peptide     162436..162510
FT                   /locus_tag="Rpic_3919"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.984 at
FT                   residue 25"
FT   gene            complement(163975..165468)
FT                   /locus_tag="Rpic_3920"
FT   CDS_pept        complement(163975..165468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3920"
FT                   /product="peptidase dimerisation domain protein"
FT                   /note="PFAM: peptidase M20; peptidase dimerisation domain
FT                   protein; KEGG: dac:Daci_1258 peptidase dimerisation domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3920"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29027"
FT                   /db_xref="GOA:B2UHH6"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHH6"
FT                   /protein_id="ACD29027.1"
FT                   /translation="MLGATGLAGAAELSSADAERHAQATYREYFQLLSLPNDAIVPEDV
FT                   RKNADWLEQAFRKRGFTTKQLANNGKPMLYAELPNPDAGRKTVLFYMHLDGQPVIPAQW
FT                   AQKSPWTPVLKHKTAQGDWEEIDAAQLFSGPLDPEWRVFGRSSADDKGPIMMMLAAIDA
FT                   LKASGAQPAVNVKIILDSEEEKGSPSISKVMQANRELLRCDAIVIHDGPMHASNLPTLV
FT                   FGNRGAAEARLTVYGAKVPLHSGHYGNYARNPAQQLANLLASMKNDAGRVTVPGYYDHV
FT                   KISEADRKIMAAVPDDQAALNKRLGIAHADKVGANYQEAMQYPSLNVRGMASAAVGDKV
FT                   ANIVPDKAVAELDLRTTPDSSAAYLGKLIERHIERQGYHLVKNAPTDEERSRYDKLATF
FT                   TYQSEGADAAGSPIDSAVGTWAYRSLTDTFGANPAPVRIRMMGGTVPTAEIVGVLQVPF
FT                   AIIPLVNADNNQHAANENLRMGNYVGGVRTIYGLLTHPL"
FT   gene            165677..166594
FT                   /locus_tag="Rpic_3921"
FT   CDS_pept        165677..166594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3921"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: reh:H16_B2306 transcriptional
FT                   regulator, LysR-family"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3921"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29028"
FT                   /db_xref="GOA:B2UHH7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHH7"
FT                   /protein_id="ACD29028.1"
FT                   /translation="MSSHRLQETSLRYFLEVVRSGSLTEAAARLHVSASAISRQVAMLE
FT                   ELLGVPLFERQSRGMRPSAAGELLAAHALRGALEAERVVSDIQGLQGLQRGRVRIACSD
FT                   GFAIEFVPRAIVAFRERHPGIQFDLRAEEPMRVTEAVLRGDVDIGLTYSRAAVHGIRVA
FT                   YQQRGSVFAIMRPDHPLAKFNSVTLAQMHPFPIALSGPDNTVRQLFDMGCSQRGLVFEP
FT                   VLVSNRFDGLLSFVLQGGGLGIAGEITVRERVQRGELHAAEIRERGMRGRTVELQILAG
FT                   RTLPEVVRVFLDFLREALPEQPPR"
FT   gene            complement(166611..168092)
FT                   /locus_tag="Rpic_3922"
FT   CDS_pept        complement(166611..168092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3922"
FT                   /product="AMP nucleosidase"
FT                   /EC_number="3.2.2.4"
FT                   /note="KEGG: rso:RSp0214 AMP nucleosidase; TIGRFAM: AMP
FT                   nucleosidase; PFAM: purine or other phosphorylase family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3922"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29029"
FT                   /db_xref="GOA:B2UHH8"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR011271"
FT                   /db_xref="InterPro:IPR018953"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="InterPro:IPR037109"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHH8"
FT                   /protein_id="ACD29029.1"
FT                   /translation="MTDTRATAHLYPAHDLAICTDANTAVERITAIYERSAQAVRDRFH
FT                   AFARGEDCSEDLSACYPYLGITVDPKTLVSDARPAWGTVAYPGVYGTTLTRPDLFRDYY
FT                   RVQIERLLHYHNSPVVVGVSNRPIPLPFVVEASTVDITPEQARALGGAFTLPDLAQIDD
FT                   SIANGTYRPIGDEPQPLSMFTAERVDLALQRLYHYTATHPKHFQRFVLFTNYQRYVDEF
FT                   AALGRKLMEDGNDEGYIRFVEPGDTEHELGTPAPDDSHRIKGLPQMPAYHLVREDRLGV
FT                   TLVNIGVGPSNAKTITDHLAVLRPHCWMMIGHCGGLRRSQQLGDYVLAHAYVRDDHVLD
FT                   QDLPPWVPVPPIAEIQVALQEAVARITGLSGADMKSRMRTGTVVSTDDRNWELKYQALY
FT                   SRFNQSRAIAIDMESATIAANGFRLRVPYGTLLCVSDKPLHGELKLRGMANLFYRQRVS
FT                   QHLDIGMEAVRLLRESGVEALHSRKLRSFDEPAFR"
FT   gene            complement(168140..168913)
FT                   /locus_tag="Rpic_3923"
FT   CDS_pept        complement(168140..168913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3923"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: reh:H16_B2488
FT                   ABC-type transporter, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3923"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29030"
FT                   /db_xref="GOA:B2UHH9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHH9"
FT                   /protein_id="ACD29030.1"
FT                   /translation="MTTEAVLLHLRYLLIGPYPNGPLAGAALTLWMALWACVMATAAGV
FT                   GCALLLDRLDATPGLRRLARLLRGLLATLRAIPVLMLMFWAYFLIPMALGVSVPETATV
FT                   VAALAAVGAAYITQSMEAGLRAVGAGQRNAALALGMSPPQALLTVVLPQAWRIMLPSLA
FT                   NQWVSTVKDTSLAYIVGVVELSTAASQVNSRTVAYPAEVFGAVAVLYFLLCTGIEALPN
FT                   WLRAGPRTPAAQPDHMSTWQRFLRWRERPVSDAVT"
FT   gene            complement(168910..169602)
FT                   /locus_tag="Rpic_3924"
FT   CDS_pept        complement(168910..169602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3924"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: reh:H16_B2489
FT                   ABC-type transporter, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3924"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29031"
FT                   /db_xref="GOA:B2UHI0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHI0"
FT                   /protein_id="ACD29031.1"
FT                   /translation="MTLLVSAAAIAGGLAIGLLLTALRASAQPWLHLPARALVAFLRKT
FT                   PLLVQLFFWYFGAAQLLGEDVVGAIIGWGGIAVGAWRLPAPSFEFLAAAFGIALYAGAF
FT                   FSEELRAGIRAVPRGQREAALSLGFTPRAAFLRVVLPQALRVSALPLLGQCANTIKNTS
FT                   LAMGIGLAELAYSARQVETDTLLAFQAFAVATVLYAGVILLLQWVAPRVLRRLGWTSTS
FT                   TLPDGAPA"
FT   sig_peptide     complement(169519..169602)
FT                   /locus_tag="Rpic_3924"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.982 at
FT                   residue 28"
FT   gene            complement(169674..170561)
FT                   /locus_tag="Rpic_3925"
FT   CDS_pept        complement(169674..170561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3925"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="PFAM: extracellular solute-binding protein family 3;
FT                   KEGG: reh:H16_B2490 ABC-type transporter, periplasmic
FT                   component: PAAT family"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3925"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29032"
FT                   /db_xref="GOA:B2UHI1"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHI1"
FT                   /protein_id="ACD29032.1"
FT                   /translation="MQASVSGAFSLQGLTQALRKLSRQAVGVVIGAALAVAVLHAPQAH
FT                   ADKLDDIKKAGVLRVGVFDANPPFGYADAKTGQPVGLDVDYAQEIANKLGVKLELRATN
FT                   PANRVPLLTSGKVDIVAANFTITDERKKQIEFSTPYFASGLQFIARKGVLKQPDDLKRD
FT                   GIRLGVDKGTTQETTLRDGYPKARVIAYDDSPLALTALRTGAIQAFAQDGAKLGALLAT
FT                   LPNRSELEISPFVLTREYMGIGVPKGETKLTATIDQILQGLEKDGTAGRIYDRWFGPKS
FT                   AAPLPRDFIIGSTK"
FT   sig_peptide     complement(170421..170561)
FT                   /locus_tag="Rpic_3925"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.902) with cleavage site probability 0.900 at
FT                   residue 47"
FT   gene            170878..172527
FT                   /pseudo
FT                   /locus_tag="Rpic_3926"
FT   gene            172660..173166
FT                   /locus_tag="Rpic_3928"
FT   CDS_pept        172660..173166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3928"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: reu:Reut_B3507 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3928"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29033"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHI2"
FT                   /protein_id="ACD29033.1"
FT                   /translation="MPTGQSIATVVDHYLRNAELPEAISAQQTFQHAFDVYLKDSNAYA
FT                   NTYFARYFEWQGVVRERWFHECIDADLLMSGRVIFVTKLAHQEFVEETFPFQRVECHLN
FT                   TFRVQPCSFYMVFRFVSGGRLVSLGYQQVVCANAERVIQRLPEHVRMRVKAYELDTLPE
FT                   LAHAS"
FT   gene            complement(173186..174571)
FT                   /locus_tag="Rpic_3929"
FT   CDS_pept        complement(173186..174571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3929"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   KEGG: rso:RS05203 probable two-component transmembrane
FT                   sensor histidine kinase transcription regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3929"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29034"
FT                   /db_xref="GOA:B2UHI3"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR031621"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHI3"
FT                   /protein_id="ACD29034.1"
FT                   /translation="MYALFPAFVSSLFLFYGVYVVTTRGRTRASLAFLGMTTLTCLWQG
FT                   IWAFLFQTHDIGTAQVLAKLGWIAILVMPTMLYHFAVEVAEAPSERPSLLAAYALDAAL
FT                   IALLLTTNLVIDGVHQFHFGFYPRAGVLEAVHIAQTVVLVTRGMWVLYREQRHATAEKR
FT                   KRLLTCLFGVGLISLAAADYAVNYGIAFYPPGVLPLAVALGIIAVGVVKFDLMRPYALA
FT                   ATVAHEVRTPLTTIRLQAAEIARAWPDVYRGYQLAIDNGLCQPPQHPAMLDRLSKLAGA
FT                   ITSEVASAHSVIEMALASVTLERLDRRTFAAHSLRECVETAVAQYPFQAGERERVHVQP
FT                   FNADWRFVGSDTLLVYVLFNLLKNALHAIQIARKGHIEISARQDGDSYVLVVRDSATGI
FT                   PPSVQRRIFDPFFSTKHVGKGSGVGLTFCRRVMQAFGGRIQCESVVGEYTLFSMRFPQP
FT                   PAI"
FT   gene            complement(174797..175549)
FT                   /locus_tag="Rpic_3930"
FT   CDS_pept        complement(174797..175549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3930"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: UbiE/COQ5 methyltransferase; Methyltransferase
FT                   type 11; Methyltransferase type 12; KEGG: bmu:Bmul_0867
FT                   methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3930"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29035"
FT                   /db_xref="GOA:B2UHI4"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHI4"
FT                   /protein_id="ACD29035.1"
FT                   /translation="MQQHRLVDQQFGQVAQAYLTSAVHAQGADLDALAALAQSAPHAKV
FT                   LDLGSGGGHVSFAMAPHVAAMVAYDLSEDMLGVVAAEAARRGLAQLHTQAGRAENLPFD
FT                   DAAFDIVATRFSAHHWYDVRKGLSEARRVLKPGGKLVIVDIVAPEVPLLDTLLQTAEVL
FT                   RDASHVRDYRVSEWQAMLAEAGFQPGTPRTWKLMMAFDSWIARIRTPQVRADAIRDLFD
FT                   RAADEARAYFAVAPDHSFAIDAMLIEAT"
FT   gene            complement(175668..176588)
FT                   /locus_tag="Rpic_3931"
FT   CDS_pept        complement(175668..176588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3931"
FT                   /product="amidohydrolase 2"
FT                   /note="PFAM: amidohydrolase 2; KEGG: rso:RS05190 probable
FT                   hydrolase transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3931"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29036"
FT                   /db_xref="GOA:B2UHI5"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHI5"
FT                   /protein_id="ACD29036.1"
FT                   /translation="MPTRRAFNTGLLAMLGSTALAGCAATGNSDATRGTSAGITAIDTH
FT                   AHVFERGLPLADARRYAPTYDAPLPAYLAQLDAHGVSHGVLVQPSFLGVDNSYLLAALK
FT                   QAPQRLRGVAVIDPAAPETLLAQMNAEGIVGIRLNLIGAADPQLKSPVWQASLARLHAL
FT                   GWHVELHVEARRLPALLQPLQEAQVNVVVDHFGRPDPALGVDDPGFAALLAAGRSRRVW
FT                   VKISGAYRNGANGRGEAIAQAAMPRLKDALGLDRLVWGSDWPHTQFESQIDYDKMWAFA
FT                   GVLLPSAADRKQVLVDTPAQLFRFG"
FT   sig_peptide     complement(176514..176588)
FT                   /locus_tag="Rpic_3931"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.598 at
FT                   residue 25"
FT   gene            complement(176644..177891)
FT                   /locus_tag="Rpic_3932"
FT   CDS_pept        complement(176644..177891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3932"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1; KEGG: rso:RS05189 probable
FT                   metabolite transport transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3932"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29037"
FT                   /db_xref="GOA:B2UHI6"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHI6"
FT                   /protein_id="ACD29037.1"
FT                   /translation="MFGWFKEISKGEKRTFWACFGGWALDALDVQMFSLVIPTIIAAWH
FT                   IGKAEAGLVSGITLVASALGGWIAGALTDRFGRVRTLQITVLWFSLATFASAFAQNFEQ
FT                   FLVLKAIQGFGFGGEWAAGAVLMAESIRASHRGKAMGTVQSAWAVGWGAAVLLYALTYS
FT                   FIEPDLAWRVMFAAGLLPALLIIYIRRGVQEPVPAATPDANANAMPISRFPLLDIFRPQ
FT                   VLRMTLIGGLLGVGAHGGYYALMTWLPTYLKTERHLSVLGTGGYLAVIIFAFWCGCVAS
FT                   AWLLDVLGRRGNILLFSCCCVVTVLVYLLVPLSDGAMLVLGFPLGFFAAGIPASMGALF
FT                   NELYPQGVRGTGVGFCYNFGRVVSAAFPVLVGKMSASMSLGTAIGIDAAIAYSIVAVAV
FT                   LMLPETKGRDLAAVTV"
FT   gene            complement(178027..180849)
FT                   /locus_tag="Rpic_3933"
FT   CDS_pept        complement(178027..180849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3933"
FT                   /product="malto-oligosyltrehalose synthase"
FT                   /note="KEGG: rso:RS05188 putative maltooligosyl trehalose
FT                   synthase transmembrane protein; TIGRFAM:
FT                   malto-oligosyltrehalose synthase; PFAM: alpha amylase
FT                   catalytic region; SMART: alpha amylase catalytic sub
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3933"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29038"
FT                   /db_xref="GOA:B2UHI7"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR012767"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHI7"
FT                   /protein_id="ACD29038.1"
FT                   /translation="MSELTTPPAPVTLQRVPRATVRLQLHRDFTFDHARALLDDFAALG
FT                   ISHLYTSPITTAQPGSTHGYDVVDPTHVNPELGGERALEQLVDALHARGMGLVVDIVPN
FT                   HMGVGGAHNTWWLDVLESGPESTYANFFDIDWQPPNPALRNKVLAPFLGENYADALAGG
FT                   RLQLTYDDTAARLAIAYYDHRFPIALADYAALLRAGNADTATHAVADRFAALGTIRSLR
FT                   TRRERADEARDALRNLATTEAGAAHIAEAVRTLNAQPDQLDALMARQHWRLAHWCTAND
FT                   EINWRRFFDIGSLAGLRMERAEVFEATHALLFRLYRLGWIDGVRIDHVDGLADPAAYCR
FT                   QLRRRLQDEHAARPADRLTNHPWIVVEKILASDEPMRTDWGVDGTSGYDFMNQVGALLH
FT                   DAHGETALTQGWLEWIGAPVADAPFSATTAPARRQILHVHFAAELDSATSALHAVAQQN
FT                   HSSHDVTWHAIRRALAEVIVHFPVYRTYANAQQRDAQDSAILQTAMSRAATCLRRVDQP
FT                   VLGWLDAWLGGQPAGQDKLRQLALRRCQQLSSPVAAKAVEDTACYRYGRLLSRNEVGAN
FT                   PGEFSMSANAFHHAMQARAHTWPHAMLTTATHDHKRGEDVRARLAVLSERPTQWLAAAH
FT                   QWRAEHAAWVQKLPAGPAPSPAAQWMLYQTLVGIWPADLDWHDADAVRELAERVAQWQE
FT                   KAQREAKLRTDWFAPDADYEAASRNFVFTLLTGEAAPTFLPSLCAFVQSVAPAAAINGL
FT                   VQTLLRTTLPGVPDLYQGADFWDTSLVDPDNRRPVDYAARHRALRALHLHAGHGLASLL
FT                   AHWTDGRIKQAVLARALALRAALPAVFESGDYQPLAVTGSGAQHVLAFARVHGANAIIV
FT                   IVPLHASALLGHAPAPTFADGAWRDTTVCLPSTLSHLPLHNAFDGQTLHSPRLALGQVL
FT                   AHLPVALLHT"
FT   gene            complement(180846..183128)
FT                   /locus_tag="Rpic_3934"
FT   CDS_pept        complement(180846..183128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3934"
FT                   /product="4-alpha-glucanotransferase"
FT                   /EC_number="2.4.1.25"
FT                   /note="KEGG: rso:RS05187 putative
FT                   4-alpha-glucanotransferase (amylomaltase) protein; TIGRFAM:
FT                   4-alpha-glucanotransferase; PFAM: glycoside hydrolase
FT                   family 77"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3934"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29039"
FT                   /db_xref="GOA:B2UHI8"
FT                   /db_xref="InterPro:IPR003385"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHI8"
FT                   /protein_id="ACD29039.1"
FT                   /translation="MDRTTNLSGTPRTPLQQLATDAGLLVDWEDAASRPMRVADEVLRA
FT                   VLFTLGLPAGTPAQVSESQARLRAEAEAVAIPPLVTGVVGQPIVLQTSAPQAALLDGQP
FT                   YRVDFESDGSTEGRISVSASEHHATLRLAAVQAVGYHRLTIDAGPGTVIEATLAIAPAR
FT                   CYGVADALRQHDRPTDSRLWGASAQLYGLRCDAERAASSAGLGDYTAAGTLARHLSQRG
FT                   ADALALSPVHAMFTADPRRYSPYSPSSRLFLNAWMIDPAALFGNETVRQAVVDCNLVAD
FT                   YARLEAAPLIDWPASGNARMTVLRALHRRLLQAPLGDTIGQTLLDDFRAYCINGGASLR
FT                   DHAHFEALNAHLGPAHWKQWPAQYQDPSYLGVQAFAREHEDAVNFHLFLQWAAARQWAI
FT                   AQRTAEGAGMAIGLVADLAVGTDSAGSHAWARQRDLLIGVTVGAPPDVFNAQGQGWGLT
FT                   TFSPRAMRTQGFSAFIEMLRAVMAVPGGVRIDHVLGLMRLWVIPDGARPLDGVYLRYPM
FT                   QDLLRLVALESWRNRCIVIGEDLGTVPAGLRDKLADDGLLGMRILWFEREYTRDDAPFK
FT                   APRTWAPASVAMTSTHDLPTLVGWWIGNDLRWQAQLGLLPAGMSESEAHARRMDDRAAL
FT                   VAAFAEHNRLVLADGGVPMIGVASLQAALEQTRVATAAQAEVILQASAQDFATAATVFT
FT                   GAANTPLALVPLEDLLGLVEQPNLPSTIDTHPNWRRRLPGPAGTLIEAPTVLARLSALA
FT                   NARNSMS"
FT   gene            complement(183167..185008)
FT                   /locus_tag="Rpic_3935"
FT   CDS_pept        complement(183167..185008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3935"
FT                   /product="malto-oligosyltrehalose trehalohydrolase"
FT                   /note="KEGG: rso:RS05186 putative maltooligosyl trehalose
FT                   trehalohydrolase protein; TIGRFAM: malto-oligosyltrehalose
FT                   trehalohydrolase; PFAM: glycoside hydrolase family 13
FT                   domain protein; alpha amylase catalytic region; SMART:
FT                   alpha amylase catalytic sub domain"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3935"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29040"
FT                   /db_xref="GOA:B2UHI9"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR012768"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR022567"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHI9"
FT                   /protein_id="ACD29040.1"
FT                   /translation="MTAPAPRFAHDMPFGATVLADGNTRFRLWAPDATAAWIDIDDTRG
FT                   NESIRMDAEPDGWYAAVAPVGSGTCYRYRLTNRDGVTLSVPDPAARAQWQDIPGPSLVV
FT                   DPQRYRWQHADWQGRPWHETVLYELHVGALGGFKGVRGRLPELARLGITAIELMPVAEF
FT                   PGARNWGYDGVLPFAPDASYGTPDDLKALIDTAHGLGMMVFLDVVYNHFGPDGNYLHHY
FT                   ARSFFRDDVHTPWGAAIDFRKPQVREFFIQNALMWLMEYRFDGLRLDAVHAITERDWLG
FT                   ELAARVRLSAEPGRHVHLVLENEHNAASLLRDGNTHGDFDAQWNDDGHNVLHVLLTGER
FT                   EAYYAAYADAPAQRLARVLQDGFCYQGEPSPIHDNAPRGEPSAHLPPTAFVLFLQNHDQ
FT                   IGNRAFGERLTQLAHPDALHAAQVLLLLSPQIPMLFMGEEWGSTCPFQYFTSHHGMLAE
FT                   AVREGRRREFAKFEAFADPHQRERIPDPNEELTYLASCPGEANLAEPAQLNTLNRMHRL
FT                   LALRHAEIIPRLPHARALDAVALGHAGAIARWRMGDGSVLTLMLNLADQPVAVPTVLAG
FT                   SPADLLHESREGAAAALITHRLPERACVALLHTPSPG"
FT   gene            complement(185005..187305)
FT                   /locus_tag="Rpic_3936"
FT   CDS_pept        complement(185005..187305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3936"
FT                   /product="glycogen debranching enzyme GlgX"
FT                   /note="KEGG: rso:RSp0238 probable glycogen operon protein
FT                   GlgX; TIGRFAM: glycogen debranching enzyme GlgX; PFAM:
FT                   glycoside hydrolase family 13 domain protein; alpha amylase
FT                   catalytic region; SMART: alpha amylase catalytic sub
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3936"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29041"
FT                   /db_xref="GOA:B2UHJ0"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR011837"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHJ0"
FT                   /protein_id="ACD29041.1"
FT                   /translation="MLRFPKTLSPGKPFPLGAQWDGLGINFAVFSANASKIELCIFDPA
FT                   GRKELTRFALPECTDEVWHGYLPGVEAGLVYGYRAYGPWEPQHGHRFNPHKLLLDPYAR
FT                   RLVGALRWSDALFGYRLNSNRGDLSFDRRDSAPAMPKAVVTDESFNWGNDIRPNTPWSR
FT                   TVIYEGHVRGMSMLREDLLPPERGTFSALGDSVFIERLQRLGITAIELLPIHAFLQDQF
FT                   LVERGLRNYWGYNTLCFFAPEPSYLSAPSLHELKVAIRRLHAAGIEVLLDVVYNHTCEG
FT                   SELGPTLSFRGLDNASYYRLVPGQERYYINDTGCGNTLNLSHPRVLQMVMDSLRYWVNA
FT                   FHVDGFRFDLGVTLGREGNGFDPGSGFFDAIRQDPVLSTVKLISEPWDVGPDGYQVGNH
FT                   PPGFAEWNDRFRDGIRRFWRGDSGQRPDLAARLTGSGDMFDRRHRRPWASINYVASHDG
FT                   FTLHDLVSYADKHNDANGEDNRDGHNDNCSANWGTEGPTQDPAIQALRERVTRALLATV
FT                   FFSNGTPMLLAGDEFGRTQDGNNNAYCQDNALSWLDWSLLQKDPGQALARYTARLIALR
FT                   KASPALRWPHYVHGNTEILPGVPDIAWFDERGQTLSPDAWNDSEARALALRRACVETID
FT                   AEARPHVALLLINGAATDLTFTLPEPAMDWLLAIDSAAPEQDARPHSGGTLNVAGRSVV
FT                   LLLATQLATIAQIAGQPDADASGETLGHVPDAHNAAQNALQNATPEQPASDDERTAPTA
FT                   GQAASDANGDATR"
FT   gene            complement(187897..190203)
FT                   /locus_tag="Rpic_3937"
FT   CDS_pept        complement(187897..190203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3937"
FT                   /product="1,4-alpha-glucan branching enzyme"
FT                   /note="KEGG: rso:RSp0239 glycogen branching enzyme;
FT                   TIGRFAM: 1,4-alpha-glucan branching enzyme; PFAM: glycoside
FT                   hydrolase family 13 domain protein; alpha amylase catalytic
FT                   region; alpha amylase all-beta; SMART: alpha amylase
FT                   catalytic sub domain"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3937"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29042"
FT                   /db_xref="GOA:B2UHJ1"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006048"
FT                   /db_xref="InterPro:IPR006407"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR037439"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHJ1"
FT                   /protein_id="ACD29042.1"
FT                   /translation="MTALDFATPTKTAAEPEAPVVLPPGLDQMQVDALTHGRLGDPFAV
FT                   LGPHRLDTEDGPRWVVRAFYPGARRVQAIDSRGQIITEMTPVGRTGLFHGPLRADAQDV
FT                   YGHPELYRLRVIWPAGTGHEAVQETEDPYAFGLLLGDLDMHLLNEGTHWALASCLGAQA
FT                   MRIDGISGVRFAVWAPNAQRVSVVGEFNQWDGRRHPMRLRHQAGVWELFLPSGLGVGPG
FT                   ARYKFELIGADGRLMVKADPAARQTEPPPATASVVADPAPLRWNDDAWMQTRAERQKPD
FT                   APISIYEVHAGSWLRDLEDGGRNLQWDELADRLIPYVTALGFTHIELLPVAEHPFGGSW
FT                   GYQPLGLFAPSARFGAPEAFARFVDRCHQAGLGVIVDWVPAHFPTDAHGLAQFDGTALY
FT                   EHQDPREGFHQDWNTLIYNFGRNEVRGFLIASGLEWLERFHIDGLRVDAVASMLYRDYS
FT                   RRAGEWVPNRYGGRENLEAVAFIQKMNTVVHERCPGAITIAEESTAWPGVTAPVEFNGL
FT                   GFDYKWNMGWMHDTLHYMQRDPVYRQHHHDGMTFGLVYAFSEHFILPISHDEVVHGKGS
FT                   LLGKMPGDEWQRLANLRAYLAFMWTHPGKKLLFMGCEFGQVGEWNHDASPEWHLLDDPR
FT                   HRGVQRLVHDLNALYRNEPSLHARDTAPEGFNWVIGDDRTNSVFAFLRLDGEGRPMLVV
FT                   ANMTPVPREGYRIGVPPADGATQWREVLNTDAAVYGGSDFGNGGAVDVDHVAAHGQEQS
FT                   LVLRLPPLGVVVLKV"
FT   gene            complement(190200..193694)
FT                   /locus_tag="Rpic_3938"
FT   CDS_pept        complement(190200..193694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3938"
FT                   /product="trehalose synthase"
FT                   /note="KEGG: rso:RS05183 hypothetical protein; TIGRFAM:
FT                   trehalose synthase; trehalose synthase-fused possible
FT                   maltokinase; PFAM: alpha amylase catalytic region; SMART:
FT                   alpha amylase catalytic sub domain"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3938"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29043"
FT                   /db_xref="GOA:B2UHJ2"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR012810"
FT                   /db_xref="InterPro:IPR012811"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR032091"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHJ2"
FT                   /protein_id="ACD29043.1"
FT                   /translation="MTRNPTALLVDDALWYKDAVIYQLHVKSFCDSDNDGVGDFPGLIS
FT                   KLDYIAELGVDVIWLLPFYPSPRRDDGYDIAEYRGVHPDYGNMADVRRFIAEAHARGLR
FT                   VITELVINHTSDQHPWFQRARRAKPGSALRDFYVWSDNDKRYAGTRIIFIDTEPSNWTW
FT                   DPVANAYYWHRFYSHQPDLNFDNPRVLKAVIGVMKFWLNLGVDGLRLDAVPYLVEREGT
FT                   SNENLPETHEVLRKIRAAMDGEFKNRLLLAEANQWPEDTQEYFGAGDECHMAFHFPLMP
FT                   RMYMAIAREDRFPITDIMRQTPEVPAGCQWAIFLRNHDELTLEMVTDAERDYLWEVYAS
FT                   DRRARLNLGIRRRLAPLLERDRRRVELMNSLLFSMPGTPVMYYGDEIGMGDNIHLGDRD
FT                   GVRTPMQWSPDRNGGFSRADPEQLVLPAIMGSLYGYESVNVEAQSRDAHSLLNWTRRLL
FT                   ATRKRHRVFGRGSIQFLQPSNRKVLAYIRALEGEAPILCVANLSRASQAVELDLSTFAQ
FT                   RVPVELIGGTAFPPIGQLSYLLTLPPYAFYWLELRENEPGPTWSQPAAEQLPEFTTLVL
FT                   RAGLDALADTRQREAHRQLIEREILPTYLPKRRWFAAKDSVLRSAKFAWGAPVPVDAAS
FT                   TNRPLAGATRPEVFLNEVAVTLGSPDGTERVERYLLPLSIAWESATLPALPIQLALARV
FT                   RRGRHVGYLTDAFTTETFARALLTNLVRGTTLEANDGTVHFEPEPNIAELAEPAGAPEA
FT                   GSTRPAPLPLAPDTPIQWLAAEQSNSSLVIGESVIVKLIRRIATGIHPEVEMTRHLTRV
FT                   GYANTAALIGEVSHHAADGERATLAVMQSFVPNQGDAWTWALDYLRRTIDELAVQMEGV
FT                   TTGDGESSPVAVSEARVDTDEALAGYVNFIGVIGTRLGELHAALAAPTEDPNFGARIAD
FT                   ADDATYWIARVSEQLTRAHDNLTAWQRQNPDSARQPDVQWLLSQHQALLDAARAHAENG
FT                   LGATLSRIHGDFHLGQVLVAQGDAFLIDFEGEPSRPVEERRRKTSPLRDVAGLMRSLDY
FT                   VVGAMRQGPDHVAGPAQERRNVLLERFRAASTERFLEAYAAAIRGPDLNALDQPVVDFH
FT                   LLDLFLLEKAAYEVNYEASNRPTWLPIPLEGFTRVARRLLHAEPPSPAAEDPTGGPP"
FT   gene            complement(193691..197281)
FT                   /locus_tag="Rpic_3939"
FT   CDS_pept        complement(193691..197281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3939"
FT                   /product="alpha amylase catalytic region"
FT                   /note="PFAM: alpha amylase catalytic region; SMART: alpha
FT                   amylase catalytic sub domain; KEGG: rso:RS05182 putative
FT                   alpha-amylase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3939"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29044"
FT                   /db_xref="GOA:B2UHJ3"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR021828"
FT                   /db_xref="InterPro:IPR026585"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHJ3"
FT                   /protein_id="ACD29044.1"
FT                   /translation="MPETKSPKPATSRKTTAALKAAKPPGSKAKSATKPTAMPSERPPA
FT                   ATQPPYAPAICYVHPLQLGRLDRWDGVLDRIASLGFDHVLMAPPFAVGAAGNVFVTRDH
FT                   AQLHAALGGGPADAALATLAEGCRARGLTLQLDLVIDRVAIDAPLRADHPDWFASHAED
FT                   GDALDPRLPPSHLEVASFRHDDPRCADAILMWWTQQLRAWAALGIGGFRCEAPARLPAA
FT                   RWRTLIADVRKDVGVIRFLAWTPGMDGAAVDALAGAGFDATFSSLRWWDFRAGWMVEEH
FT                   ARLAAVAPPIAAVEAPFGTRYGQAFGDAMIRERAYRRLLHVADTLDAGWLMPLGFERGA
FT                   LLPMLAERGDPSDQQWIDAHAAFDLSDAVRDVNATIRAARETNTVAPHAELRMLTGPDA
FT                   PATALLRADGPDLRAGDAATLTVINPDLYMGVSVHADHFLPGVAGGFTRGVALDLLTEP
FT                   VGSCDDTLRARARPLAEIDLLPGDVQVWRVFRNAPVRTPAAVKPAKSLRTKAGEAKEPV
FT                   NAAIASPRIGIEQVQPSVEDGRFAVKRLVGDDIIVEADVLMDGHDKLAVHLLWRAQDED
FT                   TWQHVPMMPLGNDRWRGAFRPERLGRHVYAVAAWRDAFGTYRSELEKKHTAGVEVTLEL
FT                   EEGARLVALAAEHAPNDAPVDALHKLARLLAEADQAHRLKLLLDPVTEHVMAQASHYRP
FT                   FYVESVAYPLDVERAGAAFASWYKLFPRSASDDEQRHGTFDDVIRRLGAIRGMGFDVLY
FT                   FPPIHPIGRTNRKGRNNSLRAEPDDPGSPYAIGATEGGHDAIHPQLGTLEDFRRLMRAA
FT                   REKGLELALDFAIQCSPDHPWLREHPGWFAWRPDGSIKYAENPPKKYEDIVNVDFYADD
FT                   AKPGLWTALRDVVMFWADEGVRLFRVDNPHTKPLPFWEWMIGEVRARYPDTVFLSEAFT
FT                   RPKVMYRLAKVGFSQSYTYFTWRHTKQEFIDYLTELTRTPVREYFRPHFFVNTPDINPV
FT                   FLQTSGRPGFLIRAALAATLSGLWGVYNGFELCEGAAVPGKEEYLDSEKYQLRAWDHNR
FT                   PGNIVKEIALLNRIRRANPALHSHLGVTFQPASGDRILFFSKSTPPVLPAQLETSQAEP
FT                   ANALSPDRFGDNTVFVAINLDPHHAHESDIELPLWQWGLPDHGALMAENLVNGQRTVWR
FT                   GKWQHIRLEPEHPFAIWRVRPALPSEEQPS"
FT   gene            complement(197313..198944)
FT                   /locus_tag="Rpic_3940"
FT   CDS_pept        complement(197313..198944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3940"
FT                   /product="glycogen/starch synthase, ADP-glucose type"
FT                   /note="TIGRFAM: glycogen/starch synthase, ADP-glucose type;
FT                   PFAM: glycosyl transferase group 1; Starch synthase
FT                   catalytic domain protein; KEGG: rso:RSp0242 glycogen
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3940"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29045"
FT                   /db_xref="GOA:B2UHJ4"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR011835"
FT                   /db_xref="InterPro:IPR013534"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHJ4"
FT                   /protein_id="ACD29045.1"
FT                   /translation="MTLSLNVLFVASEAVPLAKTGGLGDMVGACANALRRAGMKVTVML
FT                   PGYPDAITQLQHTRTVCEWTDLPGGPARLLSGHMGAQGIPVLLFDAPALFARPGNPYLD
FT                   AHGEPYEDNALRFASFSQAAARVAGGVPGVHRSDTVQAHDWHAGLVPLFVKRAQAPVKT
FT                   VFTIHNLAFQGNFPMHVVPDIGVPPDAAHEAEFWGQFSFLKAGLLWADRITTVSHAYAR
FT                   EILTDTAGCGMQDLLRARQRDLIAILNGIDNDVWNPSKDPLLPQPFVASNLSGKHTAKR
FT                   VLQQRFGLPEDAKAPLLAVGSRLTHQKMADVTLQALPQLLESNPQLQVAVLGCGEHAYE
FT                   TGMADLAARYPRQVAAKIGYTEAFAHLLHAGADILLHGSRFEPCGLTPLYSMRYGTVPV
FT                   ASRVGGLMDTITDRGSPEAALHGATGFLFDGDTADAMVAAVERALHVFAQPQAWRILQY
FT                   NGMTTDFGWSQPAREYIALYRTLVPAATPMPAVALVQAPVAPDAVHTPRPEQPVRTPAR
FT                   RRSTALSDEIRAHAVARAASAEKIRA"
FT   gene            199347..199910
FT                   /locus_tag="Rpic_3941"
FT   CDS_pept        199347..199910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3941"
FT                   /product="peroxiredoxin"
FT                   /EC_number="1.11.1.15"
FT                   /note="KEGG: rso:RSp0245 probable alkyl hydroperoxide
FT                   reductase (subunit C) oxidoreductase protein; TIGRFAM:
FT                   peroxiredoxin; PFAM: alkyl hydroperoxide reductase/ Thiol
FT                   specific antioxidant/ Mal allergen; Redoxin domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3941"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29046"
FT                   /db_xref="GOA:B2UHJ5"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017559"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHJ5"
FT                   /protein_id="ACD29046.1"
FT                   /translation="MSLINTQVQPFKAQAFHNGKFIEVTDESLKGKWSVLIFMPAAFTF
FT                   NCPTEVEDAADNYAEFQKAGAEVYIVTTDTHFSHKVWHETSPAVGKAQFPLVGDPTHAL
FT                   TNAFGVHIPEEGLALRGTFVIDPQGVIKTMEVHDNAIARDVKETLRKLKAAQFVANNPG
FT                   NVCPAKWNEGAKTIKPSLDLVGKI"
FT   gene            200036..201610
FT                   /locus_tag="Rpic_3942"
FT   CDS_pept        200036..201610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3942"
FT                   /product="alkyl hydroperoxide reductase, F subunit"
FT                   /note="TIGRFAM: alkyl hydroperoxide reductase, F subunit;
FT                   PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: rso:RSp0246 probable alkyl
FT                   hydroperoxide reductase (subunit F) oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3942"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29047"
FT                   /db_xref="GOA:B2UHJ6"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR012081"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHJ6"
FT                   /protein_id="ACD29047.1"
FT                   /translation="MLDADVKAQLKAYLERLVQPIELVANVDDSEGSRDMMDLLRDVAE
FT                   QSSMIVLTEQRDAAERAPSFLIRRTGADVSVRFAAIPTGHEFTSLVLALLQVGGYAPKL
FT                   EADVIEQIRNIEGDFRFETYMSLTCQNCPDVVQALNVMSVINPRIQHVAIDGALYQGEI
FT                   EARQIMAVPTVFLNGETFGTGRMGVEEILAKIDTGAAARDAEKLAAKEAFDVLIVGGGP
FT                   AGAAAAVYAARKGVRTGVVAERFGGQVLDTLGIENFISVQETEGPKFAAALEQHVRQYD
FT                   VDIMNTQRAVKLTPADKPGGFAEVTLANGAVLKGRSVILSTGARWRNVNVPGEQEYKNK
FT                   GVAYCPHCDGPLFKGKRVAVIGGGNSGVEAAIDLAGLVSHVTLLEFASELKADAVLVRK
FT                   LQSLPNATIVTNAQTTEITGDGQKVNGLRYKSRVDGVEHTVALEGVFVQIGLVPNTEWL
FT                   DGALERNRFGEIVVDARGQTSAEGVFAAGDATTTPYKQIIIATGDGAKAALSAFDHLIR
FT                   VPLAEAA"
FT   gene            complement(201688..202575)
FT                   /locus_tag="Rpic_3943"
FT   CDS_pept        complement(201688..202575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3943"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: pap:PSPA7_2742 probable
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3943"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29048"
FT                   /db_xref="GOA:B2UHJ7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHJ7"
FT                   /protein_id="ACD29048.1"
FT                   /translation="MIDLVLLRSFVTVVDTGNFTRAAEHLHLTQSTVSQQILRLEQQLD
FT                   CRLLDRSQRQVLPTEEGDRLLGYARRLLRLANEASEALSPEHTGGVLRLGVPEDLGSGA
FT                   LMPLIASFARERPRLRLEVESGLSHHLLRLYRNGDLDMLLVKQWGTDSDCHARWAEPVC
FT                   WIDSAERPHTLPLGPSQPSLPLVVFPVGALYRQEMLHALESIGQPWRITYSSPSLASLC
FT                   AAVSAGLGVSLLPASTVQAGHRVLGAADGFPEIGGLELALFARPDLDSAGRALRDRLVE
FT                   MCAARAQALQSAAG"
FT   gene            203210..203665
FT                   /locus_tag="Rpic_3944"
FT   CDS_pept        203210..203665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3944"
FT                   /product="ferric uptake regulator, Fur family"
FT                   /note="PFAM: ferric-uptake regulator; KEGG: rso:RSp0247
FT                   probable ferric uptake transcriptional (FUR)-related
FT                   transcription regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3944"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29049"
FT                   /db_xref="GOA:B2UHJ8"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHJ8"
FT                   /protein_id="ACD29049.1"
FT                   /translation="MPNSTDLRRAGLKATSPRVKILEILTAGTEHGRHLSAEDVYRQLL
FT                   TSEIDVGISTVYRVLNQLVDAGVLLRHAFEAGHAVYELNEGAHHDHLICVSCGRVEEFH
FT                   DDAIESRQERVANERGFVLRDHALALYGVCPACQAGAGVSSMVGLNA"
FT   gene            203762..204013
FT                   /locus_tag="Rpic_3945"
FT   CDS_pept        203762..204013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3945"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RS03718 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3945"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29050"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHJ9"
FT                   /protein_id="ACD29050.1"
FT                   /translation="MQRRLKSEDELKTLLARCVQQHPECAQCELRAMCIHRPDHTGCNW
FT                   SAEFDFPVDDDAAAIRGLSVAKRLLTRARTQYNVVPAQ"
FT   gene            complement(204023..204328)
FT                   /locus_tag="Rpic_3946"
FT   CDS_pept        complement(204023..204328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3946"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RS03717 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3946"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29051"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHK0"
FT                   /protein_id="ACD29051.1"
FT                   /translation="MTEELLVQLIAEVEKEDPVDFANLPFDEQMLRDLVCKLVSRQLTQ
FT                   MEKAHFSQDEVIVSLTASIAKLVLENLVLNARLLAQQGHGESARALLERISRQAKG"
FT   gene            complement(204435..204755)
FT                   /locus_tag="Rpic_3947"
FT   CDS_pept        complement(204435..204755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3947"
FT                   /product="putative transmembrane protein"
FT                   /note="KEGG: rso:RS03716 putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3947"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29052"
FT                   /db_xref="GOA:B2UHK1"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHK1"
FT                   /protein_id="ACD29052.1"
FT                   /translation="MSVYHVVETGVVATVVALSALSLTGRYAPAMRARTAARVAGWCNR
FT                   PSRPGWMRAFGQRLLTPGESPSCHSDPLSGSACGTGCSGCASGDSVSAAPVVQPIHFVR
FT                   RK"
FT   gene            complement(204752..206617)
FT                   /locus_tag="Rpic_3948"
FT   CDS_pept        complement(204752..206617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3948"
FT                   /product="ferrous iron transport protein B"
FT                   /note="TIGRFAM: ferrous iron transport protein B; small
FT                   GTP-binding protein; PFAM: GTP-binding protein
FT                   HSR1-related; Ferrous iron transport protein B domain
FT                   protein; Ferrous iron transport B domain protein;
FT                   nucleoside recognition domain protein; KEGG: rso:RSp0251
FT                   probable ferrous iron transport B transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3948"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29053"
FT                   /db_xref="GOA:B2UHK2"
FT                   /db_xref="InterPro:IPR003373"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR011640"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030389"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHK2"
FT                   /protein_id="ACD29053.1"
FT                   /translation="MQMHASSSSASTPALRVALVGNPNCGKTALFNLLTGSRQKVANYA
FT                   GVTVERKEGRFTAPSGRHVQILDLPGAYSLIATSPDEAITRDICLGTFRGESRPDMLIC
FT                   VVDATNLRLHLRFVLELQRLGLPMVLALNMVDAAERRGIRIDRAKLETALGVPVVQTVA
FT                   IKRNGAADLVAHIDHEQLPAVPVGLPADADPHVEVKRLLDTAVTMPRSTAELDDRLDRI
FT                   VLHPVLGLMLLAVLMFFMFQAVFSWAQPLMDGIQGAVEAVGVWVGNVMPDGMLKSLLVN
FT                   GIIAGTGSVLVFLPQILILFLFILSLEESGYLPRAAFLLDRLMAGAGLSGRSFIPLLSS
FT                   FACAIPGVMATRTIQDPRDRLVTILVAPLMTCSARLPVYALLIGAFIPVRKVWGLFNLQ
FT                   GLVLFGLYMAGIVSALVVAYVLKYLKRDRNEHPLILELPSYRLPSVRNLIVGLVERARI
FT                   FLRRIGTVILKMMVLLWFLSTFPAPPANATLPAIDYSFAGMIGRALEVVFAPIGFTWQM
FT                   CIALIPGMAAREVAVGALATVYSLSATHEDAAAQLAPIISQQWSLATALAFLAWYVYAP
FT                   QCISTLATIRRETNSWKVMAGTAGYLFALAYLAAFATYQIARVLT"
FT   gene            complement(206664..206972)
FT                   /locus_tag="Rpic_3949"
FT   CDS_pept        complement(206664..206972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3949"
FT                   /product="FeoA family protein"
FT                   /note="PFAM: FeoA family protein; KEGG: rso:RS03714
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3949"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29054"
FT                   /db_xref="GOA:B2UHK3"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR038157"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHK3"
FT                   /protein_id="ACD29054.1"
FT                   /translation="MRLSELSRRATAVVDHVEDREPADPISQRLRELGFVTGEEVRVVA
FT                   VGPFGGDPLVVQVGFTRFALRRQEAARVCVRAESATQPAAAIASPETAPPVKVREAA"
FT   gene            207660..211211
FT                   /locus_tag="Rpic_3950"
FT   CDS_pept        207660..211211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3950"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC sensor(s)"
FT                   /note="KEGG: rso:RS03712 probable transmembrane protein;
FT                   TIGRFAM: PAS sensor protein; diguanylate cyclase; PFAM:
FT                   GGDEF domain containing protein; EAL domain protein;
FT                   histidine kinase HAMP region domain protein; PAS fold-3
FT                   domain protein; PAS fold-4 domain protein; PAS fold domain
FT                   protein; SMART: PAS domain containing protein; PAC
FT                   repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3950"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29055"
FT                   /db_xref="GOA:B2UHK4"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHK4"
FT                   /protein_id="ACD29055.1"
FT                   /translation="MPKHAFFPTTLRGRLLALAAVAALPAIVVAIAGVALYRDRLNDHL
FT                   AQHLTHETETAAARVGMVLSNANTLLSVLIADDSALRMERQECSSFVNRVFHNQSELAN
FT                   LGIIDAHRKLVCTPDTAKLAIDLSDRPYINEIMATGRPSLSTFVIGRVSGQAVLISARP
FT                   MAGNDGTIRGVAYAAVRQSALIAAAVDGMSEAPVYLVDAAGNVLSTHGALEAAQVPAIV
FT                   RGPLVAAAAQQPGEPVFVDDTDGVRRAYAAMVVPHAAGGHLRIVRGVDATDIVRQQRNV
FT                   TLAGGGAILLMVVMLLALIQMALRRMVMPRIDALVDAARHYATGDFSARVPEHGSSRDE
FT                   LSLLERTFNEMRAAIQRHDATVHRLTERFQRVARATNDWIFDWDIATGESWANASLHRL
FT                   LGSDALLGQGDDDGTGGGTSRTLTFQQFVHPDDVDAFAHELRTVLNSDRDSWQHVCRVI
FT                   DANRATRTVEIRASLYRDQDGRAVRMVGGVTDISQRSAIEQELRSSEANLRVAEQIALL
FT                   GSWRWDVLRDSTTWSSGMYVLTGMPPGAPPAFAQQAQFFTADSYNRLREAASRAVTEGE
FT                   AYSLELEMIRRDGEHRWVLSRGNIERNDRDEVVALFGTMQDITDRRESDEQLRLLRRVV
FT                   ESVPSGITVADAQQPDFPIVYVNPGFERMTGYRAEEILGRNARFLHSSEPGQPALNEVR
FT                   TALRDESEIRVLLRNFRKDGHAFLNNFLLSPVRDAKGAVTHYVGIQDDVTEQEMTRTRL
FT                   AQHATIDSLTGLPNRTLLADRVQQSVEMAARQRSRFYVALVNIDRFKVVNDSLGHLLGD
FT                   EVLRRVAERLRDAADTVDTVARFGGDVFALVISHAGSRGVDFGFDLFAEPVRVEGHEVF
FT                   VTASIGVAEYPAHGADADSLIRHAEMAMYYAKQNGRNRLEFFAPEMDIGVSYRLNLEHQ
FT                   IRATLEQGQFRLLYQPQIDTKTGRVCGLEALIRWIHPTRGLLPPAAFIPVAEESGLIVE
FT                   IGNWVLTEAARQRAEWHKRGLADDLTLAVNVSPLQFKRGTVLPTLLKLQRQYGLGSGFL
FT                   ELEVTESMLMEGTERTIEDLTAIRQLGVRIAIDDFGTGYSSLAYLKRLPIDLIKIDRAF
FT                   VKDIDRDSNDAAICTTVVVLAHNLGVKVCAEGVEDAAQSAFLASHQCDVLQGYYFSEPL
FT                   LPEAVTALLERNTRFTL"
FT   sig_peptide     207660..207758
FT                   /locus_tag="Rpic_3950"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.674 at
FT                   residue 33"
FT   gene            complement(211233..212822)
FT                   /locus_tag="Rpic_3951"
FT   CDS_pept        complement(211233..212822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3951"
FT                   /product="methyl-accepting chemotaxis sensory transducer
FT                   with Pas/Pac sensor"
FT                   /note="KEGG: rso:RS03711 probable methyl-accepting
FT                   chemotaxis transducer transmembrane protein; TIGRFAM: PAS
FT                   sensor protein; PFAM: histidine kinase HAMP region domain
FT                   protein; chemotaxis sensory transducer; PAS fold-3 domain
FT                   protein; PAS fold domain protein; SMART: PAS domain
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3951"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29056"
FT                   /db_xref="GOA:B2UHK5"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHK5"
FT                   /protein_id="ACD29056.1"
FT                   /translation="MRKNLPVTQAETALNPTDYLISRTDLKGLIVFANPAFVRISGYAH
FT                   DELMGAPHNLVRHPDMPEAAFADLWATLQAGKPWRGFVKNRRKDGGFYWVLANVTPVFQ
FT                   NNAVVGYTSVRSMAMPAQIARAQRAYTAINEGDTSYTVRAGRILRTGWRRVVNLFQIDS
FT                   LRFKVIGLQTLIASAILIGTVWAHIALEAADLHGAAWLVFSRDWLWLTGVGCAGLATMS
FT                   GVLLARTLIRPLEEAATLATRLAAGDLTTVVEARSSDELGEVMRAMGTMRASLSSIVRD
FT                   IQDGAASVAHSTQQISAGNHDLSARTEQQAAALEETASSMEELTSMVAQNADHARAASA
FT                   LAEQASTIAADGGQVVQRVVQTMDAIRADSQRVTEIIATIESIAFQTNILALNAAVEAA
FT                   RAGEEGRGFAVVAGEVRSLAQRSAQAAAQSKEIIRASDQSVRDGVDLVHKAGATMTQIV
FT                   QSVQTVTQLMSEISASSREQSSGIAQINASVSQLDGVTQQNATLVEEAAAATSVLARQS
FT                   EDLKHAIAVFRA"
FT   gene            213039..213290
FT                   /locus_tag="Rpic_3952"
FT   CDS_pept        213039..213290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3952"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RS03710 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3952"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29057"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHK6"
FT                   /protein_id="ACD29057.1"
FT                   /translation="MHKICGDVEIVPRVVPAGGRGWEARVEVVFRGAEGQSLSGSQPVR
FT                   PGCTFGSPREAMDAALLHGQRLLREWVRGATPQTEVAT"
FT   gene            complement(213304..214131)
FT                   /locus_tag="Rpic_3953"
FT   CDS_pept        complement(213304..214131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3953"
FT                   /product="FAD-binding 9 siderophore-interacting domain
FT                   protein"
FT                   /note="PFAM: Siderophore-interacting protein;
FT                   Oxidoreductase FAD-binding domain protein; FAD-binding 9
FT                   siderophore-interacting domain protein; KEGG: rso:RS03709
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3953"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29058"
FT                   /db_xref="GOA:B2UHK7"
FT                   /db_xref="InterPro:IPR007037"
FT                   /db_xref="InterPro:IPR013113"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="InterPro:IPR039374"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHK7"
FT                   /protein_id="ACD29058.1"
FT                   /translation="MFAFNRTQGLMSQLLSSVKPATRRMRVRVRAIHTLSPRMRRVVFT
FT                   GVAAMDLADLAGAAPGAAIKLMFPHDAAGPGRTLGRAYTIRRYHAARDELEIDFVVHDE
FT                   TPAAQHGPAARWLEHAAPGDEVEFAGPKRGFRADPAAPWTLLIGDETALPAIFAILEAL
FT                   PEHAQVLTYIAIGDARARLPLEGALAEHPRSRGIHWVESDTAHAGAMMVGALSAQAMPA
FT                   GTPQVFLAGEASLLKQVRTLLEGAWAVPHDAIDAKGYWTAGLSREERKASEAR"
FT   gene            complement(214232..214891)
FT                   /locus_tag="Rpic_3954"
FT   CDS_pept        complement(214232..214891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3954"
FT                   /product="transcriptional regulator, PadR-like family"
FT                   /note="PFAM: transcriptional regulator PadR family protein;
FT                   KEGG: rso:RS03708 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3954"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29059"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHK8"
FT                   /protein_id="ACD29059.1"
FT                   /translation="MRGWFGHHHKMWIEKHFMMGRHGHGGHGFGRGMGGPGGYGEGDDE
FT                   GGSPWRGRRLSSADLQLVLLALLKGTPRHGYELIKAVEEHSLGFYTPSPGMVYPALSYL
FT                   EDHGFASVTVEGNKKRYGITPEGETWLAERQHSADAILAQLRAMGERVKRMNEAMAFDR
FT                   ETDNAAEWTDTGHDPLRTARWRLKFALMEKRFASREEQQRVADILLRALKEITGER"
FT   gene            complement(215004..215519)
FT                   /locus_tag="Rpic_3955"
FT   CDS_pept        complement(215004..215519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3955"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; KEGG: rme:Rmet_3441
FT                   transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3955"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29060"
FT                   /db_xref="GOA:B2UHK9"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHK9"
FT                   /protein_id="ACD29060.1"
FT                   /translation="MSKRATAGKDNDTSRNAPSIPEPGQGKRGEEGYLGYLLRQASAAQ
FT                   RLRMERAMADVGVTLPQFLVLTMLRAYPGISNADLARLTMLTPQTVSVIVTNLERSGAI
FT                   TRRPHAVHGRIQHIDVTPEGSALLAACRKRSGGIEQDLLEGFTPEEEEVVRRWLVHVAK
FT                   LGSDKPAS"
FT   gene            215598..216095
FT                   /locus_tag="Rpic_3956"
FT   CDS_pept        215598..216095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3956"
FT                   /product="alkylhydroperoxidase like protein, AhpD family"
FT                   /note="TIGRFAM: alkylhydroperoxidase like protein, AhpD
FT                   family; PFAM: Carboxymuconolactone decarboxylase; KEGG:
FT                   reu:Reut_A3275 alkylhydroperoxidase AhpD core"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3956"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29061"
FT                   /db_xref="GOA:B2UHL0"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHL0"
FT                   /protein_id="ACD29061.1"
FT                   /translation="MEDLSPRMDYSEFVDTAVGVAPALQALGKAVDASGLEKPLTELIK
FT                   LRASQINGCAFCVQFHLNLARKLRVAPAKLDLVAVWRDTPAVFTPRERAALAWTEALTT
FT                   LARAADHGVEDHEYDAVLEHFSRTEVAFLTAAVANIQAWNRIAVAMRFAPQVPAAVTAE
FT                   QA"
FT   gene            216092..216541
FT                   /locus_tag="Rpic_3957"
FT   CDS_pept        216092..216541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3957"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   rme:Rmet_3439 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3957"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29062"
FT                   /db_xref="GOA:B2UHL1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHL1"
FT                   /protein_id="ACD29062.1"
FT                   /translation="MTMDAVRPIEDEAALRACFPVMHQLRPHLADADELVARWRRQVQD
FT                   GYRLIAVWRDGVPVALAGYRQQENLVYGPFLYVDDLVTDANLRSSGLGNVLMSHLKAEA
FT                   ERLGCARLVLDTPLSNVLGHRFYYRNGLLAGALRFGMNTKTGAAR"
FT   gene            216538..217164
FT                   /locus_tag="Rpic_3958"
FT   CDS_pept        216538..217164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3958"
FT                   /product="NAD(P)H dehydrogenase (quinone)"
FT                   /note="PFAM: NAD(P)H dehydrogenase (quinone);
FT                   NADPH-dependent FMN reductase; KEGG: reu:Reut_A3273
FT                   (acyl-carrier protein) phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3958"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29063"
FT                   /db_xref="GOA:B2UHL2"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR023048"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHL2"
FT                   /protein_id="ACD29063.1"
FT                   /translation="MTTLLHVTVSPRDDRSHSRRGAKWVVAQLAEAVGGLRVIERDLAA
FT                   TPLPHPDAGFVEASLTPDADRTAAHRAALALSETLIGELGAADAVLISTPVHNYTVPSA
FT                   LKAWIDLVVRPERTFRRTPTGKVGMLTDRSVLVVSASGGHFDGAHAQTDFLMPYLRYVF
FT                   ATVGIHQVEGIRLQNTARGADSAMQAFESFRQELAARMLLMPLVA"
FT   gene            complement(217230..217877)
FT                   /locus_tag="Rpic_3959"
FT   CDS_pept        complement(217230..217877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3959"
FT                   /product="pyrrolidone-carboxylate peptidase"
FT                   /EC_number="3.4.19.3"
FT                   /note="KEGG: rso:RSp0259 probable pyrrolidone-carboxylate
FT                   peptidase protein; TIGRFAM: pyrrolidone-carboxylate
FT                   peptidase; PFAM: peptidase C15 pyroglutamyl peptidase I"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3959"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29064"
FT                   /db_xref="GOA:B2UHL3"
FT                   /db_xref="InterPro:IPR000816"
FT                   /db_xref="InterPro:IPR016125"
FT                   /db_xref="InterPro:IPR029762"
FT                   /db_xref="InterPro:IPR033694"
FT                   /db_xref="InterPro:IPR036440"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHL3"
FT                   /protein_id="ACD29064.1"
FT                   /translation="MTTVLVTGIEPFESDPTNPSWDIAQALDSTQVDSAVIVARQLPCV
FT                   FGLANEILVDAIEATSPALVFALGLATGRTEISVERVAINVIDARIPDNAGNQPVDTPV
FT                   VADGPTAYFSTLPIKAIVHALREAGVPAGVSQSAGTYNCNHLFYGLMHHIAMRAPQVRG
FT                   GFIHVPTTPELAARHAGRPSLSIDTQIKGIRLAVRTTLATQSDLKMSAGAVH"
FT   gene            complement(217956..218375)
FT                   /locus_tag="Rpic_3960"
FT   CDS_pept        complement(217956..218375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3960"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; KEGG: rso:RS03706
FT                   probable transcription regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3960"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29065"
FT                   /db_xref="GOA:B2UHL4"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHL4"
FT                   /protein_id="ACD29065.1"
FT                   /translation="MFDHCLYFNTTALARSVEREWTVAYAPFSLTPPQGFVLRVVLKRP
FT                   GVLNRELAEVLGIARPTATRLVDGLIAKGLVERQPSAEDGREWNLFPTEAARELETALQ
FT                   AASAKVARRLREHVGASAFDDTVQAIRNVRSTLNT"
FT   gene            complement(218461..220059)
FT                   /locus_tag="Rpic_3961"
FT   CDS_pept        complement(218461..220059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3961"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: reh:H16_B1494 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3961"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29066"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHL5"
FT                   /protein_id="ACD29066.1"
FT                   /translation="MTPPTLPALHVELTTPQTVDGRRAPFQSLWLLVRLAYAHRLSPEQ
FT                   PLVRLADLRGAVSDASTQRMMISRAFRDWQNWGVQAGWGEQRDREPRFLNADKRSQGPF
FT                   WLTPEDAARVVCLVEGRIADDTDVRAFLGIAAPESSTDNSAEANASALSGPAPGTPNPA
FT                   FWHAFLTARHAMREGRLLHALSTGTIASDTERGGALLALRHAGDAADNDFQRALVTLGE
FT                   AMAARRLGDSTRASALLSQLRAHRRQRHVLGNDYLAAMERIVTAWCAYDRRDLDLAAGL
FT                   LARLADAEPGRSLLRYHPQIRFEWNNLSALIERARLLYADADGIALEARAHAAQRIVAQ
FT                   FETALAAALESQASDAVQQVAANLGMTCWLLRDVLGNAVHADGTVDAVRWLAMSEWQAL
FT                   RNGGPLQSAWNAIALMRIARADTSRAALKLNDLGTQAGPFAEAFDARYWPQRWSDVAAL
FT                   RLREHDSGRHRYGHVQVSGLLLELAWFAHADGDHVTARTAMNRLAQATQDLAPHDRAYF
FT                   VQALKQLTQMADAPP"
FT   gene            220251..221066
FT                   /locus_tag="Rpic_3962"
FT   CDS_pept        220251..221066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3962"
FT                   /product="Beta-lactamase"
FT                   /EC_number="3.5.2.6"
FT                   /note="PFAM: penicillin-binding protein transpeptidase;
FT                   KEGG: pla:Plav_3016 beta-lactamase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3962"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29067"
FT                   /db_xref="GOA:B2UHL6"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR002137"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHL6"
FT                   /protein_id="ACD29067.1"
FT                   /translation="MFSRWSKTFASALTACAVAMSTTTAHAELVVRNDLKRAFDDAGVS
FT                   GTFVLMDIGADRTYVVDPARAARRIHPASTFKIPNSLIAFDTGAVRDDQEVLPYGGKPQ
FT                   PYQQWEHDMALPEAIRLSAVPIYQEVARRVGLERMQAYVDAFEYGNRQLGSVIDQFWLR
FT                   GPLEISAFEEARFTSRMALKQLPVKPRTWDMVQRMLLIEQQGDAALYAKTGVATEYQPE
FT                   IGWWVGWVERAGHVYAFALNIDMPREGDMAKRVPLGKQLMQALAVWPAP"
FT   sig_peptide     220251..220334
FT                   /locus_tag="Rpic_3962"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.985 at
FT                   residue 28"
FT   gene            221233..221676
FT                   /locus_tag="Rpic_3963"
FT   CDS_pept        221233..221676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3963"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3963"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29068"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHL7"
FT                   /protein_id="ACD29068.1"
FT                   /translation="MFRVYKAMAVAITAAVGASGALAAGSQDGVIYFTGAIVEAGFRVL
FT                   PALQATGTGEGLQARRSASGDQVVLDFRSTAVRAVPVDVSVEARAASSLNPLRVGDARS
FT                   KADVLAKYGGFKANLLTANNGTLTLSRAPGVEPALAVVTLSYQ"
FT   sig_peptide     221233..221304
FT                   /locus_tag="Rpic_3963"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.923 at
FT                   residue 24"
FT   gene            complement(221728..223341)
FT                   /locus_tag="Rpic_3964"
FT   CDS_pept        complement(221728..223341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3964"
FT                   /product="periplasmic glucan biosynthesis protein MdoG"
FT                   /note="PFAM: periplasmic glucan biosynthesis protein MdoG;
FT                   KEGG: rso:RS03704 glucan biosynthesis protein D"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3964"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29069"
FT                   /db_xref="GOA:B2UHL8"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR007444"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014438"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHL8"
FT                   /protein_id="ACD29069.1"
FT                   /translation="MVTRRTLLASASVTATLAALGITPEALAADRVKLGDAAPFSFDAL
FT                   IERARTMAGKPYTPPATAPADILSKIDYEAHGKIKFDTAHALFADGPGQFPVTFFHLGT
FT                   FFRAPVRMHVVEKGAAREIVYDESYFDMPADSPARKLPRGSGFAGFRFQESRLGDQKKL
FT                   DWKKNDWVAFLGASYFRAIGELYQYGLSARGIALDVAQAGKPEEFPNFTHVWFDTPADN
FT                   RADSVTIYTLLDGPSITGAYRFVMHRTKGVVMDIDTAIFLRKDVDRFGIAPATSMYWFS
FT                   ETAKGTATDWRPEVHDSDGLALWTGNGERIWRPLNDPPRTMASAFGDNNPRGFGLLQRD
FT                   RDFNNYQDGVHYERRPSLWVEPLEGWGEGAVQLIEIPTDDEIHDNIVAMWVPKAPARAG
FT                   SQYRLRYRLHWLADEPYPTQLARCVATRMGNGGQPGQPRPRGVRKFMVEFKGGPLEKLP
FT                   FGTKPEAVLSTSRGTFSYVFTEAVPNGVPGHWRAQFDLTVDGKEPVDMRLFLRVDGKPL
FT                   SETWLYQYHPFQSPVGPVAS"
FT   sig_peptide     complement(223255..223341)
FT                   /locus_tag="Rpic_3964"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.881 at
FT                   residue 29"
FT   gene            223539..224681
FT                   /locus_tag="Rpic_3965"
FT   CDS_pept        223539..224681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3965"
FT                   /product="beta-lactamase"
FT                   /note="PFAM: beta-lactamase; KEGG: bra:BRADO6186 putative
FT                   beta-lactamase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3965"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29070"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHL9"
FT                   /protein_id="ACD29070.1"
FT                   /translation="MARRLRSIGIALAWVCTVCGAQAAPCDAPARLNDGWQVEADPAAA
FT                   GFDAGQLCTVLRNVADADINFHSLLVVRHGRLVAEVYRAGKDERVKDLFRTTRTFDAST
FT                   LHDIRSISKSVTSLLWGIAQGQGKTPPLDTPVLSLFPGLADLNRDGREAITLSQMLSMS
FT                   SGLAWNEWRATSLFNNDEFGLFWHTSQAHYVFDRPMAAAAGTQFNYNGGNTAVLAQLLA
FT                   ERVGMPVPEYARKQLLEPLGITDWEWVDDYRGRPLAFAGVRLRPRDLARIGQLVLQHGQ
FT                   WNGRQLVPAEWIAESTRPHIDTGMGLQYGYQWWLGKVAAGSAEYAWIGGIGNGGQRLWI
FT                   VPGLDLVVVTTAGDYNQRAIWKQAETLLNEVMTAVQPTPR"
FT   sig_peptide     223539..223610
FT                   /locus_tag="Rpic_3965"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.948 at
FT                   residue 24"
FT   gene            complement(224712..225191)
FT                   /locus_tag="Rpic_3966"
FT   CDS_pept        complement(224712..225191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3966"
FT                   /product="Domain of unknown function DUF1854"
FT                   /note="PFAM: Domain of unknown function DUF1854; KEGG:
FT                   rme:Rmet_0706 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3966"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29071"
FT                   /db_xref="InterPro:IPR015005"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHM0"
FT                   /protein_id="ACD29071.1"
FT                   /translation="MTAMQTPDFALSRNGFGKLVMTLADGTVHEGVVPVRAFPISAAGE
FT                   GLSLMSTDGRELAWITQPDALPTPMRALIEAELGAREFMPEIRTIVGVSTYATPSTWTV
FT                   QTDRGQTDLVLRGEEDIRRLTGTTLLISDSHGIHYLIRDLLALDKHSRKILDRFL"
FT   gene            complement(225205..227511)
FT                   /locus_tag="Rpic_3967"
FT   CDS_pept        complement(225205..227511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3967"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter transmembrane region; ABC
FT                   transporter related; SMART: AAA ATPase; KEGG: rme:Rmet_0705
FT                   ABC transporter-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3967"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29072"
FT                   /db_xref="GOA:B2UHM1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHM1"
FT                   /protein_id="ACD29072.1"
FT                   /translation="MTQSSPSSAPTVVRAQEPWRVVLGSSLAPEETVLAGLQLDLDARL
FT                   HFTQGWLVVTNRRLIGQAVGEKDLQSWDIAPGMTLAHSDHAGVGTLELSDGQRRLASWR
FT                   YTLGHNTDALRLADAFDAQRNALTTGAKAAQPDADICPTCKAPLPAGEDNCPQCSRELE
FT                   QPPSTWALLRLWRFAQPYRWELLAGFALLLIGTAATLVPPYLTMPLMDKVLIPYQNGQP
FT                   VDYRLVTLYLSGLFGAALVAWVLGWARTYLLARVSERISADLRTTTYEHLLKLSLEYFG
FT                   GKRTGDLMARIGSESDRISVFLSLHLLDFATDVLMIAMTAVILVSIDPWLALVTLVPLP
FT                   FIAWMIHLVRDRLRHGFEKIDRIWSEITNVLADTIPGIRVVKAFAQEKREVTRFAEANK
FT                   HNLAINDRVNAVWSLFTPTVTLLTEVGLLVVWIFGIWRVSHDAITVGVLVAFLTYISRF
FT                   YTRLDSMSRIVSVTQKAAAGAKRIFDILDHVSSVPEPARPVHLEKVKGAIELRDLGFRY
FT                   GNRAVIRGLNLSIQPGEMIGLVGHSGSGKSTLVNLICRFYDVSEGAIRLDGTDIRSLPV
FT                   SEFRRNIGLVLQEPFLFFGTIADNIAYGKPDATREEIIAAARAAHAHEFILRLPHGYDS
FT                   LVGERGQALSGGERQRISIARALLINPRILIMDEATSSVDTTTEKEIQKALDNLVQGRT
FT                   TIAIAHRLSTLRKADRLVVMDRGQIVEVGNHDELLAREGAYYKLYQAQARNVDAETDLT
FT                   SDGERVDAAAPAYAQ"
FT   gene            227801..230461
FT                   /locus_tag="Rpic_3968"
FT   CDS_pept        227801..230461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3968"
FT                   /product="cyanophycin synthetase"
FT                   /note="TIGRFAM: cyanophycin synthetase; PFAM:
FT                   phosphoribosylglycinamide synthetase; ATP-dependent
FT                   carboxylate-amine ligase domain protein ATP-grasp;
FT                   cytoplasmic peptidoglycan synthetase domain protein; Mur
FT                   ligase middle domain protein; KEGG: rme:Rmet_0704
FT                   cyanophycin synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3968"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29073"
FT                   /db_xref="GOA:B2UHM2"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011810"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHM2"
FT                   /protein_id="ACD29073.1"
FT                   /translation="MKKKDIEILDVMSLRGPNMWTYRPVLEAWVDIGELEDSPSNTIPG
FT                   FYERLSTWLPTLIEHRCSPGVRGGFLMRLKEGTWPGHILEHVTLELQNLAGMPGGFGKA
FT                   RETPVRGVYKVIVRAWHEDVTRAALFAARDLVMAAIEDRPYDVDAAVETLRDMVDEQCL
FT                   GPSTACIVEAADDRNIPSIRLSDGNLVQLGYGARQRRIWTAETDRTSAIAESISRDKDL
FT                   TKSLLQSCGVPVPEGRMVDSAEDAWDAAEDIGVPVVVKPYDGNHGRGVFTNLMTREEVE
FT                   TAYAVAIEEGNGVIVERFVSGNEHRLLVVGGRLAAAAMGETASVVGDGNSTIEELIESQ
FT                   INSDPRRGNTEEHPLNCVRLDSAARLELKRQGYADGSAVPPAGRSVLIQRNGNVAFDVT
FT                   DRVHPSVAAHASLAARVVGLDIAGVDLVAEDISRPLDEQRGAIVEVNAGPGLLMHIRPA
FT                   QGEPRPVGRAIVDHLFSDKDGTQDDGRIPIVGITGTNGKTVVAKLVAQMLQLSGKHTGL
FT                   GCSDGLYLDRRQVESGARTDRAAWDACHRILMNRAVEAAVFESDSGMILSQGLPYDRCQ
FT                   VGVVTNFGKPDHLGDFYVEDEDRMVSVLRTQIDVVLKTGVGVLNAADARLVEMAELCDG
FT                   EVIFFALSGDLEAIAAHRAAGKRAVFVRDGKVVLATGPTELALADVSAIPLTYDGRVPF
FT                   QLENVLAAVATGWALGISNDLMRAGIMTFDVGQVDVPGRFTLFQHHGATIVVDDAHNAS
FT                   ALEALAAALDNFPAQRRTLVFGAGLQRRDEDLVAQGTVIGQTFDRVLLCEDASVKRTDA
FT                   EFDRQARALLKQGLQAGGRVAEVVVEGAKRRDVVDAALSQVTAGDLLVLQCDECAIEGT
FT                   VQQVHQWMGRAESQN"
FT   gene            230515..233082
FT                   /locus_tag="Rpic_3969"
FT   CDS_pept        230515..233082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3969"
FT                   /product="cyanophycin synthetase"
FT                   /note="TIGRFAM: cyanophycin synthetase; PFAM:
FT                   phosphoribosylglycinamide synthetase; ATP-dependent
FT                   carboxylate-amine ligase domain protein ATP-grasp;
FT                   cytoplasmic peptidoglycan synthetase domain protein; Mur
FT                   ligase middle domain protein; RimK domain protein
FT                   ATP-grasp; KEGG: rme:Rmet_0703 cyanophycin synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3969"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29074"
FT                   /db_xref="GOA:B2UHM3"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011810"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHM3"
FT                   /protein_id="ACD29074.1"
FT                   /translation="MEVSRIRALRGPNLWCRHTAIEAIVACSDQSQLLAELPGFEDRLR
FT                   ARFPAIGPMRPDDEADAPSIAHALEAAALGLQAAAGCPVTFSHTEPTLEPGTYQVVVEY
FT                   TEEEVGRLAFELAGQLCLAARDDQPFDLDDALHRLRELDEDVRLGPSTGSIVDAAVVRG
FT                   IPYRRLTQGSMVQFGWGSKQRRIQAAETDMTSAVAESIAQDKDLTKALLHAAGVPVPLG
FT                   RSVRSAEEAWEAAQEIHGPVVVKPRDGNQGKGVAVRIRTREEVMTAYEAAADISSDVIV
FT                   ERYIPGHDFRLLVVGKHLVAAARRDPPQVIGDGKHTVRELVDEVNRDPRRGEGHATSLT
FT                   KIRFDDIALATLAKQGLSADAVPPKGTRVVLRNNANLSTGGTATDVTDDVHPAIAARAV
FT                   AAAQMVGLDICGVDAVCETMLKPFEDQAGGIVEVNAAPGLRMHLQPSYGKGRAVGEAIV
FT                   STMFADGDDGRIPVVAVSGTNGKTTTVRLITHLLASSGLRMGMTGTDGVYIQGQRIDTG
FT                   DCSGPRSARNVLLHPDVDAAVFETARGGLLREGLAFDRCDVAVVTNVGEGDHLGLNYIS
FT                   TVEDLAVLKSVIVQNVAPRGMAVLNAADPMVARMAEGCPGSVTFFAHDPGLPTLALHRA
FT                   QGKRVVFVDGPEIVAAEGANETRIALADIPLTRNGTIGFQVENAMSSIAAAWALGIDWT
FT                   VIRRGLATFVNDAATAPGRFNLFDYKGATLIADYGHNPDAIQALCNAVATMPAQRRMVV
FT                   ISGAGDRRDEDIRKQTQILGGVFDDVVLYEDQCQRGRADGEVLALLREGLQGASRTSRV
FT                   DEIRGEFLAIDTALGRLQPGDLCLILIDQVEEALEHIARRVAE"
FT   gene            233728..234309
FT                   /locus_tag="Rpic_3970"
FT   CDS_pept        233728..234309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3970"
FT                   /product="flavin reductase domain protein FMN-binding"
FT                   /note="PFAM: flavin reductase domain protein FMN-binding;
FT                   KEGG: cvi:CV_3073 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3970"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29075"
FT                   /db_xref="GOA:B2UHM4"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHM4"
FT                   /protein_id="ACD29075.1"
FT                   /translation="MPNPITPAPVELAKCYRLLNHGPTTLVTSAHNGVRNVMAAAWAMP
FT                   LDFDPPKVLVVVDSRTLTRELIEGSGVFALNIPTRAIAETTLTVGTLSGRDVDKFDALG
FT                   LVTMPARTIDVPLVAGCAGWLECRVIPEPHNEKRYDLFIAEVTAAWANPALFSNGRWHF
FT                   TDAGSKTLHYLAGGAFFETGEAFTVEVKQL"
FT   gene            234306..234818
FT                   /locus_tag="Rpic_3971"
FT   CDS_pept        234306..234818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3971"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   rso:RS03701 probable acetyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3971"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29076"
FT                   /db_xref="GOA:B2UHM5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHM5"
FT                   /protein_id="ACD29076.1"
FT                   /translation="MSVIAIRPLIDEDVAAFKALRLRAIQDAPTAIWPTHDEEAARTLD
FT                   ETRNRIRTTDHQIVLGAFAGPELVGIAGLRREALAQVAHKAVLWGVFVDPAHRRGGIAG
FT                   RLLHAAITHARAARVLQIHLCVNAENPRAQALYRNAGFETFGIERRAMRVGDRFYDEEH
FT                   MALRLDA"
FT   gene            complement(234815..235831)
FT                   /locus_tag="Rpic_3972"
FT   CDS_pept        complement(234815..235831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3972"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; KEGG: rso:RS05569 probable transcription
FT                   regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3972"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29077"
FT                   /db_xref="GOA:B2UHM6"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR032687"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHM6"
FT                   /protein_id="ACD29077.1"
FT                   /translation="MPMKNNEKGTVSVSLVNEAVTRARAHGVDMQPIMAAAGITPQMLA
FT                   QPRSRVSSAQYGALWAGIAQAMDDEFFGQDAHPMRWGSFVTMTQAALTARTGRQALARA
FT                   TGFLRLVLDDLHVRVEEDDQRVRLVFVHRKGTRVPPMFTYATWLIMVYGLVCWLVGRRI
FT                   PFIAARFRCAAPQDAQEYRLMFCDDMAFKHDASYVDLSPTFLDLPVIQTAASIKTFLRD
FT                   APGSFIVKYRNPDSFAARVRKTLRNLPVASWPASDAMALKLNVAEATMRRRLKLEGHTY
FT                   QSIKDDLRRDIAIGQLQDTRRTIADIAVAVGFAEPSAFHRAFRKWTGMRPTDYRTER"
FT   gene            235997..237130
FT                   /locus_tag="Rpic_3973"
FT   CDS_pept        235997..237130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3973"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase type 2 domain; KEGG: rso:RS05570
FT                   probable acyl-CoA dehydrogenase oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3973"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29078"
FT                   /db_xref="GOA:B2UHM7"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHM7"
FT                   /protein_id="ACD29078.1"
FT                   /translation="MDDFYTEEQRMIHDAARAFATERLAPNAAQWDRDGALPDEVVREM
FT                   GELGLLGMIVPAEWGGSYTDYVAYALALEEVAAGCAASATMMSVHNSVGCGPILKFGTE
FT                   AQKARYLPDLATGRAIGAFCLTEPHAGSEANNLRTRAVLRDGKWVLTGNKQFVTNGARA
FT                   DIAIVFAVTDPEAGKRGISAFIVPTDTPGFHVGRPEHKLGIRASDTCPITLEDCAVPEE
FT                   NLLGERGEGLKIALSNLEGGRIGIAAQAVGIARAAFDAARNYANERIQFGKALREHQTI
FT                   ANMLADMATRLNAARLLVHHAARLRSADKPCLSEASQAKLYASELAEEICSNAIQIHGG
FT                   YGYLADYAVERHYRDARITQIYEGTSEVQRMVIARHV"
FT   gene            237192..238886
FT                   /locus_tag="Rpic_3974"
FT   CDS_pept        237192..238886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3974"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   rso:RS05571 probable acetyl-coenzyme A synthetase
FT                   (acetate--CoA ligase) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3974"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29079"
FT                   /db_xref="GOA:B2UHM8"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHM8"
FT                   /protein_id="ACD29079.1"
FT                   /translation="MNEAVSAAQGFVEARDFLLRHRTDYDRAYREFAWPKLDTFNWALD
FT                   YFDVMARGNDNPALWIVDDAQGEGLKLSFAQMSERSSCMANFLRGLGMVRGDRLLLMLP
FT                   NRVELWDVMLAAMKLGAVVLPATTQLSPDDVRDRVELGGATCVVVDAAELHKFESVDAS
FT                   VKRIAVGAQRDGWIDLAAAYDAPAEFVPDGPTKATDPLLLYFTSGTTSKPKLVEHTHQS
FT                   YPVGHLSTMYWIGLQPGDIHWNISSPGWAKHAWSCFFAPWNAQACVFVYNYARFVPKDT
FT                   LDVLVRFNVTTLCAPPTVWRMLVQEPLATYAVKLREIVGAGEPLNPEIIERVRSAWGVT
FT                   IRDGFGQTETTCQIGNTPGQPVVPGSVGRPLPGYRVELVDHDDQPASEGEIVLPLSHRP
FT                   LGLMQGYANNAKATAEAMRNGYYHTSDVAMRRDDGYFVYVGRTDDVFKSSDYRLSPFEL
FT                   ESVLIEHEAIAEAAVVPSSDPLRLSVPKAFVTVRQGYEAGPELARAVFLFSREKLAPYK
FT                   RIRRLQFSELPKTISGKIRRVELRRLELERTPQPARLPGEYWEEDFA"
FT   gene            238959..240506
FT                   /locus_tag="Rpic_3975"
FT   CDS_pept        238959..240506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3975"
FT                   /product="methylmalonate-semialdehyde dehydrogenase"
FT                   /note="TIGRFAM: methylmalonate-semialdehyde dehydrogenase;
FT                   PFAM: Aldehyde Dehydrogenase_; KEGG: rso:RSp0650 probable
FT                   methylmalonate-semialdehyde dehydrogenase oxidoreductase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3975"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29080"
FT                   /db_xref="GOA:B2UHM9"
FT                   /db_xref="InterPro:IPR010061"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHM9"
FT                   /protein_id="ACD29080.1"
FT                   /translation="MSAVASLASAKPAAQQDTPPTVKLLIGGEFVESQSKEWRDIVNPA
FT                   TQEVLARVPFATAGEVDAAIRSAHAAFATWKNTPVGARMRIMLKFQALIREHSPRIART
FT                   LTAEQGKTLPDAEGDIFRGLEVVEHACSVGSLQQGEFLENVAGAVDTYTLRQPIGVCAG
FT                   ITPFNFPAMIPLWMFPMAIVCGNTFVLKPSEQDPLSTMQLVELALEAGVPPGVLNVVHG
FT                   GKDVVDALCTHEHVKAISFVGSTAVGTHVYRLGSEHGKRVQSMMGAKNHAVVLPDANRE
FT                   QAINALVGAAFGAAGQRCMATSVVVLVGAAQQWVPDLIAKAKTLKVNAGVEPGTDVGPV
FT                   VSRAAKQRILGLIESGVQQGATLALDGRNVRVAGYEDGNFIGPTIFTDVKTDMDIYTNE
FT                   IFGPVLLVLTVPTLDDAIALVNANRFGNGVGLFTQSGASARKFQSEIDVGQVGINIPIP
FT                   VPVPYFSFTGSRGSKLGDLGPYGKQVVQFYTQTKTVTARWFDDAVDTGGVNTTISLR"
FT   gene            240526..241419
FT                   /locus_tag="Rpic_3976"
FT   CDS_pept        240526..241419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3976"
FT                   /product="3-hydroxyisobutyrate dehydrogenase"
FT                   /EC_number="1.1.1.31"
FT                   /note="KEGG: rso:RSp0649 probable 3-hydroxyisobutyrate
FT                   dehydrogenase oxidoreductase protein; TIGRFAM:
FT                   3-hydroxyisobutyrate dehydrogenase; PFAM:
FT                   6-phosphogluconate dehydrogenase NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3976"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29081"
FT                   /db_xref="GOA:B2UHN0"
FT                   /db_xref="InterPro:IPR002204"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011548"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHN0"
FT                   /protein_id="ACD29081.1"
FT                   /translation="MKIAFIGLGNMGAPMARNLLKAGHVLSVFDLNTQAVGVLVEAGAM
FT                   AAASPKDAVAGAETVITMLPAAAHVRHVLTAEDGVLAGIAKGVPIIDSSTIDPASAKAL
FT                   AALAAEHGNPFVDAPVSGGTGGAAAGTLTFMVGGSAAAFEQVRPVLSAMGKNLVHCGDT
FT                   GAGQGAKICNNLVLGITMAGVAEAMSLGEALGIDPKVLGGIINTSTGRCWSSDTYNPFP
FT                   GVIDTAPSSRGYTGGFGTDLMLKDLGLAGDAAKSVRQPVYLGALAQQLYQTVSSKGDGK
FT                   LDFSAVIKLYRKDGAA"
FT   gene            241419..242216
FT                   /locus_tag="Rpic_3977"
FT   CDS_pept        241419..242216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3977"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   rso:RS05574 enoyl-CoA hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3977"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29082"
FT                   /db_xref="GOA:B2UHN1"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHN1"
FT                   /protein_id="ACD29082.1"
FT                   /translation="MIELETLHQNTVAVLTLKRPPANAFTPEGLLQLQGTVARLNADAR
FT                   VRALVVTGDGPKFFSAGADLNTFADGDRDVAREAAARFGAAFEALQNARPVVIAAINGF
FT                   AMGGGLECALACDIRIAEAHAKLAVPETAVGLLCCGCGTQTLPWLVGEGWAKRMILTGE
FT                   RVDAQTALRIGLVEEVVETGAAREAAIAMALRVTTLSPQAVTFSKQLIHQARNGVPRGA
FT                   ALAVERERFVDLFDHPDQREGVNAFLEKRAPRWHSTHESETRQ"
FT   gene            242213..243364
FT                   /locus_tag="Rpic_3978"
FT   CDS_pept        242213..243364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3978"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   rso:RS05575 putative enoyl-coenzyme A hydratase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3978"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29083"
FT                   /db_xref="GOA:B2UHN2"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR032259"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHN2"
FT                   /protein_id="ACD29083.1"
FT                   /translation="MSAVQLETVPPQAAAAEPEVLMRVVNRLAIITLNRPSALNALSHG
FT                   MVRQLATLLEQCRHDDGIAALVLRGAGQKGFCAGGDVRALYQLAQQGRMDGDDGWLQFF
FT                   VDEYRLDYALHQFPKPIVALMDGVTMGGGMGLGQAARLRVVTERTKMAMPETRIGFLPD
FT                   VGATRFLSVMSPELELYVGLTGVTLTGADALHCHLADVCVPAEWLASFEDRLQRMPHDG
FT                   DLMQALRRVFEPPCNIVPHAPLAQATPWVQRYFDRRSSVDRIVATLRESLEREQAREPR
FT                   QWLQATLEAMTTHSPTMLHVTREALLRGRQLSLAECFQMELGIVARGIQEGDFCEGVRA
FT                   HLVDKDHRPGWAPATLPQVRPERVRHFLTSPWRAERHPLAGLC"
FT   gene            243716..245485
FT                   /locus_tag="Rpic_3979"
FT   CDS_pept        243716..245485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3979"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pau:PA14_46540 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3979"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29084"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHN3"
FT                   /protein_id="ACD29084.1"
FT                   /translation="MATSVDSFQMKVYQGDSAVLFAFDVADADRADLAGFAIQCTPQGG
FT                   APYWVPNRLTFDTPIHADAPLKAGKYVDSIDAPFQSFHWVHFPPHAAAQLTYTVHARYF
FT                   VSTNPVQLETRATRIVTVTLQQPMSDWATVGMVRGYVSSQAFIDHYGGNTALAPDKRAQ
FT                   IKSPLLYDTQPYQDKYAYLGATGRRLIIDLLNQCHASDGYGIDVLAYDLDEPDIIRAIA
FT                   WLAQNGRKVRVIQDNSVGTGANATGHGTDDAFETQAAEYFKQTGADVRRTHLARFQHHK
FT                   AILLRDAAGKPVRVLAGSANFSLRGLYVQANSVLVFEQDAAQLYAQVFERLWGWIDQYG
FT                   EDAAGSRKVATAFRADALAADWQAVPQGSTPRARFGFSPHQTDALLTEAADRVKGALSS
FT                   VLFAVMATDGGGEMLTTLEQVVPHKAGLLSLGVIDKQGGVDAFAPGRDVPSQTVSFAYL
FT                   KDEAPAPFKQEVDAGTGQHIHHKFVVCDFNGDEPVVFCGSSNLSKGGEEQNGDSLIAIY
FT                   DPAIVTAYAIEAIRLFDHYRFRAGESKATADKPLVLKQSAAWADPYYDPQNIKFTERTL
FT                   FAKSGTALEAVVA"
FT   gene            complement(245513..247006)
FT                   /locus_tag="Rpic_3980"
FT   CDS_pept        complement(245513..247006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3980"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   reu:Reut_A3057 acyl-CoA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3980"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29085"
FT                   /db_xref="GOA:B2UHN4"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHN4"
FT                   /protein_id="ACD29085.1"
FT                   /translation="MTAHLIFDDRPTDAETLLARGAALAGGLRRMGVQEGDVIGVLLRN
FT                   APAYIDVMHACRIAGCYFCPINWHFTPAEVEFLVRDSGAKVLIGHRDLVDAAEPLLPAH
FT                   VQLLRVDAEGTDRADGYANWLALQTPYDGPIVSPRGHMAYTSGTTGRPKGVVRQAVPLD
FT                   QLEAHLQKARAVVAATFGIVPGCRALVPAPLYHSAPSLFAQQAAQMAEVLVVNARFDAL
FT                   RVLEQIERYRIDTVYLVPIMYVRLLKLTDEERSRYDLSSLRFVASTGAPCAPEIKRRMI
FT                   DWLGPVIYETYASSETGMITVMDPRDAAARPGSAGRPVCDARVRILREDGTPCPTGEIG
FT                   LIYSHQPAYPDFTYRGNDEARSKIERDGLVTLGDMGYLDADGYLYVCDRASDMVISGGV
FT                   NIYPAEIEHALLRHPDVVDCAVFGVPCDEYGERLVAVVQTERQDLQAEPLIEWLRGQIA
FT                   GFKIPRQIEFTTALPRDDNGKIAKRRLRDAWWSDRQRRV"
FT   gene            247489..248769
FT                   /locus_tag="Rpic_3981"
FT   CDS_pept        247489..248769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3981"
FT                   /product="Chloride channel core"
FT                   /note="PFAM: Chloride channel core; KEGG: rso:RSc1803
FT                   probable transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3981"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29086"
FT                   /db_xref="GOA:B2UHN5"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHN5"
FT                   /protein_id="ACD29086.1"
FT                   /translation="MKKMATRSEPLLMFGYLLRWLSLGSLVGMLAGLGSAVLLMALDWA
FT                   TNTRTAHPWLLWFLPVAGLAVGLLYHYTGRSVEGGNNLLIDEIHDPKRVVPKRMAPLIL
FT                   LSTVVTHIFGGSAGREGTAVQMGGSFADYLTRLFSLAPADRRILLMAGISAGFASVFGT
FT                   PLAGAVFGLEVLAIGRLRYDAILPCFIAAIVGDLVPPLLGVHHTPYAIPFVPHLTPVAI
FT                   GLVVVAGIVFGLAGMTFAALTHRLSRLLKRHIAFGPLRPVLGGSVVVAAALALGTDKYL
FT                   GLGIPVIVDTFHNPLPAYDFAGKAAFTIVTLASGFKGGEVTPLFYIGATLGNALGYVLP
FT                   LPFPLLAGLGFVAVFAGAANTPIASTLMAMELFGPEVGTFAGIACVVSYLFSGHTGIYH
FT                   AQRIGHAKRPTEAAPAGQVPAESAERP"
FT   sig_peptide     247489..247614
FT                   /locus_tag="Rpic_3981"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.985) with cleavage site probability 0.840 at
FT                   residue 42"
FT   gene            complement(248808..249518)
FT                   /locus_tag="Rpic_3982"
FT   CDS_pept        complement(248808..249518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3982"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="PFAM: regulatory protein IclR; Helix-turn-helix type
FT                   11 domain protein; KEGG: bmu:Bmul_4707 transcriptional
FT                   regulator, IclR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3982"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29087"
FT                   /db_xref="GOA:B2UHN6"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHN6"
FT                   /protein_id="ACD29087.1"
FT                   /translation="MGNDGVAAVEKALALLDCFKPGAEALSLAALAQASGMHKTTVYRL
FT                   MNSLERMSYVIRSESGAYSLGPRLLYLGKLYEQSFHLSSVVEPVLHALAAATRESASYY
FT                   VVDHGRRLCLFRAEPSEGLRETRLPGTSLPLDDTAISHVLRYWGLGEALYDETPKLPLF
FT                   TSGARDQHTAAFATPIFGSGDKFMAALTLSGAASRLEAARTSGDVVAKQLQAASDLSRK
FT                   LGASAALCERFYGV"
FT   gene            249688..250386
FT                   /locus_tag="Rpic_3983"
FT   CDS_pept        249688..250386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3983"
FT                   /product="Dimethylmenaquinone methyltransferase"
FT                   /note="PFAM: Dimethylmenaquinone methyltransferase; KEGG:
FT                   bch:Bcen2424_5398 dimethylmenaquinone methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3983"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29088"
FT                   /db_xref="GOA:B2UHN7"
FT                   /db_xref="InterPro:IPR005493"
FT                   /db_xref="InterPro:IPR036704"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHN7"
FT                   /protein_id="ACD29088.1"
FT                   /translation="MSTPSHNTSAIVRDIERVSPALVEAAARFQAAILADVAGRRGTLN
FT                   CRVKPLAPTMKVAGPAVTVEVRPGDNLAIHAALAVAKPGDVIVVDGKGDQSCALIGEIM
FT                   ATQAQATGIAGFVIDGAVRDSHELANGTFPIFSAGLNPCGPTKSVAGRVNLPVSAAGAT
FT                   VHPGDLVVGDADGVVVIPRADVERILVLAQKKVDAEAARIAAIRKGDTRPGWLEKELRA
FT                   AGMLAEGEAL"
FT   gene            250386..251336
FT                   /locus_tag="Rpic_3984"
FT   CDS_pept        250386..251336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3984"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding"
FT                   /note="PFAM: D-isomer specific 2-hydroxyacid dehydrogenase
FT                   catalytic region; D-isomer specific 2-hydroxyacid
FT                   dehydrogenase NAD-binding; KEGG: bch:Bcen2424_5397 D-isomer
FT                   specific 2-hydroxyacid dehydrogenase, NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3984"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29089"
FT                   /db_xref="GOA:B2UHN8"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHN8"
FT                   /protein_id="ACD29089.1"
FT                   /translation="MSTTATKPVLLVTAADLAPQALEMLGDFEVVFAGKQPTEDDIVAL
FT                   CARHKPVAIIVRYGKINARIMDAAAGNLQVISKHGSGIDVIDQDAAAARGIAVRAAVGA
FT                   NAAAVAEHAWALILACAKSVPQLDARMRAGHWDKATHKSVELDGRTLGLVGLGAIGRRT
FT                   AAIGLAFGMKVLAFDPYTKEAPAGVQLVALGELYAQSDVVSLHCPLTAENRKMLNRDAF
FT                   SCFKPGAILVNTARGGLIDEAALVEALANGRLRAAGLDSFDVEPMTVPHPFQGVANIIL
FT                   SPHIGGVSDAAYVNMGKGAAANVLAVIEERASTAA"
FT   gene            251336..252292
FT                   /locus_tag="Rpic_3985"
FT   CDS_pept        251336..252292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3985"
FT                   /product="SMP-30/Gluconolaconase/LRE domain protein"
FT                   /note="PFAM: SMP-30/Gluconolaconase/LRE domain protein;
FT                   KEGG: bch:Bcen2424_5396 SMP-30/gluconolaconase/LRE domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3985"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29090"
FT                   /db_xref="InterPro:IPR005511"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013658"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHN9"
FT                   /protein_id="ACD29090.1"
FT                   /translation="MSMFLLSPPAMREAEVFTRMPAKFRKPDVQTEWARANRGGQATDS
FT                   FLEGPVWCPDGRGYGHLYVTDIPHGRVFRISPAGDWELVTEYDGEPNGMKFVDDAHLLI
FT                   TDYRNGLMLLDIKRGEVTPYLERRNSERFKGVNDLTFDSHGNLYFTDQGQTGLQDPTGR
FT                   VYRLSPEGRLDMLLGNCPSPNGLVLSPDEKVLYVAMTRGNCVWRVPLQADGSVSKVGQF
FT                   FTSYGPSGPDGLTIDTAGRLFVANPGLGRAWVLNHRAEPDMILTSPEGASLTNLCFGGP
FT                   EMKTLFMTESVSGTVLKSEMDIAGPLPHRAKQTKVTP"
FT   gene            252355..253719
FT                   /locus_tag="Rpic_3986"
FT   CDS_pept        252355..253719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3986"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bch:Bcen2424_5395 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3986"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29091"
FT                   /db_xref="GOA:B2UHP0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHP0"
FT                   /protein_id="ACD29091.1"
FT                   /translation="MSQTLSATTPAHGADVRSAATLPDADYQASERTLAKAFRRILPFI
FT                   FACYVISYLDRTNVGFAALTMNKDIGLTAEQFGFGAGLFFIGYFLFEIPSNLIMQKVGA
FT                   RIWIARIMITWGIFSMATAFVVGPKSFAAARFLLGLAEAGFTPGIYLYFTHWFPGKWRA
FT                   KVTAAFLVGIPVANMIGSPISGALLELGGLHGLRSWQWLLLIEGLPAVLLGIACLFVLA
FT                   DRPEKAKWLTDDEKAVLARRLAMEQRAIASKHGTTLRDAMTNWRVFVLAFINFCGIVGS
FT                   IGVGLWMPQIIKQFGVEHTVVGWLTAIPYALGAVVMLWWARMANRAQNRVPYVAAALVV
FT                   AAVALAASTALDAPALKLAALCVTVSGILAFQATFWAIPSTFLTGRAAAGGLALIVSVG
FT                   NLGGFVGPSMVGAIKQYSQGFAAPLLAVSAVLLIGALSIAWLGDPGADAGEAATR"
FT   gene            253796..255121
FT                   /locus_tag="Rpic_3987"
FT   CDS_pept        253796..255121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3987"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bch:Bcen2424_5390 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3987"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29092"
FT                   /db_xref="GOA:B2UHP1"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHP1"
FT                   /protein_id="ACD29092.1"
FT                   /translation="MQVTGSTGVTEIEQRTLRKVVWRLVPFLMLCYLLAFIDRGNVGMA
FT                   SLQMNHDLGLTARVFGFGSSLFFVSYFFFEVPSNLALQRYGARIWIARIMITWGLISAA
FT                   TALVSGPASFYALRFLLGAAEAGFFPGVLLYLSYWIPATHRARIVATFMVAIPAASFIG
FT                   SPISAVLLQMDGFAGLRGWHWLFILEGIPTVLLGIACLRVLTNRPEEAKWLSNEERQWL
FT                   TNTLAGEARGPKKVAQMPLLKLFCNRYVLCLALVDVCASAAGSTLSVWQPQLLKSFGLT
FT                   VMQTGLLNSVPYAVASVLMVVWGRRSDRLKERRWHTAIPMLLIGLGLFGTSLSGSLVPT
FT                   MVMLCAVLVGAYSFKGPFWALASGMLSNSAAAAGLATINAIANLIGGGLMVNVYGWVKQ
FT                   ATGSYALALMPLALLTLVSVTTLLLLSRAKPEAQVLNKTETA"
FT   gene            255157..255753
FT                   /locus_tag="Rpic_3988"
FT   CDS_pept        255157..255753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3988"
FT                   /product="amidohydrolase 2"
FT                   /note="PFAM: amidohydrolase 2; KEGG: bmu:Bmul_4697
FT                   amidohydrolase 2"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3988"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29093"
FT                   /db_xref="GOA:B2UHP2"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHP2"
FT                   /protein_id="ACD29093.1"
FT                   /translation="MAGASAVAAAVPGLTEAEELWSSGSATPTFKLPAGAVDCHMHIYD
FT                   DRFPSAPGTTLRPPNASIEQYRKVQARLGMQRNVVVTPSTYGTDNRCTLDALKRLGPSA
FT                   RGVAVVDTSVTQAQLAEMHAAGVRAIRFNLSYPGATTVDMLAPLASRIGALGWHIELVV
FT                   QGAKLPALESHLLALPCPLAALPYHAAFIDDLRDG"
FT   gene            complement(255986..257926)
FT                   /locus_tag="Rpic_3989"
FT   CDS_pept        complement(255986..257926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3989"
FT                   /product="peptidase S8 and S53 subtilisin kexin sedolisin"
FT                   /note="PFAM: peptidase S8 and S53 subtilisin kexin
FT                   sedolisin; KEGG: xcb:XC_1442 extracellular serine protease"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3989"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29094"
FT                   /db_xref="GOA:B2UHP3"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHP3"
FT                   /protein_id="ACD29094.1"
FT                   /translation="MKDITGKSLALTLFATVALAACGGGDSGSNTASNGGNTSGNTPPA
FT                   STCAETGVDAKYACQTGSTEPLYTYQWALKQATSFFAAFGLVANGTTDINVEDAHKAGI
FT                   KGQGVNVLVLDDGIDVHNEDLFANANSDMTHNFDDGLNDPTPADNPANINDAHGTNVAG
FT                   IIAAAQNGKGVMGIAPRATLGGARFIGAANPDTTAAYGGANWSKNGHIINASYGANPQA
FT                   PLEYDTSTSTQAAVRAFPNLRGGRGLVMLKASGNEYESINDGINVPPRTCPTVGATAGM
FT                   IGCETPANDPEALEPGVIVVGAANAQGIKSSYSNAGSVNWITGLGGEYGNGGKYGETGS
FT                   GPKIFSTDLSGCARGYSRANPDDTYDFAIAGTATNLKDNAKCDYSSMNGTSAATPTLSG
FT                   VVALMLAANPNLTWRDVREILRATARKIDADYGSRDGRNARIDLLTGAATGDTSAALTD
FT                   GATTARLDYGWQTNAAGYAYSTWYGFGLVDASAAVKMAKATVAYKPAALSVPDFAAAFA
FT                   NVNQLNYGAVQKLGQFNVSGTDKVDALQLRVSGSVCVGSVGFFVKSPSGTVSALSLPYN
FT                   GYYNNGVDTVNKYGLGSYAFYGENAAGTWEVYAVSGVPTNACAKYQPQGGTHTVTLTTP
FT                   LAVEYRVIAAK"
FT   sig_peptide     complement(257855..257926)
FT                   /locus_tag="Rpic_3989"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.993) with cleavage site probability 0.466 at
FT                   residue 24"
FT   gene            complement(258219..259235)
FT                   /locus_tag="Rpic_3990"
FT   CDS_pept        complement(258219..259235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3990"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; KEGG: atc:AGR_L_1441 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3990"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29095"
FT                   /db_xref="GOA:B2UHP4"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR035418"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHP4"
FT                   /protein_id="ACD29095.1"
FT                   /translation="MSKPPHSHFDTSALPREHQFAAWRDAINVLFDSRSAAPQSHGFQA
FT                   SVDAYLCGETGVGMLSAQAQHYDRSRSKLGRDGMDVYVLQYYLEGSCGQRDGASDSATR
FT                   PGDLFIVDAAQPLATSTTDSRFLSLAVPRRLLAPLLRAPDELSMRVLRGGAPMVGLLRD
FT                   HLCSLYHSVGKLSDAEAQAVIPGTLQLAAAAINCQVTEANAPAVRESLFASVCRHVQHN
FT                   LSDLALSPEGVSVQFGISRATLYRLFEREGGFFNYLRMQRLRQCHAILADRSQTHRSVA
FT                   EIAQTYGFSDASNFARAYRRATGMSPRETRMLAVEGRAAAMPFVQHKDWRTWVMQMR"
FT   gene            complement(259323..260840)
FT                   /locus_tag="Rpic_3991"
FT   CDS_pept        complement(259323..260840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3991"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; KEGG: rso:RS04801 probable
FT                   transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3991"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29096"
FT                   /db_xref="GOA:B2UHP5"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHP5"
FT                   /protein_id="ACD29096.1"
FT                   /translation="MPLQRATGALLRRPSLLIIGASALSLVLAALTALSLWEMRSDALA
FT                   RARDAADNLALILQRDIARNIEVYDLSLQAVIDGVRDPAMLALPPAVRQLVLFDRSTNA
FT                   QDLGSLLVTDKAGDVVIDSHSVPPRHIYLGDRDYFQVHQASDDVGLYISEPFMPRATGL
FT                   ERSLGLSRRLNGPHGEFNGIVVGTLRLNYFRRLFDGINLGPHATVTLIRTDGTLLMRRP
FT                   YNEKLIGRNLADATAFQKRLLAPEGSYVDIAGIDDIERLFSFRHIGDHPLIVTVGLATE
FT                   DIYAEWWRRAWVISGIVLMLDAVFIVLSFLFAQQLRKRLEMEQQLHLLANTDSLTGLGT
FT                   RRALDSALDVEWRRANRHHTPMAVLMIDVDDFKPYNDRYGHAAGDTALRTVARCINDSI
FT                   KRPGDFAGRYGGEEFCAVLPNTDLGGAARVAESIRAAVLAANERNAGSAYGKLTVSIGV
FT                   AVHSGIAAEDDTLEDLVRLADGRLYEAKAAGRNVVMPRHERPKPAVV"
FT   sig_peptide     complement(260733..260840)
FT                   /locus_tag="Rpic_3991"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.337 at
FT                   residue 36"
FT   gene            261135..261329
FT                   /locus_tag="Rpic_3992"
FT   CDS_pept        261135..261329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3992"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RS04800 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3992"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29097"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHP6"
FT                   /protein_id="ACD29097.1"
FT                   /translation="MPEPDDRASPTPAPANPHPPVADTHEEALLDEGLEETFPASDPVS
FT                   VDAGKPNVPPKPPESAPKP"
FT   gene            261614..264247
FT                   /locus_tag="Rpic_3993"
FT   CDS_pept        261614..264247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3993"
FT                   /product="protein of unknown function DUF470"
FT                   /note="PFAM: protein of unknown function DUF470; protein of
FT                   unknown function DUF471; protein of unknown function
FT                   DUF472; KEGG: rso:RS04799 probable transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3993"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29098"
FT                   /db_xref="GOA:B2UHP7"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR022791"
FT                   /db_xref="InterPro:IPR024320"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHP7"
FT                   /protein_id="ACD29098.1"
FT                   /translation="MPDAASNDASPTSRRSSARTPPAAPATPVRSESGLGLAGWIVVGM
FT                   VLVLGALVFDSLYALLDHVHYADMVAALQATPRSHLLLAVLATALSYVALTGYDASGLR
FT                   YAGAHVAPGTVATTSFIAYALGNTVGLGSLTAGAVRTRLYTAAGLDPARVTEAVAFDAG
FT                   ALGVSTTAFGAVGLLWGAPHIATITHLPAPLLEVVALLVLAGVVALLVLCMRQRHVTLF
FT                   GRWEVRPPPPGLAARQFAISAADMIAAAAALWVLMPAGAVDLPTFVAFYALAVTLGVLS
FT                   QSPGGLGVFEAVILLGCSGQAPPAEVLAALLFYRAIYFLLPLVVAAAMLGAFELRSGAG
FT                   APFGRAAVKLSPGLLAALTMVAGVMLLVSGVTPASDEAEDLLRMHVPLFVVEASHMIGS
FT                   VAGLIMLFVARGLLHRLDAAWWAALVLSLLTGVLALPKGIAVSEMAVLVTLAVLLVISR
FT                   RQFDRPSSLFSQRLEAGWLLAMVCVFAACVWILFFAYREVAYANQLWWQFTFDGDAPRS
FT                   IRALMAVAVTGLGFGMWQLFRKEPGVTTFPSDEELARAAEIVRKQPAADATLALMGDKS
FT                   LLFSPSGNAFIMYAKQGRSWVALSDPVGAQQEWPELIWRFIEMADAHGGRAAFYKTRPQ
FT                   TLPLYLDAGLRAYKLGEEAYVSLPDFSLKGSRRANLRHGVTRGEREGLSFEIIPTADVP
FT                   TVLDELRAISDEWLRNQNAREKGFSLGAFDDRYIRSQPVAVVRREGVIVAFATLMCPDV
FT                   LRIEASVDLMRYRSDVPPGTMDFLFGKVILHFQAQGYQRFGLGMAPMSGMVEHQLAPRW
FT                   HRFGRMMFRHGARFYNFRGLRNFKDKFEPVWEARYLLARGGIAPLFTLTDVAALIGGGL
FT                   KGVISK"
FT   gene            264244..266010
FT                   /locus_tag="Rpic_3994"
FT   CDS_pept        264244..266010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3994"
FT                   /product="virulence factor family protein"
FT                   /note="PFAM: virulence factor family protein; KEGG:
FT                   rso:RS04798 probable AcvB-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3994"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29099"
FT                   /db_xref="GOA:B2UHP8"
FT                   /db_xref="InterPro:IPR010333"
FT                   /db_xref="InterPro:IPR011225"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHP8"
FT                   /protein_id="ACD29099.1"
FT                   /translation="MSWQAPRTQEARHRGVLRKGLRLAGHVGAVGMVLAASWAIAADAP
FT                   APTSKPTPVQGAVLVPPVGMTGASGVVAVPPRGDMPPRLQMSGPAVTANKAANGGVLSL
FT                   PVVAPATPAAAPGAVEFVTHGRFRDVPVYKPKGEIRSVVLMLSGDLGWTPAASRMAESL
FT                   AQQGALVAGLSTPALFASLEADPGDCAFPDGDLENFSRFLQAYEKVPGYYPPILVGDNE
FT                   GGALAYAMIAQARPNIFAGAMSMEFCPVLELRKPLCKGEGVHFSRRMSESRTTAKRVKP
FT                   PENAGVVLLPATKLSAPWVALQSAMPTSFARRSGPLCDARATQAFIDTISGAQSVALPA
FT                   MATGANAPPVTASEPFKTAFAKLVAQRKPPPPPPPAAVSDLPIIEVPAQPGSSSELFAV
FT                   LLSGDGGWAGLDKEVAAALSKSGVPVVGIDSLRYFWTPRTPASAAADMDRLVRFYASRW
FT                   KKQKALLIGYSQGADVLPFIVNRLPAASREHVALAVMMGLGKRADFEFHMTNWVSSSAS
FT                   GLLILPEVQKLPAGLGMCIYGKEEKDTNCPGLDPKQVQLVKLPGGHHFDGDYAKLARIS
FT                   LEGARAPGNASR"
FT   gene            complement(266070..267791)
FT                   /locus_tag="Rpic_3995"
FT   CDS_pept        complement(266070..267791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3995"
FT                   /product="sulphate transporter"
FT                   /note="PFAM: Sulfate transporter/antisigma-factor
FT                   antagonist STAS; Xanthine/uracil/vitamin C permease;
FT                   sulphate transporter; KEGG: rso:RS04796 putative sulfate
FT                   transporter transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3995"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29100"
FT                   /db_xref="GOA:B2UHP9"
FT                   /db_xref="InterPro:IPR001902"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHP9"
FT                   /protein_id="ACD29100.1"
FT                   /translation="MPPSNEHPAAALQHPESFAPLDAPPQPPQQRAVRDVIAGFSIAGL
FT                   LLPEAVAYAGIASLPPQAGLIALLCGLVVYSLLGSSRFAIVSATSSSAAVLFATVLSEP
FT                   GASSATALTMAAALIIATGVLFILAGAARLGGMSDFIARPVLRGFTFGLALTIAVKQLP
FT                   KILDVTVHHSDTPRVALDLISSAASANPYSTALGAIALALLFGLGRWGRVPATLVVIVL
FT                   AIAAGYWINWHSYGIAVVGHIDLQNISFGVPALNRVQWMQSAELGFALMLILYAESYGS
FT                   IRNFALKHGDGISANRDLVALGCANLLSGLLHGMPVGAGYSATSANEAAGAQSRLAGLC
FT                   AAVVVALIVWLFLPELARIPEPVLAAIVIFAVSHSLHPAVFKPYWAWHRDRLVVIAALL
FT                   AVLVLGVLHGLLAAIGVSLLLTLRKLSEPNVSVLGRLRESHDFVDVSLHPEAKPVPGVL
FT                   IVRPEVPLFFANTERVLGKVRAMLQQPHEPALRAIMLSLEETPDVDGSAIEALRVFAAE
FT                   CAARGLQLMLVRLKPRALTVLQRATDSTLRAEMLHELSVDECVQSLAATPSTPAGA"
FT   gene            complement(267871..268422)
FT                   /locus_tag="Rpic_3996"
FT   CDS_pept        complement(267871..268422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3996"
FT                   /product="putative alanine-rich signal peptide protein"
FT                   /note="KEGG: rso:RS04795 probable alanine-rich signal
FT                   peptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3996"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29101"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHQ0"
FT                   /protein_id="ACD29101.1"
FT                   /translation="MKLSALMFSIGALVMGSAFAQGTAAPATAPAAAPAAAPAAVHAVC
FT                   KDGTPYSGATLKGACRGHGGVDKKASAGGAPAAAPAAAPAASAPAKPAAAAPAAPAAAP
FT                   APAPAAKPAAAAPAKPAAAAAATVAPGGGPDKVWANASTKVYHCPGDRYYGKTKQGEYM
FT                   TEADAKAAGMRPSRNKACTK"
FT   sig_peptide     complement(268360..268422)
FT                   /locus_tag="Rpic_3996"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.988 at
FT                   residue 21"
FT   gene            complement(268632..269558)
FT                   /locus_tag="Rpic_3997"
FT   CDS_pept        complement(268632..269558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3997"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; regulatory protein
FT                   LysR; LysR substrate-binding; KEGG: reh:H16_B1766
FT                   transcriptional regulator, LysR-family"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3997"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29102"
FT                   /db_xref="GOA:B2UHQ1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHQ1"
FT                   /protein_id="ACD29102.1"
FT                   /translation="MLTDEELALLEAIRQTGSLSRAAAQLGKAPSTVSYAARQLEQRFD
FT                   ALLFDRRRYRLQLTRAGQLLTEEAARLAQDVSRVTQRVRQVANGWEDRLWIVTDELLEF
FT                   ESLMAVMHAFDALQSGVALRVTHEVLAGTWEALRDGRADLVIGATNEPPSIPNLGWFEL
FT                   GVVEWVFAVSPRHPLAAVDAPLTREEIARHRAVVVADSARTTAGRAYGMLSGQPTLAVP
FT                   SMRAKTLAQRDGLGVGWLPRHRVASLLARGELVEKRTTDPREPNLLYVGWRSGDVDGEG
FT                   RALQWWLEQLRQPRLARRLVQGIDTFA"
FT   gene            269671..270432
FT                   /locus_tag="Rpic_3998"
FT   CDS_pept        269671..270432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3998"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: reh:H16_B1767 putative
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3998"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29103"
FT                   /db_xref="GOA:B2UHQ2"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHQ2"
FT                   /protein_id="ACD29103.1"
FT                   /translation="MNRFEGKTVLVTGGNSGIGLAAAQAFAREGARVVITGRDAAALET
FT                   ARATLGTAGGNAALAIRNETGTVAAARELTRQLQEAGVRLDAVFINAGMAKFAAVPDVE
FT                   EALWDATFNANVKGAFFQMQALLPILNKGTSIVLNGSINAHIGMPNSSVYAASKAALIS
FT                   LAKTLSGELIGSGIRVNVVSPGPVTTPLYGKLGLDADTLAATAAQIQGQVPLGRFGQPE
FT                   EIASTVLHLSAPESAFIVGTEIIADGGMSQL"
FT   sig_peptide     269671..269754
FT                   /locus_tag="Rpic_3998"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.954) with cleavage site probability 0.901 at
FT                   residue 28"
FT   gene            270729..271370
FT                   /locus_tag="Rpic_3999"
FT   CDS_pept        270729..271370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3999"
FT                   /product="YheO domain protein"
FT                   /note="PFAM: YheO domain protein; KEGG: rso:RS04794
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3999"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29104"
FT                   /db_xref="InterPro:IPR013559"
FT                   /db_xref="InterPro:IPR039445"
FT                   /db_xref="InterPro:IPR039446"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHQ3"
FT                   /protein_id="ACD29104.1"
FT                   /translation="MKPTEENRLLLREGRKIVEALGKTLAPLVEVVLHDLTDPDHAVVA
FT                   IANNLSGRQVGDAVTELGLARLADPDFPEVIENYANRFPDGRPAKSTSIGLKNSRGDYV
FT                   AAICLNMDVSMLHAVTTGLTQLMRVDAAAPPVPESLGSRRVEDVRIALEQFAAARNTTP
FT                   MAMTLDQRREAMRELAVSGLLNLRRALTEVAQTLGVARSTVYTYLPEDLA"
FT   gene            271367..272344
FT                   /locus_tag="Rpic_4000"
FT   CDS_pept        271367..272344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4000"
FT                   /product="Pyridoxal-5'-phosphate-dependent protein beta
FT                   subunit"
FT                   /note="PFAM: Pyridoxal-5'-phosphate-dependent protein beta
FT                   subunit; KEGG: rso:RS04793 serine/threonine dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4000"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29105"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHQ4"
FT                   /protein_id="ACD29105.1"
FT                   /translation="MSLPISYDDVVAAHARLQGVAHKTPVLTSATANAMTGAELFFKAE
FT                   SFQRMGAFKFRGAYNALSQFTPEQRRAGVITFSSGNHAQAIALSAKLLGMRAVIVMPKD
FT                   APVVKVEATRGYGGEVVFFDRYTEDREAIGRQLAEEHGLTLIPPYDHPHVMAGQGTAAK
FT                   ELIEEVGPLDVLLAPLGGGGLLSGCATAARALNPACKIFGVEPEAGNDGQQSLRKGEIV
FT                   HIDTPKTLADGAQTQHLGNYTFAVIRELVDDIVTVSDAELVSAMQFFASRMKAVVEPTG
FT                   CLAAAAVLNGKVDVRGKRVGVILSGGNVDLQLFAKLVLGAEAAK"
FT   gene            272341..272730
FT                   /locus_tag="Rpic_4001"
FT   CDS_pept        272341..272730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4001"
FT                   /product="Endoribonuclease L-PSP"
FT                   /note="PFAM: Endoribonuclease L-PSP; KEGG: rso:RS04792
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4001"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29106"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHQ5"
FT                   /protein_id="ACD29106.1"
FT                   /translation="MSDARYLNAPQLRPPAGHYSHAVCANGFVFVAGQIPVTPTGEKLV
FT                   DAPFETQVRQVLSNLDAVLAAAGTDRSRLVQVRVYVTDMESHWPAFDALYSAWIGELRP
FT                   ARAVVPVPTLHYGLAVEIEATAVAG"
FT   gene            272882..273763
FT                   /locus_tag="Rpic_4002"
FT   CDS_pept        272882..273763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4002"
FT                   /product="type IV pilus assembly PilZ"
FT                   /note="PFAM: type IV pilus assembly PilZ; KEGG:
FT                   reh:H16_A1321 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4002"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29107"
FT                   /db_xref="GOA:B2UHQ6"
FT                   /db_xref="InterPro:IPR009875"
FT                   /db_xref="InterPro:IPR009926"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHQ6"
FT                   /protein_id="ACD29107.1"
FT                   /translation="MILQKTRQLTQEDVPVGQPLPFPLADSVGRLLLPAGAVVPDAEDV
FT                   RLLFHHGPVLALAEGDDIAAVPATAPAEAPPRIGSAGLSVGTVLQVQEKSAPLRGLLPC
FT                   RLIGYIEGEALFVTQPADAKRTLRPEPRDVLILRGFSGRSVFTMMCSVVSVGQFPSPYL
FT                   VLSAPIKMQKMPLRRAKRVQVRIGARVRAQGQAASAADRVAVIRDICLNGALVQSANPA
FT                   FQPGDRLALDFNAYVDGQLETFSLTGRVASGSPALGTTASAFPSFGVEFTLSKEQTAQL
FT                   SHLIIERLDENA"
FT   gene            complement(273768..274652)
FT                   /locus_tag="Rpic_4003"
FT   CDS_pept        complement(273768..274652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4003"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: rso:RS04791 putative transcription
FT                   regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4003"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29108"
FT                   /db_xref="GOA:B2UHQ7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHQ7"
FT                   /protein_id="ACD29108.1"
FT                   /translation="MRHSPEALLAFAEAATLGSFSAAARKLGKRQSTISEAIANLEIDL
FT                   GLTLFDRSTRQPTLTEAGHAMLTQVRRVLDASAQMDRMAAQMAGGLEARLTLVMSDTYQ
FT                   SDRYEQTLATLEQRYPDLELECLIAEHEDVVDIIQLGRAQIGLVAAQAAYPADIGWATI
FT                   AEQSEIGLFVGLQHPLARYGDEEVPHAILREARELRLNTFVDPTGPRTDAVPVRSLRRW
FT                   SAPSYLMLLEMAVLGFGWTELPRWLVDHFAADRLHEVRARGWPRLVPVDAVWSRNRTLG
FT                   QAGAWLLETMLAG"
FT   gene            274768..275205
FT                   /locus_tag="Rpic_4004"
FT   CDS_pept        274768..275205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4004"
FT                   /product="transmembrane pair domain protein"
FT                   /note="PFAM: transmembrane pair domain protein; KEGG:
FT                   rso:RS04790 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4004"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29109"
FT                   /db_xref="GOA:B2UHQ8"
FT                   /db_xref="InterPro:IPR007896"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHQ8"
FT                   /protein_id="ACD29109.1"
FT                   /translation="MQVIQKTPAERLVHALTFELVAMLICAPLFSWLMELPLAEMGVMT
FT                   LMFAAVAMVWNMVFNAIFERVERRYRLSRTLVLRVVHACLFEGGLVLMLVPLAAWWLDV
FT                   GLWEAFVLDIGIMLLFLPYTFFFNLAYDHLRARWMSRRALA"
FT   gene            275320..275961
FT                   /locus_tag="Rpic_4005"
FT   CDS_pept        275320..275961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4005"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="PFAM: regulatory protein LuxR; KEGG: rso:RS04789
FT                   putative transcription regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4005"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29110"
FT                   /db_xref="GOA:B2UHQ9"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHQ9"
FT                   /protein_id="ACD29110.1"
FT                   /translation="MPRLSVTSPHASATVLRQCYVAACAGDAVGVMNVLRDACGADHAA
FT                   AMIRWRVDGRWHWAASRGARSADVLLHAVRGDGVDAWPMADAEVRGAVWLDYRKAGVPQ
FT                   PMQHGAAPQALLPHFAQALPLCWRRVAARAGISPAQPASLWLTDAFHLTRREADVADLL
FT                   ASGSDPACIARTLGISLDTVRTHLKHVYRKTNTHSQCDVVRLMLALSARR"
FT   gene            complement(275979..276197)
FT                   /locus_tag="Rpic_4006"
FT   CDS_pept        complement(275979..276197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4006"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RS04788 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4006"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29111"
FT                   /db_xref="InterPro:IPR009409"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHR0"
FT                   /protein_id="ACD29111.1"
FT                   /translation="MGRRYIDCRAFPSETNCSVAISADSDAELLEAAVQHAVSVHKHTD
FT                   SPELRAQLQTLFQDGTPAVAPPKMATV"
FT   gene            complement(276333..276862)
FT                   /pseudo
FT                   /locus_tag="Rpic_4007"
FT   gene            complement(276892..277290)
FT                   /locus_tag="Rpic_4008"
FT   CDS_pept        complement(276892..277290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4008"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RS03031 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4008"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29112"
FT                   /db_xref="InterPro:IPR007438"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHR1"
FT                   /protein_id="ACD29112.1"
FT                   /translation="MALRIVRLGEPRHPDEGLRIGTVRRPPRGVPKEEFASRDFYDVWM
FT                   PLLSPTPELVKQAQAAQSQHDEKAWQTFVRHFRTEMRDGDAARLLDMLAALSHQTHLSV
FT                   GCYCEDEAHCHRSVLRALLEERGAKLAP"
FT   gene            complement(277326..278354)
FT                   /locus_tag="Rpic_4009"
FT   CDS_pept        complement(277326..278354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4009"
FT                   /product="putative periplasmic substrate-binding
FT                   transmembrane protein"
FT                   /note="KEGG: rso:RS03032 putative periplasmic
FT                   substrate-binding transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4009"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29113"
FT                   /db_xref="GOA:B2UHR2"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHR2"
FT                   /protein_id="ACD29113.1"
FT                   /translation="MQQPRRNILRFTMAATLAASLLAGAVSTAHAEASEVRISHGYGIL
FT                   YLPIMVMASEHLLEKQAKAAGLGDVKVSYRILDGGNVINDAMLSGALDIASLGVPGFLT
FT                   LWDKTRGSAIEVRGLSSLSSSSMYLMTRNPNVKTLADFSDKDRIAVPGIKTSLPAVVLQ
FT                   MAAAKTFGDKQFNKLDPITVPLPHPDATAVMLAGGSQINSHMASPPFSYTEAAAPGLHR
FT                   VFNTVDVLGNITLDMTYTSKKFYEANPKLSAAFVAALDEANALIAKDKSKAAQIYITQS
FT                   KVKSSPEEVKKILDDPDSRFTTTPVGVAHYAEFMQRVGTLKNKPASWKDLFFPTVQSRQ
FT                   GS"
FT   sig_peptide     complement(278259..278354)
FT                   /locus_tag="Rpic_4009"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.984 at
FT                   residue 32"
FT   gene            complement(278658..279554)
FT                   /locus_tag="Rpic_4010"
FT   CDS_pept        complement(278658..279554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4010"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: rso:RS03033 probable
FT                   transmembrane ABC transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4010"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29114"
FT                   /db_xref="GOA:B2UHR3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHR3"
FT                   /protein_id="ACD29114.1"
FT                   /translation="MQTETLSMPATTDISNRAPVYSTPVAFERIGVVEKPLSVAERLYE
FT                   QAWLRKVVILVVLALVWEGGARWLDNPLLLPTFSDTVQALWAGLASGTLFARIGTSMQT
FT                   LLAGYALGLALSCALVVLGISNRLGQDFLETLTAMFNPLPAIALLPIALVWFGLGNGSL
FT                   IFVIVHSVVWAVSLNTHAGFLSVSNTLRMVGRNYGLSGMGYLTKILIPAAFPSILTGLK
FT                   IGWAFAWRTLIASELVFGVSSGQGGLGWYIYENKNQLQIPEVFAGLLTVIIIGLLVENL
FT                   VFRTLEARTVKRWGMQN"
FT   gene            complement(279544..280338)
FT                   /locus_tag="Rpic_4011"
FT   CDS_pept        complement(279544..280338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4011"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: rso:RS03034 probable ATP-binding ABC transporter
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4011"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29115"
FT                   /db_xref="GOA:B2UHR4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHR4"
FT                   /protein_id="ACD29115.1"
FT                   /translation="MQANSPTAPPLLDVRGVTLQYKTRQHLVTATYRVDFQVYPGERYI
FT                   LLGPSGCGKSTLLKAIGGYLTPTEGEIRLKGQPVTKPGPDRMMVFQEFDQLLPWKTVKE
FT                   NVLFPLLSTGKLGAREAEERALHYINKVNLTKFADHHPHMLSGGMKQRVAIARGMAMEP
FT                   DVLLMDEPFAALDALTRRKMQDELLQLWDETRFTVLFVTHSIPEAIRCGSRILILSPHP
FT                   GQVRAELPSLARGDDDPERFKALEAEIHDMLFARAVEETHAD"
FT   gene            complement(280395..281117)
FT                   /locus_tag="Rpic_4012"
FT   CDS_pept        complement(280395..281117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4012"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR HTH; UbiC
FT                   transcription regulator-associated domain protein; KEGG:
FT                   rso:RS03035 probable transcription regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4012"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29116"
FT                   /db_xref="GOA:B2UHR5"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHR5"
FT                   /protein_id="ACD29116.1"
FT                   /translation="MPADLRLPRYQQLRDDLAAQIAQQHWRPGDAIPTEAELAKTYNVA
FT                   VGTVRKAVDVLVAEGLLERFQGRGTFVRRASFASSLFRFFRFQSESGERRIPESRILKR
FT                   DVLDAPSAPAAGLQIETGAPVIRLTRLRLLDGAPMLAEEIWLPYDRFASLATLELNAFG
FT                   DLLYPLYESHCGQIIASAEETLTAEAVNATYARLLRIQPGDPVMVIERVARGYDRVPLE
FT                   WRRSRGAAAHFRYHVDIR"
FT   gene            complement(281264..283540)
FT                   /locus_tag="Rpic_4013"
FT   CDS_pept        complement(281264..283540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4013"
FT                   /product="putative nitric oxide reductase (subunit B)
FT                   transmembrane protein"
FT                   /note="KEGG: rso:RSp1505 probable nitric oxide reductase
FT                   (subunit B) transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4013"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29117"
FT                   /db_xref="GOA:B2UHR6"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHR6"
FT                   /protein_id="ACD29117.1"
FT                   /translation="MKTNQRLWRWLGLIFILSFGALGYLGRQIYLAAPPIPHAVVTSVG
FT                   EVLFTGEQIQRGQEAWLAAGGQQLGTVWGHGSYVAPDWSADWLHREATALQAIRAHQQF
FT                   DTDAPLTTVQQAAVDASVKEEMRRNTYDANHDILTVSRERAEAIHGVAQHFEALFGTDP
FT                   SLATLRDQYAMATGVLPEAADREALAAFFFWTSWAAAADRPGETDISYTSNWPHEPLVG
FT                   NTMTGGAAVWSMVSIVLLLGGIAAMLWLHGSSKHEEEAAPLPADPFLNVVATPSMKATR
FT                   KYFFAVIGLMLVQIGMGAITAHYAVEGESFFGIPLAQVLPYVISRTVHTQLGVLWIATA
FT                   WLATGLYIAPLLSGREPKFQKLGVDLLFWALIFIVVGSIATGWLGTLQHRGADFGFWVG
FT                   NQGLEYTSMGRVWQILLFVGLLFWVVLLGRALWPALKTPSESRGLIAMVFLSATCIGGF
FT                   YSTSLVWGQHTHYSMIEYWRWWLVHLWVEGFFEVFATAVIALIFTRLGLIRASSANRAI
FT                   VAETIVFLFGGILGTLHHLYFTGTPTSIISVGAVFSALEVVPLSLIGLEALQNYRRTQG
FT                   TPWLNAYKWPVLCFVAVGFWNTVGAGLLGFAINPPASLYYVQGLNMTAAHGHAALFGVY
FT                   GMLGIGLMLFCLRGLYARSLHADRLLKPAFWGLNIGLAMMVFMSLLPAGIYQAWASVTK
FT                   GMWYARSPEVVHSKVMETLVWLRVPGDIVFAIGALVLAWYALRLLRRPKAQQMEPLPAS
FT                   ARATR"
FT   sig_peptide     complement(283442..283540)
FT                   /locus_tag="Rpic_4013"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.948) with cleavage site probability 0.540 at
FT                   residue 33"
FT   gene            complement(283573..283863)
FT                   /locus_tag="Rpic_4014"
FT   CDS_pept        complement(283573..283863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4014"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rme:Rmet_4922 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4014"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29118"
FT                   /db_xref="InterPro:IPR018720"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHR7"
FT                   /protein_id="ACD29118.1"
FT                   /translation="MTQSASTIQLDLRVLAPRERHPLIFSAFGELGIGQSLELINDHDP
FT                   RPLQSQFQVERPGQFSWDYLERGPGTWRVAITKVASAASAGHCCGGCGGGA"
FT   gene            284137..285636
FT                   /locus_tag="Rpic_4015"
FT   CDS_pept        284137..285636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4015"
FT                   /product="nitrite reductase, copper-containing"
FT                   /EC_number="1.7.2.1"
FT                   /note="KEGG: rso:RS03038 probable major anaerobically
FT                   induced outer membrane transmembrane protein; TIGRFAM:
FT                   nitrite reductase, copper-containing; PFAM: blue (type 1)
FT                   copper domain protein; multicopper oxidase type 1;
FT                   cytochrome c class I; multicopper oxidase type 2;
FT                   multicopper oxidase type 3"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4015"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29119"
FT                   /db_xref="GOA:B2UHR8"
FT                   /db_xref="InterPro:IPR001287"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="PDB:2YQB"
FT                   /db_xref="PDB:3ZBM"
FT                   /db_xref="PDB:3ZIY"
FT                   /db_xref="PDB:4AX3"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHR8"
FT                   /protein_id="ACD29119.1"
FT                   /translation="MSRLHTVRSLMRAGLISVVLGALLAGTAARAASAKLPGDFGPPRG
FT                   EPIHAVLTSPPLVPPPVHRNYPAKVIVELEVVEKEMQISEGVSYTFWTFGGTVPGSFIR
FT                   VRQGDTVEFHLKNHPSSKMPHNIDLHGVTGPGGGAASSFTAPGHESQFTFKALNEGIYV
FT                   YHCATAPVGMHIANGMYGLILVEPPEGLPKVDHEYYVMQGDFYTAGKYREKGLQPFDME
FT                   KAIDERPSYVLFNGAEGALTGDKALHAKVGETVRIFVGNGGPNLVSSFHVIGAIFDQVR
FT                   YEGGTNVQKNVQTTLIPAGGAAVVKFTARVPGSYVLVDHSIFRAFNKGALAILKIDGPE
FT                   SKLVYSGKELDSVYLGDRAAPNMSAVTKATEASVSGTLTVQDQVQAGRALFAGTCSVCH
FT                   QGNGAGLPGVFPPLAKSDFLAADPKRAMNIVLHGLNGKIKVNGQEYDSVMPPMTQLNDD
FT                   EVANILTYVLNSWDNPGGRVSAEDVKKVRAQPAPAKAVAEH"
FT   sig_peptide     284137..284232
FT                   /locus_tag="Rpic_4015"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.815 at
FT                   residue 32"
FT   gene            285653..286444
FT                   /locus_tag="Rpic_4016"
FT   CDS_pept        285653..286444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4016"
FT                   /product="protein of unknown function DUF323"
FT                   /note="PFAM: protein of unknown function DUF323; KEGG:
FT                   rso:RS03039 probable signal peptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4016"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29120"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR042095"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHR9"
FT                   /protein_id="ACD29120.1"
FT                   /translation="MSRLTSHIAAMLMALASATAHGATYVRLPGGDFDSVLPQNAPGQP
FT                   QRVRIEPFELRSTPVTIGEFQAFVQRHEAWQRGRVPQVFAGKAYLADWADATHADAQAS
FT                   LQAPVTGVSWFAARAYCENEGARLPTWLEWESAAAADATRTDARDDPQWAQRILGWYER
FT                   PATRVLPPVGGPADVHGVRDMHGLIWEWVDDFNALFIAGDSRTQGDPDKQKFCGAGAIS
FT                   IVRRDSYAVLMRVALLSSLEGADATGSLGFRCARSLNGDHP"
FT   sig_peptide     285653..285721
FT                   /locus_tag="Rpic_4016"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.995 at
FT                   residue 23"
FT   gene            286441..287025
FT                   /locus_tag="Rpic_4017"
FT   CDS_pept        286441..287025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4017"
FT                   /product="electron transport protein SCO1/SenC"
FT                   /note="PFAM: electron transport protein SCO1/SenC; KEGG:
FT                   rso:RS03040 probable signal peptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4017"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29121"
FT                   /db_xref="GOA:B2UHS0"
FT                   /db_xref="InterPro:IPR003782"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHS0"
FT                   /protein_id="ACD29121.1"
FT                   /translation="MMFTTFIRRAFVVLLLAGATAGAHAAGPAPSASLYQSDVALTDQN
FT                   GRVFHLADLRGEPVLVSMFYASCQMVCPMIFETIRATLAKGGKPAHDGVRVLMMTVDPE
FT                   RDSVAALKKTASAHGADDRWQVARANASGTREVAALLGVQYRRLADGDFNHSSTILLLD
FT                   AEGRINARTNTLGAVDPKLVDAMRKLVAAQR"
FT   sig_peptide     286441..286518
FT                   /locus_tag="Rpic_4017"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 26"
FT   gene            complement(287044..287892)
FT                   /locus_tag="Rpic_4018"
FT   CDS_pept        complement(287044..287892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4018"
FT                   /product="5-oxopent-3-ene-1,2,5-tricarboxylate
FT                   decarboxylase"
FT                   /EC_number="4.1.1.68"
FT                   /note="PFAM: fumarylacetoacetate (FAA) hydrolase; KEGG:
FT                   reh:H16_A0072 2-keto-4-pentenoate
FT                   hydratase/2-oxohepta-3-ene-1,7-dioic acid hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4018"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29122"
FT                   /db_xref="GOA:B2UHS1"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHS1"
FT                   /protein_id="ACD29122.1"
FT                   /translation="MKLVRVGAPGAERPGLIDTQGRVRDLSGVVSELGPQQLSDAALAR
FT                   LAGVDMASLPVLPDARFGVPWTGIGKIIAIGLNYADHAAEAGLPPPAEPIIFLKANSAL
FT                   NGPNDAVMLPRGSEKTDWEVELGVVIGKTASDVSREAALSHVAGYCVVNDVSEREFQLE
FT                   RGGTWDKGKGCDTFCPVGPWLVTRDEVPDPQALGLWLDVNDERAQRGNTATMVFGVAHL
FT                   VSYVSRFMTLHPGDLICTGTPPGVGMGAKPPRYLKAGDTMRLGIDGLGEQMQTVVAYTK
FT                   A"
FT   gene            complement(287889..288656)
FT                   /locus_tag="Rpic_4019"
FT   CDS_pept        complement(287889..288656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4019"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR HTH; GntR domain
FT                   protein; KEGG: reh:H16_A0071 transcriptional regulator,
FT                   GntR-family"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4019"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29123"
FT                   /db_xref="GOA:B2UHS2"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHS2"
FT                   /protein_id="ACD29123.1"
FT                   /translation="MWCIFPILVTSVTQPLLQSPRLRTLGMSAEIASRLRTLIEEGELP
FT                   PGARIDERAFCEMFDVSKTPLREALKVLVAEGLVLHRQYIGYRVAPLDLDELRATFETL
FT                   HGLEFTAGELAAARLSEVALARLERRHQAMLDAHAAGRRTEYFRINQEIHQLIIDGTAN
FT                   PVLAGIYAALMSRVHRARGAANADMLRWQESHEEHEAIMAALREPGRPRLAQVLRHHSE
FT                   NTAKEVLSVVANSLAEASRPTRSTKESPKKGAQ"
FT   gene            288887..290194
FT                   /locus_tag="Rpic_4020"
FT   CDS_pept        288887..290194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4020"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   reu:Reut_A0048 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4020"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29124"
FT                   /db_xref="GOA:B2UHS3"
FT                   /db_xref="InterPro:IPR000849"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHS3"
FT                   /protein_id="ACD29124.1"
FT                   /translation="METASQAPAMALTETKSSVRWKIFLMMLMLISINYVDRASLSVAM
FT                   PLIAKEFNIGPAVQGLLLSSFFLTYALMQIPGGMLADRFGPRVVIAGATLGWGFFQSIA
FT                   ALCTGWVPLLVTRLGLGAAEAPIYPAGGKLNAIWMTQNERGRGATLLDGGAPLGAALGA
FT                   LIIAGLIAEFNSWRTSFVVAGIGTMVAGLFAWWYIRNHPREHPSVNDAEAAYIEEAHAA
FT                   DQAAEPAALSGNVLDFFKYRSVWGMFFGWMCFNALFYGLLTWMPTYLSKVHGLDIKEMG
FT                   GAVFTMFFSGFVGEMVGGWIADKWMATGASRARVLRTLFGIASVLATIAIYTVARFKDP
FT                   VVVVALLSTTLFFLRWCGLFWCIPSILGTRKRVGFLGGTMNLGGNFAGVGMPIIVGLIV
FT                   QATGSYDMALMLFAAAGAGLFICSTLLIDYSKKLPV"
FT   gene            290357..291085
FT                   /locus_tag="Rpic_4021"
FT   CDS_pept        290357..291085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4021"
FT                   /product="Asp/Glu/hydantoin racemase"
FT                   /note="PFAM: Asp/Glu/hydantoin racemase; KEGG:
FT                   reu:Reut_A0046 Asp/Glu racemase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4021"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29125"
FT                   /db_xref="InterPro:IPR026286"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHS4"
FT                   /protein_id="ACD29125.1"
FT                   /translation="MKKRIKLGMLTPSSNTALEPITSAMVSGLPNVSAHFSRFTVTEIS
FT                   LRDQALGQFDLENILNAAKLLADAHVDVIAWNGTSSGWLGFEKDEALCRQITEATGIPA
FT                   TTSVLALNEILAKTGARDFALVTPYLDDVQQRIVQNYARHGFKCVAERHLDLHVNHSFA
FT                   DVEEDTIRTLVREVAQQKPAAITTFCTNLRAAHLVEALEAETGIPVYDTISTVVWKSLR
FT                   LAGVDTRELHGWGRLFADVA"
FT   gene            291107..292522
FT                   /locus_tag="Rpic_4022"
FT   CDS_pept        291107..292522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4022"
FT                   /product="dihydropyrimidinase"
FT                   /EC_number="3.5.2.2"
FT                   /note="KEGG: reh:H16_A0068 D-hydantoinase; TIGRFAM:
FT                   dihydropyrimidinase; PFAM: amidohydrolase; Amidohydrolase
FT                   3"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4022"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29126"
FT                   /db_xref="GOA:B2UHS5"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR011778"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHS5"
FT                   /protein_id="ACD29126.1"
FT                   /translation="MSTELDLVIRNADVVTASDRFTCDIGVRDGRIAVLGNGLPRGVRE
FT                   LDASGLLALPGGVDGHCHLDQPMPDGMRMADDFFTGTRAAICGGTTTVIPFAAQEKGGS
FT                   LKAAVADYHRRAEGRAVADYGFHLIVADPTPEVLKHELPELIHQGYTSFKVYMTYDDLK
FT                   LSDREMLDVLDVAKQNNALVMVHAENADCISWLTEKLVGEGRISPRFHGLSRPAAVERE
FT                   ATHRAITFAELVDVPILIVHVSGKEAIEQIRWAQSRGLQILAETCPQYLYLTAEDMGLH
FT                   GDDGYEGAKCVCSPPPRDPENQAAVWRALAGGVFSVFSSDHAPFNYDDAQGKKLGGLAQ
FT                   PFDHIPNGVPGIETRLPLLFDGIARGKLSLHQFVELTSYRPARLYGLYPRKGTIAVGAD
FT                   ADITLWDPERRVRITNDALHHAVDYTPYEGIEVTGWPVHCFSRGELLVENGKYLEPAPG
FT                   RGQFLPAGAPSLV"
FT   gene            292553..293290
FT                   /locus_tag="Rpic_4023"
FT   CDS_pept        292553..293290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4023"
FT                   /product="Asp/Glu/hydantoin racemase"
FT                   /note="PFAM: Asp/Glu/hydantoin racemase; KEGG:
FT                   rme:Rmet_3885 Asp/Glu racemase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4023"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29127"
FT                   /db_xref="GOA:B2UHS6"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHS6"
FT                   /protein_id="ACD29127.1"
FT                   /translation="MRILVVNPNISESVTELIHAEARRSVSPGTTLTMATAPFGVAYIE
FT                   TRFEALVGGYATACVVAEHAGQFDGVVVAAFGDPGLAGIKELCNVPVVGMTEAALASAC
FT                   LLGQRFSIIAISNRIQAWYRECVAANGLSSRLASVRSLQQPLRDIGSVQEDHAARLEEL
FT                   SLQAVREDGADVIIVAGAPLAGLARTLKDRIPVPVVDGVSSAIRHCESLIALAPNGAAE
FT                   GSFTRPPHKPNRGLPPALAAMLA"
FT   gene            293536..293664
FT                   /pseudo
FT                   /locus_tag="Rpic_4024"
FT   gene            complement(293705..293872)
FT                   /locus_tag="Rpic_4025"
FT   CDS_pept        complement(293705..293872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4025"
FT                   /product="putative linoleoyl-CoA desaturase"
FT                   /note="KEGG: cvi:CV_2452 probable linoleoyl-CoA desaturase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4025"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29128"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHS7"
FT                   /protein_id="ACD29128.1"
FT                   /translation="MHHLFPTYSHWHYPALAARVAEVARAHALDYRALTYRELLTAQQT
FT                   FPRAMGQRPN"
FT   gene            complement(293966..294670)
FT                   /locus_tag="Rpic_4026"
FT   CDS_pept        complement(293966..294670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4026"
FT                   /product="cyclic nucleotide-binding protein"
FT                   /note="PFAM: cyclic nucleotide-binding; KEGG: bra:BRADO5261
FT                   putative transcriptional regulator with cAMP binding domain
FT                   belongs to HTH Crp family"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4026"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29129"
FT                   /db_xref="GOA:B2UHS8"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHS8"
FT                   /protein_id="ACD29129.1"
FT                   /translation="MAEHDTNSRPGISRARLAHIAAWSIDLPAEEADRACAGIVEKTYA
FT                   RGACICPKNTLLESWTGVVTGLIKIGTVSPEGRSVTFTGVPAGGWFGEGTVLKNEPRRY
FT                   DIVALRDTRMAFMERATFMWLVENSVAFNRFLVKQLNERLGHFMALLEYDRLLDVTPRL
FT                   ARCIASLFNPVLYPGAGDHLEITQEELGLLSGMTRQVANQSLKTLEKDGVVRLEYGGVT
FT                   VVDLDRLRSYGA"
FT   gene            complement(294663..295298)
FT                   /locus_tag="Rpic_4027"
FT   CDS_pept        complement(294663..295298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4027"
FT                   /product="DSBA oxidoreductase"
FT                   /note="PFAM: DSBA oxidoreductase; KEGG: bch:Bcen2424_5467
FT                   DsbA oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4027"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29130"
FT                   /db_xref="GOA:B2UHS9"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR014440"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHS9"
FT                   /protein_id="ACD29130.1"
FT                   /translation="MPATVDWFFDVISPFAYLQLEQFDALQKANDIVIRPRPLVLGAIL
FT                   HHWGQKGPAEISTKRVFTYRHALFRAQQLGIPFRMPPAHPFNPIKALRLTIAMGGSLDV
FT                   VRAVFRHIWRDGNDVASPEGFAALCEAVGFAEGAAAVEQPAVKDALRAHTDAAIALGVF
FT                   GVPTLVHEGELFWGEDATAMFLQSLRAGWLSTPEAQRVSTLPVGIQRG"
FT   gene            complement(295308..295982)
FT                   /locus_tag="Rpic_4028"
FT   CDS_pept        complement(295308..295982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4028"
FT                   /product="3-oxoacid CoA-transferase, B subunit"
FT                   /EC_number="2.8.3.9"
FT                   /note="KEGG: fal:FRAAL3149 acetyl-CoA:acetoacetyl-CoA
FT                   transferase, beta subunit; TIGRFAM: 3-oxoacid
FT                   CoA-transferase, B subunit; PFAM: coenzyme A transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4028"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29131"
FT                   /db_xref="GOA:B2UHT0"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR012791"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHT0"
FT                   /protein_id="ACD29131.1"
FT                   /translation="MQALPETPKQRIAARCAQELHPGEVVNLGLGIPTLTANYLDAEAG
FT                   VIFHTENGAFGFGGRPALDAIDSDFTNAGCEPITLMPGAALMDLATSLGAMRNGYIDVT
FT                   ILGALQVDALGNLANWACDRNGKWWPGIGGAMDLCYGTRKVIAALAHTDKHGNSKILPR
FT                   CTLPLTGRACVKVIVTEHAVFDVTDAGLVLREILSHATLDDIRAMTAAPFTLAPLLQMR
FT                   AA"
FT   gene            complement(296011..296775)
FT                   /locus_tag="Rpic_4029"
FT   CDS_pept        complement(296011..296775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4029"
FT                   /product="coenzyme A transferase"
FT                   /note="PFAM: coenzyme A transferase; KEGG: cbe:Cbei_2654
FT                   3-oxoacid CoA-transferase, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4029"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29132"
FT                   /db_xref="GOA:B2UHT1"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHT1"
FT                   /protein_id="ACD29132.1"
FT                   /translation="MRYANKVLSVDEAIAHVRSGSRLMLGEFVGAGEPACCIEALLASG
FT                   IGQLTLITNTPGLRGGFLKARLFSSGQLAEFIGTHVGTTDESTQAYLTDSVHVAEFFPM
FT                   GTWAEKVRAGALGLGGALVPVGVSILDQPGMFPKRGAPKQTLTVDGTTCFVEPPLRADV
FT                   SIIKGWRADTFGNVEFRGTALQNQRDIAMAGDYTIVEVNEIVEVGTIPPERVGCPGVFV
FT                   NAVVQGLSLDDQHALYRHHWTKLGRLPAAAEA"
FT   gene            297014..298231
FT                   /locus_tag="Rpic_4030"
FT   CDS_pept        297014..298231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4030"
FT                   /product="sodium/hydrogen exchanger"
FT                   /note="PFAM: sodium/hydrogen exchanger; KEGG: rso:RS03045
FT                   probable cation-efflux system transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4030"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29133"
FT                   /db_xref="GOA:B2UHT2"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHT2"
FT                   /protein_id="ACD29133.1"
FT                   /translation="MHVDTPLISTIIGGIVLAFIFGTIAQRLRLPPLVGYLMAGVVAGP
FT                   FTPGFVADQSLAPQLAELGVILLMFGVGLHFSMKELLAVKAIAIPGAIGQIALATLMGM
FT                   GLAWLLGWDWGPGLVFGLALSVASTVVLLKALEDRGIDNSHEGHIAVGWLIVEDLVMVV
FT                   TLVLLPALAGALGGAGSTAVGAWDIIKVLAVTLSKVVAFAALMLVVGRRVIPWMLERIV
FT                   MTGSRELFRLGVLATALGVAYGATVLFGVSFALGAFFAGMVLAESEFSQRAAEESLPLR
FT                   DAFAVLFFVSVGMLFDPSVLIEDPWAVLGTVLIVVVGKSLAAFAVVRAFGHGNRTALTI
FT                   SASLAQIGEFSFILIGLGISLEILPDRARGLLLSAAILSILLNPLMFALINRLKREVAP
FT                   EPATAD"
FT   gene            298275..298829
FT                   /locus_tag="Rpic_4031"
FT   CDS_pept        298275..298829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4031"
FT                   /product="NADPH-dependent FMN reductase"
FT                   /note="PFAM: NADPH-dependent FMN reductase; KEGG:
FT                   rso:RS03046 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4031"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29134"
FT                   /db_xref="GOA:B2UHT3"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHT3"
FT                   /protein_id="ACD29134.1"
FT                   /translation="MSNLTIGVIVGSLRKASFNRQLAQALSGLLPSGATAQFIEIGELP
FT                   LYNQDLDASLPEPVQRFKAAVAGVDALLFVTPEYNRGIPGVLKNAIDWGSRPYGQSVWD
FT                   GKPAGIAGASPGAIGTALSQAQLRNVLAAVGVKVLPLPEVFFHFAGEPFDAQGGVTDAR
FT                   TRQFLQGFVDRFVQWAGQKPA"
FT   gene            complement(299241..300083)
FT                   /locus_tag="Rpic_4032"
FT   CDS_pept        complement(299241..300083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4032"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4032"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29135"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHT4"
FT                   /protein_id="ACD29135.1"
FT                   /translation="MPRHTPIAHLHANRYVGGGGRQRHKWARAYALLCGGMHTPTESSA
FT                   IFSARSPRVAPFITEWYRRWGRCVRYICAAVWITFAGMAPWSPTGAAPKFAYPVTQRID
FT                   ASASLALPRTWGPLRLTSETPIPSIAATINSPFGPSRLVFAQQTVAPESFALVTVRKSD
FT                   FDKGTPGYLETLRPRDLAILLNHMESRVHGDRPAWAARLVRGKAPALQVLAGRRVLYWE
FT                   GEWSTSAARTVVVRGYAFFGNGAVYLLRIFGTASGSEPVEFAEEARFADLVAATFHTK"
FT   gene            300214..300921
FT                   /locus_tag="Rpic_4033"
FT   CDS_pept        300214..300921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4033"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   bch:Bcen2424_4519 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4033"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29136"
FT                   /db_xref="GOA:B2UHT5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHT5"
FT                   /protein_id="ACD29136.1"
FT                   /translation="MTTLNAYQQPIGAPLSSWTARPLPPHTPLAGRYCRLEPLDAARHA
FT                   DALFEAFSQAQDDRVWTYMVEGPFANVAAHRAYIERIAAKRDPLQYAVIDARNDQPVGT
FT                   LALMRVTPEHGVIEVGAVTFSPLLQRTPASTEAQFLLMKHVFEDLGYRRYEWKCDSLNA
FT                   PSRQTAQRLGFLFEGIFRQAVVYKGRSRDTAWFSIIDADWPQARAAFEQWLSPENFDED
FT                   GRQRASLAALRSA"
FT   gene            complement(300931..302544)
FT                   /locus_tag="Rpic_4034"
FT   CDS_pept        complement(300931..302544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4034"
FT                   /product="putative transmembrane protein"
FT                   /note="KEGG: rso:RS03125 probable transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4034"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29137"
FT                   /db_xref="GOA:B2UHT6"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHT6"
FT                   /protein_id="ACD29137.1"
FT                   /translation="MTSAASDALPPTVPTDPDRERAPSRNFFARHWRGDYSLARAYWLH
FT                   TALMQFGVVALSAGVTHALAHNAPARAASSALLVIYVMGLALWIWAVVGTWRSADREQA
FT                   RNRLAGLSNPWPLIAKVMIVLGAVGTCSRLINDGPRLVAHLRTALGEQAASPYAVMPQR
FT                   DGRAILFNGGINDGAADALEAALRKAPNATAVVLRSEGGWLREGTLVADVIRRHHLRTY
FT                   VERACASACTIAFLAGADRAAAPGARIGFHRPRAVGADHDQTPGATDSELWRAYSDAGL
FT                   PDAFVRRVQDTPFDQMWFPTAQELLANHVVTRTSPGGEYATMATQLNTREALAAELRSA
FT                   PLYATLERKYPAHFSRLIDTLGPELQRNVTDAQVVTLLREQTGKLYRALIPTAPDALLF
FT                   ANAQLTLEQAQALQRVSPEACVAYLDGTSGASAAAARLPRALVTREQALFSDLMQAADP
FT                   DHAPVVTRAQTLPVLQLAMAALPLNEQRVLTVPALRRTAPPAERCRALIGFSRSILALP
FT                   EAERALALRGMYADTSAPDA"
FT   gene            complement(302703..303215)
FT                   /locus_tag="Rpic_4035"
FT   CDS_pept        complement(302703..303215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4035"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RS03126 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4035"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29138"
FT                   /db_xref="InterPro:IPR025577"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHT7"
FT                   /protein_id="ACD29138.1"
FT                   /translation="MKGVLISEMAMQLSSPSVSTATAGASGSGTSSAPDIERLQRQLKN
FT                   LQKSMQDLPAQNLPPDQAREQAQLLSQQIQIVQAQIARLQAQNGLEQAETRLENRHNAS
FT                   KSASGTSTTDATTQARTTAKVTGSSTLSDARLQARHATQAQAAQAAHPASAEAITPAEP
FT                   PLVSVKA"
FT   gene            303474..304295
FT                   /locus_tag="Rpic_4036"
FT   CDS_pept        303474..304295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4036"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: mlo:mll6978 ABC-transport protein, ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4036"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29139"
FT                   /db_xref="GOA:B2UHT8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHT8"
FT                   /protein_id="ACD29139.1"
FT                   /translation="MLSSPPAASGRLHAGLPAVQLNQVSVRFGSFTAVQGVDLSIGEGE
FT                   FVAVVGPTGCGKSTLLNAVTGLLKPAGGTVSVFGEPLTGLNGKAGFMMQQDSLLPWKTA
FT                   LDNVALGLVFQGMPVDEARERARPWMKKVGLAGFEARYPHQLSGGQKKRISMAQTLILS
FT                   PKIVLMDEPFSALDVHTRHLMQSELLRLWQEDRKSLLFITHDLEEAIALADRVVVMSAG
FT                   PASRPVGDVGITLPRPRNVSEINMSDAFIRLYREIWSILGTEVEKSHAVQH"
FT   gene            304279..305109
FT                   /locus_tag="Rpic_4037"
FT   CDS_pept        304279..305109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4037"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: atc:AGR_L_1202 ABC
FT                   transporter (permease)"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4037"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29140"
FT                   /db_xref="GOA:B2UHT9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHT9"
FT                   /protein_id="ACD29140.1"
FT                   /translation="MPSSTNTMPAVGAQRTGLAHKTKIRLFQLAVVVLMFGSWEGLGRA
FT                   GVVDPFYFSMPSSIVARIWEWFTAGDIYTHLAITLAETILSFGIGTLLGISLGLWLGLS
FT                   RLAAEVLDPFIKVFNAIPRILLAPIFVMWFGLGLTSKVALGATMVLFITFFNTYQGVRE
FT                   VNPVILANARLLKASRISLLRHVYVPSATSWILSSLRASVGMAVMGAIVAEYLGSSAGL
FT                   GHLIAQAEGVFDATGVFSGIVVLSAFVIALDRSVDALEGKLLVWRPKVDPETSA"
FT   gene            305143..306147
FT                   /locus_tag="Rpic_4038"
FT   CDS_pept        305143..306147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4038"
FT                   /product="NMT1/THI5 like domain protein"
FT                   /note="PFAM: Substrate-binding region of ABC-type glycine
FT                   betaine transport system; NMT1/THI5 like domain protein;
FT                   SMART: extracellular solute-binding protein family 3; KEGG:
FT                   mlo:mll6979 ABC transporter, periplasmic substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4038"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29141"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHU0"
FT                   /protein_id="ACD29141.1"
FT                   /translation="MKRWISALLCAAVCSAANAAEPEKKDVSLSVGSMILNYMPVPLTQ
FT                   SLGNFQKEGLNVKVENFQAGGSKALQALIAGSTDAVVGFYDHTIHIQAQGKDIVSVALL
FT                   NVTPGIVLAVRPDLDIKSGKDLKGKKIGITAPGSSTDLFARYYAIKNGLQVNDVSYVAV
FT                   GSGAPGMVALDRKEIDALVNFDPVASLLEKRRAAKFLVDTRTDAGSNAVFGGRYPTATL
FT                   YVTRDFMTKNPETVQRLVNAFIRTLKWIDASTPEAIADKMPKEQQVGGRDVFVDALRHS
FT                   KPIFSKDGLMTDADAKVALTVLSSYDEKIRSARIDLAKTYTNRFVDQALKTVK"
FT   sig_peptide     305143..305202
FT                   /locus_tag="Rpic_4038"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 20"
FT   gene            306168..306962
FT                   /locus_tag="Rpic_4039"
FT   CDS_pept        306168..306962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4039"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="PFAM: regulatory protein IclR; Transcriptional
FT                   regulator IclR; KEGG: bam:Bamb_4808 transcriptional
FT                   regulator, IclR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4039"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29142"
FT                   /db_xref="GOA:B2UHU1"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHU1"
FT                   /protein_id="ACD29142.1"
FT                   /translation="MTAERQTTQNETTPAANEGDAATPGQSGVAALDRAFSILFAFRPG
FT                   DYALTLAELAARTGLYKSTILRLAGSLIQHRMLFRLEDGRYQIGAAPLMLGALYQRSMR
FT                   LGDVVLPHMRALAEATGEAVSLYIRERDVRVCLHRVDSNHSIRDHVREGDVLPLERGSG
FT                   GRVLCAFSGMQGATYDAIRRDHYYVSIGERDRETVGLSVPVFGAQQALRGALCLAGPAS
FT                   RIDGALLQSWRVPVLEHAAQITSTLGGDPAPLRLAAQLISKT"
FT   gene            307034..308221
FT                   /locus_tag="Rpic_4040"
FT   CDS_pept        307034..308221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4040"
FT                   /product="L-carnitine dehydratase/bile acid-inducible
FT                   protein F"
FT                   /note="PFAM: L-carnitine dehydratase/bile acid-inducible
FT                   protein F; KEGG: reh:H16_B2210 predicted acyl-CoA
FT                   transferase/carnitine dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4040"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29143"
FT                   /db_xref="GOA:B2UHU2"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHU2"
FT                   /protein_id="ACD29143.1"
FT                   /translation="MALPLAGLRVLDLSNVLAGPFCGYQLGLLGAEVIKVEVPGNGDLA
FT                   RRLGADPEQARRKMGASFVAVNAGKQSVTVNLKHPEGRAILLKLVAQADALIENYRPGV
FT                   MDRLELGYDVLREVNPRLVYCAISGFGKDGPLSGRPAYDQIIQGISGVMSVTGDDASAP
FT                   LRVGYPISDTVGGITAALAVTACLLGAQRTGQGCMVDVSMLESTLATMGWVVSNYLNAG
FT                   VTPQPMGNQNFTAAPSGTFTTGDGLINIAANEDKQFAALCRVVGHPELATDARFAERHA
FT                   RKEHRQQLNDALEAALAARPATEWEPLLIDAGVPAGLVLDVPGVLAHEQVTGRGFVTAF
FT                   PEAGQHVTRAGFRLSGEDPCPQTPAPMLSAHTDDWLTRLGYRHDQIEALRAEGAI"
FT   gene            308224..309078
FT                   /locus_tag="Rpic_4041"
FT   CDS_pept        308224..309078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4041"
FT                   /product="citrate synthase"
FT                   /note="KEGG: rme:Rmet_4144 citrate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4041"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29144"
FT                   /db_xref="GOA:B2UHU3"
FT                   /db_xref="InterPro:IPR002020"
FT                   /db_xref="InterPro:IPR016142"
FT                   /db_xref="InterPro:IPR016143"
FT                   /db_xref="InterPro:IPR036969"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHU3"
FT                   /protein_id="ACD29144.1"
FT                   /translation="MTTAPTQDAAGLAADYWRTDIIDIEPGRIHVRGYPIQELIGQIGF
FT                   AEMIWLMLRGELPAKRQAVLLEAALVASVDHGPHAPSIAIAKMATSCGLPLNGAMASAL
FT                   NALDDVHGGAGQQAVELFHDIEARMFDGASLEAATAAGVDAFIAAHGKYLPGFGHRFHP
FT                   VDPRAGRLLALVDEAAQDGVVGGRYAAIGRAIEALLSSRKGKPIPMNIDGATAVIYAEL
FT                   GFAAPLARGVFCLSRAVGILAHAWEQSGRGERNKGPMPRQLPYRYTGHATRHLAQAEPA
FT                   PAP"
FT   gene            309075..309971
FT                   /locus_tag="Rpic_4042"
FT   CDS_pept        309075..309971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4042"
FT                   /product="SMP-30/Gluconolaconase/LRE domain protein"
FT                   /note="PFAM: SMP-30/Gluconolaconase/LRE domain protein;
FT                   KEGG: pol:Bpro_4512 gluconolactonase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4042"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29145"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013658"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHU4"
FT                   /protein_id="ACD29145.1"
FT                   /translation="MTYFNWPVIETTVFAEMPVALRRPVPTEWSRANKGGAPVDCFLEG
FT                   PCWDAHGNLWLVDIPHGRILRVSSQGDWDVVAEYDGEPNGLALRHDGTLLIADYKNGLL
FT                   SLDPATGAVTPFLTRRNSERFKGPNDLIVARNGDVYFTDQGQTGLHDPTGRVYRLRTDG
FT                   RLDCLLANGPSPNGLVLTPDESALFVAMTRDNAVWRLPLLADGSTSKVGRFAQFYGTSG
FT                   PDGMAMDAAGHLFVAHASLGAVFVVSPHGEPLARIASCRGRTTTNVALTPDGHSLVITE
FT                   SATGTILRARWTPPPHD"
FT   gene            310832..311149
FT                   /locus_tag="Rpic_4043"
FT   CDS_pept        310832..311149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4043"
FT                   /product="flagellar transcriptional activator"
FT                   /note="PFAM: flagellar transcriptional activator; KEGG:
FT                   rso:RSp1413 transcriptional activator FlhD"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4043"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29146"
FT                   /db_xref="GOA:B2UHU5"
FT                   /db_xref="InterPro:IPR023559"
FT                   /db_xref="InterPro:IPR036194"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2UHU5"
FT                   /protein_id="ACD29146.1"
FT                   /translation="MDTQDIVSEISELNLTYLMLAQQMLAKDRDAALFRLGISEELADI
FT                   LLTMSPAQIVKLASTNMMLCRFRFDDHAILGLVTQPHRDKGLQQSQMSILLARQAVEQI
FT                   S"
FT   gene            311227..311787
FT                   /locus_tag="Rpic_4044"
FT   CDS_pept        311227..311787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4044"
FT                   /product="flagellar transcriptional activator FlhC"
FT                   /note="PFAM: flagellar transcriptional activator FlhC;
FT                   KEGG: rso:RSp1412 transcriptional activator FlhC"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4044"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29147"
FT                   /db_xref="GOA:B2UHU6"
FT                   /db_xref="InterPro:IPR007944"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHU6"
FT                   /protein_id="ACD29147.1"
FT                   /translation="MRHTSVMNEVEQIHLAAELISLGARLQLLEQETTLSRERLVKLYK
FT                   EIRGESPPKGMLPFSADWFLTWSPNIHSSIFLNIYRFLGENSRSTGVRRLISAYKLYQE
FT                   HIHVHEQEEVLSITRAWMMLKFFEGKMLHTVKCKRCTGHFVAHADDLHHDFVCGVCQPP
FT                   SRAGKKKRVAAPVDAIAEKTIDA"
FT   gene            312328..313188
FT                   /locus_tag="Rpic_4045"
FT   CDS_pept        312328..313188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4045"
FT                   /product="flagellar motor protein MotA"
FT                   /note="KEGG: rso:RSp1411 flagellar motor protein MotA"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4045"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29148"
FT                   /db_xref="GOA:B2UHU7"
FT                   /db_xref="InterPro:IPR000540"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="InterPro:IPR022522"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHU7"
FT                   /protein_id="ACD29148.1"
FT                   /translation="MLVAIGYIVILASVFGGYMLAGGHLGPLFQPTELLIIFGAGIGAF
FT                   VVGNDKKAINATVKALPGLFKGSKYTKALYMEVMALLYVVLSKIRREGMMSIEADIENP
FT                   HESTLFANYPAIQADHHALDFICDYLRLMVGGNLNPFQIEALMDQEIDTHHHEAEQPAR
FT                   IITKVGDAMPAFGIVAAVMGVVHTMGSVGLPPAELGKLIASALVGTFLGILLAYGFIGP
FT                   LGSLLEQRAEESTKLFQCIKVTLLASMNGYAPAIAVEFGRKVLFSTERPSFAELEDHVR
FT                   GAKTA"
FT   gene            313389..314336
FT                   /locus_tag="Rpic_4046"
FT   CDS_pept        313389..314336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4046"
FT                   /product="OmpA/MotB domain protein"
FT                   /note="PFAM: OmpA/MotB domain protein; KEGG: rso:RSp1410
FT                   flagellar motor protein MotB"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4046"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29149"
FT                   /db_xref="GOA:B2UHU8"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR025713"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHU8"
FT                   /protein_id="ACD29149.1"
FT                   /translation="MSKSSTPTFIVIRRNKKGGHGHHGGAWKIAYADFVTAMMAFFLLM
FT                   WLLSSVTKAELSSVETYFRTPLKVALFGGAGSGDQSSILQGSPALKQNMPQPNPSPSPT
FT                   VQRQRNIRDESDDAALNKLKQKIAEMVETNPVMSQFKHQLLIDMTTEGLRIQIVDQQNR
FT                   PMFANASAEVQPYMRTILRELGTALNDVPNPISLSGHTDATQYATQHGYSNWELSADRA
FT                   NASRRELVAGGMKPEKVSRVVGLEASVPLDKTNIYNPINRRISIVVLNARAAEAVRSGG
FT                   VEPVADLRNDGKDTLTDAAARATGVADAVTAAKP"
FT   gene            314362..314775
FT                   /locus_tag="Rpic_4047"
FT   CDS_pept        314362..314775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4047"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG: rso:RSp1409
FT                   putative chemotaxis response regulator transcription
FT                   regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4047"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29150"
FT                   /db_xref="GOA:B2UHU9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHU9"
FT                   /protein_id="ACD29150.1"
FT                   /translation="MSEKHILVVDDSTSIRRMIAACLRECGFAVTEAGDGSAALEAVRT
FT                   SAQGSHHLVITDQVMPSMDGLTLIRALRALPAYADTPILMLTTEADNSIRDQARAAGAT
FT                   GFLPKPFDPDGLTDSVMQLLEWHAQTHGSASTH"
FT   gene            314794..316968
FT                   /locus_tag="Rpic_4048"
FT   CDS_pept        314794..316968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4048"
FT                   /product="CheA signal transduction histidine kinase"
FT                   /note="PFAM: CheW domain protein; ATP-binding region ATPase
FT                   domain protein; Signal transducing histidine kinase
FT                   homodimeric; Hpt domain protein; CheY binding; KEGG:
FT                   rso:RSp1408 probable chemotaxis sensor histidine kinase
FT                   transcription regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4048"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29151"
FT                   /db_xref="GOA:B2UHV0"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004105"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR015162"
FT                   /db_xref="InterPro:IPR035891"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037006"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHV0"
FT                   /protein_id="ACD29151.1"
FT                   /translation="MNLDLSQFFGAFFEEAEELLVDMERLLLNLDVANPSSDDLNAIFR
FT                   CAHSIKGGAATFGFTHMTELTHVAESILDRARTGTLQLRENMVDAFLETKDVLKSQLDA
FT                   YRQEHPIDTATLEYMVAKLNSLTAEDGAPVAAAPAVAAPVAAAPEPVAAPQPAPVVVEA
FT                   PAAEVVGDIEGGLDIKLINVSNEDCELIVTELKHLGTVLRHARTGRNSDIVLQSTCTAD
FT                   DIIAVSCFIIDADQIVITPHVGGAAPAAEAAAPVVAAPTPAAAQTEVHAPAANEAAPAQ
FT                   AVAAAAVPVPVRPAAADQKPTVAAETSIRVGVEKVDQLINLVGELVITQAMLAQTAQAF
FT                   DPVLNERLFAGLSQLTRNARDLQEAAMSIRMMPMDYVFNRFPRLVRDLAHKLGKQVELS
FT                   TFGKSTELDKGLIERIIDPLTHLVRNSLDHGIELPEARVAAGKDATGQLLLSAAHQGGN
FT                   IVIEVSDDGQGLNRDKILKKARERGLPVSDNMTDDEINQLIFAPGFSTADQVTDVSGRG
FT                   VGMDVVKQNIQSMGGYVEIQSQKGKGTTIRIVLPLTLAILDGMSVKTGDEVFILPLSCV
FT                   AESLQPRPEDIKAVPGGGRLLKVRNEYLTLVPMYERFRITPSLPDPSEGIVVILDSEGK
FT                   KIALQVDELVGQQQVVVKNLETNYRRVPGISGATILGDGSVALIVDVSALMRETRSGHS
FT                   ENAMRAVTAEKHELGEPQGGRFSTEAMAAA"
FT   gene            317049..317540
FT                   /locus_tag="Rpic_4049"
FT   CDS_pept        317049..317540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4049"
FT                   /product="CheW protein"
FT                   /note="PFAM: CheW domain protein; KEGG: rso:RSp1407
FT                   probable chemotaxis protein CheW"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4049"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29152"
FT                   /db_xref="GOA:B2UHV1"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR039315"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHV1"
FT                   /protein_id="ACD29152.1"
FT                   /translation="MEVKKHAIGDDTGGEEYLAFTLGREEYGIDILKVQEIRGYETVTR
FT                   IANAPDFIKGVINLRGIIVPIVDLRIKFQLDRVEYNQYTVVIILNLMDRVVGIVVDGVS
FT                   DVLTLQSQQIKPAPEFSGALDTEYIRGLGSIDERMLILVDIERLLLSADMALCDEAEAA
FT                   "
FT   gene            317664..319511
FT                   /locus_tag="Rpic_4050"
FT   CDS_pept        317664..319511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4050"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: histidine kinase HAMP region domain protein;
FT                   chemotaxis sensory transducer; KEGG: rso:RSp1406 probable
FT                   methyl-accepting chemotaxis I (serine chemoreceptor
FT                   protein) transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4050"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29153"
FT                   /db_xref="GOA:B2UHV2"
FT                   /db_xref="InterPro:IPR003122"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR035440"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHV2"
FT                   /protein_id="ACD29153.1"
FT                   /translation="MFSKMTIRLRLGLMMAGIGVLAVIVGLTGLIGMRHANTRVQDGYA
FT                   VQLAGTVALAESDSNLLSFRIVLDRAAMAPNAPGMEKTIERAQMFLDKSDAAWKRYRAL
FT                   PTPADERKLADEAQGLRDVFLRDGAQVLMQAVQAHDEARINKTVMDVMPALYRPLGDKV
FT                   AALNRLQMDVAKTSYEASQAEQRNLSALTTGLLLGGILVGGLLTWALRRSITLPLMRAI
FT                   ETAEHITQGDLTHTIQVDRADETGRLLRALQRMQDSLQKMVGQVRSGSDSIASTTQQIA
FT                   AGNADLSQRTEQQASALEETASSMEELTSIVRQNADNARQASTLAGNASDIAVKGGEVV
FT                   GRVVDTMAGINASSKKIADIIGVIEGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEV
FT                   RSLAQRSATAAKEIKELISDSVGRVENGTTLVAEAGSVIDEVVVAVKRVTDIMGEISSA
FT                   SDEQSAGIEQVNQAVTQMDEGTQQNAALVEQAAAAAMSLQEQASALRQAVEAFRTQAGA
FT                   QANVVPAVSVAARVAAKPALKAKAVPSRAAKPKAAAGSNTAEPIAQTGAATAAPASAKE
FT                   QQRERTAAAAETKAAASAPKLPVPKLVAAGGDDSDWETF"
FT   sig_peptide     317664..317774
FT                   /locus_tag="Rpic_4050"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.920 at
FT                   residue 37"
FT   gene            319736..321640
FT                   /locus_tag="Rpic_4051"
FT   CDS_pept        319736..321640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4051"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: histidine kinase HAMP region domain protein;
FT                   chemotaxis sensory transducer; KEGG: reu:Reut_B5602
FT                   histidine kinase, HAMP region:bacterial chemotaxis sensory
FT                   transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4051"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29154"
FT                   /db_xref="GOA:B2UHV3"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHV3"
FT                   /protein_id="ACD29154.1"
FT                   /translation="MGWIKRLPVSTVLTGGFLIVAAMGAAIGGLGIYTITQLTKASEEL
FT                   AQKQMRAITQMGSAANSLAHASRAQTALLIATTLTERKTLSTQIADSMQHLKDGVENVR
FT                   PLFTSDEGKKMIREVDAIYPVWGKRMTDFVALMDKQGLDPTQFDSRVTAENVGLLDDTA
FT                   AFEKTLDKMVKRVEEVSAASTVKARDDAHRSRLVMMVMACAGALLGIVLGLVIARRLSR
FT                   QLGGEPSYAAEIARRIAAGDLAVHVQTRPGDHGSMLFAMAQMQQQLTGTITNIKSSADS
FT                   IASATKQIAAGNADLSQRTEEQASSLEETASSMEELTSIVKQNADNARQASQLAGSASD
FT                   IAVKGGEVVGRVVETMAGINASSKKIADIIGVIEGIAFQTNILALNAAVEAARAGEQGR
FT                   GFAVVAGEVRSLAQRSATAAKEIKELIGDSVGRVRNGSALVAEAGTVIEEVVVAVRRVT
FT                   DIMGEISAASDEQSSGIEQVNQAVNQMDEVTQQNAALVEQAAAAALSLEEQAQLLRNAV
FT                   ATFRTDASAELAVAAPIAVAAPAVPGEARPHKTEVVPSVARALASRKAAKPAVLPEAAP
FT                   EQVAGPAAEQGEKAPHDAHAPIVPVAAAVVSAAASEAVVAPALKLTTGSADEDDWSTF"
FT   sig_peptide     319736..319810
FT                   /locus_tag="Rpic_4051"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.978) with cleavage site probability 0.731 at
FT                   residue 25"
FT   gene            321744..322625
FT                   /locus_tag="Rpic_4052"
FT   CDS_pept        321744..322625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4052"
FT                   /product="MCP methyltransferase, CheR-type"
FT                   /EC_number="2.1.1.80"
FT                   /note="PFAM: MCP methyltransferase CheR-type; KEGG:
FT                   rso:RSp1405 probable chemotaxis protein methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4052"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29155"
FT                   /db_xref="GOA:B2UHV4"
FT                   /db_xref="InterPro:IPR000780"
FT                   /db_xref="InterPro:IPR022641"
FT                   /db_xref="InterPro:IPR022642"
FT                   /db_xref="InterPro:IPR026024"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036804"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHV4"
FT                   /protein_id="ACD29155.1"
FT                   /translation="MAAQNLAPVSPTLASREFSFTAEDFGRIRDLIYRRVGISLSDRKS
FT                   EMVYSRLARRLRVVNLGSFRDYLDALEKGHLPDEWEAFTNALTTNLTAFFREQHHFPIL
FT                   HEHAKAKRTPFTVWCSASSTGEEPYSIAITLAEAFGSMSPSQVSVIASDVDTNALARAR
FT                   AGIYPMERVAALSPERLKKYFLRGTGKHEGYARVRPELQAMIDFRQINLLDRDWPLQQK
FT                   FDVIFCRNVMIYFDKPTQAKILEHFIDVMKPDGLLFAGHSESFLQVTKAWSLRGKTVYE
FT                   IAPELRARMGAR"
FT   gene            322622..323332
FT                   /locus_tag="Rpic_4053"
FT   CDS_pept        322622..323332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4053"
FT                   /product="CheD"
FT                   /note="stimulates methylation of MCP proteins; PFAM: CheD
FT                   family protein; KEGG: rso:RS02054 probable chemotaxis
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4053"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29156"
FT                   /db_xref="GOA:B2UHV5"
FT                   /db_xref="InterPro:IPR005659"
FT                   /db_xref="InterPro:IPR011324"
FT                   /db_xref="InterPro:IPR038592"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2UHV5"
FT                   /protein_id="ACD29156.1"
FT                   /translation="MIEFGKRATPQSAADAVRGDSGMASGMSAGAMATLAQSAASTHAY
FT                   YDTTFSRRAMKVLPGEYSVTTEDLMLVTVLGSCVSACVRDKTLGIGGMNHFMLPSRNEG
FT                   ESILSPSMRYGTHAMEVLLNQLYKAGAKRERLEIKVFGGAAVLAGMSTLDVGERNGKFV
FT                   LEFLRNEGLTVAAKDLFDVHPRKVYFVPSTGQIMVRKLRSQNSAAELDSEAQYASKLSK
FT                   SITTKPASRLQLFT"
FT   gene            323356..324483
FT                   /locus_tag="Rpic_4054"
FT   CDS_pept        323356..324483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4054"
FT                   /product="response regulator receiver modulated CheB
FT                   methylesterase"
FT                   /EC_number="3.1.1.61"
FT                   /note="PFAM: CheB methylesterase; response regulator
FT                   receiver; KEGG: rso:RSp1403 chemotaxis-specific
FT                   methylesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4054"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29157"
FT                   /db_xref="GOA:B2UHV6"
FT                   /db_xref="InterPro:IPR000673"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR008248"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035909"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHV6"
FT                   /protein_id="ACD29157.1"
FT                   /translation="MNDKRKIQVLCIDDSALIRSILKEIINSQPDMEVVGVAPDPIIAR
FT                   DLIKQTNPDVLTLDVEMPKMDGLDFLEKLMRLRPTPVVMISSLTERGSEATLRALELGA
FT                   VDFVAKPKLGMRDGMNEYADQIADKIRAAARAKLRPRTAAPVAAAGSATASTPGAHVRA
FT                   EHAPATPALARTHFSSTEKLIIVGASTGGTEAIKDFLLEMPPDCPGILIVQHMPAGFTT
FT                   SFAKRLDGLCRIRVKEAAHGERVLPGHAYIAPGDMHLSLGRSGANYVTELDQGPPVNRH
FT                   RPAVDVLFRSAARNAGANALGVILTGMGKDGAVGMLEMRNAGAYNVAQDEASCVVYGMP
FT                   KEAVAHGGVHEVLPLSQIGPHVLAKLSAHGRVTRV"
FT   gene            324633..325034
FT                   /locus_tag="Rpic_4055"
FT   CDS_pept        324633..325034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4055"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG: rso:RSp1402
FT                   probable chemotaxis response regulator transcription
FT                   regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4055"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29158"
FT                   /db_xref="GOA:B2UHV7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHV7"
FT                   /protein_id="ACD29158.1"
FT                   /translation="MDKSQYRFLVVDDFPTMRRIVRNLLKELGFANVDEAEDGAAGLAK
FT                   VKEGRFDFVISDWNMPNMDGLQMLQSIRADANTAISKLPVLMVTAEAKKENIIAAAQAG
FT                   ANGYVVKPFTAATLDEKLGKIFEKLEKGA"
FT   gene            325034..325702
FT                   /locus_tag="Rpic_4056"
FT   CDS_pept        325034..325702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4056"
FT                   /product="chemotaxis phosphatase, CheZ"
FT                   /note="PFAM: Chemotaxis phosphatase CheZ; KEGG: rso:RSp1401
FT                   chemotaxis regulator CheZ"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4056"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29159"
FT                   /db_xref="GOA:B2UHV8"
FT                   /db_xref="InterPro:IPR007439"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHV8"
FT                   /protein_id="ACD29159.1"
FT                   /translation="MSEMHDGAQALAAEGVDHGDMPEMLQRIGHLTRMLRESMRELGLD
FT                   KGVEKAASAIPDARDRLNYIANMTEQAATRVLNAIDAARPVQDALESDSQALVNRWQSW
FT                   MDRQLGDDEIRELVGQTNGFLRSVPEKTRDTNQQLMEILMAQDFQDLTGQVIKKVLDVV
FT                   QLIESQLVGILLDNAPEHLRVEAAQVATSLLNGPQINPDHPDVVANQEQVDDLLESLGF
FT                   "
FT   gene            complement(325778..326818)
FT                   /locus_tag="Rpic_4057"
FT   CDS_pept        complement(325778..326818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4057"
FT                   /product="ApbE family lipoprotein"
FT                   /note="PFAM: ApbE family lipoprotein; KEGG: rso:RSp1366
FT                   probable thiamine biosynthesis ApbE transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4057"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29160"
FT                   /db_xref="GOA:B2UHV9"
FT                   /db_xref="InterPro:IPR003374"
FT                   /db_xref="InterPro:IPR024932"
FT                   /db_xref="InterPro:IPR042159"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHV9"
FT                   /protein_id="ACD29160.1"
FT                   /translation="MHPLPPSNLGRRRCLAGVPLLAVGMFVRPALADPTVERASTQLLG
FT                   TQIDIIAQDARPGAAGAAMRAAFVEMARLECLMSRYRPDSQVSALARAAGRNPVPVAPE
FT                   VMSVFKLARQVSEQSRGAFDITVGAYSGWNFDPEHSRIPSSSELARERRFVNYRDVVLD
FT                   ERHGSVYLRRPGMRLDLGGIAKLPILEAGMRVLRQHGIRDAMINGGGDVVASGKLQGHE
FT                   WRVGLRDPLAPERLLGVVTLSDGVVASSGDYERYFMHNGQRFHHVLDPETGLPAHGPHG
FT                   VTLVSRDVDDVNGLGAAIMAAGTATGQRMLAPMLARVDALIVGSGVRPWMSAGMATRLR
FT                   QFSASS"
FT   sig_peptide     complement(326720..326818)
FT                   /locus_tag="Rpic_4057"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 33"
FT   gene            complement(326823..327245)
FT                   /locus_tag="Rpic_4058"
FT   CDS_pept        complement(326823..327245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4058"
FT                   /product="cytochrome c class I"
FT                   /note="PFAM: cytochrome c class I; KEGG: rso:RS02091
FT                   probable lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4058"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29161"
FT                   /db_xref="GOA:B2UHW0"
FT                   /db_xref="InterPro:IPR002323"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHW0"
FT                   /protein_id="ACD29161.1"
FT                   /translation="MRTKTTLGLMLICGAVLAACGQKEPAAPAASTAAAPAPVQTSTPP
FT                   AATTVAAAAEPENALGKRTFANVCSMCHAAGVAGAPKPGDKADWGPRIAQGKDTLYKHA
FT                   LEGFNGNKGAMPARGGSTLPDDAIKAAVDYMVAKSQ"
FT   sig_peptide     complement(327180..327245)
FT                   /locus_tag="Rpic_4058"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.507 at
FT                   residue 22"
FT   gene            327484..329433
FT                   /locus_tag="Rpic_4059"
FT   CDS_pept        327484..329433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4059"
FT                   /product="Nitrous-oxide reductase"
FT                   /EC_number="1.7.2.4"
FT                   /note="PFAM: cytochrome c oxidase subunit II; KEGG:
FT                   rso:RSp1368 nitrous-oxide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4059"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29162"
FT                   /db_xref="GOA:B2UHW1"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011045"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR023644"
FT                   /db_xref="InterPro:IPR028096"
FT                   /db_xref="InterPro:IPR034205"
FT                   /db_xref="InterPro:IPR041114"
FT                   /db_xref="InterPro:IPR041142"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHW1"
FT                   /protein_id="ACD29162.1"
FT                   /translation="MMTKHQQSPSTQQEEALSVPGRRRFMNSAALAGLATVVACTDKGT
FT                   PAAAPAASASAPTATAAGEHVIAGLHPKPGELDTYYGLWSGGHTGDMRVMGMPSGREIH
FT                   RIPMFVPDALVGWGITNESKKVMGTKPDGSLRYTVGDTHHVHASYKDGNYDGRYAWIND
FT                   KINSRLGRVRLDYFICDKITELPNVQGFHGIFPDKRDPLDPKINYTTRVFCGGEFAIPL
FT                   PNTAGIDDPSKYRSLFTCVDAETMEVRWQVLIDGNCDLVATSYDGKLAATNQYNTEMGV
FT                   HYEDMMSAERDACLFFNVARIEAAVKAGKFKTIGDSKVPVVDGTHAANQDPKTALTAYV
FT                   SVPKNPHGVNASPDQKYFVCAGKLSPTGTVIELSRVLDWFDGKLAKIDDAIVAEVELGL
FT                   GPLHTAFDGRGNAYTTLFLDSQIVKWNIDAAIKFHNGDKNAKYVVDRLDVHYQPGHLSA
FT                   SQSETMAADGKFLAVGCKFSKDRFLPVGPLHPENEQFIDISGDKMVLLQDHPIRSEPHD
FT                   FIIFKRELLHPKQVYSLDDFPLATKDPKQSGVVRNGKKVTVRLTSQAPAYSLREFKLKK
FT                   GDEVTLILTNLDKVEDLTHGFAIPKYNINFIVNPQETASVTFIADKPGVFWCYCTHFCH
FT                   ALHLEMRSRMIVEA"
FT   gene            329452..332115
FT                   /locus_tag="Rpic_4060"
FT   CDS_pept        329452..332115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4060"
FT                   /product="FMN-binding domain protein"
FT                   /note="PFAM: FMN-binding domain protein; KEGG: rso:RSp1369
FT                   probable transmembrane regulatory NosR transcription
FT                   regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4060"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29163"
FT                   /db_xref="GOA:B2UHW2"
FT                   /db_xref="InterPro:IPR007329"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHW2"
FT                   /protein_id="ACD29163.1"
FT                   /translation="MPRAGPRVPMNSKMPSRKQGFAAWVAVFLLMLLVGVQPAQAGRGA
FT                   YEAELPANLAEAKDLCALVPCADVFPGAVRFSERMGQPPYVEAYGAAQGGKAALLGYVM
FT                   LSTDITDIPAYSGKPVVTLIGMDRQGRYVGIKVLKHSEPILLLGIPESALLNFNKQYIG
FT                   KSVKDKIEVGQSRPDEGVLGVDAISGATVTVIAQNQVLATATSSVARQVGILAPTRHEP
FT                   ARYAQTGQRASWAELVKQGSVQRLLIRPEQLGLERAPEPFIELWFGDLNHPDLGASLLG
FT                   QSVWNDLHAQLKQNEHAIFVIRTAGAASFKGSGFVRGGIYDRIQIKQGAESFTFRDSDY
FT                   LNLYGLAAPGAPAYTESAIFVVRSPAFSAAYPWKLSFLGNRVDRATGTRSFVTFDAPYW
FT                   LPETLLQGGHPHIDEPEAPWRRVWRTRAPQIALFIVLLVSVSVVYALRERLTRRSTHKN
FT                   KWPVNAFKYTAWALSIGFVGFGAMAQPSITQVLTWFHSLLFQWTWSLFLTDPFIFCFWI
FT                   FIILTVFLFGRGLFCGWLCPFGSLSEALYKIGGRLGLKRWQRHLPRAWHDKLKWLKYAI
FT                   FFGLLTVSVFSMGLAEKLAEVEPFKTTFLVGISHRAWPYGLFVCTLLGISLFVERPYCK
FT                   YICPLGAALAMPSTFRWFGLRRKQDCNSCKACAVGCGSLAIDADGRIDHRECLHCLDCM
FT                   VLYTDVKGCPPLAKERKRRERDGLEITPIGKDGYFIPIQPVPVPMNPRVAQGPDPRMPT
FT                   DRVVPTGREGARGLRWLMLELRDHLWPWSSNGWRSARGLQIAGASLALAASVAWILAAT
FT                   GHLSSGAVIAWWFGWSLYEVLIRLAGRRYVKDGPWWQANYRRATVMDMLSYVGFKNLLI
FT                   GAMLFLTLKALGWLQV"
FT   sig_peptide     329452..329577
FT                   /locus_tag="Rpic_4060"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.989) with cleavage site probability 0.985 at
FT                   residue 42"
FT   gene            332112..333407
FT                   /locus_tag="Rpic_4061"
FT   CDS_pept        332112..333407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4061"
FT                   /product="periplasmic copper-binding"
FT                   /note="PFAM: periplasmic copper-binding; SMART: Parallel
FT                   beta-helix repeat; Carbohydrate-binding and sugar
FT                   hydrolysis; KEGG: rso:RSp1370 probable copper-binding
FT                   periplasmic NosD signal peptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4061"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29164"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR006633"
FT                   /db_xref="InterPro:IPR007742"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR022441"
FT                   /db_xref="InterPro:IPR026464"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHW3"
FT                   /protein_id="ACD29164.1"
FT                   /translation="MRWLPVLLVVCGWLAAVQGAHASAATTVRVAAGQSLQAAIDAAHP
FT                   GDVLEIERGTYTGNLIVNKPLTLRGLDRPTLSGGQRGDTIRIGAPDVVIEGLIVRDSGD
FT                   SLKEQNAGINILPGAHRAVVRQCELTYNLFGLWIEKANDVRIEANTITGKRDYNSAQRG
FT                   NGVELYNTQGARIIGNNISFVRDALYVDVSHHAVFKGNRLHHSRYGTHYMNSYYNLWED
FT                   NDSYANRGGLALMEVRDQIVRNNRTWGNADHGIMLRTLQDSVVENNVVADNDRGFFIYD
FT                   VEYTQLRGNLIVGNQVGVHLSAGSTRNVVQGNDFIGNREQVRYVGARDEAWGARTAAER
FT                   AQGNFWSDYLGWDRDGDGIGDVPYEANDVVDRLIWRHPGVQLLLASPAVQALRFVSRQF
FT                   PILRVPSVVDAYPRMQPANPHWSTWRDRSPSR"
FT   sig_peptide     332112..332180
FT                   /locus_tag="Rpic_4061"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.748 at
FT                   residue 23"
FT   gene            333385..334341
FT                   /locus_tag="Rpic_4062"
FT   CDS_pept        333385..334341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4062"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: rme:Rmet_4914 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4062"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29165"
FT                   /db_xref="GOA:B2UHW4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHW4"
FT                   /protein_id="ACD29165.1"
FT                   /translation="MTDPLHVDETAAISLRGVCKHYGAVRAVDGVDLDVGYGELFGLIG
FT                   HNGAGKSTLFKMMLGLIPATAGSIRVAGASVRGAAFRAARRQIGYLPENLVLYDNLSGL
FT                   ETLRFFAKLKGAPAADCASLLARVGLAGAVDQPVRAYSKGMRQRLGFAQALLGAPRVLF
FT                   LDEPTNGLDPAAIHDFYATLQALREQGVTILITSHILAELQQRIDRLAILADGRVLALG
FT                   SVAALRAQADLPLTLALRVEAGARGALWAQLAPLRAHGAEIVDGQAEHEVMLRCSRSLK
FT                   MDVLQALQPLGGRLLDLQIHEPSLEDVFFGLRQTEAA"
FT   gene            334338..335162
FT                   /locus_tag="Rpic_4063"
FT   CDS_pept        334338..335162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4063"
FT                   /product="putative NosY transmembrane protein"
FT                   /note="KEGG: rso:RSp1372 probable NosY transmembrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4063"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29166"
FT                   /db_xref="GOA:B2UHW5"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHW5"
FT                   /protein_id="ACD29166.1"
FT                   /translation="MIGIEYRQVAAVAAKELRDRLRNRWVLAVAVVFAVFSLVISYFGG
FT                   AEQGTLGPRSIEFVITSLVSLVIYLIPLIALLLGFDAVVGERERGSLDLLLALPLTRVE
FT                   LLLGKYLGLAAALTLSTLGGFALMAVLLWHQFGSAGLYQAAGFVLSSVLLGLVFLSLAL
FT                   FVSVVSRERTRASGAAIALWFGFVLIFDLLLLGLLVATGGSFGGQALAYLLLLNPTDIF
FT                   RILNVFSLDQLRGLHGLVSIVPPALGNPWAMGAAMLAWIAAPLALAAWRFRA"
FT   gene            335159..335689
FT                   /locus_tag="Rpic_4064"
FT   CDS_pept        335159..335689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4064"
FT                   /product="NosL family protein"
FT                   /note="PFAM: NosL family protein; KEGG: rme:Rmet_4912 NosL"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4064"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29167"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008719"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHW6"
FT                   /protein_id="ACD29167.1"
FT                   /translation="MNPDRRRLLAAALAGSAALIGLAACGRQAEATLVPAEADAATTCD
FT                   LDGMLVADYPGPKAQLYYQGDATPHWCCDTVEMFNTLLKPEQARPIRAALVQDMGQADW
FT                   EHPRGHWFDAKTGYYVFGSRRRGSMGPTVASFRLEADARAFIARDGGKLLRYAEVTPDM
FT                   VDLSGGALHDGRM"
FT   sig_peptide     335159..335248
FT                   /locus_tag="Rpic_4064"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.717 at
FT                   residue 30"
FT   gene            335692..336294
FT                   /locus_tag="Rpic_4065"
FT   CDS_pept        335692..336294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4065"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rme:Rmet_4911 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4065"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29168"
FT                   /db_xref="InterPro:IPR008719"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHW7"
FT                   /protein_id="ACD29168.1"
FT                   /translation="MRLRRSGLMTVALLAASLWWYGVYASRRVEPEIPTEICFVAAPTP
FT                   YDPRSGTAPDAPRAIPLNARCPVCGAFPSRAPDWAAQVIFADGDAYFFDSPLSLFIYLR
FT                   NLPRYAAGRKSADIAAAYVRAVGDGRWIAALQAVYVWGSDVPGPMRRGNLPAFRNHTDA
FT                   RDFITRHGGSVTGSAGITAERLRALEPSQPHPAGRHT"
FT   sig_peptide     335692..335769
FT                   /locus_tag="Rpic_4065"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.839) with cleavage site probability 0.668 at
FT                   residue 26"
FT   gene            336488..337651
FT                   /locus_tag="Rpic_4066"
FT   CDS_pept        336488..337651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4066"
FT                   /product="flagellar biosynthetic protein FlhB"
FT                   /note="TIGRFAM: flagellar biosynthetic protein FlhB; PFAM:
FT                   type III secretion exporter; KEGG: rso:RSp1394 probable
FT                   flagellar biosynthetic FlhB transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4066"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29169"
FT                   /db_xref="GOA:B2UHW8"
FT                   /db_xref="InterPro:IPR006135"
FT                   /db_xref="InterPro:IPR006136"
FT                   /db_xref="InterPro:IPR029025"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHW8"
FT                   /protein_id="ACD29169.1"
FT                   /translation="MSEESDLEKTEPASPRRLEQAREEGDVPRSRELASFALTAVSAGG
FT                   LWVMGDSIVRAASSFLARCLEFHRYNYTSGQDQWNYVTGQFMPLAMTLGGLMLMLVIAA
FT                   LSPLALTRGAISFKPLSPDISRLFKLQGLTRMFSLEGLMELPRLLIKLFLIAGVGWLLV
FT                   RYYRGDLIELPQQDLGVAMRDTLHVAGVAFLCMAAVMMLVAAVDVPLSLWQYARKHRMT
FT                   KEEVRKEHRESEGDPHVKGRIRNLQRQAAQRRMMADVPKADVIVTNPTHYAVALRYSEK
FT                   EGGAPRVLAKGADMVAAKIRELGTEHKIPILEAPPLARALYRHTEIGHQIPEALYAAVA
FT                   EVLAYVYQLRRLHQVGGRVPVRPTDLPVPAELDPGPQPGPDDEPEDA"
FT   gene            337945..340071
FT                   /locus_tag="Rpic_4067"
FT   CDS_pept        337945..340071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4067"
FT                   /product="flagellar biosynthesis protein FlhA"
FT                   /note="TIGRFAM: flagellar biosynthesis protein FlhA; PFAM:
FT                   type III secretion FHIPEP protein; KEGG: rso:RSp1393
FT                   probable flagellar biosynthesis FlhA transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4067"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29170"
FT                   /db_xref="GOA:B2UHW9"
FT                   /db_xref="InterPro:IPR001712"
FT                   /db_xref="InterPro:IPR006301"
FT                   /db_xref="InterPro:IPR025505"
FT                   /db_xref="InterPro:IPR042193"
FT                   /db_xref="InterPro:IPR042194"
FT                   /db_xref="InterPro:IPR042196"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHW9"
FT                   /protein_id="ACD29170.1"
FT                   /translation="MNAALLRVTDILRKGDYRSAAGPVLIILILAMMVLPLPPFILDLL
FT                   FTFNIALSIIVLLISMHTLKPLDFSSFPSILLITTLMRLSLNVASTRVVLMEGHTGPDA
FT                   AGKVIEAFGHFLVGGNYTVGIVLFVILVIINFMVISKGAGRIAEVSARFTLDAMPGKQM
FT                   AIDADLNAGLIREDEARRRRTEIAQEAEFFGSMDGASKFVRGDSVAGIAILLINIVGGL
FT                   AVGVLQHGMDVGHAATNYTLLTIGDGLVAQIPALVISTAAGIMVSRVSTDKDVGQQLSS
FT                   ELFAMPTVLMTTAGVLGLLGLVPGMPHFPFILFGGGLGYLGWYLKKKREVPEIEPVLQA
FT                   IAPVDTPEASWDDVSWVDVLGLEIGYRLIPLVDKSQDGELLRRIKGIRKKFTQDMGFLA
FT                   PVVHIRDNLELGPSSYRITLKGVEIGHGEVQQGKFLAINPGGQDGMGGHGGMGGLGGRL
FT                   GTQLPGTPTVDPTFGLPAMWITADVRDRAQAEGYTVVDCSTVIATHVNQLIYTHSTELL
FT                   GRLEVQQLLDHLGKEAPKLVEDVVPKLLPVATVQKVLQNLLDEGLHIRDIRTIVETLAE
FT                   HGGRTQDPAELTAAVRVALGRAIAQQLFPNKTEMQVVTLDPNLENILLQSVVGSNAGPI
FT                   EPQLADSLMQAAADSSRQHEQMGQTGVLLVPPALRPMLARLFKRAAPSLRVLSHAEIPD
FT                   HRTIKVVAMLGGRA"
FT   gene            340068..341966
FT                   /locus_tag="Rpic_4068"
FT   CDS_pept        340068..341966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4068"
FT                   /product="GTP-binding signal recognition particle SRP54
FT                   G-domain"
FT                   /note="PFAM: GTP-binding signal recognition particle SRP54
FT                   G- domain; SMART: AAA ATPase; KEGG: rso:RSp1392 flagellar
FT                   biosynthesis regulator FlhF"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4068"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29171"
FT                   /db_xref="GOA:B2UHX0"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR020006"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHX0"
FT                   /protein_id="ACD29171.1"
FT                   /translation="MKMHRFTGLTSRDVLRKVRDQLGDGALILSNRAIPGGIEIIAASD
FT                   SHVDALVDTQSSAPKTAQRRPMAPAPIPEPAPIAAATAAVAAAHAPAEEAAQAEAPAPN
FT                   ALARLRNRFIASRRAPAQEDAPAAPAAPVAKPAGRTLQTRVDDDVAFGEEDALAASTRM
FT                   LAGLSLDRANAEVAQSAAQALASTAQFIARRSTVEDDQPEMESTARFAARREQAREQDD
FT                   RPVTLRSFTERVEAQARTLRAEQQKTEAPMKARIEAQAEAGTSSDIFVRVEDTMVKPEA
FT                   PRDDVSLQRSAFQADVKESIRAETDVMTRRMVGEIETLKSTLNDAMSSLASLGVKLGDP
FT                   VRTRLFQTMLNAGFSAQLTRYVLENMPQHDAYEGALDFVQRAIEKNLSTVSDENSLLDQ
FT                   GGVFALMGPTGVGKTTTTAKLAARFVLRHGASRVALLSTDSYRIGGHEQLRIYGKILGV
FT                   SVHAVKDAQDLSLALNDLREKHVVLIDTIGMSQRDRAVSEQMAMLHAVGPSIKRLLLLN
FT                   AASNGKTLDEVVGAYRDANLAGCILTKIDEAASVGHAMDVMIRRRLPLHYVSYGQRVPE
FT                   DIAVPNKKLLIHRSFRAGAEQSSFSLDSDESLLVAQGAVLRNAGNREPGLAAFDFA"
FT   gene            341982..342773
FT                   /locus_tag="Rpic_4069"
FT   CDS_pept        341982..342773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4069"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RS02067 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4069"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29172"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHX1"
FT                   /protein_id="ACD29172.1"
FT                   /translation="MTTPFAKDQAAGLRRMLGHAAARRVLVIGAEEQVDDFVDNLRIAL
FT                   SAMGRDTAVVNAQTMLAMPGVLEQYDETADVTLVAAHFGTRALSTVAEACDDVLLTFSD
FT                   GPEGLKSAYTLLKKTAVLQGSAGIRTVVCGAHSVDSAVRVFGNLANTVGQYLNTRIDFA
FT                   GYLPEDRHVELALSLGKPVASAFPASPSAMAFRQLAEEMLSWASAEAQAGDGSVPSRVV
FT                   MSARAPAQPADESAQATSMSASTATATATPGATARAAELVY"
FT   gene            342782..343543
FT                   /locus_tag="Rpic_4070"
FT   CDS_pept        342782..343543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4070"
FT                   /product="RNA polymerase, sigma 28 subunit, FliA/WhiG"
FT                   /EC_number="4.1.1.65"
FT                   /note="KEGG: rso:RSp1390 flagellar biosynthesis sigma
FT                   factor; TIGRFAM: RNA polymerase sigma factor, FliA/WhiG
FT                   family; RNA polymerase sigma factor, sigma-70 family; PFAM:
FT                   sigma-70 region 3 domain protein; sigma-70 region 2 domain
FT                   protein; sigma-70 region 4 domain protein; Sigma-70 region
FT                   4 type 2"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4070"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29173"
FT                   /db_xref="GOA:B2UHX2"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR012845"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR028617"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHX2"
FT                   /protein_id="ACD29173.1"
FT                   /translation="MNEASKAGMDMYTATGRKTKSDEMATYAPLVRRIANQMMVKLPAS
FT                   VELDDLIQAGMMGLLDALSRYEETQGVQFEFYAAQRIRGAILDELRGSDWLPRGLRRNA
FT                   RTIEQAIQKLQQQKGRAPTETEIAVALGMSLAEYQKQLVDLQGSQLLYYEDFDREDADA
FT                   FIENRAPENDATPLDQLLDHDLRESVVAAIEGLPEREKLMMSLYYEQDLNLREIGAVMG
FT                   VSESRVCQIHSQAIARIRSRLRDRAWLPTPT"
FT   gene            343922..345349
FT                   /locus_tag="Rpic_4071"
FT   CDS_pept        343922..345349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4071"
FT                   /product="xanthine permease"
FT                   /note="TIGRFAM: uracil-xanthine permease; xanthine
FT                   permease; PFAM: Xanthine/uracil/vitamin C permease; KEGG:
FT                   rso:RSc2118 putative xanthine permease transmembrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4071"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29174"
FT                   /db_xref="GOA:B2UHX3"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR017588"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHX3"
FT                   /protein_id="ACD29174.1"
FT                   /translation="MRQSPGQPTPSSSTIADTVADPVNEFLPLPRLFALGLQHLLVMYA
FT                   GAIAVPLIVGNALGLSKSDLSYLVNCDLFAAGIGTLIQSLGFLIFGIRLPVMMGVTFAA
FT                   VAPMIAIGVEPGMGLPGIFGASIVSGVFGIAVAPLMGRLLGLFPRVVTGTVIMLIGFSL
FT                   LSVGINWAAGGQQMIPQVVDGVRHMVPNPAFGDPFGLAIAALVLVTILLLTKFGNALLC
FT                   NIAVLLGIVTGTLVAAAFGKVSMADASAAPLMTLVTPFYFGMPKFELSAIISMCIVIVI
FT                   TLVESTGMFLALAHVVGKPISRNELTNGLRADGLATVVAGVFNTFPHTSFSQNIGLVSI
FT                   TGVRSRYVAAAGGVLLIVLGLFPKLSYVVASVPQYVLGGAGIVMFGMVAAAGIRMLGMV
FT                   DFQQQRHNLLIIAVSVGFGMMPTLAPAFFHHFPDWTRPITHSGIVMGTLVAVVLNAWFN
FT                   GIRGSHEVIHGEAAAAH"
FT   gene            complement(345378..346460)
FT                   /locus_tag="Rpic_4072"
FT   CDS_pept        complement(345378..346460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4072"
FT                   /product="Aldose 1-epimerase"
FT                   /EC_number="5.1.3.3"
FT                   /note="PFAM: Aldose 1-epimerase; KEGG: bxe:Bxe_B2624 aldose
FT                   1-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4072"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29175"
FT                   /db_xref="GOA:B2UHX4"
FT                   /db_xref="InterPro:IPR008183"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR015443"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHX4"
FT                   /protein_id="ACD29175.1"
FT                   /translation="MSIAPALSAHAPLDGAISSATWGHLPDGEPVRLFTLRNASDMRVS
FT                   ISDLGATLVSWQAPDRGGRLGEILLNHATPAAYLQSGGYLGGLIGRWANRIAGARFTLD
FT                   GIDYALDRNEDSNLLHGGASGFHRALWDAEEQDGALVLRLMSAEGDAGFPGNVAVQVRY
FT                   ALDDDGTLSIDYEARTDAPTPINLTSHGYFNLSGKPGTDIRGHILSIDADAYLEVDAKL
FT                   IPTRAVSVAGTAFDFRQAAPIGVRLDWPNAQLAQAGGFDHCFMLRNTVPDDHPHVRPVA
FT                   RLYEPGSGRELTVLTDQRGLQFYSGHMLSGTHAQRSGLCLEASAFPNQVNMPDAEAVML
FT                   RPGQVYRQRTAYRVSVARET"
FT   gene            complement(346457..347680)
FT                   /locus_tag="Rpic_4073"
FT   CDS_pept        complement(346457..347680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4073"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; KEGG: bxe:Bxe_B2623 transcriptional regulator,
FT                   AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4073"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29176"
FT                   /db_xref="GOA:B2UHX5"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHX5"
FT                   /protein_id="ACD29176.1"
FT                   /translation="MHRQLPDPSQHARIHRIALLFNANKVYDREIIAGIGDYMRSTRVT
FT                   WDLFLEEDFRCRLPGIERFDGDGIIADFDDPAVAEALRDCPLPVVAVGSSYEDAAHYPA
FT                   NVPYVATDNSKLVALAYRHLIEAGLQHFALYSLPQAPENRWAQQRELAFTRLRRQDNPA
FT                   APVEQEIYRGLSTSAPTWHQAISQLIEWLRGLPRPIGIIAVTDARARHLLQACMTAGFA
FT                   VPEEIAIIGIDNDPLTRTLSRIPLSSVIQGTVEMGRTAAHLLHQMLGGARLAGRQILVP
FT                   PVGINVLASSRHQPLASPYVMRARHFIRQYACQGIKTEQVADYVGISRSSLEEHFRREL
FT                   HCTVHQEILRHKLDAAKHMLASRDVATAEVAVRCGFTSPQYMHAVFRRELDCTPREYQE
FT                   RAIAEGQS"
FT   gene            347950..348978
FT                   /locus_tag="Rpic_4074"
FT   CDS_pept        347950..348978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4074"
FT                   /product="D-xylose ABC transporter, periplasmic
FT                   substrate-binding protein"
FT                   /EC_number="3.6.3.17"
FT                   /note="KEGG: bxe:Bxe_B2621 ABC xylose transporter,
FT                   periplasmic ligand binding protein; TIGRFAM: D-xylose ABC
FT                   transporter, periplasmic substrate-binding protein; PFAM:
FT                   periplasmic binding protein/LacI transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4074"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29177"
FT                   /db_xref="GOA:B2UHX6"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR013456"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHX6"
FT                   /protein_id="ACD29177.1"
FT                   /translation="MKSNQRRCVLRAAFCGAVLASLSMGAPLAHASKAHPEIGFCIDDL
FT                   RVERWSRDRDYFVAAAEKLGAKVSVQSADASEQRQISQIENLISRGVDVIVIVPFNSKA
FT                   LTNVVAEAKKAGIKVVSYDRLILDADVDAYISFDNEKVGELQAQGVFNVRPKGNYFLLG
FT                   GAPTDNNAKMLRQGQLKVLQPAIDRGDIKVVGSQWVPEWSASAALGIVENALTANNNKI
FT                   DAVVASNDGTAGGAIQALAAQKLAGKVPVSGQDADLAAVKRVIAGTQTMTVYKPLKLIA
FT                   TEAAQLSVALAKGDKLKYNAQYDNGKKKVDTVLLQPTQLTKDNVNLVVKDGFYTQAQIS
FT                   GQ"
FT   sig_peptide     347950..348045
FT                   /locus_tag="Rpic_4074"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.816 at
FT                   residue 32"
FT   gene            349060..350613
FT                   /locus_tag="Rpic_4075"
FT   CDS_pept        349060..350613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4075"
FT                   /product="D-xylose ABC transporter, ATPase subunit"
FT                   /note="KEGG: bxe:Bxe_B2620 ABC xylose transporter, ATPase
FT                   subunit; TIGRFAM: D-xylose ABC transporter, ATPase subunit;
FT                   PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4075"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29178"
FT                   /db_xref="GOA:B2UHX7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013455"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHX7"
FT                   /protein_id="ACD29178.1"
FT                   /translation="MSEPLLQMRGIVKTFDGVKALDGINLVVRPSECVGLCGENGAGKS
FT                   TLMKVLSGVYPSGTWDGEILWEGQPLRAGGICDTERAGIVIIHQELMLVPELSVAENIY
FT                   LGNEITLPGGRMNYAAMYQGADKLLRDLNIQGINVALPVMHYGGGHQQLIEIAKALNKR
FT                   AKLLILDEPSSSLTAAETRILLDIVRDLKARGIACVYISHKLDEVEAVCDTVTVIRDGR
FT                   HVSTAPMRDLTTDRIVAQMVGREITQLFPREPHPIGEVVFEARNVTCYDANNPTRKRVD
FT                   DVSFAVRRGEILGVAGLVGAGRTELMQAVFGAYEGASEVELVLDGKPLKIRAPLDAIRA
FT                   GIAMVPEDRKRHGIVSLMSVGHNITLAVLQRFARLGRIDGAAELDTIRKEMRRLAVRAA
FT                   HPMLPIASLSGGNQQKAVLTRMLLTEPRVLILDEPTRGVDVGAKYEIYKLIGDLAKRGM
FT                   AIIVISSELPEVLGISDRVLVIGEGELRGDFVNDGLTQEHILTAAIQPVRHTSTFHRGG
FT                   "
FT   gene            350616..351818
FT                   /locus_tag="Rpic_4076"
FT   CDS_pept        350616..351818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4076"
FT                   /product="Monosaccharide-transporting ATPase"
FT                   /EC_number="3.6.3.17"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   bmu:Bmul_4211 monosaccharide-transporting ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4076"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29179"
FT                   /db_xref="GOA:B2UHX8"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHX8"
FT                   /protein_id="ACD29179.1"
FT                   /translation="MTSQTSPQAAGGVDHSRSTIKATQRLRQLFARYKILALLIAVAAI
FT                   WLFFSMLTDGAFTSPRNLSNLLRQMSITGMLACGMVFVIIAGEIDLSVGSLLGLLGGVA
FT                   AILDQGLGWPITATVPVVLLLGVAMGLFNGWWSTYRGVPSFIVGLGGMLAYRGILLGLT
FT                   HGSTIAPVSDSFVLIGQGYLPRHVGDLMAVLIFCLLIFVVARQRREHRRYELDVAPLWQ
FT                   DVAKLVVAGAVIVAFVATLNSYGGIPVPVLLVLALLGIFSWIASQTVFGRRIYSVGSNL
FT                   EATRLSGINTDRVKLAIFGLMGLMCAFAGIVNTARLAAGSPSAGTMGELDAIAACFIGG
FT                   TSMRGGAGTVYGALVGALVMASLDNGMSMLDVDAYWQMIVKGSILVLAVWVDVISRSGR
FT                   R"
FT   gene            351865..352632
FT                   /locus_tag="Rpic_4077"
FT   CDS_pept        351865..352632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4077"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   bxe:Bxe_C1363 putative dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4077"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29180"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHX9"
FT                   /protein_id="ACD29180.1"
FT                   /translation="MSYAIYPSLVNKNVVITGGGSGIGAAIVEGFAKQGARVTFLDIAR
FT                   ADSEALASSLGECVHPPVFRYCDLRDIDTLNATFSDIEADTGPIDVLINNAANDDRHQI
FT                   GTVTQAYWDNRIEVNLRHQFFCAQAVLPSMKKRGHGVILNLGSISWHLAQADLAIYMTA
FT                   KAGIEGLTRGLARDLGGFGIRVNCIVPGAVRTPRQMALWQSPESEAKLLGEQCLHERVD
FT                   PEHVARMALFLASDDAARCTAREYFVDAGWYGG"
FT   gene            352629..353534
FT                   /locus_tag="Rpic_4078"
FT   CDS_pept        352629..353534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4078"
FT                   /product="SMP-30/Gluconolaconase/LRE domain protein"
FT                   /note="PFAM: SMP-30/Gluconolaconase/LRE domain protein;
FT                   KEGG: bxe:Bxe_C1362 putative senescence marker protein-30
FT                   (SMP-30)"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4078"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29181"
FT                   /db_xref="InterPro:IPR005511"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013658"
FT                   /db_xref="InterPro:IPR039096"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHY0"
FT                   /protein_id="ACD29181.1"
FT                   /translation="MMAPIIPDCVWRVGATLGEGAVWHAASRCVVFVDIQGRRLYRYDP
FT                   DTDVRRSWVAPGQIGFALPSVDGSWICGVPGGLYRFSFETGTFSRVLPVETDRPGNRLN
FT                   DGYVDRTGALWFGSMDDAEREPSGQLYRVGGDGGLSVRDSGYVITNGPTASPDGRTLYH
FT                   TDTLQRVIYAFDLGDDGSLERKRIFTSIEGSGYPDGMAVDEEGCLWVALFGGGRIERFS
FT                   PDGRCIGRVDFPCSNITKLAFGGDDLQTVYATTARKGLTDEALQKEPLAGGLFAFRAPV
FT                   RGLPSTDCAVDFSAAATGQP"
FT   gene            complement(353525..354709)
FT                   /locus_tag="Rpic_4079"
FT   CDS_pept        complement(353525..354709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4079"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bch:Bcen2424_6697 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4079"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29182"
FT                   /db_xref="GOA:B2UHY1"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHY1"
FT                   /protein_id="ACD29182.1"
FT                   /translation="MTAIANHLPHDLEHATLVGRVWRTTEKSKGPSVVVVRNGVVFDIT
FT                   EAVPTVADLFEHPDALAVARQAQGENLGRVETLVERSLAADRAGNAPTLLAPNDLQPIK
FT                   ACGVTFAVSLIERVIEEQAGGDPAKARDVRASIAGVVGSDLSKIKPGSDAAMRLKDELQ
FT                   RRGAWSQYMEVGIGPDAEVFSKSQPMSAVGFGADVGLHPASRWNNPEPEIVLAVSSTGH
FT                   VVGAALGNDVNLRDIEGRSALLLGKCKDNNGSCAIGPFVRLFDERFTLDTIRATQVSLR
FT                   VDGADDGFVLDGVSHMSEISRDPLDLVAQTCGPHHQYPDGFMLFLGTMFSPIKDRDAPG
FT                   AGFTHHLGDRVTISAPPLGALVNTVRLSTEIAPWTFGVRALYRNLAARGLVRQG"
FT   gene            354849..355604
FT                   /locus_tag="Rpic_4080"
FT   CDS_pept        354849..355604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4080"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="PFAM: regulatory protein IclR; Transcriptional
FT                   regulator IclR; KEGG: bpt:Bpet4676 transcriptional
FT                   regulator, IclR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4080"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29183"
FT                   /db_xref="GOA:B2UHY2"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHY2"
FT                   /protein_id="ACD29183.1"
FT                   /translation="MKTDYEVPALKRIHDVLEILCAATSPVRPAALAQATGMSRSTLYL
FT                   LLESLEKRRWIEKQADGYLIGLTLFELGNAYFRHDSLLAAFRRESAAFVAAHNEVVQLA
FT                   VLDGTEVVYIAREDAPRPVRLVSDVGLRLPAHCCALGKALLASLDDEAVRALLPARLAA
FT                   MTERTTTRRADLLDELERIRVRGLATEREEVVAGLACFAAFVGITPLGKRVAVSSSVPV
FT                   SRLDARREKRLVVGVAGMADRIGRALAQA"
FT   gene            355694..356710
FT                   /locus_tag="Rpic_4081"
FT   CDS_pept        355694..356710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4081"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: regulatory protein LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; KEGG:
FT                   bch:Bcen2424_6695 transcriptional regulator, LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4081"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29184"
FT                   /db_xref="GOA:B2UHY3"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHY3"
FT                   /protein_id="ACD29184.1"
FT                   /translation="MTTGTTPPRMADVARVAGVSKMTVSRVLAGGSVSPETRARVQEAI
FT                   DALGYVATAAAGMLSSGRSEFVAALVPSLASSNFADTVRGLSDALAPHGLQLLLGDTDY
FT                   HLDQEEALVRSLLRHQPRGIALTGRHHSPGTRALLERAGIPIVEMWDLPERPIDRAVGF
FT                   SNAKASLAMLHHLHQRGYRRIGFLCGASELDRRGTDRMRGYMSGIKSLGLGEPRVIRLG
FT                   ESPITMSHGGPAMAALLDAWPDTDAVMCVSDMSAFGAIMECHRRGLSVPGDIAVGGFGN
FT                   FEVAWCCHPTITTISVDAYGIGLRTGEVLLDALGVGEATSTRKLSRIDFSVVERESA"
FT   gene            complement(356732..358516)
FT                   /locus_tag="Rpic_4082"
FT   CDS_pept        complement(356732..358516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4082"
FT                   /product="Dihydroxy-acid dehydratase"
FT                   /EC_number="4.2.1.9"
FT                   /note="PFAM: dihydroxy-acid and 6-phosphogluconate
FT                   dehydratase; KEGG: bch:Bcen2424_6696 dihydroxy-acid
FT                   dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4082"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29185"
FT                   /db_xref="GOA:B2UHY4"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHY4"
FT                   /protein_id="ACD29185.1"
FT                   /translation="MPAQPPRRLRSQLWFDDPSHADMTALYVERFMNYGLTREELQSGR
FT                   PIIGIAQTGNDLAPCNRHHLELAQRVKAGIRDAGGIPMEFPVHPLAEQSRRPTAALDRN
FT                   LAYLGLVEILHGFPLDGVVLTTGCDKTTPACLMAAATVDLPAIVLSGGPMLDGWHEGKR
FT                   VGSGTVIWHARNRLAAGDIDYEGFMELTTASSPSIGHCNTMGTALSMNSLAEALGMSLP
FT                   GCASIPAAYRERGQMAYATGKRIVDLVREDIRPSTIMTRAAFENAIMVASALGASTNCP
FT                   PHLIAIARHMGVELSLEDWQRHGESVPLLVNCMPAGEYLGESFHRSGGVPAVLRQLDAG
FT                   GLLRRDCPTVSGRTIGAIADAAPAADREVIFPVDAPLKHRAGFIVLSGNFFDSAIMKMS
FT                   VVGEAFRQTYLSEPGAENVFETRAIVFDGPEDYHARINDPALAIDERCILVIRGCGTVG
FT                   YPGSAEVVNMAPPAALVKQGIESLPCMGDGRQSGTSASPSILNMSPEAAAGGGLALLRT
FT                   GDRIRVDLNARRVDVLVDAEELERRRESATFSVPQSQTPWQEIYRKCVGQLSTGGCLEP
FT                   ATLYLNVIETRGNPRHSH"
FT   gene            358820..359359
FT                   /locus_tag="Rpic_4083"
FT   CDS_pept        358820..359359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4083"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: aav:Aave_1254 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4083"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29186"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHY5"
FT                   /protein_id="ACD29186.1"
FT                   /translation="MQVLSARFEKTDAGRREIAMRSGALSRSSRALLIMVDGQATGEDL
FT                   VVRAGQLGLEAQAVVELVQAGFIQSATDVAGEPVFVQVAEPQPEAPKPAAPAAPARKRS
FT                   LAAARMYLMDIAARTFSSAEHPIRQRLVEATDRASVESAFDALLAALREATSASMVEQV
FT                   EVSFRGFLPAEDGVAG"
FT   gene            complement(359364..360023)
FT                   /locus_tag="Rpic_4084"
FT   CDS_pept        complement(359364..360023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4084"
FT                   /product="isochorismatase hydrolase"
FT                   /note="PFAM: isochorismatase hydrolase; KEGG: bxe:Bxe_A0706
FT                   putative isochorismatase hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4084"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29187"
FT                   /db_xref="GOA:B2UHY6"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHY6"
FT                   /protein_id="ACD29187.1"
FT                   /translation="MTTNNTPKRALIVIDVQNEYFTGGLPIEYPDPQQTVANIGVAMDA
FT                   AREAGIPVIVVQQTSPASSPLFAIDTDGWQLHPVVASRPHDHYLRKLLPSAYPETDLAQ
FT                   WLEARGIDTLTVVGYMTHNCDASTINHALHNGTAVEFLHDASGAVPYQNQAGFASAEEI
FT                   HRVFSVVLQSRFAAVMSTQEWVHSVKTGAVPVRDNIYKSNQRARGLLKDEVAQRAA"
FT   gene            360158..361153
FT                   /locus_tag="Rpic_4085"
FT   CDS_pept        360158..361153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4085"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; ThiJ/PfpI domain protein; KEGG: bpt:Bpet2223
FT                   transcriptional regulator, AraC-family"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4085"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29188"
FT                   /db_xref="GOA:B2UHY7"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHY7"
FT                   /protein_id="ACD29188.1"
FT                   /translation="MQPQQLQQPQHPQEIAVLAFNDISPFHLSVPCLVFEDRVWAGLPS
FT                   YNLRICAGEPARKGGLRTTAGFAVQTDFTLEDAARADVLVVPSWRDTEERPPAAMVNAV
FT                   RDAYERGATVVGLCLGAFVLAEAGVLDGHEATTHWSAADAFSQRYPRVKLVPDVLYLDA
FT                   ADGRLVTSAGTAAGLDCCLHLVRRWHGAEVANRMARRLVVAPHRQGGQAQYIEQPLHDA
FT                   PGGDRLSDLLNWAVANLAQPHSLDSLAERAAMSRRNFTRRFRELTGTTVSQWLLGQRLA
FT                   YAQRMLETTRQPVEAIAQLAGFGSAVSLRQHFSRTYHTSPSAYRALFAQA"
FT   gene            complement(361195..361377)
FT                   /locus_tag="Rpic_4086"
FT   CDS_pept        complement(361195..361377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4086"
FT                   /product="17 kDa surface antigen"
FT                   /note="PFAM: 17 kDa surface antigen; KEGG: rso:RS02072
FT                   putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4086"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29189"
FT                   /db_xref="GOA:B2UHY8"
FT                   /db_xref="InterPro:IPR008816"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHY8"
FT                   /protein_id="ACD29189.1"
FT                   /translation="MNAWKTALICALAALAPTLAACTAGGAVAGGVAGHEMTHSTAGTI
FT                   GGAAAGAVIGHELSK"
FT   sig_peptide     complement(361288..361377)
FT                   /locus_tag="Rpic_4086"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.798 at
FT                   residue 30"
FT   gene            complement(361450..362010)
FT                   /locus_tag="Rpic_4087"
FT   CDS_pept        complement(361450..362010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4087"
FT                   /product="protein of unknown function YGGT"
FT                   /note="PFAM: protein of unknown function YGGT; KEGG:
FT                   rso:RS02073 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4087"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29190"
FT                   /db_xref="GOA:B2UHY9"
FT                   /db_xref="InterPro:IPR003425"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHY9"
FT                   /protein_id="ACD29190.1"
FT                   /translation="MFGDITRFLLDTIFSLFGAALLLRAWTQAVRLSPRNPLSQAIFQL
FT                   TGWLVHPLRRVIPATGYIDWSSLVAAYATALVYLFLLVASVGVSPMALVPMGFVAALFT
FT                   VLKWAFNVLVWVTIASAVLSWMGPASPMGAVLNTLVDPLLRPIRRVVPPLGGRLDLSPL
FT                   ILLVIAQVIVIALSHLSLSPLFM"
FT   gene            362188..362751
FT                   /locus_tag="Rpic_4088"
FT   CDS_pept        362188..362751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4088"
FT                   /product="PEBP family protein"
FT                   /note="PFAM: PEBP family protein; KEGG: spe:Spro_2903 PEBP
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4088"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29191"
FT                   /db_xref="InterPro:IPR005247"
FT                   /db_xref="InterPro:IPR008914"
FT                   /db_xref="InterPro:IPR036610"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHZ0"
FT                   /protein_id="ACD29191.1"
FT                   /translation="MKPILFRALLSLACLSAVPHVHAQADTTFTVESPAFADNGVMDRK
FT                   YAGKNPANANCTGDNVSPPLHWSNVPAGTNSLVLIVSDPQGAGGLGVNHWMAYGMPATQ
FT                   TSLPEGAGTGPALRMGQNSIGKPAYLGPCPPKGTGMHHYVFLLIATDLAPDALPNGLTR
FT                   AELDAAIKGHSKGAAAWIGRFGNF"
FT   sig_peptide     362188..362259
FT                   /locus_tag="Rpic_4088"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.933 at
FT                   residue 24"
FT   gene            complement(362801..363787)
FT                   /locus_tag="Rpic_4089"
FT   CDS_pept        complement(362801..363787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4089"
FT                   /product="aliphatic sulfonates family ABC transporter,
FT                   periplsmic ligand-binding protein"
FT                   /note="KEGG: rso:RSp1383 putative alkanesulfonates binding
FT                   protein precursor; TIGRFAM: aliphatic sulfonates family ABC
FT                   transporter, periplsmic ligand-binding protein; PFAM:
FT                   NMT1/THI5 like domain protein; SMART: extracellular
FT                   solute-binding protein family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4089"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29192"
FT                   /db_xref="GOA:B2UHZ1"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR010067"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHZ1"
FT                   /protein_id="ACD29192.1"
FT                   /translation="MQSHPPHTAPSGRRRWLAALLGAGMALCAGLTQAAEPTTVRIGFQ
FT                   KAGLLAVLKAQGALDKPLAELGYKVEWKEFPAGPQLLEALNTGSIEFGYTGAPPAVFAQ
FT                   AAGARLVYVGAEPGGKTNEALFVLDSSPAHSVADLKGKRIALQKGSSSNYLLVQLLRRA
FT                   NLTVQDIQPIYLPPAEARAAFESGAVDAWVVWDPYYALAQKALKTRTLGDFSELPVFNF
FT                   YEATPEFVNTHPRAVNAILAQLRTAGLWVNQHPQETAALLAPKLGIEQPVVETWLRRVP
FT                   YGVTPVTPQIVASQQQIADLFLQQKLIPKPVNVQSAVWQANFPVAGL"
FT   sig_peptide     complement(363683..363787)
FT                   /locus_tag="Rpic_4089"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 35"
FT   gene            complement(363885..364178)
FT                   /locus_tag="Rpic_4090"
FT   CDS_pept        complement(363885..364178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4090"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pfo:Pfl_3157 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4090"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29193"
FT                   /db_xref="InterPro:IPR010376"
FT                   /db_xref="InterPro:IPR038492"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHZ2"
FT                   /protein_id="ACD29193.1"
FT                   /translation="MHPPERIDNDVAQGRLRLHWADAVVVLDHAALREACRCAECQFKR
FT                   HHGTPINVPAAVRVTSIAPAGYGVQLVFSDGHARGIYPWAYLAELVAIAAPG"
FT   gene            complement(364165..365124)
FT                   /locus_tag="Rpic_4091"
FT   CDS_pept        complement(364165..365124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4091"
FT                   /product="PBS lyase HEAT domain protein repeat-containing
FT                   protein"
FT                   /note="PFAM: HEAT domain containing protein; PBS lyase HEAT
FT                   domain protein repeat-containing protein; KEGG:
FT                   pen:PSEEN0177 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4091"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29194"
FT                   /db_xref="GOA:B2UHZ3"
FT                   /db_xref="InterPro:IPR000357"
FT                   /db_xref="InterPro:IPR004155"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR021133"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHZ3"
FT                   /protein_id="ACD29194.1"
FT                   /translation="MTTTPLARLHDADAATRRVALLQIADEEDADSLPNVIALLEQDPA
FT                   PEVRLEAARILATWEQPDTVAALARALEDVDGAVRDAAAIGLADLKSPESASALLAYVD
FT                   HASAFVRAAALRGLRELRVPESEAPALHALQDADAAVRREAVAVLGWRKHVGALPALAE
FT                   RARHDADVDVRRAAVGALGLATDAAVLPALLAALHDTAWRVREESASTLGKLRALAPDL
FT                   HVTQALVDALADAYWQVRLQAARALGRWRAAHAVDALAALLTHPISNLRKEAALALGEI
FT                   GEASALPALRSAQTDGDPEVVKAVRIALAQIERARASA"
FT   gene            complement(365132..365398)
FT                   /locus_tag="Rpic_4092"
FT   CDS_pept        complement(365132..365398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4092"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: bch:Bcen2424_1973 4Fe-4S ferredoxin,
FT                   iron-sulfur binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4092"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29195"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHZ4"
FT                   /protein_id="ACD29195.1"
FT                   /translation="MQQTTVHFTHTPHDITSRSSAPVTIDEAKCIADKGCTVCVDVCPL
FT                   DLLAIDLTKGKAFMQFDECWYCMPCEQDCPTGAVKVDIPYLLR"
FT   gene            complement(365401..367125)
FT                   /locus_tag="Rpic_4093"
FT   CDS_pept        complement(365401..367125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4093"
FT                   /product="fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein"
FT                   /note="PFAM: fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein; HI0933 family protein;
FT                   FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: reh:H16_B2242 putative
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4093"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29196"
FT                   /db_xref="GOA:B2UHZ5"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHZ5"
FT                   /protein_id="ACD29196.1"
FT                   /translation="MNTLELEYDLVVVGGGTAGPMAAIKAKERNPALRVLLIDKAHVKR
FT                   SGAISMGMDGLNNAVIPGHATPEQYTREITLANDGIVDQSGVYAYAQHSFATIEQLDRW
FT                   GVKFEKDETGDYAVKKVHHMGSYVLPMPEGHDIKKVLYRQLKRARVEITNRIVVTRVLT
FT                   DADGAACGVLGFDCRTADFLVVRAKAVVLSCGAAGRLGLPASGYLMGTYENPTNAGDGY
FT                   AMAYHAGAELSNLECFQINPLIKDYNGPACAYVTGPLGGYTANARGERFIQCDYWSGQM
FT                   MWEFYQELQGGKGPVFLKLDHLAEETIQTIETILHTNERPSRGRFHAGRGTDYRTQMVE
FT                   MHISEIGFCSGHSASGVYVNARAETTVPGLYAAGDMAAVPHNYMLGAFTYGWFAGQNAA
FT                   DYIAGRQGVARVDDAQIERERARIFAPLQRDHGLAPAQVEYKLRRMVNDYLQPPKVTRK
FT                   MEIGLRRFDEIAEDITHLHARNPHELMRAMEVSFIRDCAEMAARASLFRTESRWGLYHH
FT                   RVDYPERDDANWFCHTRLYKDAHGAMASRKQAVEPYVIPVDVLGTDSYAQMRIPKAA"
FT   gene            complement(367122..367907)
FT                   /locus_tag="Rpic_4094"
FT   CDS_pept        complement(367122..367907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4094"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR HTH; UbiC
FT                   transcription regulator-associated domain protein; KEGG:
FT                   reh:H16_B2241 transcriptional regulator, GntR-family"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4094"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29197"
FT                   /db_xref="GOA:B2UHZ6"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHZ6"
FT                   /protein_id="ACD29197.1"
FT                   /translation="MTTSNLHRQPAPPLYERIKGTLREGILSGHYAPASLLPSEAALGE
FT                   QFNASRITVRQALADLQNEGLIFRRHGKGTFVSQPKAFQNVTALQGFAEAMSAQGHAIR
FT                   NRVLKLRTLPAPTDVAQALQLAPGTAVTELHRVRLLDQVPVSLEVTWLPEPLGSSVARA
FT                   DLVTRDVFLVLEQDAGVALGHATLAIDAALADHATATALDTGAGAALLRVERLTHDAQG
FT                   TPIDFERLYFRGDAFQYRLRLDRQVAAHAQSILPLQGTK"
FT   gene            368303..369289
FT                   /locus_tag="Rpic_4095"
FT   CDS_pept        368303..369289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4095"
FT                   /product="periplasmic binding protein/LacI transcriptional
FT                   regulator"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; KEGG: aav:Aave_2255 periplasmic
FT                   binding protein/LacI transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4095"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29198"
FT                   /db_xref="GOA:B2UHZ7"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="InterPro:IPR033893"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHZ7"
FT                   /protein_id="ACD29198.1"
FT                   /translation="MQKTSAACARRTVLTFLATAGVLLATGLATAAHAADKSFTMGFAQ
FT                   VGAESEWRTANSESIKSTAKAQGVNLKFSDAQQKQENQIKAIRSYIAQKVDVIAFSPVV
FT                   ESGWDTVLQEAKAAKIPVILTDRGIDSKDTSLYTTFIGSDFVEEGRKAGRWLLENVKPK
FT                   GDVNIVELQGTVGSAPAIDRKRGFEEIIKADPHYKIIRSQTGDFTRAKGKEVMEAFLKA
FT                   EGKKINVLYAHNDDMAIGAIQAIEEAGLKPGKDITIISIDGVKGAFEAMMAGKLNVTVE
FT                   CSPLLGPQLMDTARAVLAGKTVPKRIVTKEGIFPMEVAAKEFPNRKY"
FT   sig_peptide     368303..368407
FT                   /locus_tag="Rpic_4095"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.995 at
FT                   residue 35"
FT   gene            369390..370967
FT                   /locus_tag="Rpic_4096"
FT   CDS_pept        369390..370967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4096"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bam:Bamb_6194 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4096"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29199"
FT                   /db_xref="GOA:B2UHZ8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHZ8"
FT                   /protein_id="ACD29199.1"
FT                   /translation="MSDHVDQPAATDARGALLHMRGICKNFPGVQALAAVDFRLFPGEV
FT                   HALMGQNGAGKSTLIKVLTGVEAPDAGEIVLGGQPIAPSSPLEAQKLGISTVYQEVNLC
FT                   PNLTVAENIHIGRFPMRMGSIDWRATNRAAQALLADLNIHIDVTLPLSLYPVAIQQMVA
FT                   IARALSTEARILILDEPTSSLDDDEVARLFAAIRTLKARGMAVLFVTHFLEQTYAIADR
FT                   ITVLRNGRLEGEYAARDLPQLQLINKMVGRDIDASRFERTEVPSVDDTAPAFLSARGMG
FT                   RRGVVQPLDLDVRPGQVLGLGGLLGSGRTETARLLFGVDRNDAGSINVHGQARQFSSPR
FT                   DAIRQGIGFCPEDRKTEGIIAELSIRENIILALQAKRGLFRYLPKKRQREIADQYIAQL
FT                   GIKTPDAEKPIGQLSGGNQQKAVLARWLATDPAMLILDEPTRGIDIAAKLDIMDLVTAQ
FT                   CRKGMAILFISSELPEVLRVSHRLAILRDRKKVGELAGADVTEDNLCHVIAGGDVPASQ
FT                   STTTGGAA"
FT   gene            370964..372013
FT                   /locus_tag="Rpic_4097"
FT   CDS_pept        370964..372013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4097"
FT                   /product="Monosaccharide-transporting ATPase"
FT                   /EC_number="3.6.3.17"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   aav:Aave_2250 inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4097"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29200"
FT                   /db_xref="GOA:B2UHZ9"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHZ9"
FT                   /protein_id="ACD29200.1"
FT                   /translation="MNPVNLRALTGHRLFWPGVTLLLLCLLNAWFNPHFFHLDIRNGHL
FT                   YGSLIDILNRAAPLMLVSLGMTLVIAVGGIDISVGAVVAISGAIAASLVGGTLVVQNGL
FT                   PVYVTKAPLLLALLAAVGAALVCGLWNGLLVAGAGMQPIIATLILMVAGRGVAQLITGG
FT                   QIITVYYEPFFFVGNGYLFGLPFGLYIAAAVLGLLLLLMHRTALGLFVEAVGINPVAAR
FT                   LAGLNTKALLFGIYAFCGAMAGVAGLIICSNVKSADGNNAGLLLELDAILAVTLGGTSL
FT                   AGGKFSLWGSVIGALIIQTLTYAIYSMGVPPEINLVVKAVVVFAVCLAQSEAFRSMLFQ
FT                   RHSRAGAQS"
FT   gene            372010..373083
FT                   /locus_tag="Rpic_4098"
FT   CDS_pept        372010..373083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4098"
FT                   /product="Monosaccharide-transporting ATPase"
FT                   /EC_number="3.6.3.17"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   aav:Aave_2249 inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4098"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29201"
FT                   /db_xref="GOA:B2UI00"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI00"
FT                   /protein_id="ACD29201.1"
FT                   /translation="MRINPRRLPFYVTLFLFALLFGFGSVTYTGFFSVQVFLNLLIDNA
FT                   FLIVVAIGMTFVILSGGIDLSVGAVVALTTMISAAQVEHHGWSIGVVVPLVLAVGCLFG
FT                   LVMGVLIQVFRIQPFIVTLGGMFLARGLCYLISIDSISITDPIYTALSQYKIQVGGGNY
FT                   VSPSVVIALVVFAAAAWLAHCSRFGRTVYALGGNERSALLMGLPVVRTRILVYVLSGFC
FT                   SALGGVLVTFYMLSGYGLHAQGMELDAIAATVVGGTLLTGGVGLISGSVVGVLLLGVIQ
FT                   SLITFDGTLSSWWARIAIGVLLCLFCLMQRFLGRAQRGASLPPSTPHRPARPSNETAKD
FT                   APASAILMQSHAVPPFN"
FT   sig_peptide     372010..372093
FT                   /locus_tag="Rpic_4098"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.967) with cleavage site probability 0.476 at
FT                   residue 28"
FT   gene            373130..373492
FT                   /locus_tag="Rpic_4099"
FT   CDS_pept        373130..373492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4099"
FT                   /product="3-dehydroquinate dehydratase"
FT                   /EC_number="4.2.1.10"
FT                   /note="PFAM: dehydroquinase class II; KEGG: ppu:PP_3003
FT                   3-dehydroquinate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4099"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29202"
FT                   /db_xref="GOA:B2UI01"
FT                   /db_xref="InterPro:IPR001874"
FT                   /db_xref="InterPro:IPR036441"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI01"
FT                   /protein_id="ACD29202.1"
FT                   /translation="MFRATIRLQALGAEPGVQVESFQTNSEAAMCERIHGAFEERQDAV
FT                   LINAGAWTHYSYGIRDALAILTCPVVELHMSNIHAREPFRHHLVFADIVSGQICGFGVQ
FT                   SYLLALRAAASAIDHA"
FT   gene            complement(373541..374110)
FT                   /locus_tag="Rpic_4100"
FT   CDS_pept        complement(373541..374110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4100"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rme:Rmet_5010 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4100"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29203"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI02"
FT                   /protein_id="ACD29203.1"
FT                   /translation="MHNPKLSFINQEAWEAWLETHGETVTGVWLRIARRSAEQSTVSYA
FT                   EAVESALCYGWIDGQKQAENEHYWLQRFTPRTAKSIWSKINTAKAEALITAGRMRPAGL
FT                   RAIELAKQDGRWEAAYSPAGTSTVPDDLQQALDANPKAKQFFATLNGQNRYAILFRIQN
FT                   VKKAETRAKKITQFIDMLNKGEKLHP"
FT   gene            complement(374148..374573)
FT                   /locus_tag="Rpic_4101"
FT   CDS_pept        complement(374148..374573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4101"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: syg:sync_0841 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4101"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29204"
FT                   /db_xref="InterPro:IPR024311"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI03"
FT                   /protein_id="ACD29204.1"
FT                   /translation="MTERDTKLHGSWRLLSFETELQETKERTQPWGADPNGSLIFGADG
FT                   RMMVLLTAKVREQGNTDEKLAALFRTIVAYTGRYRVEDDRFITKVDASWNEAWTGTEQE
FT                   RFYTLDGDKLEVRTAWMPNPLVSENAMGRGVLGFRRE"
FT   gene            complement(374596..375258)
FT                   /locus_tag="Rpic_4102"
FT   CDS_pept        complement(374596..375258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4102"
FT                   /product="bifunctional deaminase-reductase domain protein"
FT                   /note="PFAM: bifunctional deaminase-reductase domain
FT                   protein; KEGG: rme:Rmet_4484 bifunctional
FT                   deaminase-reductase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4102"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29205"
FT                   /db_xref="GOA:B2UI04"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI04"
FT                   /protein_id="ACD29205.1"
FT                   /translation="MTRVRVAGFTLSLDGYGAGPDQDINNPLGIGGMELHQWLVATRTF
FT                   QRTLFGKDGGTTGVDDDFAARSFRNVGAWILGRNMFGPIRGDWPDDNWKGWWGDNPPYH
FT                   VPVFVLTHHARAPIEMAGGTTFHFITGGFREALDRAREAAGGKDVRIGGGPSTIRQYLR
FT                   EGLIDELHIAISPVLLGRGEPLFEGIDLRALGYACVESVASEKATHVVLRRPLPTNT"
FT   gene            375434..376357
FT                   /locus_tag="Rpic_4103"
FT   CDS_pept        375434..376357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4103"
FT                   /product="putative exonuclease RdgC"
FT                   /note="PFAM: putative exonuclease RdgC; KEGG:
FT                   bch:Bcen2424_4426 recombination associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4103"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29206"
FT                   /db_xref="GOA:B2UI05"
FT                   /db_xref="InterPro:IPR007476"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI05"
FT                   /protein_id="ACD29206.1"
FT                   /translation="MWFKNLQLHRLPAPWAVTPDQLEKWLAPHAFQPGNSVEKQTFGWA
FT                   SPRDDGALVYSNNGQMLLVFRAEKKLLPASVINQVTKARALELEEQQGFKPGRKQLREL
FT                   KEQVTDELLPRAFSIRRDTRVWIDTANGWLVIDAASQAVADDVRGLLVKSIDQLPLTSV
FT                   HVKHSPVAAMTEWLLSGDAPGGFTVDQDAELRSTGEGGATVRYVGHALEAEDMRRHIEA
FT                   GKQCMRLAMTWDDRVSFVLTPSLLIKRVTPLDVIKEAEDPTAQNDDERFDSDVALMTGE
FT                   LARMLSDLVDSLGGDQLDAVQQAKAA"
FT   gene            complement(376435..376932)
FT                   /pseudo
FT                   /locus_tag="Rpic_4104"
FT   gene            376931..377150
FT                   /pseudo
FT                   /locus_tag="Rpic_4105"
FT   gene            complement(377283..377714)
FT                   /locus_tag="Rpic_4106"
FT   CDS_pept        complement(377283..377714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4106"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: reu:Reut_B4592 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4106"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29207"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI06"
FT                   /protein_id="ACD29207.1"
FT                   /translation="MSDVKRDPRRPIHAEKVAASRALRLSVPAEARPAPVSRKDWLRQR
FT                   KEQLQAARVAAKQRRDQLKAEILSAAQEVAREERVAARLEAERVKAETRSASVHAKEDA
FT                   RAAAKFERSKPARSTSKRKTLGTGKRKLISYADLLRMRG"
FT   gene            378084..379184
FT                   /locus_tag="Rpic_4107"
FT   CDS_pept        378084..379184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4107"
FT                   /product="branched-chain amino acid aminotransferase"
FT                   /note="TIGRFAM: branched-chain amino acid aminotransferase;
FT                   PFAM: aminotransferase class IV; KEGG: sme:SMc02896
FT                   branched-chain amino acid aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4107"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29208"
FT                   /db_xref="GOA:B2UI07"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005786"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR033939"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI07"
FT                   /protein_id="ACD29208.1"
FT                   /translation="MNNVVESAISIEKRPNPVPAEERARLLENPAFGRVFTDHMATIRY
FT                   TEGKGWHDAKIGAHGPIQCDPSTLVLHYAQEIFEGMKAYRLPDGGGALFRPEANARRFQ
FT                   NSAKRLAMPALPEDLFLQAVRELVKLDRDWIPSGQGSALYLRPFMIATEVVLGVKPSAE
FT                   YLFCVIACPVGAYFKGDASSGVTIWVSDNYTRAAPGGTGEAKCGGNYAASLVAQAEATR
FT                   EGCDQVVFLDAVERKWIEELGGMNVFFVFDDGSLQTPPLTGTILPGITRDSLITLARGM
FT                   GLTVREEPYSIDQWQADAQSGRLREAFACGTAAVVTPIGKVKGHKHNFTIGDGKAGELT
FT                   TKLKAALVDLQNGRAPDPHGWLDRLF"
FT   gene            379192..380004
FT                   /locus_tag="Rpic_4108"
FT   CDS_pept        379192..380004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4108"
FT                   /product="alpha/beta hydrolase fold"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG:
FT                   ppg:PputGB1_3299 alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4108"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29209"
FT                   /db_xref="GOA:B2UI08"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI08"
FT                   /protein_id="ACD29209.1"
FT                   /translation="MAESLSAPSVDGTEAWITTPDGRLHARQWGGPVNDAAKPPIVLLH
FT                   DSLGCVALWRDFPQRLAQSTGHAVIAYDRLGFGRSDAYPGQLDPGFIQQEAYGGFAALT
FT                   DQFGVDRFFVFGHSVGGGMAVSIAAAYPGRCAGLITESAQAFVEEQTRQGIRIAQAQFA
FT                   EPGQMGRLERYHGSKAQWVLDAWVNTWLSPAFAQWCLDDALLAVRSPVLALHGTEDEYG
FT                   STAQPERIVTLAGAPATLKLVQRCGHVPHREQEAAVLAAVNAFLSASA"
FT   gene            380307..381470
FT                   /locus_tag="Rpic_4109"
FT   CDS_pept        380307..381470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4109"
FT                   /product="Alkane 1-monooxygenase"
FT                   /EC_number="1.14.15.3"
FT                   /note="PFAM: fatty acid desaturase; KEGG: bch:Bcen2424_0980
FT                   alkane 1-monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4109"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29210"
FT                   /db_xref="GOA:B2UI09"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="InterPro:IPR033885"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI09"
FT                   /protein_id="ACD29210.1"
FT                   /translation="MATPGMVASVEWTDGKRYLWMLGALTITLPIVAAVSALATGWHPL
FT                   WWAGPFIVFTIIPLLDFLIGDDPENPPEDVVPTLEKQRYYRRIVYLATTVLYVSFAVSM
FT                   WVLRTYDLVWYDYIAFAFSVGVVTGISINTAHELGHKTDGFERWLAKITLAPVAYGHFF
FT                   VEHNRGHHVRVATPADPASARYGESFWEFLPRTVVGSVKSAWALEKRRLEQQGHSVWSW
FT                   RNDVLNAWAMTVVLWGVCIAFVGLKAVPFLIIQAIYGASLLEVVNYLEHYGLCRQQLPS
FT                   GRYERCTPQHSWNSNHVVTNLFLYQLQRHADHHANPTRSFQALRHFEHSPQLPAGYAAM
FT                   IMVAYVPPLWFRVMNPRVVAHYNGNMSLANIKPSIRDKVLAQYPARA"
FT   gene            complement(381480..381743)
FT                   /locus_tag="Rpic_4110"
FT   CDS_pept        complement(381480..381743)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4110"
FT                   /product="Cupin 2 conserved barrel domain protein"
FT                   /note="PFAM: Cupin 2 conserved barrel domain protein; KEGG:
FT                   pna:Pnap_4882 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4110"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29211"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI10"
FT                   /protein_id="ACD29211.1"
FT                   /translation="MDRDAFVSALRAEGFTEFVLVTREPGELDTHTHPFEAKALILAGE
FT                   IHIRAEGAERVYRPGDTFHLAANAPHTERYGAQGVQYLVARR"
FT   gene            381972..382871
FT                   /locus_tag="Rpic_4111"
FT   CDS_pept        381972..382871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4111"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; KEGG: bur:Bcep18194_B2981 transcriptional
FT                   regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4111"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29212"
FT                   /db_xref="GOA:B2UI11"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI11"
FT                   /protein_id="ACD29212.1"
FT                   /translation="MNAITPLALLESAPVSLRSSDGLGWDGFAATLLGIRAGAYRVPAM
FT                   AQHRVNVHVGPPVRMNCVCDGRRYSRIQAHGDADVIPAGVPGMWTDDADCRILRIAISD
FT                   TSVRSIAEQIGVRADITPRLQWRDARVRHLAAALGAELLAEDTSDALYAEGLCTALVVR
FT                   LLSSSRDGAAGVADRTGTLAPRVATRVIDYIEAHLHARLTLAELAAQAGLSVPHFNVLF
FT                   RATLGVPAHRYVVQRRVARAKALLLEGRRSASQIALDVGFAHQSHMTEWMQRLLGVTPR
FT                   DVIRAGKALAAAADPPAA"
FT   gene            382967..383857
FT                   /locus_tag="Rpic_4112"
FT   CDS_pept        382967..383857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4112"
FT                   /product="NmrA family protein"
FT                   /note="PFAM: NmrA family protein; KEGG: bur:Bcep18194_B2980
FT                   NmrA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4112"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29213"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI12"
FT                   /protein_id="ACD29213.1"
FT                   /translation="MFVIFGASGKVGHATAVALRNAGRPVRAVVRGARQGEALARIGCE
FT                   IAIADLTDPASVASAIKGATAVQMLCPVPVGDVDPAFTMERMIDVAADALRANPPSAVL
FT                   ALSDYGAELDRGTGLTRLFHLLEERLKPLATHLTLLRSAEHAQNWAAMLPVMLATGRLP
FT                   SLHYPLDRAFATVATQDVGALAAQLLLDGPSANTPRIVSVEGPRRVSLIDVARAFSAVV
FT                   GREIVADAVPRTAWSPMLQRAGLSANHVQLLTELYDAVNAGQIDVEKGVSEQRFGKTEL
FT                   HDVFASLLATHMSSS"
FT   gene            383983..384768
FT                   /locus_tag="Rpic_4113"
FT   CDS_pept        383983..384768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4113"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pnu:Pnuc_1326 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4113"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29214"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI13"
FT                   /protein_id="ACD29214.1"
FT                   /translation="MVGARIARAIGTAVVFSAFALPAHAVLPDEIQVYTGDINAPGEFG
FT                   LELHVNTTPSGIGTPSYPGEVTTPHGWRATAEFSYGLTPSLELGLYVPTTLTRENTFYV
FT                   TGPKVRVKWMPMRPVDGVGNFAGINVELAHVAGRFEASQNAAELRPIYGYQNDRWLWAV
FT                   NPVLDWNLSGDGRSGVPEAAPSFKIARTVATGVRAGTEYYAGLGPINHIAPLHEQQHTV
FT                   FLAFDVDRKPFVFNFGIGRGLTRASDRWTLKWIFEIPLS"
FT   sig_peptide     383983..384060
FT                   /locus_tag="Rpic_4113"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.998 at
FT                   residue 26"
FT   gene            384843..385367
FT                   /locus_tag="Rpic_4114"
FT   CDS_pept        384843..385367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4114"
FT                   /product="conserved hypothetical signal peptide protein"
FT                   /note="KEGG: rso:RS02076 hypothetical signal peptide
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4114"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29215"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI14"
FT                   /protein_id="ACD29215.1"
FT                   /translation="MMIDLRCVAMVLLLSASGAHAEDDLQNRGHDPFFQISSGVANCPE
FT                   PAGPRISEAEWKRDSHHRIEHGNHCWVEGRCRLPNAFSYDDEIAETAKRRLQWMSIHVP
FT                   GWQQNTTLWVTVWQRWMLVQGCVAPGYVLAPFMTALHDVPDVERFINETTAHPEQGVPY
FT                   AVFRKGAVAKP"
FT   sig_peptide     384843..384908
FT                   /locus_tag="Rpic_4114"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 22"
FT   gene            complement(385400..385879)
FT                   /locus_tag="Rpic_4115"
FT   CDS_pept        complement(385400..385879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4115"
FT                   /product="PEBP family protein"
FT                   /note="PFAM: PEBP family protein; KEGG: rso:RS01998
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4115"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29216"
FT                   /db_xref="InterPro:IPR005247"
FT                   /db_xref="InterPro:IPR008914"
FT                   /db_xref="InterPro:IPR036610"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI15"
FT                   /protein_id="ACD29216.1"
FT                   /translation="MTLALTSPAFAAGGEIPSRLTCEGADTSPPLAWTGAPAGTRSLAL
FT                   IVDDPDAPDPAAPKMTWVHWVLYNIPPGTTSLAEDASRKGLPPGARPGNNDWQRTAYGG
FT                   PCPPIGRHRYYHKLYALNVELPELGAPTKAELERAMRGHVLAEAELVGTYQKHKP"
FT   gene            complement(386098..386460)
FT                   /locus_tag="Rpic_4116"
FT   CDS_pept        complement(386098..386460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4116"
FT                   /product="protein of unknown function DUF1304"
FT                   /note="PFAM: protein of unknown function DUF1304; KEGG:
FT                   rso:RS04765 probable transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4116"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29217"
FT                   /db_xref="GOA:B2UI16"
FT                   /db_xref="InterPro:IPR009732"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI16"
FT                   /protein_id="ACD29217.1"
FT                   /translation="MIKTLGLIAYLLVLLIHVYIVVLEMVLWKTRGPKVFRITPEKAAE
FT                   TAAMASNQGLYNGFLVAALVIGLIAPDPAINAAFALFGLICVAVAGIWGAVTVNKRIFF
FT                   VQTVPAATALALGWFA"
FT   gene            386646..387362
FT                   /locus_tag="Rpic_4117"
FT   CDS_pept        386646..387362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4117"
FT                   /product="Carboxymethylenebutenolidase"
FT                   /EC_number="3.1.1.45"
FT                   /note="PFAM: dienelactone hydrolase; KEGG: rso:RS04764
FT                   putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4117"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29218"
FT                   /db_xref="GOA:B2UI17"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI17"
FT                   /protein_id="ACD29218.1"
FT                   /translation="MTASQGSMITFKRPDGQELQGYLAKPAKAEGAPGIVVIQEWWGLN
FT                   DQIRGVADRLARAGYVALVPDLYRGTMTVEEEEAHHLMTNLNFGDAATQDVRGAVQYLK
FT                   QTCGRVGVTGYCMGGALTLLTLSNVPEADAGVVWYGYPPLEYIDASKIKVPVQGHWGTQ
FT                   DTAFKIEGVDALEKKLVDAGVDVDFHRYLAHHAFANETAVGENRIAITQYDPVWAEHAW
FT                   DRALTFFGRTLWPRQG"
FT   gene            387783..388055
FT                   /locus_tag="Rpic_4118"
FT   CDS_pept        387783..388055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4118"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RSc3434 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4118"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29219"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI18"
FT                   /protein_id="ACD29219.1"
FT                   /translation="MTLTKRRVYLDGALEARTFLCRTQAYVCEFGQHRPRLLRQQLMEY
FT                   TGGAYPPAFARGFVDMIGAYLSLALERSDIDPATWELMAEVERLR"
FT   gene            complement(388079..389701)
FT                   /locus_tag="Rpic_4119"
FT   CDS_pept        complement(388079..389701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4119"
FT                   /product="amine oxidase"
FT                   /note="PFAM: amine oxidase; KEGG: rso:RS04763 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4119"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29220"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI19"
FT                   /protein_id="ACD29220.1"
FT                   /translation="MATRRSFLVGAAAAGVAAAGAASWAGFRAFTEITPSVRMPGQTAG
FT                   HQLRDLRVLPAPSETRRVGVAICGSGIGGLSCAWRLAKGGRRDVVVVEGPERYGNAAGG
FT                   AFGTQRFPTGAHYLPLPSMESTHVREMLADFGVIERDPFALRPTYDERVLVHAPDERLW
FT                   LGNRWQDGFVPHEGITEAERAEHTRFFAHIDRLRQTTGADGRRVFAVPTALSSADPAWR
FT                   ALDALTFRDWLHREGYRAATLHWYADYCCRDDYGATADQVSAWAGIAYFASRGGMASNA
FT                   EQGTVLTWPEGLDWMAKRLFEAAGLDEPGRLLQGSAARIGTTNEASARVFADVLQADGR
FT                   VVRLLADHVVSAMPLHVAKHIVDGFDVPAAELPETAPWLLANLLIDGFPPEHDDTPLAW
FT                   DNVVYRGTGLGYVVANHQDIRVGPPAQSVFTAYVALSDMTPKAAREWLLKASPQTLLDR
FT                   ALADLDTVYGIRLRTQIRRADLTLRGHAMAIPTPGFLSRPGIARLRESAGPIHYAHADL
FT                   SGYSVFEEAAWWGDRAARRILGN"
FT   sig_peptide     complement(389636..389701)
FT                   /locus_tag="Rpic_4119"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.579 at
FT                   residue 22"
FT   gene            complement(389701..391278)
FT                   /locus_tag="Rpic_4120"
FT   CDS_pept        complement(389701..391278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4120"
FT                   /product="Spermine synthase"
FT                   /note="PFAM: Spermine synthase; KEGG: rso:RSp1306
FT                   spermidine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4120"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29221"
FT                   /db_xref="GOA:B2UI20"
FT                   /db_xref="InterPro:IPR001045"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030374"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI20"
FT                   /protein_id="ACD29221.1"
FT                   /translation="MSTPQPDATYEPTQPSGRGNALLVLAVFVVASCGLAYELIAGALA
FT                   SYLLGDSILQFSSIIGAYLFAMGIGSWLSRYVADDALLARFVDLELLVGLFGGVSAAAL
FT                   FALFALESAPFRLVLYALVTVIGVLVGMEIPLVMRMLHRRQAKFSDLVSRVLTFDYLGA
FT                   LAVSLLFPLVLAPRLGLVRTGFLFGLFNTAIAVWTLWHFRAELALSARMRTAMAWRAGA
FT                   VAAALLAGFGASDKLTHWSERALFGDEIIHAISSPYQRLVVTRWKDDLRLYINGNLQFS
FT                   SRDEYRYHEALVLPALEAVRGARRVLVLGGGDGLALRQILKYPQIEHVTLVDLDPRMTN
FT                   LFSHAEALVALNQHAFSDPRVTVVNADAAQWMQTATDMFDVAIVDFPDPSNFSIGKLYS
FT                   VPFYRLLSRHVADTGLVVIQATSPYFAPRSYWCVDATLKEAGYRTWPYHALVPSFGEWG
FT                   FILAAPGRADFQPPASYRVPTRFLDADTTHQMFSFAPDMPRPKVEPNRLNNQSLVRYFE
FT                   EDWHGVLR"
FT   gene            391456..391854
FT                   /locus_tag="Rpic_4121"
FT   CDS_pept        391456..391854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4121"
FT                   /product="protein of unknown function DUF350"
FT                   /note="PFAM: protein of unknown function DUF350; KEGG:
FT                   rso:RS05342 probable transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4121"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29222"
FT                   /db_xref="GOA:B2UI21"
FT                   /db_xref="InterPro:IPR007140"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI21"
FT                   /protein_id="ACD29222.1"
FT                   /translation="MPDMTAPVIAYASHLLAGAVVFSGFFFVYLRLTPYDEFKLIREGN
FT                   IAAALSLSGALLGFVLTIASSITHADGLVPFLFWAVMASVVQLIVFLVLTRLMPDYRLQ
FT                   IEHNNIAAGMLFGVSALAVGVINAACLS"
FT   gene            391904..392953
FT                   /locus_tag="Rpic_4122"
FT   CDS_pept        391904..392953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4122"
FT                   /product="putative transmembrane protein"
FT                   /note="KEGG: rso:RS05341 putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4122"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29223"
FT                   /db_xref="GOA:B2UI22"
FT                   /db_xref="InterPro:IPR018649"
FT                   /db_xref="InterPro:IPR033880"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI22"
FT                   /protein_id="ACD29223.1"
FT                   /translation="MSLSSFIKKQFIDILQWTESEDGVLAWRYPMQDMEIQNGGTLVVR
FT                   DSQMAMFVNEGQIADVFGAGTFKLTTQTLPVLTYLKNWDKLFESPFKSDVYYFSTRQQL
FT                   GRRWGTPQPVTVRDKDFGMIRLRAFGVYAYHVADPKLFYQQVSGTRDIYTVDEVEAQLA
FT                   PVIMGAMATAFGESGVPFLDLAANQMLMSNKVREALLPQFTQYGLALDSFQVSSVTLPD
FT                   ELQAALDRRISMDMTGDMQRFTQYQTAESLPLAARNEGGIAGTGAGLAAGLAMGQAMAD
FT                   SLRTAVQGNAGGAAAPAAQSAAAVPAAPAADDPTARLAKLKELLDKGLITQADFDAGKA
FT                   AVLKALTGG"
FT   gene            393041..394486
FT                   /locus_tag="Rpic_4123"
FT   CDS_pept        393041..394486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4123"
FT                   /product="putative transmembrane protein"
FT                   /note="KEGG: rso:RS05340 probable transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4123"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29224"
FT                   /db_xref="GOA:B2UI23"
FT                   /db_xref="InterPro:IPR025235"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI23"
FT                   /protein_id="ACD29224.1"
FT                   /translation="MFHANCPACGAPVELKSAAAVMAVCSFCKSTLLRDGETLSDIGKM
FT                   SAVLEDYARVQIGTTGRYKNKAFTIVGRIQLRYDAGFWNEWYVLFDDGSDGWLAEASGQ
FT                   VTMTFARGTPANAVAFEGLRPGQLYDAEGKQFTLSDVREADCTGGQGELPFRVGEGWHA
FT                   RVADGRREDAFITLDYSDGTAPALYVGEATTLDVLECQLLRTDAEIKETAGRIPGKLTN
FT                   LDCPQCGTSIPFSPGVTGHVLCPGCGAAIDAATPRGDIIARARSVPQVATTLELGDKAL
FT                   IDGLQWQVIGVMRRAVVDGGGEWFEYLLYTPKRGFSWMVETDDGWFRANVLDRWPTRND
FT                   GRTAVLDGKVYARDEDYTSRVTYAAGAFNWRVQTGDQTRVVEYTAGGESLAAESDAHEL
FT                   TWSKSTPVSAAQIKAWFGKVVAEPAKASSNYMTVAVVACVLLGLLNLVPFFMAPGSVFG
FT                   ITFFAALLLLVPAWLVAKIGGGE"
FT   gene            394483..394671
FT                   /locus_tag="Rpic_4124"
FT   CDS_pept        394483..394671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4124"
FT                   /product="putative serine-rich transmembrane protein"
FT                   /note="KEGG: rso:RS05339 probable serine-rich transmembrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4124"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29225"
FT                   /db_xref="GOA:B2UI24"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI24"
FT                   /protein_id="ACD29225.1"
FT                   /translation="MKNWFVLYAVAVVIGATYMDWKAGFAAPRTPSYGSSSGGSSSYWG
FT                   GSSGGSGYGGGFSGGHK"
FT   gene            394668..395093
FT                   /locus_tag="Rpic_4125"
FT   CDS_pept        394668..395093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4125"
FT                   /product="S-adenosylmethionine decarboxylase proenzyme"
FT                   /note="TIGRFAM: S-adenosylmethionine decarboxylase
FT                   proenzyme; PFAM: S-adenosylmethionine decarboxylase
FT                   related; KEGG: rso:RS05338 putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4125"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29226"
FT                   /db_xref="GOA:B2UI25"
FT                   /db_xref="InterPro:IPR003826"
FT                   /db_xref="InterPro:IPR016067"
FT                   /db_xref="InterPro:IPR017716"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI25"
FT                   /protein_id="ACD29226.1"
FT                   /translation="MTRTDAALSVEEAPAAVGEHLLLDLYGVAPVLLRDAATLETALRD
FT                   AANALGATILHAHLHRFDSVRAGLPGGEQGGVTGVLLLAESHLSIHTWPEHGFAAIDAF
FT                   MCGTGTTHAARAVFERALAPERVDVRVARRGGEPAPH"
FT   gene            complement(395095..396141)
FT                   /locus_tag="Rpic_4126"
FT   CDS_pept        complement(395095..396141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4126"
FT                   /product="diguanylate cyclase with GAF sensor"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; GAF domain protein; KEGG: pen:PSEEN2246
FT                   diguanylate cyclase (GGDEF domain)"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4126"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29227"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI26"
FT                   /protein_id="ACD29227.1"
FT                   /translation="MKPAPIPTNEPERLASLQDMLLLSTPDEELFDRVTRTTKRVFDAP
FT                   IVLVSLIDAQRQWFKSCIGLNVRETGRDISFCGHAVAEDQMLVIPDTKADPRFADNPLV
FT                   TGAPHIRFYAGRPVRNLSGYAVGTLCVLDKKPRSFDQAERELLNDLASWVESGFREREL
FT                   SETQRSILTELQIARHESLTDPMLGIWNRRAAMELLTRECGHAMRYGQPLSLLVVDVDH
FT                   FKRVNDTYGHPVGDAVLVEIARTLRVNSRPIDAVGRYGGEEFLVVLPDTTTLQASDIAE
FT                   RLRSAVESLEIATPEANIRSSISVGLASCEPEKNLCTPTDLIMRADAALLAAKRLGRNR
FT                   VIFDGQPV"
FT   gene            complement(396242..397627)
FT                   /locus_tag="Rpic_4127"
FT   CDS_pept        complement(396242..397627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4127"
FT                   /product="fumarate hydratase, class II"
FT                   /note="TIGRFAM: fumarate hydratase, class II; PFAM:
FT                   fumarate lyase; KEGG: rso:RSp1279 fumarate hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4127"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29228"
FT                   /db_xref="GOA:B2UI27"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR005677"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR018951"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI27"
FT                   /protein_id="ACD29228.1"
FT                   /translation="MTTRTERDTFGPIEVPADHLWGAQTQRSLQNFDIAGDRMPRELID
FT                   ALARIKRASATVNQRLGLLSADKANAIVGAADEVIAGKHPNEFPLVVWQTGSGTQTNMN
FT                   MNEVLANRASELLGGERGEARLVHPNDDVNRSQSSNDVFPTAMHVAAVTAITHHLIPSL
FT                   RTLRETLAKKAADFNDIIKIGRTHLQDATPLTLGQEFSGYVAQLQHNETHLNAALPHLC
FT                   ELALGGTAVGTGLNAPAGYAEQVAEELAQLTGLPFITSPNKFETMASADGLVHAHGALK
FT                   TLAASLTKIANDIRWLASGPRSGLGEISIPENEPGSSIMPGKVNPTQSEAVTMLCAQVY
FT                   GNDVAVNVGGASGNFELNVFRPMIAYNFLHSVRLLADGMRSFNDHCAAGIEPNRDRIDE
FT                   LVQRSLMLVTALNPHIGYDKSAQIAKKAHKEGTSLREAALALGYVTSEQFDAWVRPENM
FT                   VGR"
FT   gene            397763..399235
FT                   /locus_tag="Rpic_4128"
FT   CDS_pept        397763..399235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4128"
FT                   /product="drug resistance transporter, EmrB/QacA subfamily"
FT                   /note="TIGRFAM: drug resistance transporter, EmrB/QacA
FT                   subfamily; PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   rso:RS05323 probable transporter transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4128"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29229"
FT                   /db_xref="GOA:B2UI28"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI28"
FT                   /protein_id="ACD29229.1"
FT                   /translation="MTAASHICRFCPRPMPTTPSASLDTSLKPLLWLVAMGLFMQTLDS
FT                   TIVNTALPAMARSLSESPLKMQSVIIAYTLTTAMLMPASGWLADRFGTRKMFFAAIFLF
FT                   TIGSLLCAESRSLTMLIASRVVQGVGGALLMPVGRLTVLRVVPREQFLPAMSFVTIPGL
FT                   IGPLIGPTLGGWLVEAVSWHWIFLINIPVGVIGALVTLKVMPDVHAEDDSRFDWSGYLM
FT                   LAFGMAAVSFSLDGLSELGFQHATVLVLLVFGLAALTAYWLHAGRVAGPLFPRTLFGIP
FT                   SFSIGVLGNLFARIGSGGMPFLIPLLLQVSLGYTPLQAGLMMVPVAAAGMAAKPLGTWA
FT                   IKRYGYRRMLSVNTVMVGLMMASFAVMTPNVPVWLRIVQLAIFGTFNSMQFTAMNTLTL
FT                   KDLTGPLASAGNSMLSMVMMLSMSLGVAAAGALLTGFTDFTAGPEGRDTLAAFHKTFVC
FT                   VGVMTCAAAWIFAQLSRFESTHVVKRPEMEVH"
FT   gene            complement(399261..401411)
FT                   /locus_tag="Rpic_4129"
FT   CDS_pept        complement(399261..401411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4129"
FT                   /product="UvrD/REP helicase"
FT                   /note="PFAM: UvrD/REP helicase; KEGG: rso:RS05321 probable
FT                   ATP-dependent DNA helicase II protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4129"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29230"
FT                   /db_xref="GOA:B2UI29"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI29"
FT                   /protein_id="ACD29230.1"
FT                   /translation="MLAASPTPDTANAPATPGYLAQLNDQQRQAVEFGISGADAAETGP
FT                   LLVLAGAGSGKTHTLGWRVAHLVANGADPQRILLLTFSRRAASELSNRAGHLLARAMQG
FT                   ERSNNALNSAGTSYKTTLPWAGTFHGIGARLLREYAERVGLAPDFTIHDRSDSADLLNV
FT                   VRHELNLSTKERRFPLKQTCIAIYSRAINAESPLNAVLKHHFPWCAMWETQLRTLFDAY
FT                   VEAKQAQHVLDYDDLLLYWHAMVSDAELAAEIGARFDHILVDEYQDTNRLQSSILRALR
FT                   PDGRGVTVVGDDAQSIYAFRAATVRNILDFPRHFSRPAHTVLLERNYRSTQPILDASNG
FT                   VMRFATERFAKTLWTDRASTHRPRLISVRDEAEQARCVAEQVLHHREGGLTLKSQAVLF
FT                   RTASHSAPLEIELTRRNIPFVKYGGLKFLEAAHVKDVLSVLRWAENPRNRIAGFRVIQL
FT                   LPGAGPATAARVLDAMAEAADPIAALLAYEPPARLAGDWSTLMALMQTLRVPKDSLEWA
FT                   GELEAVGAWYSPHMERLHDDAAVRQGDLDQLARMAATYATRERFLTEMTLDPPELTSDE
FT                   SGDPYRDEDYLILSTIHSSKGQEWKAVYVLNAVDGCMPADLGAGSHEELEEERRLLYVA
FT                   MTRAREHLDILVPQRFYVTQQTPNGDRHIYASRTRFIPPALLPLFEACAWPEPEPGADP
FT                   AAEARAAAKVDLSKKMRGYWKK"
FT   gene            complement(401512..401829)
FT                   /locus_tag="Rpic_4130"
FT   CDS_pept        complement(401512..401829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4130"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bam:Bamb_5087 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4130"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29231"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI30"
FT                   /protein_id="ACD29231.1"
FT                   /translation="MPAITLKHLVVATMLMTAAMTASALTTSTFTFTDQDLQGMLAHSQ
FT                   PPQPIQPAKATESASHDRLRVGLSDPGTQLVLPWFLADLVDAVNRRASPQDFAKKLRDG
FT                   I"
FT   sig_peptide     complement(401755..401829)
FT                   /locus_tag="Rpic_4130"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.802 at
FT                   residue 25"
FT   gene            complement(401976..402308)
FT                   /locus_tag="Rpic_4131"
FT   CDS_pept        complement(401976..402308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4131"
FT                   /product="protein of unknown function UPF0060"
FT                   /note="PFAM: protein of unknown function UPF0060; KEGG:
FT                   bur:Bcep18194_A4425 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4131"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29232"
FT                   /db_xref="GOA:B2UI31"
FT                   /db_xref="InterPro:IPR003844"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2UI31"
FT                   /protein_id="ACD29232.1"
FT                   /translation="MELLRIAVLFAFTAVAEIVGCYLPWLVLRQGKPFWLLLPAAASLA
FT                   LFAWLLTLHPAAAGRTYAAYGGVYIAVALVWLRLVDGVALTRWDVGGAAIALTGMAVIA
FT                   LQPQAN"
FT   gene            complement(402391..402804)
FT                   /locus_tag="Rpic_4132"
FT   CDS_pept        complement(402391..402804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4132"
FT                   /product="PfkB domain protein"
FT                   /note="KEGG: bam:Bamb_1422 PfkB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4132"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29233"
FT                   /db_xref="GOA:B2UI32"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI32"
FT                   /protein_id="ACD29233.1"
FT                   /translation="MAAITSVIKVSDEDLRQLFPGDADPLTTLRTLAPQADILLTLGAD
FT                   GMEWLTAAHGGQDDARITQPAFTVPVADTVGCGDAAMGAWLASQLQSPGAPVQAHLRQA
FT                   AAAAALTATRAGAFAGTQAEIDALLQAHAASPA"
FT   gene            complement(402932..403954)
FT                   /locus_tag="Rpic_4133"
FT   CDS_pept        complement(402932..403954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4133"
FT                   /product="GumN family protein"
FT                   /note="PFAM: GumN family protein; KEGG: aav:Aave_0743 GumN
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4133"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29234"
FT                   /db_xref="InterPro:IPR002816"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI33"
FT                   /protein_id="ACD29234.1"
FT                   /translation="MARNRTTWRALTAAFFLLTGVGTAAAQDTTPVQAPAPTPNCPPPA
FT                   SSFIPKDGWTAAAQRATDHGLLWRIEKNGHTSWLYGTIHVARADWMLPGPTVRSALQQV
FT                   DSIALELDLLDKDTDRTPLTAQNSAEDRRLLTGRRGERFNKLLSAACLPDTALTQIRKF
FT                   QPTMQLASLAVLGVRTDGLYPDFGIDLFLTTYAKSVHLPIVPLETLAQQVRVLNEIVPK
FT                   NEVAQQFDTVLDAIESGEARTQTLTLANAWADSDLSTLEHYPQWCDCLKTASDKRAFQR
FT                   LVTHRNRAMAENIARVHNSGQRVFGAVGALHMIGPKGIPALLAARGYKVTPVLPAITPR
FT                   "
FT   sig_peptide     complement(403874..403954)
FT                   /locus_tag="Rpic_4133"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.980 at
FT                   residue 27"
FT   gene            complement(404038..405219)
FT                   /locus_tag="Rpic_4134"
FT   CDS_pept        complement(404038..405219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4134"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RS05318 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4134"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29235"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI34"
FT                   /protein_id="ACD29235.1"
FT                   /translation="MDSDTDTGRFSFHRQDLANTLCDSLEGKGLADARSGLFLAAPRRT
FT                   GKSTFLREDLVPEVERRKWIAIYVDLWADRARDPGLLIADAIKSKLAQFDGPIAKLAKQ
FT                   AGMEKVDVLRTFTFNLGKIGLPPGITLADALDVLYKAVQRPVVLIIDEAQHALSTEAGT
FT                   NAMFALKAARDQMNQGVDEPRLFLVFTGSNRDKLANLLLNRTQPFFGSRVTNFPLLGRP
FT                   YVSAYTAWVNQHLAPDNQFKEDDMFAAFQLVGHRPEMLKGIVSEIALELGEAASLGELL
FT                   KRGAQGFRDRIWGEIESDYSALTEIQRAVLAVLIERGQGYSPFSEDSMKAYAAKLGHSE
FT                   FSTATVQAALDALRDKNLIWKESRGAYALEDESLALWFSETRGAHAVPPKLST"
FT   gene            405407..405808
FT                   /locus_tag="Rpic_4135"
FT   CDS_pept        405407..405808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4135"
FT                   /product="putative transmembrane protein"
FT                   /note="KEGG: rso:RS05317 probable transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4135"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29236"
FT                   /db_xref="GOA:B2UI35"
FT                   /db_xref="InterPro:IPR021333"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI35"
FT                   /protein_id="ACD29236.1"
FT                   /translation="MLHRRWLFLVWLAIVLNVLSPVLASARAAATGTLDVELCSATAPH
FT                   GSTVQVAIDLQGDGSADDSTAHHGVAHCLYCPGFAAGLALASVPALDVPSAHFVYRVRQ
FT                   PATPAPVYARSALRVAGSRAPPVSPSLSI"
FT   sig_peptide     405407..405496
FT                   /locus_tag="Rpic_4135"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.318 at
FT                   residue 30"
FT   gene            405891..408209
FT                   /locus_tag="Rpic_4136"
FT   CDS_pept        405891..408209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4136"
FT                   /product="TonB-dependent receptor"
FT                   /note="PFAM: TonB-dependent receptor; TonB-dependent
FT                   receptor plug; KEGG: rso:RS05316 putative ferrisiderophore
FT                   receptor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4136"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29237"
FT                   /db_xref="GOA:B2UI36"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI36"
FT                   /protein_id="ACD29237.1"
FT                   /translation="MSFHKRAGAAALKRTLVCRAALALSAAAPLSAFAAEDAASVPAPV
FT                   TQELAPTVVRANANPAPFARNTPAVVQSVTADQLADRNVVTAEDAVKYQPNVMVRRRFI
FT                   GDRNSIFAGRDFNEIQSARGLLYADGILLSNLLGSSYSYPPRWSMVGPDELARVDILYG
FT                   PFSALLPGNSMGTTIAMTLRRPEKFEAAAQTQIMSQHYNDAYGFSRNVTGNHESASLGD
FT                   RIGKFWYALSVDRLENDSQPMQYATPNSRFTAGGTPVPVTGARQDLGPNGQPRVILGPQ
FT                   MLERTQQLQETLRFGYVFSDSLEASLTLGHWENHFNDQALSFLRDAAGNTVTGGNVLIN
FT                   GTPYTIAPNTFAPQNGDQENWLYGLGVKGKIGGWKIDTNASAYNVSRDILRASNTAAGN
FT                   GPGTVFYGDGTGWSNFDIKATSPTVSGHTFTTGYHYDQYHLRNQTFNASNWSTETLSTL
FT                   KSSYQGDTQTQAVFLQDAWAFAPRWLATLGLRYESWRAYNGQLGNGTSALGYASRTEDA
FT                   FSPKAAIQWQATQDTLLRLSYGCAVRFPTVAELFQGTISGNTIVNNDPNLKPERANDFD
FT                   FTVEQAVPYGVLRTSLFQSDVRDSIYTQTNITVTPNVTNVQNVDRVRTRGIELAYSGQE
FT                   VLQDAGVRGVDVEANVAFTQSKTLADAANPTYVDKTWPRMPRVRANLFASWHATPDWTV
FT                   GAGVRYSGRQYGTLDNTDVLPNVYGGTSSFFTVDLKASYRIDKHITLALGVDNLTDRRY
FT                   FVYHPYPSRTFYGQLKWRL"
FT   sig_peptide     405891..405995
FT                   /locus_tag="Rpic_4136"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 35"
FT   gene            408197..409462
FT                   /locus_tag="Rpic_4137"
FT   CDS_pept        408197..409462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4137"
FT                   /product="glycosyl hydrolase BNR repeat-containing protein"
FT                   /note="PFAM: glycosyl hydrolase BNR repeat-containing
FT                   protein; KEGG: rso:RS05315 putative signal peptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4137"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29238"
FT                   /db_xref="GOA:B2UI37"
FT                   /db_xref="InterPro:IPR026856"
FT                   /db_xref="InterPro:IPR036278"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI37"
FT                   /protein_id="ACD29238.1"
FT                   /translation="MASVMQSIPRFVAGALLTLAATVAPAHEGHDHGAMAAKPAAKPQL
FT                   ATTAAFDKAGRLWVTWAEGQHVVVASSGDLGKTLSAPQRVNPQPEPIYTDGENRPKVIA
FT                   SPDGALYVSWSRPLDAPYTGFVRFSRSLDGGRTWSAPVTVHHDRQPITHRFDSIAVDGA
FT                   GRIFVTWIDKRDLLLAQAAKQPYAGAAVYYTVSTDRGATFAPERKVIDQTCECCRIALA
FT                   PDADGHMLALWRNVFAGQIRDHALATLPIGNTPLAITRATFSEWRVDACPHHGPALAVT
FT                   ADGVRHMAWFSVLQDKPGLFYSRLSADGKPIGGAWAFGGSAQAGAQASHPAMLAADGAL
FT                   WLAWKQFADDRMQILLRRSTDGGAHWTAPASAANTDSGSDHPQLLARDGHVYLSWRTQA
FT                   EGYRLIDISNVSPSNPSLEASK"
FT   sig_peptide     408197..408283
FT                   /locus_tag="Rpic_4137"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.800) with cleavage site probability 0.719 at
FT                   residue 29"
FT   gene            409459..409965
FT                   /locus_tag="Rpic_4138"
FT   CDS_pept        409459..409965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4138"
FT                   /product="putative signal peptide protein"
FT                   /note="KEGG: rso:RS05314 probable signal peptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4138"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29239"
FT                   /db_xref="GOA:B2UI38"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI38"
FT                   /protein_id="ACD29239.1"
FT                   /translation="MNTRWKSFAMGLALSAAAFTAQAAGALQFQPLHARDVPTLLQTPH
FT                   ARPLIVEIWSLECSYCRENIARIAQWRRTAKQTVDVVMVSMDGPDQAEMLNRALAPLAR
FT                   DGRIGLARVPQYTNAEDMPERLRAALDPGWQGEMPRTIILRPDGKRHASSGLLTPQALD
FT                   TALRD"
FT   sig_peptide     409459..409530
FT                   /locus_tag="Rpic_4138"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.980 at
FT                   residue 24"
FT   gene            complement(410199..410477)
FT                   /locus_tag="Rpic_4139"
FT   CDS_pept        complement(410199..410477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4139"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4139"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29240"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI39"
FT                   /protein_id="ACD29240.1"
FT                   /translation="MSHMQPHPTRRPPAPRAYRYPLSHRATLSAWHAHITETPSAEPEI
FT                   AGAQAVFYIARSVAVLLAAVAVGLGAASNDAERPSTAYPSSSQATTR"
FT   gene            complement(410495..411253)
FT                   /locus_tag="Rpic_4140"
FT   CDS_pept        complement(410495..411253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4140"
FT                   /product="protein of unknown function DUF81"
FT                   /note="PFAM: protein of unknown function DUF81; KEGG:
FT                   rso:RS05313 probable integral membrane transmembrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4140"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29241"
FT                   /db_xref="GOA:B2UI40"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI40"
FT                   /protein_id="ACD29241.1"
FT                   /translation="MESATLLLFGAGLLAGMMNALAGGGSFVTLPALMFAGVPSVFANA
FT                   SSTVALLPGAATSAWAYRADYRGFGHVSMRAMVGISLVGGLFGALLLMNTSSRAFDFIV
FT                   PWLLLVGSLAFTFGKQVGVWLRQRVQIGRTTLLVAQGALAIYGGYFGGAVGIMMMAVWA
FT                   LFGHDDIKALNASRTLLVGATNLVAVACFALANMVWWPQTLVMLVAAALGGHLGAHVGK
FT                   RLPVPVVRALISTFGFSMTALLFWRAWSHA"
FT   sig_peptide     complement(411185..411253)
FT                   /locus_tag="Rpic_4140"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.985 at
FT                   residue 23"
FT   gene            411384..412268
FT                   /locus_tag="Rpic_4141"
FT   CDS_pept        411384..412268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4141"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: rso:RS05312 probable transcription
FT                   regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4141"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29242"
FT                   /db_xref="GOA:B2UI41"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI41"
FT                   /protein_id="ACD29242.1"
FT                   /translation="MRFDLTDLRLFLHTAEAGSITAGAERAHLTLASASARIRGMEDAL
FT                   GAPLLTRNRRGVETTAAGRTLVHHARVVLQQMDRMRGELGEYARGLKGYVRLLSNTAAM
FT                   TEFLPETLSAFLAAHPEVDVDLEELVSHEIVEAIAQGRADIGIVNDAVDLSGLETFPFR
FT                   HDRLVLVTAREHPLAERRELAFVETLQEDFVGLTGDNALQAYLAGHAARAGHRLKYRVR
FT                   LRSFDAVCRMVERNVGVGVIPEHAAIRLQRSMGIRRVRLTDAWATRLLRICVRHFDDLP
FT                   VFARQLIEHLREA"
FT   gene            412413..412934
FT                   /locus_tag="Rpic_4142"
FT   CDS_pept        412413..412934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4142"
FT                   /product="putative transmembrane protein"
FT                   /note="KEGG: rso:RS05311 probable transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4142"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29243"
FT                   /db_xref="GOA:B2UI42"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI42"
FT                   /protein_id="ACD29243.1"
FT                   /translation="MASAGVPPDVPPIGLLHAARALRIYRRHEINALAWIALGVCLRSP
FT                   APMVAISVALLIVCAWSLTRHIQYMKPLYELPVFSRLLTHSGMAFAAVNAALLAVELAT
FT                   GAGRGAWFDADGWLAPAWPQILPDMAGTIELMLVSAQWIVVLGVVVAATAWAWLSLGGG
FT                   RSLRFPPRSQ"
FT   gene            413084..414781
FT                   /locus_tag="Rpic_4143"
FT   CDS_pept        413084..414781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4143"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   rso:RS05310 probable acetyl-coenzyme A synthetase
FT                   (acetate--CoA ligase) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4143"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29244"
FT                   /db_xref="GOA:B2UI43"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI43"
FT                   /protein_id="ACD29244.1"
FT                   /translation="MTSLDAFLRCRDFLLAHREDYDTAVRDFAWPQLDRFNWALDYFDA
FT                   MARGNDAVALWVVDDQGNETRLSFAQMAERSARVANHLRALGVQRGDRILLMLGNVPGL
FT                   WDVMLASIKIGAVIIPATTLLTAEDLRERIAMGEVSHVVVGGADCAKLDAVSGTFTRIA
FT                   VGTDKAPAGWHRFEDAYDASAEFTPDAPTQASDPLLLYFTSGTTSKPKLVMHTHASYPV
FT                   GHLSTLYWIGLRPGDVHWNISSPGWAKHAWSCFFAPWNAGATVFIYNYARFEPKAVLDV
FT                   LCRAKVTTLCAPPTVWRMLIQEDLAAWKPALRELVGAGEPLNPEVIERVRAAWGITIRD
FT                   GYGQTETTCQIGNSPGQRVQPGSMGRPLPGYRITLRDPDGHEAEEGEICIELNSRPTGL
FT                   MEGYAGNADKTAEAMRGGVYHTSDIAARDASGYLTYVGRADDVFKASDYRVSPFELESV
FT                   LIEHPAIAEAAVVPSPDPLRLAVPKAFLVLRAGHEAGPELARDILGFCRSRLASYKRVR
FT                   RIEFADLPKTISGKIRRVELRMREAARSENTAGVRNLQEYWEEDFPGD"
FT   gene            complement(414858..415199)
FT                   /locus_tag="Rpic_4144"
FT   CDS_pept        complement(414858..415199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4144"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RS05307 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4144"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29245"
FT                   /db_xref="InterPro:IPR009962"
FT                   /db_xref="InterPro:IPR036692"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI44"
FT                   /protein_id="ACD29245.1"
FT                   /translation="MNISFTGKTFRSVGDLFFQAIVDGKVVSCFVTSEALSLCDCAHQK
FT                   ITAEEVYRNYRDWIELAASDLIRAGSLAPVIVRGRDLAASRASLPHGGVPAYDLDRARQ
FT                   LRLVPRSSR"
FT   gene            complement(415470..415670)
FT                   /locus_tag="Rpic_4145"
FT   CDS_pept        complement(415470..415670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4145"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4145"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29246"
FT                   /db_xref="GOA:B2UI45"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI45"
FT                   /protein_id="ACD29246.1"
FT                   /translation="MGTIKRETAGLTARLGWERHPANWQMIPTRRRLFQTRLPATRAST
FT                   ILLWLLAISITVGVGLLHRLW"
FT   gene            416089..417147
FT                   /locus_tag="Rpic_4146"
FT   CDS_pept        416089..417147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4146"
FT                   /product="putative signal peptide protein"
FT                   /note="KEGG: rso:RS05306 probable signal peptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4146"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29247"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI46"
FT                   /protein_id="ACD29247.1"
FT                   /translation="MTQARRARSNRAFAEFGQGGRAVLVAWAALVAGAAAHAAAPSLAA
FT                   RRAAVQSTLAHAGSCQRLGDYYWEIGDAHGELIHGQQGQRIGANKTVRLASASKWIFGA
FT                   YVVERAQGKPTPAEIDALTMRSGYDGLNPLLCNRNDTVQSCFARGRNATFTPGHVGRFS
FT                   YNGGHDQKLLIDLGLGRADAEALNNDLDHQLANAPGLRDAGKPLGIRYLAPEPGGGMIA
FT                   TPAAYGQFLRRLIRGEYQLGRMLGQHAVCTEPGTCPTAVSTPAALPWHYALNYWIEDQP
FT                   GGDGAFSSAGAFGFYPWITADKRYYGMLVRETLGPRAYVRSAACGALIRRAFAEGKPQH
FT                   SAEGAGSADFAD"
FT   sig_peptide     416089..416205
FT                   /locus_tag="Rpic_4146"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.977 at
FT                   residue 39"
FT   gene            417286..418397
FT                   /pseudo
FT                   /locus_tag="Rpic_4147"
FT   gene            418399..418761
FT                   /pseudo
FT                   /locus_tag="Rpic_4148"
FT   gene            complement(418799..418930)
FT                   /locus_tag="Rpic_4149"
FT   CDS_pept        complement(418799..418930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4149"
FT                   /product="putative lipoprotein transmembrane"
FT                   /note="KEGG: rso:RS05305 probable lipoprotein
FT                   transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4149"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29248"
FT                   /db_xref="GOA:B2UI47"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI47"
FT                   /protein_id="ACD29248.1"
FT                   /translation="MKRTIALLILAAAATSALSACVVVPAGGYYDRPHYYHPYYRGY"
FT   sig_peptide     complement(418868..418930)
FT                   /locus_tag="Rpic_4149"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.771 at
FT                   residue 21"
FT   gene            complement(418995..419120)
FT                   /locus_tag="Rpic_4150"
FT   CDS_pept        complement(418995..419120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4150"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29249"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI48"
FT                   /protein_id="ACD29249.1"
FT                   /translation="MLLHSLIAKVTANYGGPGTPVANVGRAVDYRPWRHSFSYKR"
FT   gene            419356..419502
FT                   /locus_tag="Rpic_4151"
FT   CDS_pept        419356..419502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4151"
FT                   /product="putative transmembrane protein"
FT                   /note="KEGG: rso:RS05304 probable transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4151"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29250"
FT                   /db_xref="GOA:B2UI49"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI49"
FT                   /protein_id="ACD29250.1"
FT                   /translation="MTNVLESTIAWAAPCLIATAIVVPVMWNKLRTRRLLEAMHQAREH
FT                   RDE"
FT   gene            complement(419646..420272)
FT                   /locus_tag="Rpic_4152"
FT   CDS_pept        complement(419646..420272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4152"
FT                   /product="NAD(P)H dehydrogenase (quinone)"
FT                   /note="PFAM: NAD(P)H dehydrogenase (quinone);
FT                   NADPH-dependent FMN reductase; KEGG: rso:RSp1258 putative
FT                   [acyl-carrier-protein] phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4152"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29251"
FT                   /db_xref="GOA:B2UI50"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR023048"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI50"
FT                   /protein_id="ACD29251.1"
FT                   /translation="MQVLHIDSSILGDASASRLLSAAIVDELRRENPSATVVHRDLSVE
FT                   AIPHLDGAIAAGFRATGADDFDDATRAEHARSETLVNELLASDVIVVGAPMYNFSVPSQ
FT                   LKAWIDRVAQAGRTFKYTETGPVGLAGGKKVIVASTRGGMYSAGPAAAMDFQEAYLKTV
FT                   FGFFGITDVQFVRAERLAMGPDARAQALEAAHAAMRDVVSQAVAA"
FT   gene            420400..421347
FT                   /locus_tag="Rpic_4153"
FT   CDS_pept        420400..421347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4153"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: rso:RS05302 probable transcription
FT                   regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4153"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29252"
FT                   /db_xref="GOA:B2UI51"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI51"
FT                   /protein_id="ACD29252.1"
FT                   /translation="MEDLNDLVLFASVVTHGSFSGAARALGIPKSRVSRRVADLETRLG
FT                   VRLLQRSTRAVHVTDVGSAFFTHCESMTQAARAAFEVAEHAGEKPSGRLRVSCPVGVAH
FT                   VFIAPVLSKFLRAQPDVRLELDVTNRRVDVIGDGYDVALRVRSTLDDSNLVVRSFGVSD
FT                   QVLVASPSFVAEHGPFETPESMRGVMGVGVDGAAGERTRWRLTAPEGGAVDIEYTPALV
FT                   TDDLYLMGQTALAGIGVAQLPFNLCAEPVRDGRLVVLLPEYRLPVHQFHAVFPSRRGLV
FT                   PAVRVFIEFLAEELPGMTANVSRCYEDIVRQPDR"
FT   sig_peptide     420400..420477
FT                   /locus_tag="Rpic_4153"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.609) with cleavage site probability 0.585 at
FT                   residue 26"
FT   gene            421438..423018
FT                   /locus_tag="Rpic_4154"
FT   CDS_pept        421438..423018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4154"
FT                   /product="drug resistance transporter, EmrB/QacA subfamily"
FT                   /note="TIGRFAM: drug resistance transporter, EmrB/QacA
FT                   subfamily; PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   rso:RS05301 probable integral membrane transmembrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4154"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29253"
FT                   /db_xref="GOA:B2UI52"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI52"
FT                   /protein_id="ACD29253.1"
FT                   /translation="MSSRPSIEPPKPDTPTAPIASASSPLDALPVPEIPVMAVMGGLML
FT                   AILLGALEQTIVAVALPVIAGEFNGFALMAWLVSAYLVASTVVTPIYGKLSDLYGRRAM
FT                   LTTAIVLFVLASVACAVATSMPMLLFARVLQGLGGGGLISVSQATIADVVPLRERGRYQ
FT                   GYVSGMWAMASLAGPVIGGYLTHYLSWRWIFWINLPLGIVALFVVRRTLRHLPVAHQRR
FT                   PIDVPGVVLFAGGLTALLLMITRVGQGTPLTQPENLGLLAAAVVLLGAFVWQENRAVEP
FT                   IIPLSMFRVRTVTICCLALFLCFFQLIATSVLMPLRFQMVAGASPDAAALRLVPLTLSI
FT                   PLGAFIAGKWMTHSGRYKPLMLGGACVVPFAVASLGLLDPHSVLALTLAMIVLGLSIGV
FT                   QFPTGLVATQNAVSPQTVGLATALTAFSRLLGGAVGVAVLTSVLIALLRQAAPEAQVAA
FT                   GGDVLMDLFHAALASSGADAQALQRAGESAFRHLFFFAAAVSVISPLLVMRLEEKALRG
FT                   KVSLAEAVE"
FT   gene            complement(423030..423926)
FT                   /locus_tag="Rpic_4155"
FT   CDS_pept        complement(423030..423926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4155"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RS05300 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4155"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29254"
FT                   /db_xref="InterPro:IPR018713"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI53"
FT                   /protein_id="ACD29254.1"
FT                   /translation="MPSPLVAIRERIANQVRGLTRATGSLTLDIASPPGDPGLFGPDAV
FT                   CWKVHADFPAMMAGGISALLLQALHPRALAGVWDHSNFREDLQGRLGRTAQFVAGTTYG
FT                   SRHDALALIDRVKTIHDRVQGIAPDGRPYSANDPDLLTWVHVAEMSSFLAGYLRYADAS
FT                   LSGAQQDRYFEETALVAEMLGAQDVPKSRAAVQTYLHAMRAELVASDRTRTVVEVLMTW
FT                   QAPRPGLRPAVRLFLDAGIQLLPPWAIQMLDLKRPPLQAAFASAAMRTVAPTLRWALYE
FT                   GSVARRARRRALTPATS"
FT   gene            424111..425040
FT                   /locus_tag="Rpic_4156"
FT   CDS_pept        424111..425040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4156"
FT                   /product="putative signal peptide protein"
FT                   /note="KEGG: rso:RS03196 probable signal peptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4156"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29255"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI54"
FT                   /protein_id="ACD29255.1"
FT                   /translation="MPMTPHRHTAWLDWLVLSALLVGLCLSLPGRAADNAQGLRDKYQS
FT                   VAPQLADNVFHRPLVLESTEAPDRLKSDIYSVLDYPFATVKGALGDPEHGAANWCDVLI
FT                   LHLNIKYCHATHGADSSVLNVNLGRKVEDSLSASYRLEFGYHPVVSSADYFRVELSAAS
FT                   GPLSTRDYHIMLEAIPAPGTGNHTFLHLTYAYGYGAAGRLAMRTYLATVGSGKVGFTKT
FT                   AESSPGAEPEFVGGVRGLLERNTMRYYLAIDAYLKSLSAPPDKRLQQRLNTWFNATEQY
FT                   ARQLHEVERQDYLQMKHHEVERQQQAAQ"
FT   sig_peptide     424111..424209
FT                   /locus_tag="Rpic_4156"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.992 at
FT                   residue 33"
FT   gene            complement(425045..425476)
FT                   /locus_tag="Rpic_4157"
FT   CDS_pept        complement(425045..425476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4157"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RS03194 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4157"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29256"
FT                   /db_xref="InterPro:IPR025688"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI55"
FT                   /protein_id="ACD29256.1"
FT                   /translation="MPTLQHVDLRTDPAARPFVKDETVHVDFAAQAGELMSLEGPNRYA
FT                   PGDALITGSTGDRWVVSRERFDAKYVPADASFAHGQAGAYRNRPSVVLAKQMREAFSLA
FT                   RSEAGDVLHGHPGDWVLQYAPGDYGVVQAQRFAKVYRPA"
FT   gene            complement(425737..426768)
FT                   /locus_tag="Rpic_4158"
FT   CDS_pept        complement(425737..426768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4158"
FT                   /product="cytochrome bd ubiquinol oxidase subunit II"
FT                   /note="PFAM: cytochrome bd ubiquinol oxidase subunit II;
FT                   KEGG: rso:RS03187 putative transmembrane cytochrome BD-II
FT                   oxidase (subunit II) oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4158"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29257"
FT                   /db_xref="GOA:B2UI56"
FT                   /db_xref="InterPro:IPR003317"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI56"
FT                   /protein_id="ACD29257.1"
FT                   /translation="MSTIPDLTQPAGWLPVVFMALMGIAVLAYVVLDGYDLGVGILLRR
FT                   ADDAEKDTMIASIGPFWDANETWLVLGVGLLLVAFPAAHGEILGALYLPVALMLFGLIL
FT                   RGVAFDFRVKARAHHKPWWNRAFYAGSVIATAAQGLMLGLYITGFQYDAANVIFAICTA
FT                   GGLIAGYLLLGATWLIMKTEGALQLRAVLWARGSLWFTALGVAAVSLATPWVSTRVFDK
FT                   WFALPNIILLAPVPLVTIVLFLLIDWVLRRLPQQIAKGDEHLVWAPFVGTGAIFLLAFN
FT                   GLAYSLFPYLVVDRLDIWQAASAPESLEFMLVGVAIVLPTIVGYTIYSYKVFHGKATEL
FT                   RYY"
FT   gene            complement(426765..428138)
FT                   /locus_tag="Rpic_4159"
FT   CDS_pept        complement(426765..428138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4159"
FT                   /product="cytochrome bd ubiquinol oxidase subunit I"
FT                   /note="PFAM: cytochrome bd ubiquinol oxidase subunit I;
FT                   KEGG: rso:RS03186 putative transmembrane cytochrome BD-II
FT                   oxidase (subunit I) oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4159"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29258"
FT                   /db_xref="GOA:B2UI57"
FT                   /db_xref="InterPro:IPR002585"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI57"
FT                   /protein_id="ACD29258.1"
FT                   /translation="MSLDPVVLARIQFGANITFHILFPTISIALAWVLLFFKLRYRKTG
FT                   DEAWMAAYRLWVKVFALTFALGVVSGVTMSFQFGTNWPGYMNTVGNIAGPLLAYEVLTA
FT                   FFLEASFLGIMLFGTGRVSPRIHTFATFLVALGTTISVFWIIALNSWMQTPAGYVMIDG
FT                   RAHPQSWLAIIFNPSFPYRFTHMLLASGLTVSFLLAGLSAYRWLRNDRGGDVRAAHKTG
FT                   VVLAAMLIPLQIAAGDAHGLNTLEHQPAKLAAIEGIWQTERGVPAVLFGIPDAATRSNR
FT                   HEIAVPKVASLYLTHSLDGEVRGLDQFDQHPPVLPVFFAFRLMVGVGLLMLAVSWTSAW
FT                   RLRRNGELPRWLARTLVAMTFSGWVAVVAGWYVTEIGRQPWLVYGVLTTAQAASSVPAR
FT                   MIGSTLAMYLALYAFLIASYIGVVFYLARKAGGAIDPTDADIPGKHTSELSAPVASHA"
FT   gene            complement(428154..428714)
FT                   /locus_tag="Rpic_4160"
FT   CDS_pept        complement(428154..428714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4160"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RS03185 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4160"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29259"
FT                   /db_xref="GOA:B2UI58"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR026282"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI58"
FT                   /protein_id="ACD29259.1"
FT                   /translation="MQLSPLKQRFVLHFGEMGSRWGINRTVGQIYALLYAAREPINADE
FT                   IAESLGFSRSNVSIGLKELESWKLVRLSHKPGDRREYFSAPDDIWTIFRTLAEERRKRE
FT                   IDPTLSLLRDVMLESPTDPDDRHAQARMKQMYELITLMTNWFDDVQKLDAESLQQLMKM
FT                   GAKVHKLLEMKNKLAVVVGGKSK"
FT   gene            428923..429177
FT                   /locus_tag="Rpic_4161"
FT   CDS_pept        428923..429177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4161"
FT                   /product="Transglycosylase-associated protein"
FT                   /note="PFAM: Transglycosylase-associated protein; KEGG:
FT                   bxe:Bxe_B1859 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4161"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29260"
FT                   /db_xref="GOA:B2UI59"
FT                   /db_xref="InterPro:IPR007341"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI59"
FT                   /protein_id="ACD29260.1"
FT                   /translation="MASHGLIAWLIIGAVAGWLAGILVKGGGFGIFVDIVVGIVGAFIS
FT                   GWLAGVLGISLGGGWIGSIITAVIGAVILLFIIRLIKRA"
FT   gene            429339..429632
FT                   /locus_tag="Rpic_4162"
FT   CDS_pept        429339..429632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4162"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RSc2198 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4162"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29261"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI60"
FT                   /protein_id="ACD29261.1"
FT                   /translation="MSDQLTTAPQELYEGFEIHVVPSPTRANSLRYTYTGYVCHPGADP
FT                   QLPGHVVPFHADGDDTFRSPEEAMEEAVHVARSIVDGTHPDLSVLSIVTHGY"
FT   gene            430017..431339
FT                   /locus_tag="Rpic_4163"
FT   CDS_pept        430017..431339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4163"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   rso:RS03167 probable high affinity nitrate transporter
FT                   transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4163"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29262"
FT                   /db_xref="GOA:B2UI61"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI61"
FT                   /protein_id="ACD29262.1"
FT                   /translation="MTGKATRIDLFSLRTPQMRAFHLTWLAFFVCFYAWFACAPLMPVL
FT                   KGEFHLTPGQIANINIAAVAVTILVRLIVGPLCDRFGPRKTYTGLLLLGAIPVLGVALA
FT                   QSYETFLFFRLAIGAIGASFVITQYHTSVMFAPNVVGTANAAAAGWGNAGGGVAQGTMP
FT                   LLLTAIVMMGVTQSMGWRLAMVVPGVAMLLVAALYWRYTQDCPEGNFSALRAAGKTIEG
FT                   GKKGGWGSFVAAAGNYRVWLLFITYGACFGVEIFIHNIAATYYVDHFGLSLSAAGMAAA
FT                   SFGLLALFARALGGIVSDRVAAKRGLDARTQLLCVLMMGEGLGLFGFAHAGSVPVAILA
FT                   MLGFGLFTHMACGATYALVPFIDRRALGGVAGIIGAGGNAGAVAAGFLLKGMADTQATL
FT                   SILGVLVALSAICAIAVRFSAEHKAREQALYDNTLAAAGNA"
FT   gene            431354..433909
FT                   /locus_tag="Rpic_4164"
FT   CDS_pept        431354..433909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4164"
FT                   /product="nitrite reductase (NAD(P)H), large subunit"
FT                   /note="TIGRFAM: nitrite reductase [NAD(P)H], large subunit;
FT                   PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; nitrite/sulfite reductase hemoprotein
FT                   beta-component ferrodoxin domain protein; nitrite and
FT                   sulphite reductase 4Fe-4S region; BFD domain protein
FT                   [2Fe-2S]-binding domain protein; KEGG: rso:RSp1222 probable
FT                   nitrite reductase NADPH (large subunit) oxidoreductase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4164"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29263"
FT                   /db_xref="GOA:B2UI62"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006066"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR012744"
FT                   /db_xref="InterPro:IPR017121"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041575"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI62"
FT                   /protein_id="ACD29263.1"
FT                   /translation="MTMKIVVIGHGMVGHKFLESLLHAPGHHLQVTVLCEEPRPAYDRV
FT                   HLSEFFTGKTAEELSLVAPGFFDRDDVVLKLNARATAIDITAKTVTASTGEVLPYDKLV
FT                   LASGSSPFVPPVPGRDRKDCFVYRTIEDLEAMAECGQRAKTGVVIGGGLLGLECAKALR
FT                   DMNLQTHVVEFAGRLMAMQVDDGGGRMLRRKIEDLGVTVHTQKNTSEIVDGETATHRLN
FT                   FADGTHLEADMVVFSAGIRPRDELARACGLEVGERGGIVIDSECRTSAPDVYAIGECAL
FT                   WGGKIYGLVAPGYEMARITAKQILAADDASEFSGADMSTKLKLMGVDVASLGDAQGVTP
FT                   GSRSVQFTDERKQIYKKLVVSEDGKYLLGGVLVGDAAEYGTLLQMMLNRIELPEAPEFL
FT                   ILPQADGNARPALGVDALPDSAQICSCNDVSKGALCQAVCAGATTVGALKDATKAGTSC
FT                   GGCVPLMTQVMKAEMKKQGLAVNNHICEHFPYSRQELYHLVRVGRIQSFEALLEAHGSG
FT                   MGCDICKPAVASILASCWNDFVLKKEHASLQDSNDYFLANIQKDGTYSVVPRMPGGEVT
FT                   ADGLIAVGQVAKKYDLYTKITGGQRVDLFGARLEQLPLIWEELIAAGFESGHAYGKSLR
FT                   TVKSCVGSTWCRYGVGDSVGFAIALENRYKGLRSPHKIKFGVSGCTRECAEAQGKDVGI
FT                   IATEKGWNLYVCGNGGMKPRHAELLAADLDQETLIKYVDRFLMFYVRTADRLQRTSTWR
FT                   DNLEGGLDYLKDVVINDKLGIVAELEAEMQHVVDTYQDEWKTAVTNPDVRKRFRHFVNS
FT                   EAKDANVVFVEERGQIRPATVEERAKTRPVRIPVVAEAA"
FT   gene            433936..434274
FT                   /locus_tag="Rpic_4165"
FT   CDS_pept        433936..434274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4165"
FT                   /product="nitrite reductase (NAD(P)H), small subunit"
FT                   /note="TIGRFAM: nitrite reductase [NAD(P)H], small subunit;
FT                   KEGG: rso:RSp1221 probable nitrite reductase NADPH (small
FT                   subunit) oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4165"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29264"
FT                   /db_xref="GOA:B2UI63"
FT                   /db_xref="InterPro:IPR012748"
FT                   /db_xref="InterPro:IPR017881"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI63"
FT                   /protein_id="ACD29264.1"
FT                   /translation="MQASRWTPICALDDIVPNTGVCALVEGDQVAVFRVGGNTTQGVYA
FT                   IGNYDPNSDAAVLSRGLVGNLGERIVVASPIYKQHFDLTTGECLEAPANSVHAYATKVE
FT                   DGKVWVAA"
FT   gene            434314..435546
FT                   /locus_tag="Rpic_4166"
FT   CDS_pept        434314..435546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4166"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: rso:RS03164 probable flavoprotein FAD
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4166"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29265"
FT                   /db_xref="GOA:B2UI64"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041575"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI64"
FT                   /protein_id="ACD29265.1"
FT                   /translation="MNAKTVRPKLVVIGNGMAGMRTVEELLKLAPDLYDITVFGEEPHG
FT                   NYNRILLSPVLAGEKQVDDIMLNTREWYDQNHITLHAGDPVVAIDRPRRTLRSRDGVEM
FT                   RYDRLLIATGSRPFILPVPGHLLPGVIAFRDIQDVETMLEAARNHRHAVVIGGGLLGLE
FT                   AANGLMRQGMDVTVVHLPDSLMERQLDKPAALLLQKALEAKGLRFLLGAHTAELLGTDR
FT                   VSAVRFKDGTEIPADLVVMTAGVRPNIELAKAAGLHCERAIIVDDTLQTYDPRIYAVGE
FT                   CVQHRSATFGLVAPIWDQARVCAAHLAGAGHRRYVQQATATKLKVTGVDLYSAGDFIGG
FT                   DGTEDIVLRDPRRGVYKRLVLKEDRIVGAVLYGDVADGPWYFDLIQREVPITSIRQRLL
FT                   FGRALCEAEAA"
FT   gene            435846..438593
FT                   /locus_tag="Rpic_4167"
FT   CDS_pept        435846..438593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4167"
FT                   /product="Nitrate reductase"
FT                   /EC_number="1.7.99.4"
FT                   /note="PFAM: molybdopterin oxidoreductase; molydopterin
FT                   dinucleotide-binding region; molybdopterin oxidoreductase
FT                   Fe4S4 region; BFD domain protein [2Fe-2S]-binding domain
FT                   protein; KEGG: rso:RSp1219 probable nitrate reductase large
FT                   subunit oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4167"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29266"
FT                   /db_xref="GOA:B2UI65"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR027467"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="InterPro:IPR041957"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI65"
FT                   /protein_id="ACD29266.1"
FT                   /translation="MTTIPIHPVTDAVRTTCPYCGVGCGVLATPQADGSVSIQGDPTHP
FT                   ANAGRLCVKGSALGETVSLDGRLLYPAMRERSRDVDAPEFTKPAPLQRVSWDTALDAVA
FT                   QGFRRIAEEHGPDSVALYVSGQLLTEDYYVANKLMKGFIGTANIDTNSRLCMSSAVAGH
FT                   KRAFGEDLVPVCYDDLETADLIVLVGSNTAWCHPILFQRIMRAKEARPEMKVVVVDPRH
FT                   TATCELADLHLPIKPGTDVSLFNGLLSFLSRRGVVDRNFVTLHTNGPDAALEAAGTESD
FT                   DVEAVAKACKLKLDDLLTFYSWFADTERTITAFSMGVNQSTAGTDKVNSIINCHLLTGR
FT                   IGRAGMGPFSITGQPNAMGGREVGGLANMLAAHMELNDPSHRDLVQTFWASPRMADKMG
FT                   LKAVDLFKAIEDGRVKAVWIMGTNPVVSLPDADQARRALAKCELVVASDIVEATDTTVL
FT                   ADILLPALGWGEKDGTVTNSERRISRQRAFLQAPGEARADWDIIADVARRMGYDGFDFK
FT                   SPRDVFDEHARLSAYANDASGVRRAFHLGGLAGLDAGAYDGMSPVQWPVATSGNGEARL
FT                   FSDGRFAHADGRARFVPTPARAPAHAADGEYPLILNTGRVRDQWHTMTRTGRAPRLADH
FT                   VPEPFVDLHPHDALLAGVREGGLARVSSRWGSVVARVRMTGGIARGSVFVPIHWNGQFA
FT                   SDARVGAVVNPVVDPVSGEPEFKHTPVMVEPFDVAWHGFVLSRRALDTDDATWWTRIQG
FT                   KQFLRYELAGRQHLGSVHDWARTLLGVTDPHADWLEYEDATARVYRAVHVVDDRIEACV
FT                   FLSPRPDLPSRNWLAGLFAQERLEDLDRAGVLLGQPIEAGVDVGPTVCSCFGVGRNTIC
FT                   DAIRTKGLQSTGEITACLKAGGNCGSCVPELKRLLVEARVQQAA"
FT   gene            438704..439318
FT                   /locus_tag="Rpic_4168"
FT   CDS_pept        438704..439318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4168"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RS03158 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4168"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29267"
FT                   /db_xref="InterPro:IPR018715"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI66"
FT                   /protein_id="ACD29267.1"
FT                   /translation="MVAAAIHACTAFAGTRRLAAGPVRDVARVVKIHVDAHPESQVLVF
FT                   DHTTAQPVEFDLRGTVGDVLARLDSTAPSATQPAESESRPRGPGRPKLGVIAREVTLLP
FT                   RHWDWLAAQPGGASVTLRKLVEDARRAAEGADRRRVAQEAAYRFMSAMAGDAAGFEEAT
FT                   RALFAADAVAFESLTHSWPADVRDFARELASRAFNPQQEAA"
FT   gene            439315..440682
FT                   /locus_tag="Rpic_4169"
FT   CDS_pept        439315..440682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4169"
FT                   /product="MATE efflux family protein"
FT                   /note="TIGRFAM: MATE efflux family protein; PFAM: multi
FT                   antimicrobial extrusion protein MatE; KEGG: rso:RS03157
FT                   probable transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4169"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29268"
FT                   /db_xref="GOA:B2UI67"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI67"
FT                   /protein_id="ACD29268.1"
FT                   /translation="MTAPAARPLWRTFIAFLGPLILANILQSLSGTLNNVYVGHMLGVK
FT                   ALAAVSAFFPILFFFIAFIIGLGSGAAVLIGQAWGAKKPEAVKTVAGTTLSVGFIVGLA
FT                   VALLGGPFANALLGWLGTPADILQDATLYASVMLYAMPGLFVYLLATAMMRGVGDTRTP
FT                   LRTLALSTSIGLVLTPTFIRGWFGLPQLGVASGAAATIISFTIALVWLAFFLRRRNHPL
FT                   APDAVLARHLWVDFGVLKTVLKIGVPTGLQLVVISIAELALLSFVNGFGSDATAAYGAG
FT                   TQIISYVQFPAMSIAITASILGAQAIGSGNTERLDAITRTGLWLNVAITGVLVLMALLF
FT                   SRAVIGWFTTSAEVMSLAQSLLHISLWSSVIFGMASVFSGVMRSSGTVMAPTAISILAI
FT                   AAVEVPVAWVLSRHIGTDGIWAAYPAAFLAMFVMQGLYYALVWRRRAQRFGIRRMV"
FT   gene            complement(440739..442001)
FT                   /locus_tag="Rpic_4170"
FT   CDS_pept        complement(440739..442001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4170"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bja:blr5045 putative inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4170"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29269"
FT                   /db_xref="GOA:B2UI68"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI68"
FT                   /protein_id="ACD29269.1"
FT                   /translation="MSDPHDPAVDHLPPGFNRLADSNLAAQSAEQIALAAMPMVAVLTL
FT                   HADASTASWLQVALTLPFVLFAIPIGMLADRWPKRALMADAEAMRALALFVVAGLLAAG
FT                   RLNLAALGVLGFVAVCGTVVFSVAAPALVPSLVPAAMLARANGRIELARTVAFACGPAI
FT                   GGALIGWTGAMAAFVLAAALSTMASAMLAGVTAQEPVARRAAHPLRDIAEGARFVFQHP
FT                   LLRPVFITQFVFTMAFFMVSAIFVPYAAQRLNLTAQAIGLTLGMYGAGMVVGALLAARI
FT                   LARWRFGHVVATGPVCGLAGGVLLAATLWQPWPALAQAGFFLLGCGPILWVVSTTTLRQ
FT                   TVTPPALLARVSAVNVMSYGARPVGAAMAAWLAAHAGVGACLVVAVAGFALQLLCIVQS
FT                   PAVRLVRQPRADDASAGLEPA"
FT   gene            complement(442094..443527)
FT                   /locus_tag="Rpic_4171"
FT   CDS_pept        complement(442094..443527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4171"
FT                   /product="phospholipase D/Transphosphatidylase"
FT                   /note="PFAM: phospholipase D/Transphosphatidylase; KEGG:
FT                   rso:RSp1211 cardiolipin synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4171"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29270"
FT                   /db_xref="GOA:B2UI69"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR022924"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="InterPro:IPR030840"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI69"
FT                   /protein_id="ACD29270.1"
FT                   /translation="MLTNTTAFAAFLFLVHSVGVLAAMHAVLTVRTSQGAIAWAISLVT
FT                   LPEFTLIPYLIFGRSTFAGYVDARRFHNARLREITLSDDWRRLRDHESSVVAPQHTCMQ
FT                   ALPRLTGTPCLARNRVRLLVNGAETFEAIFAAIAQARRVLIVQFFIVHDDTLGRRLAEL
FT                   LLDRARAGVRVYFLFDSIGCHALPRRYVQRLIEGGVHAKPFSTHAGFVNRFQLNFRNHR
FT                   KLVVVDGERAYVGGHNVGNEYMGEKPPLAPWRDTHIEIVGAAVMDLQLTFAEDWYWAAR
FT                   EVPQLIVPELRPEEDMVCQVVASGPADKQETCSLFFMEAIQSARKRLWITSPYFIPDEA
FT                   VFAALRLAVLRGVDVRILIPSRPDHHMVFLASTLYAYQAIRAGVKIYRYLPGFLHQKVV
FT                   LIDDEAAAVGSANLDNRSFRLNFELMIMTADSRFANDVAQMLEVDFAEAARVGRDEYEH
FT                   AHPLRRVIMHVAKLFAPIL"
FT   sig_peptide     complement(443459..443527)
FT                   /locus_tag="Rpic_4171"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.982 at
FT                   residue 23"
FT   gene            443713..445407
FT                   /locus_tag="Rpic_4172"
FT   CDS_pept        443713..445407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4172"
FT                   /product="phospholipase D/Transphosphatidylase"
FT                   /note="PFAM: phospholipase D/Transphosphatidylase; KEGG:
FT                   pol:Bpro_4230 phospholipase D/transphosphatidylase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4172"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29271"
FT                   /db_xref="GOA:B2UI70"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI70"
FT                   /protein_id="ACD29271.1"
FT                   /translation="MQGHPRNHPTASLRAWFTCLAIALLSGCVSLPEHVDRPVTTALPN
FT                   AESATSLGRLAQSNAPSADVSGFRLIPSGEEAYATLLTLADRAERTLDLQYFIIESDNS
FT                   VRELMRHVLAAAERGVRVRMLVDDLHSDGRDLAFLKFSSHKNIDVRLFNPFPGGRMSNL
FT                   TRYLSGAAEFRRVNRRMHNKAFIADNALAVTGGRNLGAEYFTQNQTTNFVDLDVLAAGP
FT                   AVRQLSSAFDAYWNSEFAYPVQALAPEPSTAHPPEPKDGNYPPPVTMPHRPEGPPQQID
FT                   VPTRPVDMGSGSAKPASDQTDLASPAPEQRLPLKPAPRDWFLADQIARGRLRLEWAPAQ
FT                   VIVDRPAKVSGDDVEPGGERLAQTLLRLIDEAEREVVLISPYFVPGKRGVEVAKRMQDR
FT                   GVRLRVLTNSLAATDAPIVHVGYAKYRGELVDDGVELYELRPTLGDRPKMIGTFRSSQA
FT                   SLHVKSIVVDRSTLFVGSMNIDPRSIGLNTETGLIIRSPVLSEAVARLFDDSVRDSAYR
FT                   VTKDDGHLRWTTHENGKEVVVDHEPEVGLGRRTWIQMLAPLTPEELL"
FT   gene            complement(445484..445624)
FT                   /locus_tag="Rpic_4173"
FT   CDS_pept        complement(445484..445624)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4173"
FT                   /product="Entericidin EcnAB"
FT                   /note="PFAM: Entericidin EcnAB; KEGG: rso:RS03154 probable
FT                   lipoprotein transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4173"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29272"
FT                   /db_xref="GOA:B2UI71"
FT                   /db_xref="InterPro:IPR012556"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI71"
FT                   /protein_id="ACD29272.1"
FT                   /translation="MKKLIALLALGCAVLAGCNTMAGMGKDLQTGGQKLENAADNTKQK
FT                   M"
FT   sig_peptide     complement(445556..445624)
FT                   /locus_tag="Rpic_4173"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.875 at
FT                   residue 23"
FT   gene            445916..447484
FT                   /locus_tag="Rpic_4174"
FT   CDS_pept        445916..447484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4174"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: histidine kinase HAMP region domain protein;
FT                   chemotaxis sensory transducer; KEGG: rso:RS03153 putative
FT                   methyl-accepting chemotaxis transducer transmembrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4174"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29273"
FT                   /db_xref="GOA:B2UI72"
FT                   /db_xref="InterPro:IPR003122"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR035440"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI72"
FT                   /protein_id="ACD29273.1"
FT                   /translation="MWKWMDTSIRTRLTFLVAVFAVMIAVVGFAGITTGRATNDDLRAV
FT                   YLEDAKGLDLLAKDTINLLWARIHLTNFDSVSSPEELKKLLADAHTMVNSANDAWAQFM
FT                   KLPIPEADRAQLQAADAARTKFVKTALEPAIAALERSDLTTYRELNTNLVPKLFVDYDT
FT                   ALGPLVGARFKYGQQRFDHSQSRYAMSIWISGGLLAAALVLSIVARGVLGRTVVRPLER
FT                   AIQVFERMASGDLATRMEGQTTAGRRDETARLMHAVSSMQTSLQQIIGQVRTGSDSIAS
FT                   ATKQIAAGNADLSQRTEQQASSLEETASSMEELTSIVKQNADNARQASTLAVSASDIAV
FT                   KGGEVVGRVVDTMAGINESSRKIADIIGVIEGIAFQTNILALNAAVEAARAGEQGRGFA
FT                   VVAGEVRSLAQRSATAAKEIKELIGDSVGRVQNGSTLVAEAGTVIDEVVVAVRRVTDIM
FT                   GEISAASEEQSSGIEQVNQAVTQMDQVTQQNAALVEQAAAAAESLEEQAEALRSAVAVF
FT                   RVEHA"
FT   sig_peptide     445916..446008
FT                   /locus_tag="Rpic_4174"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.943 at
FT                   residue 31"
FT   gene            complement(447541..448956)
FT                   /locus_tag="Rpic_4175"
FT   CDS_pept        complement(447541..448956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4175"
FT                   /product="diguanylate cyclase/phosphodiesterase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; EAL domain protein; KEGG: rso:RS03152
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4175"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29274"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI73"
FT                   /protein_id="ACD29274.1"
FT                   /translation="MSRARSAAPSSLDPISGLPDRGRFVQLLAAMPQPARQDAIGALLL
FT                   IGFDHFAEATNTLGPLAAREVIAECASRLEALSVPAADGNAPIVGRIGPETFAVACADF
FT                   VSAQDVHDLARRISAALTRPFITHGYELVCSCSIGMTLFEGMPSDAARLIEQADRALYG
FT                   VQHGAEPSPALYAPAAMPPGTGTNVARADGYDAIAEHPRLAAQLRHALARRQFSLNLQP
FT                   QLSLTDGRIVGYEFLLRWSSPELGGVAPAEFLPILEQTGDIREVGHWVLDSAAQMLAGL
FT                   LREESERAGRNSRHQPGVHAAVNLSVAQLLDPQLSDVVRDIAARHAVPTTRLVFEISEH
FT                   TLHRANGSAQKAVEALHACGARVAVEDFGATAHSLDCLATFRPDQVKLDQAIVNAVTNA
FT                   SDHAVLQRLVTAAHGAGVPVIATRVETAAQLHALRACRCDVIQGYLLSQPFPARWIDDT
FT                   QDVIAERARDLMP"
FT   gene            complement(449181..450086)
FT                   /locus_tag="Rpic_4176"
FT   CDS_pept        complement(449181..450086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4176"
FT                   /product="type IV pilus assembly PilZ"
FT                   /note="PFAM: type IV pilus assembly PilZ; KEGG: rso:RS03149
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4176"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29275"
FT                   /db_xref="GOA:B2UI74"
FT                   /db_xref="InterPro:IPR009875"
FT                   /db_xref="InterPro:IPR009926"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI74"
FT                   /protein_id="ACD29275.1"
FT                   /translation="MLELQPLDIPLAIPLPWPMLDADGQLLVPKGDVIHSPEEIDLLCT
FT                   LHRPHRLADGTPAPAPAFANTQFPNTMFPDMGDDPDGERTIAMELLGLRPGGMLTVRLT
FT                   AGAGQTKGAARVMGYSPQRHLLITMPTDSGRTVMPVKDELVEVHAFSGEGIASFECTVM
FT                   AVCRIPFEYVVLSPPRRIKNRALRKSLRVRANVVGKMLVSGDPPRMIHISDISTTGASF
FT                   RSAHRLEVSGAPARLRFRVKTRDYHSELVAAALVRSEKPADLPNVYQYGVEFVELVAAQ
FT                   KMLLQCFIYEQLLWGGQRMV"
FT   gene            450206..450718
FT                   /locus_tag="Rpic_4177"
FT   CDS_pept        450206..450718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4177"
FT                   /product="GtrA family protein"
FT                   /note="PFAM: GtrA family protein; KEGG: rme:Rmet_5967
FT                   GtrA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4177"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29276"
FT                   /db_xref="GOA:B2UI75"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI75"
FT                   /protein_id="ACD29276.1"
FT                   /translation="MIEHNVGSKVDGVGTRMTSRRHFWAAVEQFARYVVIGGGATLAHY
FT                   VVLFGLVQVGVSPWRASVAGSVIGATLNYFISRQAVFNSTRGHIGAMVRFGLVAFLALG
FT                   CNATIMAAGLGIGLYYLIAQVFASSITAIFNFLVHRYWTFRDADAVGAPTEPQPTIVPA
FT                   RPTHNGP"
FT   gene            complement(450735..451217)
FT                   /locus_tag="Rpic_4178"
FT   CDS_pept        complement(450735..451217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4178"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RS03148 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4178"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29277"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI76"
FT                   /protein_id="ACD29277.1"
FT                   /translation="MELSFVAPGTQTHRYALKLAGLPEGTEPGTTPVDPAWVDDALTAA
FT                   VRVFDAHRVHFADAYFAYRARETAQQPTRTAGKTPTARVAGDLHDDTPLLADTFAIAQL
FT                   AALVSLEASGVADVIDIHLVVERLRDDAPVPPADGIGDVTFATETGAGVQSPASRH"
FT   gene            451870..453210
FT                   /locus_tag="Rpic_4179"
FT   CDS_pept        451870..453210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4179"
FT                   /product="diguanylate cyclase with PAS/PAC sensor"
FT                   /note="KEGG: rso:RS03147 hypothetical protein; TIGRFAM: PAS
FT                   sensor protein; diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; PAS fold-3 domain protein; PAS fold-4
FT                   domain protein; PAS fold domain protein; SMART: PAS domain
FT                   containing protein; PAC repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4179"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29278"
FT                   /db_xref="GOA:B2UI77"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI77"
FT                   /protein_id="ACD29278.1"
FT                   /translation="MLEDDHLYKAAIEHSPIGIGLCAPEGRFLDVNRALCALTGHEAQA
FT                   LRTRDLFDLCHPDHTERTRHGIESLLTGQRDALSMETRLVRQDGTTVWVQTDVAVAHDH
FT                   GNQHLVVQMQDVTARRLALESLRASEQRLAYVLDGAGLGTFDWSTRARHVSFNRRTADM
FT                   LGYEPTDLSNDPDAWFAMVHPQDAALSARRIYRHMRGDADSFEIEQRMRARHGQWIWVA
FT                   ARGRVTERDARGMATRVSGTLLDVTKRRTALDQAHHLALHDPLTDLPNARLLRDRLFVA
FT                   IQAARRARGQVAVVFIDLDRFKPVNDEYGHAVGDLVLKATAMRLRSGLRASDTVARLGG
FT                   DEFVAVLTHCATRDDVTQTVERLIEQLQTPFRVEGHVLSMGVSAGVALYPTDGRDAQTL
FT                   IRNADAAMYEVKRAGGNGLGFHASLNYERLMGMRSRDRDLDGEADAR"
FT   gene            complement(453289..453852)
FT                   /locus_tag="Rpic_4180"
FT   CDS_pept        complement(453289..453852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4180"
FT                   /product="putative signal peptide protein"
FT                   /note="KEGG: rso:RS03145 probable signal peptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4180"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29279"
FT                   /db_xref="GOA:B2UI78"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR018550"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI78"
FT                   /protein_id="ACD29279.1"
FT                   /translation="MIRSALPRSAKLLAAALGAATLFAALPAQADPSVRAIYGKDNKHG
FT                   IEKYGVDLDFDSGFHWGNPEGWFVNLDWEVALGQWRSTKGTNRQNITEFGVTPLFRLEK
FT                   RGGSWVPFIEAGVGPRLLSHVSTSNEHYFSTAFQFSDMIGVGVAFGSKQQFQMGYRFEH
FT                   LSNASIKRPNPGTDLNELYLRYTF"
FT   sig_peptide     complement(453760..453852)
FT                   /locus_tag="Rpic_4180"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 31"
FT   gene            complement(454153..455658)
FT                   /locus_tag="Rpic_4181"
FT   CDS_pept        complement(454153..455658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4181"
FT                   /product="RND efflux system, outer membrane lipoprotein,
FT                   NodT family"
FT                   /note="TIGRFAM: RND efflux system, outer membrane
FT                   lipoprotein, NodT family; PFAM: outer membrane efflux
FT                   protein; KEGG: rso:RS03144 putative outer membrane channel
FT                   lipoprotein transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4181"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29280"
FT                   /db_xref="GOA:B2UI79"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI79"
FT                   /protein_id="ACD29280.1"
FT                   /translation="MTRGTQALRTSLLALAACALVSACAVGPDYKRPDAEVPQQYKEAG
FT                   DWKVADPSDAIARGKWWEIFNDPQLNALEEQVAAANQNILVAEAQYRQAQALVQSAQAS
FT                   FFPTLGANASATRSRSVRTSVNPDGSLSTGNPSLLNSQSLSLNASWELDLWGRIRRTVE
FT                   SNKASAQASAGDLSSALLSAQATLAQNYFQLRVTDTQKAVLQRTVANYERFLKLTQNQY
FT                   AVGVAQRSDVLTAQTQLKQSQALLLDTEVTRAQLEHAIAVLIGKPPAEFSLAPATAASA
FT                   ADLPALPAIPLEVPSAVLERRPDIAAAERRMAAVNAQIGVAKAAYFPTLTLGASAGLAA
FT                   NTLTRLATLPSRVWSIGPTLAATLFDGGARAAAVDKAGAAYDASVATYRQTVLGAFQDV
FT                   EDNLAALRWQTQEFGVQADAVKAAQEAAQLNLNRYRAGTVSFLEVITAQATAYSAERTL
FT                   LTLQGKQYSAAVLLVKALGGGWHGEVPVVGKAALQPASTPAAQ"
FT   sig_peptide     complement(455581..455658)
FT                   /locus_tag="Rpic_4181"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.934 at
FT                   residue 26"
FT   gene            complement(455661..458762)
FT                   /locus_tag="Rpic_4182"
FT   CDS_pept        complement(455661..458762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4182"
FT                   /product="acriflavin resistance protein"
FT                   /note="PFAM: acriflavin resistance protein; KEGG:
FT                   rso:RS03143 probable drug efflux transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4182"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29281"
FT                   /db_xref="GOA:B2UI80"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI80"
FT                   /protein_id="ACD29281.1"
FT                   /translation="MNLSATFIARPVATALLTIGVALAGIAAFRLLPVSPLPQVDFPTI
FT                   SVNASLPGASPETMAATVATPLERSLGRIAGITEMTSSSSLGSSRITLQFDLSRDIDGA
FT                   ARDVQAAINASRSLLPSGLPSNPTYRKVNPADAPIMIVGLTSDTKSRGELYDAASTILA
FT                   QKLSQINGVGQVSIGGASLPAVRVELNPMALNKYGISMETVRTVITSTNANKPKGMMES
FT                   GDRVWTIYANDQAKKAVEYQSLIIAWRKGSPVRLADVAEVTDSVQDIRNYGSANGKPSV
FT                   LLIISRQPGANIIDTVDRINDVLPYLRNTIPAQINLDVMMDRTPTIRASLKDVERTLVL
FT                   SIALVIMVVFLFLRNVRATLIPSVAVPVSLIGTFGVMYLCGYSLDNLSLMALTVATGFV
FT                   VDDAIVVLENVSRHIENGMRPMQAALKGAREVGFTVVSMSFSLIAVFIPLLMMGGIVGR
FT                   LFREFAVTLSVAILVSLVVSLTTTPMMCARLLKPAAEEEHGWFHRKTEGFFTFLLDIYR
FT                   NSLAWALRHSWLTLLILLATVCLNVYLYIIVPKGFFPQQDTGRVIGFIQADQSISFQAM
FT                   RTKLTDFITIVRQDPAVENVVGFTGGSQRNTGQMFIQLKPLAERRMSADQIINRLRGKL
FT                   AGEPGASLFLQSVQDIRVGGRASNAQYQYTLQADDLNELRAWDPKIKQALTQVKSLTDV
FT                   NTDTQDKGLQTSLVIDRDKAKSLGINPSDIDNALNNAFGQRQVSTIYNPLNQYRVVMEA
FT                   APQYWQNPDGLRDIYIITSTGAQVPLSTFSHYEPTNTALAVNHQGQFAASTISFNLAPG
FT                   ASLSGATQDIQDAMNRIGVPSSVHGSFQGTAKAFQDSLSSQPVLILFALITIYIVLGLL
FT                   YESYVHPITILSTLPSAGVGALLALIITDTDFSIIALIGVILLIGIVKKNAIMMIDFAL
FT                   EAERSQGMSPADAIFHACVLRFRPILMTTMAALLGALPLALGHGDGAELRTPLGISIVG
FT                   GLLVSQILTLYTTPVVYLALDRLRLRRAGRSKDAPLPALDSQGS"
FT   sig_peptide     complement(458688..458762)
FT                   /locus_tag="Rpic_4182"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.974) with cleavage site probability 0.953 at
FT                   residue 25"
FT   gene            complement(458759..461893)
FT                   /locus_tag="Rpic_4183"
FT   CDS_pept        complement(458759..461893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4183"
FT                   /product="acriflavin resistance protein"
FT                   /note="PFAM: acriflavin resistance protein; KEGG:
FT                   rso:RS03142 probable drug efflux PUMP transmembrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4183"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29282"
FT                   /db_xref="GOA:B2UI81"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI81"
FT                   /protein_id="ACD29282.1"
FT                   /translation="MNPSRIFILRPVATTLLMVAILLSGLVAYRMLPLSALPEVDYPTI
FT                   QVTTLYPGASPDVMTSSITAPLERQFGQMPGLKQMTSSSSGGASVITLQFDLSLSLDIA
FT                   EQEVQAAINAAGNLLPNDLPMPPIYSKVNPADAPILALAITSNTMPLPKLEDLVDTRIA
FT                   QKLSQLPGIGLVSISGGQRPAVRIQANTSALAALGLSIDDIRTAIGTANVNGAKGSFDG
FT                   PMRASTIDANDQLKSAAEYSKMIVAYKNGAPIRLTDVAQIVDGAENSKLAAWSNTTPAI
FT                   ILNVQRQPGANVIEVVNRAKALLPQLKETLPGNVEVSLLTDRTTTIRASVSDVQFELML
FT                   AVALVVMVIFLFLRNVPATVIPAVAVPLSLVGTFGVMYLAGFSINNLTLMALTIATGFV
FT                   VDDAIVMIENIARYIEEGDPPMEAALKGSKQIGFTIISLTFSLIAVLIPLLFMGDVVGR
FT                   LFREFAITLAVSILISAVVSLTLTPMMCARLLKHIPEAEQSRFYHAAGAFFDNVIARYG
FT                   RMLQWVLDRQKTTLLVAIGTLVLTGLLYVVVPKGFFPVQDTGVIQGISDASQSISFSAM
FT                   AERQQKLAEVVLKDPAVESLSSFIGVDGVNTTLNSGRMLINLKPKDERDADATEIIQRL
FT                   QPELAKVAGISLYMQPVQDLTIEDRVSRTQYQFTVEDPDPNNLSKWVPKLVERLQQTRE
FT                   LRDVASDLQDNGLRAYVQVDRDKAAVYGITMAAVDSVLYSAYGQRLISTIFTQSNQYRV
FT                   VLETDPKMQLGPQSLYDLHVASSSGQQIPLGAFATVVEQPGSLVVNHQGQFPAATISFN
FT                   LAPRASLGAAVDTINAVEEEIGLPASMQTSFQGAALAFRASLSNQLWLILAAIITMYIV
FT                   LGVLYESTIHPVTILSTLPSAGVGALLSLLVSGKDMGIIAIIGIILLIGIVKKNAIMMI
FT                   DFALEAEREQGMAPRDAIYQACLLRFRPILMTTMAALLGALPLMLGTGVGSELRQPLGI
FT                   TMVGGLLVSQVLTLFTTPVIYLAFDSLGGRLRDWRARRAARRHGAAGANQSGGQR"
FT   sig_peptide     complement(461783..461893)
FT                   /locus_tag="Rpic_4183"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.914) with cleavage site probability 0.529 at
FT                   residue 37"
FT   gene            complement(461951..463339)
FT                   /locus_tag="Rpic_4184"
FT   CDS_pept        complement(461951..463339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4184"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   rso:RS03141 putative resistance transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4184"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29283"
FT                   /db_xref="GOA:B2UI82"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI82"
FT                   /protein_id="ACD29283.1"
FT                   /translation="MSDPKDQKPGQFDDAGRRTHAGKETPNEVSPTLLPPPREGGKRRR
FT                   WGIWVVITLLVLIGYAVYHAKYRDAGGPGGRGGAGGRGAAMAGKPMPVMVGTAIKGDIN
FT                   VVLSALGNVTPVNNVTVKTRVDGQLVRLAFTEGQTVKAGDLLAEVDPRTYQAQLAQAEG
FT                   QLARDQALLHNAKLDLQRYQTLLSQDSISKQQVDTQAALVRQYDGTVKLDQGNVDNARV
FT                   QLSYTRITAPVSGRVGLRQVDPGNIVHASDTNGIVVITQIDPITVIYSIPEDNLPKVMP
FT                   RLQSGDKLPVEAWDRGQTTQLARGVLMTVDNTIDNTTGTVKLRAQFPNQNAMLFPNQFV
FT                   NVRMRVDTLRDVVIVPGAAIQRGTQGTFVYVVGDNNKVALRLVKLGVTEGDRVSVAQGL
FT                   QPGERVVIDGADKLRDGSPVEVIQPGAAAASAPAAGQADQGGRHRRGQGGASAPAASAP
FT                   AAKP"
FT   gene            463593..464324
FT                   /locus_tag="Rpic_4185"
FT   CDS_pept        463593..464324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4185"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: rso:RS03140 probable two
FT                   component response regulator transcription regulator
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4185"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29284"
FT                   /db_xref="GOA:B2UI83"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI83"
FT                   /protein_id="ACD29284.1"
FT                   /translation="MSGTKILVVDDDVELRDLLREYLTQQGFAVSVLHDGDGLAARLER
FT                   ERPALVVLDLMMPKVDGLSALRDLRARNDDVPVILLTARSDEIDRIIGLEIGADDYLGK
FT                   PFSPRELLARINAVLRRRLTVPASAPEDRDSFSFGPFKLNFRMRTLFRGDSALSISDTE
FT                   FALLKLLIGHAMQVLTREHIVELMYGPGSGVSDRGIDVQIWRLRRVLEEDAQRPRYIQT
FT                   VRGRGYTFVPDEREEVNEVQG"
FT   gene            464308..465594
FT                   /locus_tag="Rpic_4186"
FT   CDS_pept        464308..465594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4186"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; KEGG: rso:RS03139 probable two
FT                   component transmembrane sensor kinase transcription
FT                   regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4186"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29285"
FT                   /db_xref="GOA:B2UI84"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI84"
FT                   /protein_id="ACD29285.1"
FT                   /translation="MKFRARFDTLFGRLAVLIVVVLVLSHFSWLGVLRAERRERQFQAS
FT                   VDQMAFQLQAFQAAMDGHLHVKLPDLVTETDEPPSGDASSASDKSAELVRQLARRLPSD
FT                   TQLRLEAGPTPRVFVRFSQRNKWIAMPLVWVHAPPSISAVVPGVMVVLAIAIAFSLFAA
FT                   WQIQRPVRELADAAGALARRRYVAPLKERGPYELRQLTVQFNHMAADLSAADEERNTML
FT                   AGIAHDLKTPLSRLRLRAEMLADQKAGAGIERDVESMSAIVEQFLAYAQSGDSEAREVS
FT                   VDRHLRGLVQPFAEQGKHVALDLHAGDRFRLKPTHLERIVVNLLDNAFAYGAEPVNVRT
FT                   SADETGYTLTVEDHGAGIPVADFDRVMRPFVRLDPARGGNAHCGLGLAIVDRLVRHLGG
FT                   DLTVGPTATDAPSPGFRVTMRFPVSTAAA"
FT   sig_peptide     464308..464400
FT                   /locus_tag="Rpic_4186"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.684) with cleavage site probability 0.537 at
FT                   residue 31"
FT   gene            465701..466138
FT                   /locus_tag="Rpic_4187"
FT   CDS_pept        465701..466138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4187"
FT                   /product="protein of unknown function DUF333"
FT                   /note="PFAM: protein of unknown function DUF333; KEGG:
FT                   rso:RS03138 probable proline rich transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4187"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29286"
FT                   /db_xref="InterPro:IPR005590"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI85"
FT                   /protein_id="ACD29286.1"
FT                   /translation="MNRAVCLVKDAGQARMTAAVATCVLAMGLAACSSPMPPWEPPRTI
FT                   IQPAPPPPRPAPAPPTPLPPSPAMQPAPAQPPAYAPPPAGDTEPPRATPGMANPASTYC
FT                   LQRGGQLEFSTRANGAEVGTCVSPGGDECEEWAFLRGSCTW"
FT   gene            complement(466224..468777)
FT                   /pseudo
FT                   /locus_tag="Rpic_4188"
FT   gene            467180..467986
FT                   /locus_tag="Rpic_4189"
FT   CDS_pept        467180..467986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4189"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   bxe:Bxe_C0489 putative transposase IS4"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4189"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29287"
FT                   /db_xref="GOA:B2U8P5"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:B2U8P5"
FT                   /protein_id="ACD29287.1"
FT                   /translation="MEKRRPYPSDVSDEEWSFAAPYLTLMNQDAPQRRYELRELFNALR
FT                   WLARAGAAWRMLPTNFPPWEAVYQQTQRWLRGGCFEAMVQDLRSVLRVAQGRQGQPSAV
FT                   ILDGRTLQSTCESGPRAGYDGYKRKRGSKVHMAVDTLGHLLAVHITPANEQERAQVQVL
FT                   AREVQLVTGQTVKLAFADQGYTGEEPAQAARDEGIELQVIKLPEAKKGFVLLPRRWVVE
FT                   RSFGWLNRFRRLARDYERLPETLAGLHFVVFAMLMLVHAAPVVQSA"
FT   gene            468916..469042
FT                   /pseudo
FT                   /locus_tag="Rpic_4190"
FT   misc_binding    469141..469296
FT                   /bound_moiety="flavin mononucleotide"
FT                   /note="FMN riboswitch (RFN element) as predicted by Rfam(RF
FT                   00050), score 112.74"
FT   gene            469423..470148
FT                   /locus_tag="Rpic_4191"
FT   CDS_pept        469423..470148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4191"
FT                   /product="3,4-dihydroxy-2-butanone 4-phosphate synthase"
FT                   /note="TIGRFAM: 3,4-dihydroxy-2-butanone 4-phosphate
FT                   synthase; PFAM: 34-dihydroxy-2-butanone 4-phosphate
FT                   synthase; KEGG: rso:RSp1191 probable
FT                   3,4-dihydroxy-2-butanone 4-phosphate synthase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4191"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29288"
FT                   /db_xref="GOA:B2UI87"
FT                   /db_xref="InterPro:IPR000422"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI87"
FT                   /protein_id="ACD29288.1"
FT                   /translation="MLSTQQSPAVHPPALLAANVAFDAIEARFDPADMPARMAAALDAV
FT                   RLGVPVVVLDDADRENEVDLIVAADKLTQASMAMLIRECSGIVCLCLTAEKSASLGLRP
FT                   MVEDNRSQYGTAFTVSIEARTGVSTGVSAADRITTIRAAIAPDADTQSVVSPGHVFPLV
FT                   AKEGGVLTRRGHTEGSVDLARLAGLPPAAVLCELMLPDGTMARRDDAVRFADQHNLPVL
FT                   TIEDIVQYREQMERAVSFV"
FT   gene            complement(470183..470809)
FT                   /locus_tag="Rpic_4192"
FT   CDS_pept        complement(470183..470809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4192"
FT                   /product="2-dehydro-3-deoxyphosphogluconate
FT                   aldolase/4-hydroxy-2-oxoglutarate aldolase"
FT                   /EC_number="4.1.2.14"
FT                   /note="KEGG: rso:RSp1190
FT                   keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate
FT                   aldolase; TIGRFAM: 2-dehydro-3-deoxyphosphogluconate
FT                   aldolase/4-hydroxy-2-oxoglutarate aldolase; PFAM: KDPG and
FT                   KHG aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4192"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29289"
FT                   /db_xref="GOA:B2UI88"
FT                   /db_xref="InterPro:IPR000887"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR031338"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI88"
FT                   /protein_id="ACD29289.1"
FT                   /translation="MGIDSVVKAGPVIPVLQFQSVDEGVKVCRALYEGGIRTFEITMRT
FT                   PVALDVIRAVVKDLGSDAIVGAGTLTRPEHFQQAKDAGAVFAVSPGITPMLAAAQGKTE
FT                   LDWLPGIATPSELILALEFGLTTLKFFPAEAAGGIPMLKSIYGPFGDVRFCPTGGITPQ
FT                   SAPDYLALPNVVCVGGSWMVPKDKVAAGDWAGITALAKEAAALKR"
FT   gene            complement(470844..472196)
FT                   /locus_tag="Rpic_4193"
FT   CDS_pept        complement(470844..472196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4193"
FT                   /product="gluconate transporter"
FT                   /note="TIGRFAM: gluconate transporter; PFAM: Gluconate
FT                   transporter; Citrate transporter; KEGG: rso:RSp1189
FT                   probable high-affinity gluconate transporter (GNT-III
FT                   system) transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4193"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29290"
FT                   /db_xref="GOA:B2UI89"
FT                   /db_xref="InterPro:IPR003474"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI89"
FT                   /protein_id="ACD29290.1"
FT                   /translation="MVPMQGNSLLLTAALAVVALIYLIAVQKLNPFVTLIVVSLVLGVV
FT                   VGMPMGNIVKAFETGVGNTLGHIALVVGLGTMLGKMMAESGGAERIAKTLISAFGEKNA
FT                   HWAMMVVAFIIGLPVFFEVGFVLLIPIAFNVAKRTGTPILLVGLPMVAGLSVVHGLIPP
FT                   HPAALLAVTAYQADIGKTIMYALIVGLPTAILAGPLWAMLVSRYVKPDENNPLAAQFVE
FT                   ADQKRELPGFGVTLFTILLPVVLMLIGSWADLIVAPKTLANDILKLAGNSVMALLIAAI
FT                   VSFYTFGKARGFNRETILKFTNECLAPIATITLVVGAGGGFGQILRDSGVSKAIVAVAT
FT                   DAHLSPLLLGWVVAVLIRIATGSATVAMTTACGIVAPIAAASGAAVKPELMVLATGAGS
FT                   LILSHVNDGGFWLVKEYFNLTVPQTFKTWTVLETIISIVALLLTLALATVV"
FT   gene            complement(472277..472663)
FT                   /locus_tag="Rpic_4194"
FT   CDS_pept        complement(472277..472663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4194"
FT                   /product="Endoribonuclease L-PSP"
FT                   /note="PFAM: Endoribonuclease L-PSP; KEGG: rso:RS03132
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4194"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29291"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI90"
FT                   /protein_id="ACD29291.1"
FT                   /translation="MTITRIGVEGGTGTGGQHLPFARAAGADGWLFVSGQTPMVNGEVV
FT                   GNGIVEQSHQTIKNVLAILAEAGYGPEHVVRCGVWLDDPRDFQSFNKVFKEYFGANPPA
FT                   RACVVSSMVIDCKVEVDCVAYKKP"
FT   gene            complement(472705..474189)
FT                   /locus_tag="Rpic_4195"
FT   CDS_pept        complement(472705..474189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4195"
FT                   /product="N-acyl-D-amino-acid deacylase"
FT                   /EC_number="3.5.1.81"
FT                   /note="PFAM: amidohydrolase; D-aminoacylase domain protein;
FT                   Amidohydrolase 3; KEGG: rso:RSp1187 probable
FT                   N-acyl-D-glutamate deacylase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4195"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29292"
FT                   /db_xref="GOA:B2UI91"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR023100"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI91"
FT                   /protein_id="ACD29292.1"
FT                   /translation="MQQYDTVIRQVRIVDGSGHDPEATLFDVAITDGRIAAIATSDSTA
FT                   WLGDEEIAGEGRVLAPGFIDVHTHDDTNVIRTPDMLCKVSQGITTVIVGNCGISASPAT
FT                   LKGEPPDPMNLLGPTSAFAYPTFASYVDAVERAQPAVNVAALVGHTALRNNHLDRLDRP
FT                   ATAGEVEGMRAQLREALDHGALGLSTGLAYANAFASTTEEVMGLAEPLAEAGAIYTTHL
FT                   RTEFAAILDAMDEAYRVGKHARVPVVISHLKCAGAANWGRAGEVLESIEGAQCYQPVGC
FT                   DCYPYTASSSTLDLKQVTDEFDIFITWSEPEPSMAGQTLKEIAAAWGTDLVDAARRLQP
FT                   AGAVYHNMSAQDLDRIITHPATVIGSDGLPNDPKPHPRLWGAFPRVLGYYSRERKLLSL
FT                   AAAIRKMTGQSAERFGLTERGLVREGYWADLVLFDPETVRDVATFTDPQQPAAGIAAVW
FT                   VNGHLSYQDGAVQPHRAGRFLKRGPRAHAAVTAETH"
FT   gene            complement(474191..475084)
FT                   /locus_tag="Rpic_4196"
FT   CDS_pept        complement(474191..475084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4196"
FT                   /product="transcriptional regulator, RpiR family"
FT                   /note="PFAM: helix-turn-helix protein RpiR; sugar isomerase
FT                   (SIS); KEGG: rso:RS03130 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4196"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29293"
FT                   /db_xref="GOA:B2UI92"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI92"
FT                   /protein_id="ACD29293.1"
FT                   /translation="MRDPKPDPMREPMDIVTRLSQRAAELRPAEQKVAQTVLSDIAEAA
FT                   AGSIQTLAERAGVSEASVTRFAKAMGCRDVRELKLKLAQAAAVGQRFLDGGADRPPSSA
FT                   DGILADISNVLEANRALVQPEAFRAAAVALVAARMIAVFGMGGGSTTMADEMRYRLARL
FT                   GRPVTTYHDSMLQRMVAATLSPDDVVVVFSVTGHVPEVIDSVTIAREYGARIVAITAIG
FT                   SPLAALADVLLPIQAMETDFIFKPSSSRYAMMMMIDLLATEVALQQADRSKELLRRIKY
FT                   VLDAHRGGGNRQPLGD"
FT   gene            475223..476500
FT                   /locus_tag="Rpic_4197"
FT   CDS_pept        475223..476500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4197"
FT                   /product="putative D-serine deaminase (D-serine
FT                   dehydratase) protein"
FT                   /note="KEGG: rso:RSp1185 probable D-serine deaminase
FT                   (D-serine dehydratase) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4197"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29294"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR026956"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="InterPro:IPR042208"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI93"
FT                   /protein_id="ACD29294.1"
FT                   /translation="MSDTKYQGDANAVVNPLDKGLGALEAACAPEQIAAQRWNVLNEDL
FT                   NLPAAVLSQSRVEHNLAWMQRFVSEYGAKLAPHGKTTMAPRLFQRQLAGGAWGITLATA
FT                   HQTRIAYAHGVRRVLMANQLVGKRNMAILAELLADPTFEFFCLVDAADQVDQLAAFFGK
FT                   TGRPIQVLIELGVQGGRTGVRDDAQLQSVLDALTRANGAVKLAGVEVYEGVIKEEADIR
FT                   TFLQRAVKVMGDLAKGGRLQRTPAVLTGAGSAWYDVVAEEFAKANIGQPLDVVLRPGCY
FT                   LTHDVGIYRAAQTRIDANNPIAHKMRSSLLPALQLWAYVQSVPEAERAIIAMGKRDAAF
FT                   DAGLPLPVLHFRPGDKTPSATPAHWEVTGMMDQHAYLKIAPGDDIKVGDMIAFDISHPC
FT                   LTFDKWRQISVVDDAYNVVDVVQTYF"
FT   gene            476513..477439
FT                   /locus_tag="Rpic_4198"
FT   CDS_pept        476513..477439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4198"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein; KEGG: rso:RS05074
FT                   putative fructokinase-like protein (sugar kinase)"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4198"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29295"
FT                   /db_xref="GOA:B2UI94"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI94"
FT                   /protein_id="ACD29295.1"
FT                   /translation="MADILAYGEALIEFNQADSGSTSWNFGFGGDTSNFCIAAARQGAR
FT                   TGYISAVGADRFGQALRGLWQDEGVDHTYVHTDTQAPTGLYFVSHDARGHHFDYLRAGS
FT                   AASRFQTAQLPLQAIAAAKAFHLSGISLAISDTACDAGLAAMAHARAAGVLVSFDTNLR
FT                   LRLWPLARARAVMQEAMRTCDLCLPSWDDVTVLLDCHDHDGIVDTLLGWGVKLVALKMG
FT                   AEGCYVATPESRTLVPRHTVNAVDATGAGDCFGGAFVARIVAGDSPVEAARYANVAAAI
FT                   STTGYSAVAPIPRAEVVRAALGQVQAD"
FT   gene            complement(477767..480196)
FT                   /locus_tag="Rpic_4199"
FT   CDS_pept        complement(477767..480196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4199"
FT                   /product="peptidase S45 penicillin amidase"
FT                   /note="PFAM: peptidase S45 penicillin amidase; KEGG:
FT                   vei:Veis_3277 penicillin amidase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4199"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29296"
FT                   /db_xref="GOA:B2UI95"
FT                   /db_xref="InterPro:IPR002692"
FT                   /db_xref="InterPro:IPR014395"
FT                   /db_xref="InterPro:IPR023343"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI95"
FT                   /protein_id="ACD29296.1"
FT                   /translation="MPIRSLSILLSAVALGFSAQAVAKDAHTAAAQTIAVPGLSKPADI
FT                   LIDRWGVPHIYARSEDDGFFAQGFNAARDRLFQIDLWRRRGLGQLSEVFGPAYVEQDRA
FT                   TRLFLYRGDMQVEWNHYSPDAQRIATRFVAGINAYVDWLAKHPEQMPFEFRKLNYAPAH
FT                   WAPEDVVRIRSHGLTRNLQSEVARANVACKANLSDDTVRFRLQPAWQTQLPEGLDPCLP
FT                   KDLLRVFTLATQGARLTPESLKGVDVDSTRVAAAANLEETMEGSNNWVIAPGKSTTGRA
FT                   VMANDPHRAYSAPSLRYIAHVSTPTLDIIGAGEPSLPAVSIGHNGHVAFGLTIFNIDQE
FT                   DLYVYELNPANNGEYRYNGGWEPFIVLHETVKVRGGESRPVDLTFTRHGPVIYIDAEKH
FT                   RAYAVRSAWLSPGMSPYFGSVGYMRARTFAQFRQSMMNWGAPTENQVYADTKGNIGWVP
FT                   GGLAPIRPNWDGLLPVPGDGRYEWAGFWRGDQLPSSYNPKSGYFTSSNEMNLPADYPYR
FT                   ERKLGFEWTNGSRHVRIDEVLSKLDKVSIEDSMRLQNDMVSIPARRLTALLAPLSSDDA
FT                   DTQAALNLFKGWNATMLADSPQAALHEVWFTHHLGRAFKNAVLSKASAEAMAAPDTDVM
FT                   LDTLEHPQGSDRKFGEDPQQAAAKRDAVLLDSLKNAWTDMVKRQGPNPQAWNWGQLHHN
FT                   LNAHPFTAIVDEATRAKLNVGPTPEGGSPYTPNQSTYRASDFLQTNGPSFRTVVDVGKW
FT                   DNSRAVNLPGQSGNPDSPHYRDLAPLWLKGKYFPLLYSRKAVEAATESRVHLVPGK"
FT   sig_peptide     complement(480125..480196)
FT                   /locus_tag="Rpic_4199"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.943 at
FT                   residue 24"
FT   gene            complement(480464..482500)
FT                   /locus_tag="Rpic_4200"
FT   CDS_pept        complement(480464..482500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4200"
FT                   /product="multi-sensor hybrid histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="KEGG: rso:RS05068 probable composite two-component
FT                   transcriptional regulatory (sensor histidine kinase and
FT                   response regulator hybrid) transcription regulator protein;
FT                   TIGRFAM: PAS sensor protein; PFAM: response regulator
FT                   receiver; ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; PAS fold-4 domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4200"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29297"
FT                   /db_xref="GOA:B2UI96"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR025201"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI96"
FT                   /protein_id="ACD29297.1"
FT                   /translation="MTSILPSSSRPSDARAADPARLPDPGPFSKSGFNDAPAIRPSAWL
FT                   VAMGAAAVGTIGRLLLESAMGIHLPFYLAFPVVTIAAWYGGFWPGMLAIVCYAGLFIAL
FT                   AALQSWPAAVPLTPIQMTVFGVGALLICALCEQLRRARAGAERRARAETQQRLSQQRLL
FT                   AALQASPISLYDVDNTMHFTWVHNPVFGLQPEQLLGRTVREVFGRRAASRLTEAGQRVI
FT                   ATGTPTRVEFAFRRRHTQRVVYDVVVMPLRDDTGEIIGLTNAVIDISERRQAEARRTQL
FT                   LEAESRAREEAERASRLKDDFLATVSHELRTPLNAVLGWAQLLNMRAYDEAMFKRGIEA
FT                   IERSARTQVHLIDDLLDMSAILSGKVPLEIGPVDLADVLERARETIEPMARQKNITIET
FT                   EFLPVPMLQGDAGRLKQVFWNLLANAVKFTPEGGHIRLSVHPAPEGVVATVRDTGIGIE
FT                   PTFLPHIFDRFQQADLSSTRRHGGLGLGLAIAKQLVELHHGRITAASSGADRGTTMAVS
FT                   LPLHAAQPGEQANRTPGLVAGTGVPTLDGIRVLAVDDNPESLGVIALMLERYGADVVTV
FT                   SSGAAALDALEHAVANAYPFDALVSDLAMPGMDGMQLVRAVRERGWTDLPAIAVTAFAD
FT                   PIRLKAAKEAGYQSVITKPIFPGELGHVLAANVHRKTGPETLV"
FT   gene            complement(482652..483950)
FT                   /locus_tag="Rpic_4201"
FT   CDS_pept        complement(482652..483950)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4201"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: protein of unknown function DUF894 DitE; major
FT                   facilitator superfamily MFS_1; KEGG: rso:RS05067 probable
FT                   transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4201"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29298"
FT                   /db_xref="GOA:B2UI97"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI97"
FT                   /protein_id="ACD29298.1"
FT                   /translation="MSGDAGLSPASSSASAQTLSHAPFSYPAFRLFWFARLSTTFAYQM
FT                   FGVAVGWQIYDLTRSAYVLGLVGLAQFLPSVVLVLASGHIADRYDRRYVVRACQAIEAL
FT                   VALALAVMAANGHAGVQPIFLCVVVIGAMRAFETPTLQALLPTLVPLQALPRAVALSSS
FT                   AGQTGVILGPALGGFLYVAGAPVVYATAAGLFLLAHVLLALVRMERAAPVSTPVSLESL
FT                   FAGIAFIKGRPVVLGAISLDLFAVLLGGATALLPIYARDILGTGAWGLGLLRSAPAVGA
FT                   LGMALFLAHRPLDRHVGRVMFAAVAVFGLATLVFGVSHWLPLSMLALVLLGASDMISVV
FT                   IRTSLVQLDTPDAMRGRVSAVNSVFVGASNQLGEFESGMLAGLLGPVASVVIGGLGTLL
FT                   VVAAWMRLFPALAQRDRMRDPHPADAGHPSSGG"
FT   sig_peptide     complement(483900..483950)
FT                   /locus_tag="Rpic_4201"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.912) with cleavage site probability 0.873 at
FT                   residue 17"
FT   gene            484103..484459
FT                   /locus_tag="Rpic_4202"
FT   CDS_pept        484103..484459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4202"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: reu:Reut_B4511 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4202"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29299"
FT                   /db_xref="InterPro:IPR021513"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI98"
FT                   /protein_id="ACD29299.1"
FT                   /translation="MATHNARSKPAPPRSTAKPKNHRWSRHVMETSDALDIEPDIFKLR
FT                   SPARIAASLKASAEHSRRRKGTAFQSAMSMLTFYINRAAHNLSGGRRRILERAKDALRA
FT                   EFGRRAQSTAKARH"
FT   gene            complement(484478..484756)
FT                   /locus_tag="Rpic_4203"
FT   CDS_pept        complement(484478..484756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4203"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RS05066 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4203"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29300"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI99"
FT                   /protein_id="ACD29300.1"
FT                   /translation="MRHPEQQALASYPPLSAVPPSPATQETARLIAETIPFNLERGGRT
FT                   IEATYSTRNGIVTVKYRGKTLSTYSPQSDNADYKAVARQLLSVMLTI"
FT   gene            485110..485358
FT                   /locus_tag="Rpic_4204"
FT   CDS_pept        485110..485358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4204"
FT                   /product="protein of unknown function DUF1458"
FT                   /note="PFAM: protein of unknown function DUF1458; KEGG:
FT                   rso:RS05065 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4204"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29301"
FT                   /db_xref="InterPro:IPR009923"
FT                   /db_xref="InterPro:IPR025543"
FT                   /db_xref="InterPro:IPR036694"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIA0"
FT                   /protein_id="ACD29301.1"
FT                   /translation="MGSHTYKLIELVGSSPESSDAAVRNAIARASETLNHLDWFEVLET
FT                   RGHLVDGKIAHWQVTLKVGMRLETLESEKPAGKKKGK"
FT   gene            complement(485424..487586)
FT                   /locus_tag="Rpic_4205"
FT   CDS_pept        complement(485424..487586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4205"
FT                   /product="acid phosphatase"
FT                   /note="TIGRFAM: acid phosphatase; PFAM: phosphoesterase;
FT                   KEGG: rso:RSp1174 putative acid phosphatase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4205"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29302"
FT                   /db_xref="GOA:B2UIA1"
FT                   /db_xref="InterPro:IPR007312"
FT                   /db_xref="InterPro:IPR017768"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIA1"
FT                   /protein_id="ACD29302.1"
FT                   /translation="MSRALRLLPLTALVAASMSACGGSDSNSSASASTSGVVTGSYFEH
FT                   AKVCIDANNNGKCDSGEASTYTDANGAYSLSGTGAITVEIGTDAFRNDPDKGTHTAITQ
FT                   PLVFRAPAGANAVVSAISTELAVLMDSNGGDINAAKTALAARLGVTIDKLLEDHNKETD
FT                   ADTKTALQAEIDQAIDLIADAVANGGDIDKRLHDGVTKRMALANNVKTIVVIYAENRGF
FT                   DNLYGLFPGANGIPGVNPTSTGTAVAQKDFDGSVLPTLPPTWGGVTAAGQSVQITQAST
FT                   ANMPNQMFQIDSPSGFGSTGTVVGQNVITRDLWHRFYQNQMQINGGKNDKFAAFADAGG
FT                   LTMGYYDGSKMAMWNIAKQYTLADNFFMGAFGGSFLNHQYLVCACAPIYPNAKASPAVN
FT                   SIANVKTNADGSPTLIPAASSVMAGAPTSYAGAGDDGNPTKDGSLTPVDSNGNSYAVNT
FT                   MQPPYQPSGNAVASGNAAYADPTKASTMPKQSTTNIGDLLTARGVDWAWYAGAWNAAIA
FT                   DAPNTTRSVIYSGAIQFQPHHQPFNYFSRFDPATTTGAAERAAHLRDYDAAFLQDAAAG
FT                   KLPAVTFYKPQGNLNQHPGYANVADGDAHIVNVIAQLQKSPQWKNMVIVVTYDENGGFY
FT                   DHATVPKADRWGPGTRIPAIIVSPFAKKGFVDHTQYDTASVLRLITHRFDLPTLPGIKQ
FT                   RDDALVSNGNKPMGDLTNALDFTQAQ"
FT   sig_peptide     complement(487518..487586)
FT                   /locus_tag="Rpic_4205"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.479 at
FT                   residue 23"
FT   gene            487861..489252
FT                   /locus_tag="Rpic_4206"
FT   CDS_pept        487861..489252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4206"
FT                   /product="Di-haem cytochrome c peroxidase"
FT                   /note="PFAM: Di-haem cytochrome c peroxidase; KEGG:
FT                   rso:RS05063 probable lipoprotein transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4206"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29303"
FT                   /db_xref="GOA:B2UIA2"
FT                   /db_xref="InterPro:IPR004852"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIA2"
FT                   /protein_id="ACD29303.1"
FT                   /translation="MSRVLPAATFRVIAVSALAGVVVVLCGCGRGDPAAHAATVAASAP
FT                   AAVAPSTAAGVKPAAAPAYEKAFYTMMATRRPSVPAMAALGKALFFDPALSASGKQACA
FT                   SCHSPTHAYGPPNDLSVQLGGTGMNKTGVRAAPSLRYLQKVPPFSEHFYESDGNDSEDQ
FT                   GPTGGYTWDGRVSSTHDQARIPLLSGHEMANGTQASVVAKLRNGRHAQTFRQVFGNDIL
FT                   DNEDTAFRAALMVLEVFQETPSEFYPYDSKYDAFLRKQVKLSPQELRGLKAFADPAKGN
FT                   CASCHVSAIKQDGAFPAFTDFGHIAVGVPRNRSLAANADPKFFDLGLCGPDRTDLKDRT
FT                   DYCGRFRTPSLRNVALRKTFFHNGAIHSLEDAVRFYAQRDTQPQKWYPRKADGTVDKFD
FT                   DLPTQYRANVNMEPPFGGKPGDKPVLSEADVRDIVAFLKTLTDGYRPVRATQSGSQGGS
FT                   RVAQR"
FT   sig_peptide     487861..487920
FT                   /locus_tag="Rpic_4206"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.955) with cleavage site probability 0.847 at
FT                   residue 20"
FT   gene            489376..490956
FT                   /locus_tag="Rpic_4207"
FT   CDS_pept        489376..490956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4207"
FT                   /product="Integral membrane protein TerC"
FT                   /note="PFAM: CBS domain containing protein;
FT                   transporter-associated region; Integral membrane protein
FT                   TerC; KEGG: rso:RS05062 probable transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4207"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29304"
FT                   /db_xref="GOA:B2UIA3"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIA3"
FT                   /protein_id="ACD29304.1"
FT                   /translation="MTWLADPSVWIGLFTLVVLEIVLGIDNLVFIAILVNKLPPALRDR
FT                   ARVIGLGLALLMRMVLLAAMSWLIGLTRPLLTLGPVDLSGRSIILLLGGFFLLFKATSE
FT                   LHERLDGQPQDESHGSGHGKFWNVIVQVVILDAVFSIDSVITAVGMVNDLPVMMAAVVV
FT                   AMGAMLFASRPLTEFVNAHRTVVVLCLSFLLMIGFSLVAEGLGFHIPKGYLYAAIGFSI
FT                   LIEFFNQMAQRNTVRYERRRPLRERTADAVLSLLGDRRGAPAESESHEAVSHAAGQSVP
FT                   ETVFRPEERSMVSGVLDLAERSVRSIMTPRHDISWVDLDADVAVTRKLLLAVPHNQFPV
FT                   CRGGLDDLLGVARAKDLMGDLDTRGSIDVDRSVKPALKVSDNIGILRLMDQLKRARGRM
FT                   LVVTDPLDVVQGVVTPIDVLEAIAGEFPDEDERLGVVEVSDGCWEVAGEADLRQLEDVL
FT                   HVEWLLDEGGGATSLGGYLFNQWDRLPEVGDTLVRHDLRFQILEAGSRRIVRVRIERME
FT                   DVTAPEAEA"
FT   gene            complement(490953..491870)
FT                   /locus_tag="Rpic_4208"
FT   CDS_pept        complement(490953..491870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4208"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: rme:Rmet_0006 protein of unknown
FT                   function DUF6, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4208"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29305"
FT                   /db_xref="GOA:B2UIA4"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIA4"
FT                   /protein_id="ACD29305.1"
FT                   /translation="MSKLSNRLEGCLYLALAMVLVGSTVAASKIIAAGLPPFTATALRF
FT                   AMALPMFLVIMRMTRTRWPVLARRDWVLLFLQAAAGSVGYTTLLISGLRHTSAADAGVI
FT                   VGTLPVMSALIAIVLLGERPGRAVLGAIGLATAGVLAIALQPRGDATHPLLGNLLVMGA
FT                   VVCEGLFILLNKRLRTPVPPLALSALMSAFGLLTALVPALWEAPWQLHASVQTTHALMA
FT                   VAYYAIVPTVGGFMLWYTGAARVSGAEASLFTALAPVAAVLFAATLLGEAVSTRQVGGI
FT                   ACVLAGVLSLGLARAPRPLSSTTS"
FT   sig_peptide     complement(491790..491870)
FT                   /locus_tag="Rpic_4208"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.646 at
FT                   residue 27"
FT   gene            complement(491963..492790)
FT                   /locus_tag="Rpic_4209"
FT   CDS_pept        complement(491963..492790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4209"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; AraC protein arabinose-binding/dimerisation;
FT                   KEGG: rle:RL3396 putative AraC family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4209"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29306"
FT                   /db_xref="GOA:B2UIA5"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIA5"
FT                   /protein_id="ACD29306.1"
FT                   /translation="MPNRPANLAFSMHRCAMRGVEAVAADSGHTFPRHTHGQFGIGIVD
FT                   RGAQKSFSGRGTVEAGAGDVITVNPLEVHDGTPIGDAGRAWRMLYLDPGVVADLATDLH
FT                   PGHDGDAEFDRPVIRDSNLAPRVRLLFAQMTMPATRNDSLLREQLLLSVLAAALHPANR
FT                   TTGKHGDAAPDAIRLARTRIDDDPAAAISLLDLAHETGLSRFQVLRGFARVTGLTPHAY
FT                   QVQRRVALARRLIAQGQPLAEVAAACGFADQSHMTRQFVRKYGVSPGMVAAAR"
FT   gene            493003..494559
FT                   /locus_tag="Rpic_4210"
FT   CDS_pept        493003..494559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4210"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; KEGG: rso:RS05645 probable
FT                   two-component sensor histidine kinase transcription
FT                   regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4210"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29307"
FT                   /db_xref="GOA:B2UIA6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIA6"
FT                   /protein_id="ACD29307.1"
FT                   /translation="MRPSFGITPKLFVALFMLSIFVALAMGTAVRWRFDANFLDYVNAR
FT                   ESERMTVLAQSVEAAYTQHGGWDFLRDDRMAWFRLLRREGARARANGMGGDRFDLPPGH
FT                   RFEPLPPGADRGMDRDMPPPPGPPPAGSMPPHPADEPPMPHSPIWLFDAQRNVIIGDGL
FT                   PLGPNARWQELHHNGQTVGWLAMPPRVRVPEGADQAFQVQQLRATWIIAGLSVLLAAFM
FT                   AVLLARGLLAPMRRLTDAARRMADGDYATRVDVHSRDELGGLAADFNHLAASLEANQKM
FT                   RRQLTADISHELRTPLAVLRGELEALEDGVRPLTATSLASLQAEVSTLSKLIDDLYELS
FT                   LADVGALAFHMEPLDLADTVCGAVQGFTPRLMEKGIALQLDVSAAPSHATMVKGDAQRL
FT                   RQVMQNLLENTLRYTDAGGTLRVHVHQEDDWQQIDVQDSAPGVPETMLPRIFDRLFRVD
FT                   ASRSRAQGGAGLGLSLCQTIVAAHGGTIEARHSPLGGLWIAIRLPVLDVLDPLADHDSD
FT                   H"
FT   sig_peptide     493003..493080
FT                   /locus_tag="Rpic_4210"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.925 at
FT                   residue 26"
FT   gene            494543..495202
FT                   /locus_tag="Rpic_4211"
FT   CDS_pept        494543..495202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4211"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: rso:RS05646 probable
FT                   two-component response regulator transcription regulator
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4211"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29308"
FT                   /db_xref="GOA:B2UIA7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIA7"
FT                   /protein_id="ACD29308.1"
FT                   /translation="MILIIEDEPKLAALMTDYLRAAHYETEWLADGTHAAQRIRETAPE
FT                   LVLLDLMLPGKDGLEICREVRAFSEVPIVMVTARVEEIDRLLGLELGADDYVCKPFSPR
FT                   ELVARIKTILRRVQRGGGVPESALHIDAAAYAATLRGQRLDLTPVEFRLLAALAGAPGR
FT                   ILSRSNLLEQIYDDHRIVTDRTVDTHIKNLRRKMEQVSPGTEMIHSVYGVGYRLDA"
FT   gene            495308..495880
FT                   /locus_tag="Rpic_4212"
FT   CDS_pept        495308..495880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4212"
FT                   /product="putative lipoprotein signal peptide"
FT                   /note="KEGG: rso:RS05425 probable lipoprotein signal
FT                   peptide"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4212"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29309"
FT                   /db_xref="GOA:B2UIA8"
FT                   /db_xref="InterPro:IPR012899"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIA8"
FT                   /protein_id="ACD29309.1"
FT                   /translation="MIAVTSRRLVAVVAGLVFSCAAVAQTAAPGAAPLSPMQPVPPHGP
FT                   GMVGRGPGPAFGPGGPHAMGPHHGGAPFLRGLTLTEAQRDKIFAIEYAQMPEAREQHKA
FT                   IEHARRDLHQMVASGQYDEARARGLTESLGRAVAREAQLRAQAGAKVMQVLTPEQRKQV
FT                   ADREARRVAERPLEYDESAPPPELAAM"
FT   sig_peptide     495308..495382
FT                   /locus_tag="Rpic_4212"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.944 at
FT                   residue 25"
FT   gene            complement(495942..496382)
FT                   /locus_tag="Rpic_4213"
FT   CDS_pept        complement(495942..496382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4213"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein; KEGG: rso:RS05426
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4213"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29310"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIA9"
FT                   /protein_id="ACD29310.1"
FT                   /translation="MFTHILLPTDGSEQCRKAIDGALELARATGCRLTAYTCIEEFPNM
FT                   AYSAGVGECPHAYYMETVQGYAKDCIERIAERAREEGVQFDSDVSQFAEPYLGILDAAE
FT                   RHACDVIFMASHGHRSLMGRLLIGNETRKVLTYAHVPVVVYR"
FT   gene            complement(496537..497454)
FT                   /locus_tag="Rpic_4214"
FT   CDS_pept        complement(496537..497454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4214"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; KEGG: rso:RS05428 probable transcription
FT                   regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4214"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29311"
FT                   /db_xref="GOA:B2UIB0"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIB0"
FT                   /protein_id="ACD29311.1"
FT                   /translation="MRRAPTSPSTQPADPRVTADASVFGTLARGSRASLERVTNLGDGV
FT                   TAAIWRNEHDEARYIQPGHHTLSVYLQGGYTTHRQDLPHLFGAPGRVCMLPAEHQSSWV
FT                   IEQPMRFVHLYFAPDALAGHAVRLLDAEPRLFTLHDRTFIEDAHLAQACANIAQLDWTD
FT                   LDDRMRANALANDTLSYLVQTQGRTRALAVRGGLAPHVCRRIATRIDAELHLPLSLGQL
FT                   AAEANLSEFHFARMFRASFGAAPHEWVMQQRMARAQMLLRTTTLALATIAERCGFASPS
FT                   HFSRRFALQLGASPSRYRQAWQRG"
FT   gene            complement(497507..497938)
FT                   /locus_tag="Rpic_4215"
FT   CDS_pept        complement(497507..497938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4215"
FT                   /product="putative signal peptide protein"
FT                   /note="KEGG: rso:RS05430 probable signal peptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4215"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29312"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIB1"
FT                   /protein_id="ACD29312.1"
FT                   /translation="MTPFAFAHRVMAGMLAALAALSMPVAGAERWIPLPNQPDSYASLD
FT                   VSSIQRMPSGPVSAWVRVEASNRAGMRSLQRMFGAFRGDMADFLYTVDCRSRQFSVSQA
FT                   KLYQGALTVSERQLANDAGWQRVDGIGLAGEVARQLCGG"
FT   sig_peptide     complement(497855..497938)
FT                   /locus_tag="Rpic_4215"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.893 at
FT                   residue 28"
FT   gene            complement(497935..498297)
FT                   /locus_tag="Rpic_4216"
FT   CDS_pept        complement(497935..498297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4216"
FT                   /product="putative glycoprotein"
FT                   /note="KEGG: rha:RHA1_ro00675 possible glycoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4216"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29313"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIB2"
FT                   /protein_id="ACD29313.1"
FT                   /translation="MPSLSSPNRSLSRRTTRLLIAVSVLAALVALPRAHASTPPAAAAV
FT                   AAPIPAAKTQKATTVASTAPTCQAIMQRLSGSLAATPSTADKPGTVMIDVDKAGVMMAC
FT                   SHSDSIAIPVPGGKPR"
FT   sig_peptide     complement(498187..498297)
FT                   /locus_tag="Rpic_4216"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.972 at
FT                   residue 37"
FT   gene            499011..501761
FT                   /locus_tag="Rpic_4217"
FT   CDS_pept        499011..501761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4217"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC and GAF sensor(s)"
FT                   /note="KEGG: rso:RS05432 hypothetical protein; TIGRFAM: PAS
FT                   sensor protein; diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; EAL domain protein; GAF domain protein;
FT                   PAS fold-3 domain protein; PAS fold-4 domain protein; PAS
FT                   fold domain protein; SMART: PAS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4217"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29314"
FT                   /db_xref="GOA:B2UIB3"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR012226"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIB3"
FT                   /protein_id="ACD29314.1"
FT                   /translation="MTQFLPAQAGASPADVAPSPEAAQRPVAVTAGAMAEGRNTDFDAL
FT                   SRLSSDAVLLTVDGRLVQANPAAARLLGAQDPAQLAGLQLAGLIHPDDVAQVVPRLAGM
FT                   VSSGVSAQPVEHRLVRADYTHVLVASEAAACEHEGQPAVMLVLREAVSRHALERHAVQA
FT                   RAEALHARRLLASENAVLAQLASNATLSTVLRHLCLYVEQVYPNAMSALLLLDAGSQTL
FT                   RVAAAPTLPAAYAATLENSPVGPEAGACGCAMYLGDTVFIDSIATDPRWQRERTAALAA
FT                   GFASAWALPIRSSRGDKLGVLALFYRQPCMPVEEEQHFLDDVTHLAGVAIQKDNVERGL
FT                   AESEERYRLAISNLHEGVVIISPDGVVQAANASAERILRVRPGQLVGRNRLDPIQRVVD
FT                   EYGKEIGSTMMPSGQVLRTGEPIFGRVYGLLLKTGELMWVRQNIIPIRRHAEPTPSSVM
FT                   LSFADITDIKRAEQRLRHLAAHDALTGLTNRSFFIAHLESAIESARDESRELALFFLDL
FT                   DRFKSVNDTAGHACGDTLLQSAAARLTDCIGPGDVIARLGGDEFVILIDQRVEGKRIAL
FT                   LAERLLQAMREPFDTVNGRYYLGVSIGVALYPHDGISGSDLLRSADAAMYRAKQNGRNR
FT                   AQFYTAELNARLQRRYMLENALRDARENNELQLVYQPKYDLASHRIVGAEALLRWNSAK
FT                   LGAISPVEFIPVAEETGLIVPIGAWVLRRACEQAVIWYEALGYDFRMAVNLSARQFQAG
FT                   DVVPMIEQTLADSGLPPTALEVEITESLLMGGADEVRPMFDALTAQGIRISIDDFGTGY
FT                   SSLSYLQRFPISNVKIDRSFITGIPHDPDSVALTEAIVAMARALGMTVTAEGVEDADQV
FT                   EFLAKAGCQEIQGYYIGKPVTAEGFDRLLRAHLSVVDAGVRAALG"
FT   gene            501885..502388
FT                   /locus_tag="Rpic_4218"
FT   CDS_pept        501885..502388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4218"
FT                   /product="putative transmembrane protein"
FT                   /note="KEGG: rso:RS05433 probable transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4218"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29315"
FT                   /db_xref="GOA:B2UIB4"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIB4"
FT                   /protein_id="ACD29315.1"
FT                   /translation="MVESIASIVSHTPAWVFVVFAVLIAIGVRQMQPRIVSRRRLIVLP
FT                   LVVAAYSLYGVSMASHGSPLALTMWLVAVVVAFLVTYMSPPNGAVSETARTVRVPGSWV
FT                   QMVVIVGLFAARYAYNVMLAIRPEVSHSGSFTALFSALFGFLGGLLLSRSVLLHVRTPR
FT                   LAAA"
FT   gene            502447..503259
FT                   /locus_tag="Rpic_4219"
FT   CDS_pept        502447..503259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4219"
FT                   /product="transcriptional regulator, ModE family"
FT                   /note="TIGRFAM: molybdate transport repressor, ModE; PFAM:
FT                   regulatory protein LysR; TOBE domain protein; KEGG:
FT                   rso:RS05434 putative molybdenum-pterin-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4219"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29316"
FT                   /db_xref="GOA:B2UIB5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR003725"
FT                   /db_xref="InterPro:IPR004606"
FT                   /db_xref="InterPro:IPR005116"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR016462"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIB5"
FT                   /protein_id="ACD29316.1"
FT                   /translation="MLELDGTIWLRAGEDNWGGRGRIELLAAIGQTGSITAGAKAVGLS
FT                   YKAAWDAIDTMNNLAGEPLVVRTTGGKGGGGSVLTPRAQRLIESFRVLEAEHRRFVERL
FT                   DAAAQAASEDVHLLRRLMLRTSARNTLFGTVESVAPGAVNDVVTLRLPGGQAVAATITQ
FT                   ESTRVLGLAPGVQAVALIKAPAVMLMRGAGEWRVSAENQLPCVVTEIRDGAVQAEVRLR
FT                   LLDVSDPSAAETVLVAMLSRTAVQTLALAEGVEAVAVFEASSVILGLA"
FT   gene            503267..503764
FT                   /locus_tag="Rpic_4220"
FT   CDS_pept        503267..503764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4220"
FT                   /product="flavodoxin/nitric oxide synthase"
FT                   /note="PFAM: flavodoxin/nitric oxide synthase; KEGG:
FT                   ajs:Ajs_1688 NAD(P)H dehydrogenase (quinone)"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4220"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29317"
FT                   /db_xref="GOA:B2UIB6"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIB6"
FT                   /protein_id="ACD29317.1"
FT                   /translation="MTPKTLLIVYHSMTGGTRQMAEAAQAGAAEEGGVTVRLLHAAQAG
FT                   PDDVLAADGYLFATPENLAAISGQLKDFFDRCYYPALDRINGRPYACLICAGSDGQNAV
FT                   RQIERIATGWRLKPVAEPIIVCTHAQTPEAILAPKQIGAEDLERCRALGQALATGLALG
FT                   VF"
FT   gene            complement(503767..504510)
FT                   /locus_tag="Rpic_4221"
FT   CDS_pept        complement(503767..504510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4221"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: rso:RS05462 probable ATP-binding ABC transporter
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4221"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29318"
FT                   /db_xref="GOA:B2UIB7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIB7"
FT                   /protein_id="ACD29318.1"
FT                   /translation="MSGGMIDLVVQKTLTSAARVFSLDIAVRSDSRRVVLYGPSGAGKS
FT                   LTLRAIAGLMTPQRGRIVLNGRTLFDHADNINLSAQERRVGYLFQDYALFNHLTVAQNI
FT                   AFGLKRGWFNPPRRAHDPRVQQWIDSFELGAVAANYPSQISGGQRQRVALARALIAEPS
FT                   MLLLDEPFAALDPALRTRMRSELSALQARLQVPMLMITHDPADVEIFGDHVFELRDGRV
FT                   VADAVRAPDAPPLSPYPHLTAVVNR"
FT   gene            complement(504507..505193)
FT                   /locus_tag="Rpic_4222"
FT   CDS_pept        complement(504507..505193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4222"
FT                   /product="molybdate ABC transporter, inner membrane
FT                   subunit"
FT                   /note="TIGRFAM: molybdate ABC transporter, inner membrane
FT                   subunit; PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: rso:RS05467 probable
FT                   transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4222"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29319"
FT                   /db_xref="GOA:B2UIB8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011867"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIB8"
FT                   /protein_id="ACD29319.1"
FT                   /translation="MSASIWTPLLLSLKVAGWATVLNLVLGVGAAYALARTRSRLREVI
FT                   DSVLTLPLVLPPTVLGYYLLVLLGRRGTIGGWLDSMGIQLVFTWQGAVIASTVVAFPLV
FT                   MKSARAAFEGVDHQLENAARVLGLPEAAVFFRVTLPLAARGIAAGVLLAFARALGEFGA
FT                   TLMIAGNLPGRTQTLSVAIYEAVQAGDDATANTLVLITSVTCIVVLVVASRLLQGRAPS
FT                   LQEQLA"
FT   sig_peptide     complement(505092..505193)
FT                   /locus_tag="Rpic_4222"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.872) with cleavage site probability 0.579 at
FT                   residue 34"
FT   gene            complement(505450..506982)
FT                   /locus_tag="Rpic_4223"
FT   CDS_pept        complement(505450..506982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4223"
FT                   /product="RND efflux system, outer membrane lipoprotein,
FT                   NodT family"
FT                   /note="TIGRFAM: RND efflux system, outer membrane
FT                   lipoprotein, NodT family; PFAM: outer membrane efflux
FT                   protein; KEGG: rso:RS05506 putative outer-membrane drug
FT                   efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4223"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29320"
FT                   /db_xref="GOA:B2UIB9"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIB9"
FT                   /protein_id="ACD29320.1"
FT                   /translation="MRAGRWTPLALAAALFLAACSLAPTYEKPDVGTPNAFKEAAQPAQ
FT                   ATDAPLAANEQGKWKTAEPALPADGAWWKIFNDPTLDKLEAQAAEASPTLAAAAARVTQ
FT                   ARAFVQANRASLFPELDVGFGPTRQRASAASAGLPVGAPVQPQTYWRAQSTVAYEVDLF
FT                   GRVRNNIDAAGADAERVEALYRAARLTLQADVAQTYFSLRTLDAEEALLSRTLVGREEA
FT                   LKLVQRRFNTGDIGELDVARADAELATARSDRIGVQRRRAVLEHALATLLGKAPADFTM
FT                   GADPLQSAEVRVPAGLPSALLERRPDVAAAERSMAAANARIGVARAAFFPQLQLTGGFG
FT                   YESHDIGDLLKWGSRTWILGPLVGTALSLPIFDGGARSAGVKQARAAYEENVANYRESV
FT                   LVAFREVEDNLSELRLLADQAKAQDDAVRASTRAAQLSRTRYNAGSVNYLDVIDAERNM
FT                   LSAERIGVQLAGSRVNSTVGLIKALGGGWGDLPPAAPANAATAAQPATVAQQ"
FT   sig_peptide     complement(506899..506982)
FT                   /locus_tag="Rpic_4223"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.986) with cleavage site probability 0.612 at
FT                   residue 28"
FT   gene            complement(507044..510250)
FT                   /locus_tag="Rpic_4224"
FT   CDS_pept        complement(507044..510250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4224"
FT                   /product="transporter, hydrophobe/amphiphile efflux-1
FT                   (HAE1) family"
FT                   /note="TIGRFAM: transporter, hydrophobe/amphiphile efflux-1
FT                   (HAE1) family; PFAM: acriflavin resistance protein; KEGG:
FT                   rso:RSp1113 probable transmembrane multidrug-efflux system
FT                   lipoprotein transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4224"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29321"
FT                   /db_xref="GOA:B2UIC0"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004764"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIC0"
FT                   /protein_id="ACD29321.1"
FT                   /translation="MNFSKFFVDRPIFAGVLSTLILLIGIISIWRLPISEYPEVVPPSV
FT                   VVRAQFPGANPKVIAETVASPLEEQINGVENMLYMQSQANSDGNLTTTVTFKLGTDPDK
FT                   AQQLVQNRVSQALPRLPDVVQRLGVTTVKSSPDLTMVVHLLSPNDRYDMTYLRNYAVLN
FT                   VKDRLARISGVGQVQLFGSGDYSMRVWLDPNKVAERGLTANEVVKAIRDQNVQVAAGVI
FT                   GGSPSVPGTDLQLSVNAQGRLKTEQEFGDIILKSSPNGAVTYLRDVARIELAASEYGLR
FT                   SLLDNKQAVAIPIFQAPGSNALQISDDVRKTMAELKEDFPEGVDYRIVYDPTQFVRSSI
FT                   EAVTHTLLEAVALVVLVVILFLQTWRASIIPLLAVPVSIIGTFGLMLMFGFSINALSLF
FT                   GLVLAIGIVVDDAIVVVENVERNIAEGLSPREATYKAMREVSGPIIAIALTLIAVFVPL
FT                   AFMTGLTGQFYKQFALTISISTVISAFNSLTLSPALAALLLKSHDAPKDWLARAMDKGL
FT                   GWIFRPFNRVFGAASESYGRSTSRVIGRKAVMLGIYLALIGATALLFNKVPGGFVPMQD
FT                   KQYLVSFAQLPDGASLDRTEDVIRRMSDIALKHPGVESAVAFPGLSINGFTNSPSAGIV
FT                   FVTLKPFDERKTPNLSGGAIAGQLNQQYGAIKDAFIAVFPPPPVQGLGTVGGFKLQLED
FT                   RGSVGYEQLFAATQAFMAKARKTPELGPSFSSYQINVPQLNADLDRVKAKQLGVPVTDV
FT                   FDTMQVYLGSLYVNDFNRFGRTYQVKVQADAPFRAHAEDILQLKTRNTAGEMVPLSSLL
FT                   RVSQGFGPDMVVRYNGYTAADINGGPAPGFSSGQAQAAVERIAHETLPKGVRFEWTDLT
FT                   YQQILAGNSAVWIFPICVLLVFLVLAAQYESLTLPLAVILIVPMSLFAAMLGVWVSHGD
FT                   NNIFTQIGLVVLVGLACKNAILIVEFARELELQGRTIVEAAIEACRLRLRPILMTSIAF
FT                   IMGVVPLVVSTGAGAEMRHAMGVAVFAGMLGVTLFGLFLTPVFYVLLRTLAARRGQRSE
FT                   DAPDRDLDLDGTLPVPSTQH"
FT   gene            complement(510280..511590)
FT                   /locus_tag="Rpic_4225"
FT   CDS_pept        complement(510280..511590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4225"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   rso:RSp1112 probable transmembrane multidrug efflux system
FT                   transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4225"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29322"
FT                   /db_xref="GOA:B2UIC1"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIC1"
FT                   /protein_id="ACD29322.1"
FT                   /translation="MSLSKRTLAISVAAVLGVAAVGTYGLVSSAGASQQPAAAPAATPV
FT                   DVAPVLAKNVSEWDEFSGRIEAVQRVEVRPLVSGTVTAVHFKDGSIVKKGDALFTIDPR
FT                   PYAAEVARTQAALTAAKSRVAYTTSELDRAQKLVADNAIARREFEEKENAAREAQANLQ
FT                   GAAAALEAARLNLEYTHIVAPVAGRVSRAEITVGNVVSAGGAAPVLTTLVSVSPMYVAF
FT                   DADEQSYLRYSAKAAQGAKTPVYIGLANEDGYTREGAIQSVDNRLDVRSGTIRVRATLD
FT                   NADGRLTPGLYARVRMSTGAPHDAILITDKAIGTDQDKKFVLVVDAANKTSYRPVVLGA
FT                   SIDGLRVVKSGLKAGERIVVNGIQRVRPGDAVAPNTVTMDSLVTKRVVLPGAQPEAPAA
FT                   PAEAKADTTTAPAAKAEAKAANAKTAATAQRLPADRA"
FT   sig_peptide     complement(511492..511590)
FT                   /locus_tag="Rpic_4225"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.739 at
FT                   residue 33"
FT   gene            complement(511706..512797)
FT                   /locus_tag="Rpic_4226"
FT   CDS_pept        complement(511706..512797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4226"
FT                   /product="Alpha/beta hydrolase fold-3 domain protein"
FT                   /note="PFAM: Alpha/beta hydrolase fold-3 domain protein;
FT                   KEGG: rso:RS02619 probable lipase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4226"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29323"
FT                   /db_xref="GOA:B2UIC2"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIC2"
FT                   /protein_id="ACD29323.1"
FT                   /translation="MGSSPPRLVVSDRSLPSDAASAAVRPAQPYATPAPTNVALNNKLR
FT                   GAASTLPKQASACKETAGAAPLPREVTAEDYWTQGYAGRIRLRVFRPEMHADDAAAPLR
FT                   RPGVLYLHGGGFVRGSIDDADAPGRYLAATLPAVVVTVGYSLAPAAPFPAAPEDVYAAL
FT                   CCMADHADAWGIDRRRIAVAGHDAGGNLSAALTMIARDRGGPNLRAQVLIAPMLDPTMA
FT                   RVRPDHLANADNSAEVCADCYRQYLPRPTERVHPYAAPVESRRLQGLPPALLLTAPQDL
FT                   LRTEAERYAACLIEAGVVTQVVRVNEACHDSIAMSAVAQDEMTCFLRWHLGMTRQTAAP
FT                   RKRRPRADRKDRTSIDPTGETPG"
FT   gene            513138..514082
FT                   /locus_tag="Rpic_4227"
FT   CDS_pept        513138..514082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4227"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: rso:RS02618 probable transcription
FT                   regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4227"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29324"
FT                   /db_xref="GOA:B2UIC3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIC3"
FT                   /protein_id="ACD29324.1"
FT                   /translation="MDRLQAMQVFTRVVEASSFTKAADSLQLPRATVTNLVQSLEAHLG
FT                   VRLLHRTTRRVNVTADGAAYYERCVRLLGDLEETEAAFSQSSSGARGTLRIDVPASIGK
FT                   RLLVPRIRDFHEAYPDLQLEIGMSDRTVDLVQEGVDCAVRGGELQDSSLVARRIGQLSM
FT                   VNCASPEYLARCGTPKTLEDLQDHTAVNYFSARNGRRMDWDFVIDGQKQIHKVRSMVSV
FT                   NDAESAVACGLHGLGLLQTSRFLVYEHLMSGALVEVLPDHISEAVPVSVVYPHNRHLSP
FT                   KVRVFVDWVATLFADHPCLQLKENPRLHIVSAA"
FT   gene            514180..514437
FT                   /locus_tag="Rpic_4228"
FT   CDS_pept        514180..514437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4228"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RSc0320 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4228"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29325"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIC4"
FT                   /protein_id="ACD29325.1"
FT                   /translation="MNSRLFSAFSRRAVLAMVATVSASATLLSQPATASIQPNFDAPAA
FT                   TQAGRFDPYTQGTDRQADTYGYLSWNGDASYPNGGAASRA"
FT   sig_peptide     514180..514284
FT                   /locus_tag="Rpic_4228"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.972 at
FT                   residue 35"
FT   gene            514586..515362
FT                   /locus_tag="Rpic_4229"
FT   CDS_pept        514586..515362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4229"
FT                   /product="protein of unknown function DUF82"
FT                   /note="PFAM: protein of unknown function DUF82; KEGG:
FT                   rso:RS02617 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4229"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29326"
FT                   /db_xref="InterPro:IPR002782"
FT                   /db_xref="InterPro:IPR027798"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIC5"
FT                   /protein_id="ACD29326.1"
FT                   /translation="MQTVVLTFDSNLTPLLPQALRGHPVARAWADGATLKHAIEALGVP
FT                   HTEVGQVLVDGRPMALEAMLPARGYIAVSAVEPLLPTAPLHFLCDAHLGATARLLRMAG
FT                   FDTAYDNNYADAAIEALANGEDWIVLSRDRELLKRRGIRRGAFIRAREPQAQMREIVMR
FT                   LRLADVARPFSRCLECNVPLRMLRPEEASASVPPRVRERQRLFSTCDVCRRVYWPGSHW
FT                   ARMNAVLADMLSPEADASTDTAEAAERMPRTGSAGA"
FT   gene            complement(515363..516793)
FT                   /locus_tag="Rpic_4230"
FT   CDS_pept        complement(515363..516793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4230"
FT                   /product="alpha,alpha-trehalose-phosphate synthase
FT                   (UDP-forming)"
FT                   /EC_number="2.4.1.15"
FT                   /note="KEGG: rso:RSp1105 probable
FT                   alpha,alpha-trehalose-phosphate synthase protein; TIGRFAM:
FT                   alpha,alpha-trehalose-phosphate synthase [UDP-forming];
FT                   PFAM: glycosyl transferase family 20"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4230"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29327"
FT                   /db_xref="GOA:B2UIC6"
FT                   /db_xref="InterPro:IPR001830"
FT                   /db_xref="InterPro:IPR012766"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIC6"
FT                   /protein_id="ACD29327.1"
FT                   /translation="MSRLIVVSNRVAPVAEGQGTAGGLAVGVFDALRETGGIWFGWSGE
FT                   SAATVSHEPTIVTKGNITYATVGLNRKDYDQYYRGFANATLWPIFHYRVDLSRYERQEY
FT                   HGYRRVNAQFAHQLKALVQPDDILWVHDYHLIPFAAECRALGLTNRIGFFLHIPFPSPE
FT                   ILTTIPPHEDLMRALCAYDLVGFQTETDRVAFYDYIEREARGYIEQKEQNGPVHAYGHT
FT                   LRAEVYPIGVHPDEIAQQAKASLARRNPFMRHAGARGERIAPQGQGQGQPPTKLIMSVD
FT                   RLDYSKGLPERFRAFEQLLDDFPDHRRHVTFIQIAPTSRQDVQSYQQIRQRLEAESGRI
FT                   NGKHSELDWTPIRYINKQYERRVLMALFRSSQIGYVTPLRDGMNLVAKEYVAAQDPENP
FT                   GVLVLSRFAGAARELDAALIVNPYDTRGMAEALNRALTMPLEERKARYAHMMDRLRSAN
FT                   LTIWRERFVTDLRGAPSR"
FT   gene            complement(516790..517590)
FT                   /locus_tag="Rpic_4231"
FT   CDS_pept        complement(516790..517590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4231"
FT                   /product="HAD-superfamily hydrolase, subfamily IIB"
FT                   /EC_number="3.1.3.12"
FT                   /note="KEGG: rso:RSp1104 probable trehalose-phosphatase
FT                   protein; TIGRFAM: HAD-superfamily hydrolase, subfamily IIB;
FT                   PFAM: trehalose-phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4231"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29328"
FT                   /db_xref="GOA:B2UIC7"
FT                   /db_xref="InterPro:IPR003337"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIC7"
FT                   /protein_id="ACD29328.1"
FT                   /translation="MSKNVSPQSSANAAPLPSLDLGRTAFLLDFDGTLVDIAPQPEAVH
FT                   VSAPLRETLAALHAASGGALAIISGRTVHDVESRLSLPGLVIAGVHGAERRYADGGFVR
FT                   LNADADALAQLERELRAELTQLSTQFSGVVLESKGIAFALHYRHAPEAENAVLTVADRL
FT                   ARRYADHVRLQAGKMVAELKPRGASKGDVVHTLMTEPPFMGRTALFAGDDLTDESAFDA
FT                   VNALEGWSIKVGTGPSQARWRVQDAAALRAWLATLTAPSKRGAA"
FT   gene            complement(517752..519803)
FT                   /locus_tag="Rpic_4232"
FT   CDS_pept        complement(517752..519803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4232"
FT                   /product="NADH:flavin oxidoreductase/NADH oxidase"
FT                   /note="PFAM: NADH:flavin oxidoreductase/NADH oxidase;
FT                   FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: bte:BTH_II0478 2,4-dienoyl-CoA
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4232"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29329"
FT                   /db_xref="GOA:B2UIC8"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIC8"
FT                   /protein_id="ACD29329.1"
FT                   /translation="MPASTPSSPYPHLLSPLDLGFTTLKNRVLMGSMHTGLEDGNHFDR
FT                   LAAYFAERARGDVGLMVTGGFAPNIAGWTKPFAGRLATHGAARRHRAVTNAVHEEGGKI
FT                   ALQILHTGRYGYHPFAVAPTALRSPISPFTPRELSVRGIERQIRAFVHCAQLAREAGYD
FT                   GVEIMGSEGYFINQFLVTHTNKRTDDWGGSYANRMRLPVEIVQRTREAVGKDFIIIYRL
FT                   SMIDLIPDGSSWEEVVQLGKAVERAGATIINTGIGWHEARIPTIATSVPRAAFAWVTKK
FT                   MKGEVGIPLVTSNRINTPEVAEAVLADGCADMVSMARPLLADADFVRKAATNRAQDINT
FT                   CIACNQACLDHAFKAKIASCLVNPRACHETELVIRPTPAKRRFAVVGAGPAGLSAAITL
FT                   AERGHAVDLFDAAPELGGQLNMAKTIPGKEEFHEMLRYFTRRVATTGVTLRLGTRVDAQ
FT                   QLLAAKYDEIIIATGVSPRNPKIPGQDHPSVLSYIDVLRHRKPVGKRVAIVGAGGIGFD
FT                   VAEFLALDGHSPTLDLQTWRAEWGVGDPTEVRGGVDGIRPEPQTPARDIVLLQRRAGKL
FT                   GGGLGKTTGWIHRTSLKNLGVRMVGGVNYERIGDEGLLVSYGEKREAAEWLPVDSVVLC
FT                   AGQEPLRELVAPLQAGGAKVHVIGGADEALELDAKRAIDQGTRLAASL"
FT   gene            complement(519911..520117)
FT                   /locus_tag="Rpic_4233"
FT   CDS_pept        complement(519911..520117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4233"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rso:RS02609 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4233"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29330"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIC9"
FT                   /protein_id="ACD29330.1"
FT                   /translation="MYPIADPIVKKTDLEKLKGLKIANNLKRNSQRTGKPGQGTGKAIP
FT                   QNKLLKALLGKPAEDDAKKSEKS"
FT   gene            520204..521184
FT                   /locus_tag="Rpic_4234"
FT   CDS_pept        520204..521184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4234"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG: rso:RS02608
FT                   probable integrase/recombinase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4234"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29331"
FT                   /db_xref="GOA:B2UID0"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:B2UID0"
FT                   /protein_id="ACD29331.1"
FT                   /translation="MTSFTPPATPVPDLFEPSLQDWAERPAQAFEHWLAARGYRESSAT
FT                   VYRAMWRKWLRWAESHQRALANWSAGDIAAFLDESGLTKLHRYRYARLIERVFHQIEQQ
FT                   RTGTHNPASSAVQQKLAEGENDPTTFLSFAERAAIEASLEVDAQASEAAANASAFKLAR
FT                   DRALVAVCHGAGLKVAQVQSLLLRQVDAALEAIVVERPRGPSYKAPMLEAARPAMAAWL
FT                   AVRAHAEVPGERVFVADAGGRVMHAASVYRRVEAWLAALPALLHRSERLSPQTLRNGYT
FT                   AALFDAGANPAEVGYALGLRDATSAWRLRAAYAEWQAAAHPDGQP"
FT   gene            521352..522377
FT                   /locus_tag="Rpic_4235"
FT   CDS_pept        521352..522377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4235"
FT                   /product="UDP-glucose 4-epimerase"
FT                   /note="TIGRFAM: UDP-glucose 4-epimerase; PFAM:
FT                   NAD-dependent epimerase/dehydratase; 3-beta hydroxysteroid
FT                   dehydrogenase/isomerase; Male sterility domain; KEGG:
FT                   rso:RSp1101 probable UDP-glucose 4-epimerase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4235"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29332"
FT                   /db_xref="GOA:B2UID1"
FT                   /db_xref="InterPro:IPR005886"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2UID1"
FT                   /protein_id="ACD29332.1"
FT                   /translation="MTETILLTGATGYIASHTWVELLDAGYQVIGLDNLCNSSSTVLSR
FT                   IEQITAKTPKFVQGDVRDRRLLDDLFASSRISAVIHFAALKSVGESVQKPLAYYDNNMG
FT                   GLVTLCAAMAHANVRQLVFSSSATVYGNPHTVPITESFPLSATNPYGQTKVMGEQVLRD
FT                   LEISNAAWQIAYLRYFNPVGAHHSGLIGEDPRGIPNNLMPYVAQVAVGKREKLSIYGGD
FT                   WPTPDGTGVRDYIHVVDLARGHLAALDTLRRDGRGFTVNLGTGRGYSVLEVVEAYKRAS
FT                   GKPVPYQIVDRRPGDIAACYADPALAASLLGWRAQYGIERMCEDSWRWQSMNPDGFQTR
FT                   G"
FT   gene            522416..523843
FT                   /locus_tag="Rpic_4236"
FT   CDS_pept        522416..523843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4236"
FT                   /product="putative PAS/PAC sensor protein"
FT                   /note="TIGRFAM: PAS sensor protein; PFAM: PAS fold-3 domain
FT                   protein; KEGG: rso:RS02606 putative lipoprotein
FT                   transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4236"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29333"
FT                   /db_xref="GOA:B2UID2"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR005330"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B2UID2"
FT                   /protein_id="ACD29333.1"
FT                   /translation="MDEPFIAHLVNTLAHALLPALLPFVVACGAGSLLLRLLDDLRSAT
FT                   APRTRVPLVMTALFSAVGLWAVPLLPLLAHWPLHEGPAVLVMTLASFCWSLAVAALWCV
FT                   LGGRAGLMRALLLGVLLSVSGPVAVLLLAGVTSFSATAWEDAGLLGIVMALSAMACAAA
FT                   LQFALSARSGATGVAVRRPGVSLFVSVLFGVALTADAVYTASLAGSFSTLSDMPGNAPA
FT                   GLRLLLVMGAAATALAALLLGYRDRATGDTAAAVATREIRLRKETVQALNDLEQSYRRR
FT                   EAELVARHQLLLDGADVGLWEFDLVTRAAQFSARFAAMLGYTLKEIGPSTSEYLRLVYP
FT                   DDLPMVLNRIQAHVDGNTPAYVAEFRMRHKDGSYRQIAAHGVAVRDAGGNAVRMAGSHI
FT                   EVAAKAASAGVAGSAASIVAEAPETLRRHGLWESWSPADHPAAEAVAPQTESTSLPGPT
FT                   TTSTGGALPSINPDALR"
FT   gene            524024..525565
FT                   /locus_tag="Rpic_4237"
FT   CDS_pept        524024..525565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4237"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; Cache type 2
FT                   domain protein; KEGG: rso:RS02605 putative methyl-accepting
FT                   chemotaxis transducer transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4237"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29334"
FT                   /db_xref="GOA:B2UID3"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR033480"
FT                   /db_xref="UniProtKB/TrEMBL:B2UID3"
FT                   /protein_id="ACD29334.1"
FT                   /translation="MNRLTLRQKLWLPLVLSWLCLLLITLWSTWETRTLRLEERQRDLQ
FT                   NISESVFSIIKDYGQMAQDGKLAADEARAQALARIKMIRYGKDGYFSINQTNSVMVMHP
FT                   IKAEMNGKDMSGFTDPAGNHLFEEISRVGKSGGGFVDYLWPKPGAEAPQPKKSYVLYYQ
FT                   PWDWCLVTGTYMDDIETAFHASLIKALGLLFGVGLLMTVVVVAVTRSLQRQLGGEPAYA
FT                   ARIAGRIAAGDLAVPVETRSGDRDSMLYAMAQMQRELTGTIGNIKSSADSIASATKQIA
FT                   AGNADLSQRTEQQASSLEETASSMEELTSIVKQNADNARQASTLAVNASDIAVKGGEVV
FT                   GRVVETMSGINESSKKIADIIGVIEGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEV
FT                   RSLAQRSASAAKEIKDLIGDSVGRVQNGSALVEEAGVVIQDVVTAVKRVTDIMGEISAA
FT                   SDEQSSGIEQVNQAVNQMDEVTQQNAALVEQAAAAALSLEEQAQLLRTAVGRFQV"
FT   sig_peptide     524024..524110
FT                   /locus_tag="Rpic_4237"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.800) with cleavage site probability 0.709 at
FT                   residue 29"
FT   gene            complement(525686..525994)
FT                   /locus_tag="Rpic_4238"
FT   CDS_pept        complement(525686..525994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4238"
FT                   /product="histone family protein nucleoid-structuring
FT                   protein H-NS"
FT                   /note="PFAM: histone family protein nucleoid-structuring
FT                   protein H-NS; KEGG: rso:RS02604 putative HNS-like
FT                   transcription regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4238"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29335"
FT                   /db_xref="GOA:B2UID4"
FT                   /db_xref="InterPro:IPR001801"
FT                   /db_xref="InterPro:IPR027444"
FT                   /db_xref="InterPro:IPR037150"
FT                   /db_xref="UniProtKB/TrEMBL:B2UID4"
FT                   /protein_id="ACD29335.1"
FT                   /translation="MPTYKEIVQKISELQRQADELRANEQATVIAEIKHKIVEYGLTAE
FT                   DLGFGAKGAVASKKAGRKVPVRYRDNNGNTWTGRGKRPGWLVKELSSGRKMEDFLVA"
FT   gene            complement(526408..528495)
FT                   /locus_tag="Rpic_4239"
FT   CDS_pept        complement(526408..528495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4239"
FT                   /product="diguanylate cyclase/phosphodiesterase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; EAL domain protein; KEGG: rso:RS02603
FT                   probable transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4239"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29336"
FT                   /db_xref="GOA:B2UID5"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR005330"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:B2UID5"
FT                   /protein_id="ACD29336.1"
FT                   /translation="MHNDFHIALLLFAWVSTGLTTFAALDAATRLPGGSTIAKRRNWRI
FT                   ACAVILGIGLWAGLWLGQLGLHRQVGAAVSAPIVATLMTALAASLAAFSIVLPDTSASN
FT                   GAQAPQRRSIAMGAVALAIGLLTMELYMTRPWVHDQALSLRRAVLGWGGGTLVLGAGVC
FT                   LAMCMAFHMPPAQRRAAVGLRARAAAVLATTAVLSLVLWPCAAAWPADESTMHIVPVIM
FT                   LSAGGVLIALGLHAVLMMLETRVDSAQAHLEASLARVANQTPRPQLHDALTGLPNRLHL
FT                   REALEAAILSSTRRGRPFALFYLDLDNFGQINDQYGRNAGDRVLQIIAERLRQAIRGED
FT                   TVARLGGDEFGILVEGLALPESAATIGDKLLFRLRESVEVEGRRLRATASIGVVVHPHN
FT                   GATADTLLEHADTAMFDCKQSTGNAYRFFEPRLNTTAHRVLQIQRALSHAALNGQLSVY
FT                   YQPKYDARTQAMAGAEALLRWNHPELGPVSPAEFIPLAERTGTIVELGDWVVEEVCRQI
FT                   MHWDAIGMAPQRIAVNLSPRQFQQPDLVQRLSQILHRYQVAAHRLMFEITETAAMRDAS
FT                   QSIAVIRQIQSLGFEVAIDDFGTGYSSLSYLQRFRAQQIKIDRAFVSALDDNPPEAAAI
FT                   IRAICAMAHSLDMTVVAEGVETEAQMQALVNLQCDQVQGYLLARPMPAKDFQGLLGVEY
FT                   A"
FT   sig_peptide     complement(528424..528495)
FT                   /locus_tag="Rpic_4239"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.985) with cleavage site probability 0.856 at
FT                   residue 24"
FT   gene            complement(528800..530053)
FT                   /locus_tag="Rpic_4240"
FT   CDS_pept        complement(528800..530053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4240"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="PFAM: regulatory protein LuxR; KEGG: rso:RS02602
FT                   putative transcription regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4240"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29337"
FT                   /db_xref="GOA:B2UID6"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B2UID6"
FT                   /protein_id="ACD29337.1"
FT                   /translation="MLSFSKELPITTEVAQNNNNHDSDGGITPQHADSKGLHSELSQYA
FT                   PGAIMLQRLSDDAEFHRLVDTIYEAVLEPAQMPIALALLSVYAGAESAHYFVWDKHTDT
FT                   PRHGVSSGWCQHCPQPGHCNSFCHDPQLLSAAPPEETPSAGMTLIDTPDMRVTMRLRTR
FT                   DDDASEVSTIERETRLQRVLPHLQRAARMQQRNLELNELAALGMAGLDTLDFGVMVIER
FT                   TMRVKYANAWARTMTTEDDRLSLDGSLLHSADHTHDAALRNLIEHAAGSLGVQGAAGSW
FT                   MYLARDGRPVPFIATPLTPSDAMRSAWASPLALVLVGNSEARSVMDAGVLASLFGLTNK
FT                   ECIVAARLAAGETLQEIAEREFLSLHTVRVHIRDILRKTGTHRQSELVRLLHLLPSVDL
FT                   ERAGAATPAARRRGRLNA"
FT   gene            complement(530185..531930)
FT                   /locus_tag="Rpic_4241"
FT   CDS_pept        complement(530185..531930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4241"
FT                   /product="Polypeptide-transport-associated domain protein
FT                   ShlB-type"
FT                   /note="PFAM: Polypeptide-transport-associated domain
FT                   protein ShlB-type; KEGG: rso:RS02601 probable
FT                   activation/secretion signal peptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4241"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29338"
FT                   /db_xref="InterPro:IPR005565"
FT                   /db_xref="InterPro:IPR013686"
FT                   /db_xref="UniProtKB/TrEMBL:B2UID7"
FT                   /protein_id="ACD29338.1"
FT                   /translation="MERAAARLRDTTNEITEETGVRTTTMRLALATGVALTGPALSWAQ
FT                   SSPTQGNPIDTLPKVDTSRPPQQKIQVEVQRPNPALENLLATHLTPTKFQIEGVKTLPF
FT                   PEVAAHFAPLAGHDVTVAQLLQAANDVTKLYADRGFPLSFAFVPAQTFEGGVVRVTVVE
FT                   GYVARMRIEGTPGPLADRLREISQRLMNEKPLRRETFERVTGVLALQPGVQITATVQPP
FT                   TTTDGASELVLNVKRQPYTIGTGIEYRSPGVRAIITGTLNSVTPLGEQITVSTLQPRGS
FT                   DHETFYSASWAQPIGTDGLLAKLTWSHYRGMPENLPLEQLGYQSRYLTDTQRLGLSLSY
FT                   PVLLSNTRNLMVTGTFYGNDDKQRYNPQVTTLPQTELDTKVRVAGAEVLYTEINPGETR
FT                   RASLGLYQGINSLGAGKAASSNAKNDVDLSFLRTRVTASEAHDLPLGFGVVVSGAAQYS
FT                   GAVLPSSEQISFGGRFFGLAYPAGEVAGDRGWGASVEINRAFQVSMDYLKTVQPYLLYD
FT                   TAKVYSNAGTLVHDQLGSIALGVRFSDRKYYTLDLAIARPVGDKPINSSSRSLRFNAAY
FT                   TYQFN"
FT   gene            complement(532137..533612)
FT                   /locus_tag="Rpic_4242"
FT   CDS_pept        complement(532137..533612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4242"
FT                   /product="putative hemagglutinin-related transmembrane
FT                   protein"
FT                   /note="KEGG: rso:RS02600 putative hemagglutinin-related
FT                   transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4242"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29339"
FT                   /db_xref="GOA:B2UID8"
FT                   /db_xref="InterPro:IPR031929"
FT                   /db_xref="UniProtKB/TrEMBL:B2UID8"
FT                   /protein_id="ACD29339.1"
FT                   /translation="MNKNIKCLAATMASLLVLGGCASSGSGDMGSSLGGSNGGGSNNNG
FT                   GSTPTPSPSPSPSPSPSPSPSPSPSPSPTPAPAPLTPTGAVLNNAGGIVTAAGSTVSGL
FT                   GKTIATAPLPSQLSGVQSGLGGVVESAGATVSALGTGVQNGLGSIGRNTNPVGTTVSSL
FT                   GNVVTGAGNTVTSAGTLVNNLGTGPLAPLAPVTTPLAGVVTQVGQAVANGGGTLGTALS
FT                   TGPVEQLTQQLSTAIVPLTSQITSGTQTLGAATGLGSPANSLLGTIGGAVANGGTTLTA
FT                   ANVPVVSGLGGVVTAAGTTVAALGGAVYSPTASGGNPLAPITGLLGGLGGATGGSNPLA
FT                   PITGALGGLGGAGGTNPLAPITGLLGGLGGATGGSNPLAPITGALGGLGGAGGTNPVAP
FT                   ITGLLGGLGGTPGGSNPLAPITGALGSLGGAAGAASNPLGPISAITAPVGGVVTTVGTG
FT                   LTSAGAATPLSPVTGAVGGLLGTVGTTLGGTRH"
FT   sig_peptide     complement(533538..533612)
FT                   /locus_tag="Rpic_4242"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.582 at
FT                   residue 25"
FT   gene            534101..535225
FT                   /locus_tag="Rpic_4243"
FT   CDS_pept        534101..535225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4243"
FT                   /product="putative hemagglutinin-related transmembrane
FT                   protein"
FT                   /note="KEGG: rso:RS02599 putative hemagglutinin-related
FT                   transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4243"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29340"
FT                   /db_xref="GOA:B2UID9"
FT                   /db_xref="InterPro:IPR031929"
FT                   /db_xref="UniProtKB/TrEMBL:B2UID9"
FT                   /protein_id="ACD29340.1"
FT                   /translation="MTHIRHSIRVAPLACAVAALMLAACSSGGSGSGSSPNPSPNDTTG
FT                   VTPVGKVANGTGNTVVATGQAVSSLGSTLQNANIPGLSDQAKAGLGGTVDNAGKAVSDL
FT                   GLGVQTGLGKMGQNPNPIGTTVASTGNVVTDLGQATVSAGSLVQGLGQGSGAPLAPITQ
FT                   PVGGGVQQIGQALIGGGTLLGSALSSGAVQQVTQQLSTAIVPVTTQVSGATQMIGDSTG
FT                   LGGALNNLLGTVGGGVGGAGNTITGTGVPVVSTLGPVVTSLGTTVAAIGGVATTGGSAG
FT                   SNPLGGLLGGVGGSSGGTTPLAPLTGLLGGASGGSSPLAPVTGLLGGAAGGSNPLAPIT
FT                   NLLSGATSAAGGTSGGNPLAPVTNLLGGVGSPAH"
FT   sig_peptide     534101..534199
FT                   /locus_tag="Rpic_4243"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.433 at
FT                   residue 33"
FT   gene            535791..535970
FT                   /locus_tag="Rpic_4244"
FT   CDS_pept        535791..535970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4244"
FT                   /product="Flp/Fap pilin component"
FT                   /note="PFAM: Flp/Fap pilin component; KEGG: rso:RS02598
FT                   putative pilin protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4244"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29341"
FT                   /db_xref="GOA:B2UIE0"
FT                   /db_xref="InterPro:IPR007047"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIE0"
FT                   /protein_id="ACD29341.1"
FT                   /translation="MKNAILKFIRDEQGATAVEYGMIAGLIAAAITVIVGKLGTQLNTV
FT                   FTNICTAVKGGTAC"
FT   gene            535980..536531
FT                   /locus_tag="Rpic_4245"
FT   CDS_pept        535980..536531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4245"
FT                   /product="peptidase A24A prepilin type IV"
FT                   /note="PFAM: peptidase A24A prepilin type IV; KEGG:
FT                   rso:RSp1091 probable prepilin peptidase transmembrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4245"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29342"
FT                   /db_xref="GOA:B2UIE1"
FT                   /db_xref="InterPro:IPR000045"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIE1"
FT                   /protein_id="ACD29342.1"
FT                   /translation="MHSHIDIAGWVSVAVLAVLAIALDIRLRRVPNWLVAAGVVLSIAL
FT                   IKFGGVQDLAYDWQDFWLGGAIAFACFLPLYTLGWMGAGDVKFFTVVGLLAGWHGLVAV
FT                   WLVSSMISGLHALGIVVLRQLDASSPSAWIVMRVCPAIARWDIAHAGLRGIPYAAYMAI
FT                   GLLSLPWVPSVMRMPWLPGM"
FT   gene            536596..537099
FT                   /locus_tag="Rpic_4246"
FT   CDS_pept        536596..537099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4246"
FT                   /product="TadE family protein"
FT                   /note="PFAM: TadE family protein; KEGG: rso:RS02595
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4246"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29343"
FT                   /db_xref="GOA:B2UIE2"
FT                   /db_xref="InterPro:IPR012495"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIE2"
FT                   /protein_id="ACD29343.1"
FT                   /translation="MPTLQREREGARMHPEVRTHAVRRPRRHGGRGAASVEFAIVVPVL
FT                   LVLMLGVVYYGVILAMQQALTLAAEEGARAALRYQPSNTQRVAAAYAAVTSVLPTFLTG
FT                   RVQTNQSSTPLVNCQNVAGMQCLSVVLTLPVTSGNNPLLPSIPLLPAPATLTGSAVVQL
FT                   VPGS"
FT   gene            537152..538075
FT                   /locus_tag="Rpic_4247"
FT   CDS_pept        537152..538075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4247"
FT                   /product="Flp pilus assembly protein CpaB"
FT                   /note="TIGRFAM: Flp pilus assembly protein CpaB; PFAM: SAF
FT                   domain protein; KEGG: rso:RS02596 probable signal peptide
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4247"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29344"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="InterPro:IPR017592"
FT                   /db_xref="InterPro:IPR031571"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIE3"
FT                   /protein_id="ACD29344.1"
FT                   /translation="MTSKHLQIFAAALLLLAAILGAVAWKSAHRPPAPVAEQKDGKAVY
FT                   PVVVTTKPLEAGKPITADQVAIEQLPINPAEAFSDVTKVVGREPILPVGVGVPLIASQL
FT                   SSGLAQQVEAGQRAVAINVDEVVGVGNRVMPGDYVDVFLVMRKDGQEIEDSQARLLLPH
FT                   LRVLAFGPLAINEGPQKQPENSGVTRKVDQAKTAVLAVPVEAVSQLAMAHQSGRLLLAL
FT                   RNPGDDAEPTVKPQDAALLAAANRNPMDVAQAGVSMASLTGSARRLVVVPPPLPAIAAA
FT                   RTTVRSSTASTGVEIIRAGKREEQHD"
FT   sig_peptide     537152..537226
FT                   /locus_tag="Rpic_4247"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.937 at
FT                   residue 25"
FT   gene            538068..539432
FT                   /locus_tag="Rpic_4248"
FT   CDS_pept        538068..539432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4248"
FT                   /product="type II and III secretion system protein"
FT                   /note="PFAM: type II and III secretion system protein;
FT                   KEGG: rso:RS02594 probable outer membrane channel signal
FT                   peptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4248"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29345"
FT                   /db_xref="GOA:B2UIE4"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR032789"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIE4"
FT                   /protein_id="ACD29345.1"
FT                   /translation="MTDAAMVRGWMGGLALGCAAFVSSAFAETAPTGQTLHLLTGSQRE
FT                   IRLGKPLERIAIGNPEIADALLLKGRGTATSVLIIAKKPGAANVMVWTQGGVATTYNVQ
FT                   VDAAAPVPGDPAVVAQGDTAVVSGQPKDVYALARARRSAAAASGAEKPKDGNVIDTTSM
FT                   NVPGTVQVDVRVVEFSKTVLKEAGFTFGRTRGGFDFRTFAPSSLSKVTFGSNGLSTEST
FT                   MPIGSAFNLLVSSVSKGLFADLSLLESNGMARVLAEPSLVALSGQSANFLAGGEIPIPV
FT                   PQALGTTTIEYKPFGIGLTVSPTILSENRIALKVAPEASDLDFSRGVTLNGATVPAIVT
FT                   RRADTTVELGDGESFVIGGLVSRSTLSNVDKVPFLGDVPIIGTFFKRLNYNQEERELVI
FT                   IVTPHLVKPMARNAPIDKMLPGQSSGRDRDTAGDPVWRPFALGVADPAAMPGFSK"
FT   sig_peptide     538068..538151
FT                   /locus_tag="Rpic_4248"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 28"
FT   gene            539442..540785
FT                   /locus_tag="Rpic_4249"
FT   CDS_pept        539442..540785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4249"
FT                   /product="putative pilus assembly protein"
FT                   /note="KEGG: rso:RSp1086 probable pilus assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4249"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29346"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIE5"
FT                   /protein_id="ACD29346.1"
FT                   /translation="MDYFLLHGGARGGKQGDAQSAGVHRWLAAAIRELGVLVAETTGHD
FT                   AFIEQIGAVNPEVVFVRFASSPTLIDVPDQDQKLGEGADAINEAMQLVAQLARLFPGLP
FT                   LVAVGSAADGRAMLAALRAGVKDFVDVDGAPAEAVRVVRRLLADRASAEPTRRGRVLAV
FT                   LGARPGVGATTLATNLATLVRRTSASDVMLLDLGQPLRDGALYLNVQANFHFVEAVRNL
FT                   RRFDQVFVQTALSRHPNGLAVLPLPISLAEMRDVSFSEALGLLNRLRTFFDLQVVDLGG
FT                   FGNIDFIAQIIKAADDVMLVTEQSVGAIVSAAELMQELKKREIDRDHLHLTISKFDARL
FT                   SLDAAQIAERLEIPSVLTVPNRREALVIASNQGAMLAETHPTDAYVRALAQIAQTLGYA
FT                   QQSERASGLSNWVSGVSARLGGRFGGRSKRKSADANELDIGTTERNAT"
FT   gene            540782..542137
FT                   /locus_tag="Rpic_4250"
FT   CDS_pept        540782..542137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4250"
FT                   /product="type II secretion system protein E"
FT                   /note="PFAM: type II secretion system protein E; KEGG:
FT                   rso:RSp1085 probable secretion ATPase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4250"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29347"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIE6"
FT                   /protein_id="ACD29347.1"
FT                   /translation="MTQPIEFSNQADAGNGAFAVSQAFQDIKEAAHEHLLTRIEELGAE
FT                   FGRWSRTAIQRFVDLEVEGFTRMRRIPVNETEIRQIAEALTKELAGFGPIEDLLADPAV
FT                   EDILVNGHLDVYVSRHGILERIPVRFADNNHLLRIVRRILAPIGRRLDESNPMVDARLP
FT                   DGGRINVVIPPLALEGPVVSIRKFRKDPLKPEDLLGLGTMSEEIGALIDSAVRARCNIL
FT                   VSGGTSSGKTSLLNAMAYHIPTTERVITIEDTAELSLNHPHVVRLESRPGGFEGTGVVT
FT                   IRELLRNSLRMRPDRIIVGEVRGGEVLEMLQAMSTGHDGSMGTIHASSPRECLYRLEML
FT                   AGFAGFQGSEVSLRRQITNAIDFIVQIGRLSNGKRRILSITEVTGLGDNIISTQELYRY
FT                   EPYVGPDGEEVDRWTALGLQPHSPKLARMRNSEGGGMDGGMTGFGGGGRFHV"
FT   gene            542130..543056
FT                   /locus_tag="Rpic_4251"
FT   CDS_pept        542130..543056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4251"
FT                   /product="type II secretion system protein"
FT                   /note="PFAM: type II secretion system protein; KEGG:
FT                   rso:RS02591 probable pilus assembly transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4251"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29348"
FT                   /db_xref="GOA:B2UIE7"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIE7"
FT                   /protein_id="ACD29348.1"
FT                   /translation="MSSMTLWFGCLALLLMGASLMLWAEAVRRREREASRSFVRAQTEQ
FT                   INARYQPNVEPVPASVPDSLNRAWQDALRRADIEPSRRFYVLLIGPALMITLAVWAVSS
FT                   MLSALTALALYVVIVAFLFWNRTRKMNERLLQQLPGFLDGVVRLMSIGSAVPAAFQAAS
FT                   ANTEQPLRNCLTAITQMQRAGKDLDAAVLTVGRQYRVNELILLSSVLRLALRYGGRADI
FT                   VMERTAAFMRDRQQAQRELFALSAETRLSAWIIGLLPVVVGGVIIMFNAAYIMSMWRDP
FT                   FGKTLILTAFGMEVLGAVMLARLAKSV"
FT   sig_peptide     542130..542204
FT                   /locus_tag="Rpic_4251"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 25"
FT   gene            543066..544055
FT                   /locus_tag="Rpic_4252"
FT   CDS_pept        543066..544055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4252"
FT                   /product="type II secretion system protein"
FT                   /note="PFAM: type II secretion system protein; KEGG:
FT                   rso:RS02590 putative tight adherence TadC related
FT                   transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4252"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29349"
FT                   /db_xref="GOA:B2UIE8"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIE8"
FT                   /protein_id="ACD29349.1"
FT                   /translation="MDDTLITLSLTAAAAGVLVFGGLALRATLTRHRSARKLDTALSDM
FT                   RATAANPAAPAASPVVPPAARPRPHGSREAQQLQQQIAKVGQRWIDTGLGRRIVTEEDR
FT                   KLLEECGYYGEHARTVFGGTRILLPPLLAVFGALHASSALFVFVFGFVGFALGYLAPKW
FT                   LLGRRKESRRRRMDDELPVMVDMLRLLQGVGLSIDQSLQVIANEFHGMLPVLAGEFGRA
FT                   NQQFASGRSREQTLLRIARLFDNEDLKGLITLLTQVDRFGGAVQEPLRQFGGRLQENRR
FT                   ARLKERVGKLTVQMTMIMVMTLLPALLIITAGPGFMGVMRSLQQTGGH"
FT   sig_peptide     543066..543149
FT                   /locus_tag="Rpic_4252"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.752) with cleavage site probability 0.346 at
FT                   residue 28"
FT   gene            544057..544980
FT                   /locus_tag="Rpic_4253"
FT   CDS_pept        544057..544980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4253"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: Tetratricopeptide TPR_2 repeat protein; KEGG:
FT                   rso:RS02589 probable lipoprotein transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4253"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29350"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR016931"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIE9"
FT                   /protein_id="ACD29350.1"
FT                   /translation="MTRFPNAVRAALAGMTMLTVMLAGCGSMATSDMSLRADADIEMAR
FT                   QRQSQEKSEITSPATYLSLIRRMQEQGLYYASLAHIDAYQQRYGRAPEIMLLRADALRE
FT                   TDQLAAADAEYRAVVGATSAMGAGTQGGLLNAAAWRGLGIIAGRQGNFTEAARRLQVAA
FT                   QANPTDASTASDLGYALMRAGEVEQARVPLMQAQQMAASSPKIAGNLVIWLTVNDRKDD
FT                   AASLASHAQLTASARKAIDEDVARVRGAWRDRRIGRDAAAAATRAVALSPSAAGVAGTA
FT                   TPAITTQSRPLALQRGRLLDTLETAQ"
FT   sig_peptide     544057..544146
FT                   /locus_tag="Rpic_4253"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.590 at
FT                   residue 30"
FT   gene            544977..545306
FT                   /locus_tag="Rpic_4254"
FT   CDS_pept        544977..545306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4254"
FT                   /product="putative signal peptide protein"
FT                   /note="KEGG: rso:RS02588 probable signal peptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4254"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29351"
FT                   /db_xref="InterPro:IPR022053"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIF0"
FT                   /protein_id="ACD29351.1"
FT                   /translation="MIPRILMAAGMAVWLMSNPAGAQGFSGGNPQNATQAAPNVGSNMG
FT                   DATRALLKAQRDGTYAGEFVPLRGEQAALAYQRYLDSFSRPMPGLSQTAPSAKSTSSSQ
FT                   ATTAR"
FT   sig_peptide     544977..545045
FT                   /locus_tag="Rpic_4254"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 23"
FT   gene            545398..547056
FT                   /locus_tag="Rpic_4255"
FT   CDS_pept        545398..547056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4255"
FT                   /product="putative transmembrane protein"
FT                   /note="KEGG: rso:RS02587 probable transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4255"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29352"
FT                   /db_xref="GOA:B2UIF1"
FT                   /db_xref="InterPro:IPR018705"
FT                   /db_xref="InterPro:IPR028087"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIF1"
FT                   /protein_id="ACD29352.1"
FT                   /translation="MTATFIATVGLAVLVSIDIGNLFYTQRALQRSADLAAMAAAQRLD
FT                   LPAAAQQAVIQNGLTVDGTNVTLAVVPGVWDASAGTAPTYFTAQAAVDGNTNAAQVTIT
FT                   QNVPYFFMVGQRRLQATAIAKNTSIVAFSLGSGLASVDNGLLNQLLGYLLHTNLNIDAV
FT                   SYQGLATTNIRLADLAVALGAGSMQQLLSLSPSLGSLFNAVISVASQSGLAGVSVGGAG
FT                   ASNALSFGSDLNVPINIGDGGASSPGLLQVLALAGNEQAALNATVNVLDLLTTAAQIAN
FT                   SQSAVNVAPVKLNLLGLGAVTLSLKIIEPPAIAVGPPGQFLSGPSAGQWKTQARTAQVR
FT                   LGVGVLVGAPGVLAVSVPIGLQVAAAQAHAKSNSCTVPRASSSATISAQPQPVSICIAT
FT                   DADKAVNGSMDCASASPAGLVDLGPLGAVSIKANVSPIANSNWGDETIAATQIGLNPQT
FT                   DTSGKSPPRVATQAVFSSILNSNLNQLQLTVTLPLGGTVQLGSDLAPVIAPVLALVGTT
FT                   LDAVLSPLLGVLGIQLGYADIKLLSLDCDAVELVY"
FT   gene            547072..548487
FT                   /locus_tag="Rpic_4256"
FT   CDS_pept        547072..548487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4256"
FT                   /product="sigma54 specific transcriptional regulator, Fis
FT                   family"
FT                   /note="PFAM: sigma-54 factor interaction domain-containing
FT                   protein; helix-turn-helix Fis-type; ATPase associated with
FT                   various cellular activities AAA_5; SMART: AAA ATPase; KEGG:
FT                   rso:RS02586 probable sigma-54 interacting transcription
FT                   regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4256"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29353"
FT                   /db_xref="GOA:B2UIF2"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIF2"
FT                   /protein_id="ACD29353.1"
FT                   /translation="MKTDRWAYETLEIFVWEGRHDIADRVARFMAPFGAEVIRAGGIDF
FT                   QPAEPRLKPAVAVISASVVESGGFTVLDWQAAQGMPVIWVASDAQHDSSRFPPEYTHVL
FT                   GPDFGATELRAQISKVLPSMSSAQAQAQDQSDLVAASPAMHGLLEQVDTFADCDSNVML
FT                   YGETGAGKERIARLLHDKNSVYGKGPFVAVNCGAIPDGLFESQFFGHAKGAFTGAMYAH
FT                   RGYFEQANGGTLFLDELGDLPLYQQVKLLRVLEDSECTRLGSTVPVKLDFRLVAATNKN
FT                   LREMVATGKFRADLYFRLAVIELRIPSLEQRGADDKIALLLSFLRHLLGDKTFDAMPPV
FT                   PEWVRASVGRAYFAGNVRELRNLAERIGITLRQFGRWDEARILPLFAGLQRDAFEREAG
FT                   NGGNGGYGDRGGGGSGGNGGEEERRRILAALDANNWRRQDTAATLGISRKVLWEKMRKY
FT                   QIADGETELRELE"
FT   gene            548594..549376
FT                   /locus_tag="Rpic_4257"
FT   CDS_pept        548594..549376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4257"
FT                   /product="putative lipoprotein"
FT                   /note="KEGG: rso:RS02585 putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4257"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29354"
FT                   /db_xref="InterPro:IPR021350"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIF3"
FT                   /protein_id="ACD29354.1"
FT                   /translation="MRTKKQSGKASHQAFQRGLAIAAAIAVVAGTAACTSAVAQSPAAP
FT                   PTAIAPIAAAAPVPALTATVGQPAATAPAAPATPGAARAERPAPTSAVFELQQRMQAHE
FT                   LSELRTTYNGAYGASLLFAQSDLTYYVTLFQQKDLWRVIKTTNEASAERLYSDFAKQTR
FT                   TMADLELQRIRLEAQKERSERQIAAQQEKLRGLKTDLDIQRQQQAQAQERQKVARTEAE
FT                   ALDIERRAARARVDELQRQIRELEAQVNAPFNSQPRRR"
FT   sig_peptide     548594..548713
FT                   /locus_tag="Rpic_4257"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.992 at
FT                   residue 40"
FT   gene            549527..552766
FT                   /locus_tag="Rpic_4258"
FT   CDS_pept        549527..552766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4258"
FT                   /product="cytochrome P450"
FT                   /note="PFAM: cytochrome P450; oxidoreductase
FT                   FAD/NAD(P)-binding domain protein; FAD-binding domain
FT                   protein; flavodoxin/nitric oxide synthase; KEGG:
FT                   rme:Rmet_3467 cytochrome P450"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4258"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29355"
FT                   /db_xref="GOA:B2UIF4"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR003097"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR023173"
FT                   /db_xref="InterPro:IPR023206"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIF4"
FT                   /protein_id="ACD29355.1"
FT                   /translation="MRSASELPANASPAAAEPIPQPKGLPWLGNLLQLPKDRLAQTLLE
FT                   TSRQFPQGLYQLDFAGRRVPFVYSADLVAELCDETRFRKLIGPPLSFLRAGAGDGLFTA
FT                   HQDEPNWGKAHRILLPAFSQRAMKGYFDVMLDVANALADKWARQGPDADIPVADDMTRL
FT                   TLDTISLAGFGYRFDSFNTPELHPFLAAMVGVLSEAMGKLTRLPLKDRFMREHHRRFEH
FT                   DVAAMHQLVDEVIRARRQAKDGGIGASDLLGLMLNARDPLSDQPLDDTNIRFQVITFLI
FT                   AGHETTSGLLTFALYMLLRHPAVLAQAYAEVDRVLPGDTVPQYAHLAQLDVIERVLKET
FT                   LRLWPTAPSFGVAPYEDTRIGGRYAIRKDQRVVTVLLALHRDPAVWDRPEAFDIDRFLP
FT                   ENEAKLHPHAYKPFGNGERACIGRQFALTEAKLALAVILQRFALSDPYDYGFHIKETLT
FT                   LKPDGFRLRARLRHARERLSVATPSRTEAVTQDDAEGALAGGGEPMHVLYGGSLGTCQD
FT                   IAEQLAATASRAGFDAKVAPLDTIADALPQRGTLVVVAATYNGRAPDSARTLEARLDAA
FT                   DALTRQATGLRYAVLGCGNSQWPAFQAFPKRVEAMLAAAGAHAIVPRGEADGNAGFDAA
FT                   VDAWTRSLWSALGARQTHADGPSVRVDYVAPDALRAAMLPPAARAMTVLANEELVSDAT
FT                   GLWDFTREAPRGPTRHLTVQLPDDVTYATGDHLAVYPRNADDRVDAAIARLALEADALV
FT                   TLTARHAHVRHLPLNQPVSVRQLLRDFVELQDTATVRDITALHAATRCPFTRGQLAVWL
FT                   EGDDAAERFDQDIQAPHVSVLDLLIRLPAIELTLEAFLARLGPMRPRFYSIASSARVSP
FT                   GVAALTVGTVSGPAWSGVGTYRGTASNYLMTLRAGAEIAAAVRTPNPPFAPDVDAHKPM
FT                   VLIGAGTGIAPFRGFLEERAAQQAAGEAVATSLLCFGCRHPEHDFLYRDTLRAWEDAGL
FT                   VRVFPAYSCVAEHPHRFVQHALWDAREAVWAAFDAGATLYVCGDGRAMAPAVRDTLIRM
FT                   HQARYGSDLATASGWLTAQMQSGRYRQDVFN"
FT   gene            552935..553225
FT                   /locus_tag="Rpic_4259"
FT   CDS_pept        552935..553225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4259"
FT                   /product="putative transmembrane protein"
FT                   /note="KEGG: rso:RS02582 probable transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4259"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29356"
FT                   /db_xref="GOA:B2UIF5"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIF5"
FT                   /protein_id="ACD29356.1"
FT                   /translation="MWRRIKASWMAIFLVTLLGAGYLWMYRFEPLLSGEAGSDVFVWDR
FT                   WTHRVCALTDNGEATEWRCDNAMETDGSSSNTNSDVSIRKRMRDAVQRIKL"
FT   gene            complement(553278..554432)
FT                   /locus_tag="Rpic_4260"
FT   CDS_pept        complement(553278..554432)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4260"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: Semialdehyde dehydrogenase NAD - binding;
FT                   oxidoreductase domain protein; Oxidoreductase domain; KEGG:
FT                   rso:RS02580 putative glucose-fructose oxidoreductase
FT                   oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4260"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29357"
FT                   /db_xref="GOA:B2UIF6"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR008354"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIF6"
FT                   /protein_id="ACD29357.1"
FT                   /translation="MNTASHEAEREPQVAPARTVQSPVRYAVVGAGWISQAAFLPGVAQ
FT                   SGNSVVTALVTGDEAKATVLADRYGIEHVHGYADYDQLLAAGDIDAIYLALPNDMHRQY
FT                   ALPALQRGIHVLLEKPMATSEADCEAMIEAARNGNAKLMIAYRLHFEPATLAAIELVRA
FT                   GKLGRIRAFSAMFSQSVAPSNHRASHGYWAGPVSDMGVYPINAVRNLFGEEPVEVSACG
FT                   VRDPDLPFNFDDTVSVTLRFADHRVAQFVVSYSGANIDQYRILGTKGDLEVSPGFMFGV
FT                   GLKYRATIDGKTHEQAFDATDQFGGELQYFSDCILNNREPEPNGEEGLADVRVLAAIER
FT                   ALESGQPQNLGPFQRQGRMETAQVRKLPPVPAPELVDAAEPSKG"
FT   gene            complement(554585..554929)
FT                   /locus_tag="Rpic_4261"
FT   CDS_pept        complement(554585..554929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4261"
FT                   /product="Antibiotic biosynthesis monooxygenase"
FT                   /note="PFAM: Antibiotic biosynthesis monooxygenase; KEGG:
FT                   reu:Reut_B5114 antibiotic biosynthesis monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4261"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29358"
FT                   /db_xref="GOA:B2UIF7"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIF7"
FT                   /protein_id="ACD29358.1"
FT                   /translation="MIAVIFEVEPAPGQRDTYLNLAARLKPLLEQVDGFISVERFQSIT
FT                   NPDKMLSLSFFRDEEAVKAWRNMEQHRGAQHVGRDHAFADYRLRIAHVVRDYGMTERDE
FT                   APTDSRAEHA"
FT   gene            complement(554978..556117)
FT                   /locus_tag="Rpic_4262"
FT   CDS_pept        complement(554978..556117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4262"
FT                   /product="cytochrome P450-like protein"
FT                   /note="KEGG: bmu:Bmul_3696 cytochrome P450-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4262"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29359"
FT                   /db_xref="GOA:B2UIF8"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIF8"
FT                   /protein_id="ACD29359.1"
FT                   /translation="MTALDTAPPADVLQAIVHADPAPYYAELAATRPFFFDATLGWWVA
FT                   ASAEAVDAVLGSRACRVRPADEPVPKAVAATPTGAFFGRLVRQIDGPDHSTRKAKVMAA
FT                   LGRLDVSALAGQALRHARTALPDAASLDAALDADAHFRVPLATMAQTLLGDHADAPACQ
FT                   ADIAAYLAALGPGASAGVVAQADAAVGRLQQRFADSPFAGGDDDSDADIANLAALLAQT
FT                   YDACAGLLGNCIVALSRHAGLTARLRAQPLAIEPFVREVLRRDAPVQNTRRFVAHDIAL
FT                   LGQPLRAGDKVLVVLAAANVDGTTNPDPLRFDSDRTAPRLWTFGGGTHRCPADALATAI
FT                   ARETVRHLLSLPDVDRWLAGLGEVAYRPSPNARIPRFQA"
FT   gene            556206..556922
FT                   /locus_tag="Rpic_4263"
FT   CDS_pept        556206..556922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4263"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: regulatory protein ArsR; KEGG: pol:Bpro_2808
FT                   transcriptional regulator, ArsR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4263"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29360"
FT                   /db_xref="GOA:B2UIF9"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIF9"
FT                   /protein_id="ACD29360.1"
FT                   /translation="MTASSPATASTTQPDIGRVAATIGDPTRIRMLLLLMEGRSLTAKE
FT                   LAYGAGVEPATASAHLRRLEADALITSLSSGRYKYFGLRSPAVAEMIESLLVVAPEKPA
FT                   DPRRSVVPENLRAARLCYDHLAGQLGTEVSEKLLSRGWLTQLDATHGAYDVTPEGEQAL
FT                   AAIGVDVNALRNGRRRFAYGCMDWSERRPHLAGALGAAVAERCIALGWLARQKHSRALS
FT                   MTEAGQRELHAWLHTA"
FT   gene            complement(556939..557481)
FT                   /locus_tag="Rpic_4264"
FT   CDS_pept        complement(556939..557481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4264"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   bmu:Bmul_3149 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4264"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29361"
FT                   /db_xref="GOA:B2UIG0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIG0"
FT                   /protein_id="ACD29361.1"
FT                   /translation="MVIEKSRDLCLRPLERNDLRFVHELNNDAKIMRYWFEEPYETFTE
FT                   LSQLYDRHVHDQRERRFICENNAGEAVGLVELMELNYIHRRGEFQIIIAPGWQGHGYAS
FT                   TATRLAVDYAFMVLNLHKLYLVVDVVNERAIHVYEKCGFQREGELIEEFFSNGAYHNAL
FT                   RMCVFQRDYVKTIRNAN"
FT   gene            complement(557537..558679)
FT                   /locus_tag="Rpic_4265"
FT   CDS_pept        complement(557537..558679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4265"
FT                   /product="PepSY-associated TM helix domain protein"
FT                   /note="PFAM: PepSY-associated TM helix domain protein;
FT                   KEGG: pap:PSPA7_5127 probable oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4265"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29362"
FT                   /db_xref="GOA:B2UIG1"
FT                   /db_xref="InterPro:IPR005625"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIG1"
FT                   /protein_id="ACD29362.1"
FT                   /translation="MLRPVLFRLHWLIGLSASVVLAVVGATGALMAYEDELLRALNPGV
FT                   LTLPARSGPAPTLPQVAAQARAAMPDRPVTFITAASDPTQPWRVWYAWPPGKHGGSSRG
FT                   ELRYVDATTGTLLPEARAQRFFATVKLLHRTLLADEIGKQIVGASTVGLVVMALSGLYL
FT                   RWPRRVTNWRSWLVIRWSRAGRIRWWDVHTVIGTLVLPLYLLAAFSGLYWAYDWYRDGL
FT                   QRLAGMPVVSKAKPVEVPRKPLEDAAIERTWNAFRDNASNYGTATLRIDDARSGQVDIN
FT                   WLPADAPHDRAFNRLTLDAATGAVLRNESFAAKPPMQRLLAGMLPLHNGRYFGPIGVVL
FT                   VLIGALMLPVFAATGWWLYLDRRRRAQPQRKHASAATRPC"
FT   sig_peptide     complement(558581..558679)
FT                   /locus_tag="Rpic_4265"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.952 at
FT                   residue 33"
FT   gene            complement(558710..560830)
FT                   /locus_tag="Rpic_4266"
FT   CDS_pept        complement(558710..560830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4266"
FT                   /product="TonB-dependent siderophore receptor"
FT                   /note="TIGRFAM: TonB-dependent siderophore receptor; PFAM:
FT                   TonB-dependent receptor; TonB-dependent receptor plug;
FT                   KEGG: rso:RS02469 probable ferrisiderophore receptor
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4266"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29363"
FT                   /db_xref="GOA:B2UIG2"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIG2"
FT                   /protein_id="ACD29363.1"
FT                   /translation="MPPKRLCLSLAVLGTLPFAQVASAADTVAAADAGTLPTSTVKGAR
FT                   SSTSYDTPIANTATKIPVPLREIPQSVNVVPRAVIQDQGALSINDTLRNVPGVSASLGD
FT                   AQRDQVTIRGFSSINDQYVDGLRDDSLYFRDLSNIDHIEVLKGPAAVLYGRGSSGGIIN
FT                   RVTKKPLATPLAEVGVVVGTERQKRAEFDLNTSINDDAIRARITGAVEDSGGFRNDYFL
FT                   RRQAISPSFLFNLAPDTKLTVQFDYLHDKRIADQGVPSYHGRPVDVPIGTRYGSADAGA
FT                   GNVESTVKSVTGTLDHRFNDKWSFHSVVRNYEYSLGRNNYTTVSRVTDGPIPTVTLAVN
FT                   QRNRSDRGTLWQNELTQKAETWGIQHTLLYGIELGYQDKSDRVAAAPGSTTYNLFNPTL
FT                   QVLPTVPGNAVPTNYGLSHNETYAAYVQDLIKFSPQWTVLAGLRYEILKQSRDDLTPRN
FT                   VDLSRTDKPVSPRFGVVYHPVEPLSLYASYSRSFQPLADSFTFFPNSGALAPQSTTNYE
FT                   IGAKYDLSAGASVTAALFDMKQTNLTAADPVTLLGVPIGTQRTRGLELSFTGEIVKTWS
FT                   LMASYAYLNGRLENPNDRSGGVAVNGNQPSLTPRHSGSVWLKHDLPNGFYVAGGVRAEG
FT                   ARYASQYNLTTLPGYMTVDLGAGYRSKHLDVTLNLQNLFNRAYYVSAHGAAENYNMPGA
FT                   PRMALLGVRYKM"
FT   sig_peptide     complement(560756..560830)
FT                   /locus_tag="Rpic_4266"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 25"
FT   gene            561096..562172
FT                   /locus_tag="Rpic_4267"
FT   CDS_pept        561096..562172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4267"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: Semialdehyde dehydrogenase NAD - binding;
FT                   oxidoreductase domain protein; Oxidoreductase domain; KEGG:
FT                   rso:RS02398 probable oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4267"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29364"
FT                   /db_xref="GOA:B2UIG3"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIG3"
FT                   /protein_id="ACD29364.1"
FT                   /translation="MPLSAALVGYGYAGKRFHAALIDATPGLRLQVIGSNRPEAVRADR
FT                   PNAVICTPEAAATHADVDLVVIAAPNDRHAPLAEAALRAGKHVVVDKPFTVTLAEARHL
FT                   ARVARDAGRVLSVFQNRRWDSDFLAVQAAIGGGTLGEVMHVEAHFDRYRPQVRARWREQ
FT                   AGQGTGIWFDLGPHLIDQALQLLGLPDAVSASFARQRPGAETPDWAHVVLDVGERRAVL
FT                   HASMLVAGGSPRWIVHGTRGSFVKRRMDQQEAQLLAGMQPGAQGWGVDDDAGLFIDGAT
FT                   SSENRIATPAGDQRAYYAAVRDAIFGQRTNPVPPVQAVAVMAVLEAAVAAAETGTAVVP
FT                   DLTDAERADWLAARETAS"
FT   gene            562169..564280
FT                   /locus_tag="Rpic_4268"
FT   CDS_pept        562169..564280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4268"
FT                   /product="sodium/hydrogen exchanger"
FT                   /note="PFAM: sodium/hydrogen exchanger; KEGG:
FT                   reu:Reut_B3954 sodium/hydrogen exchanger"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4268"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29365"
FT                   /db_xref="GOA:B2UIG4"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR018422"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIG4"
FT                   /protein_id="ACD29365.1"
FT                   /translation="MNGVVILLLVAGGLLAVVALVQMLASRLTLPESTLLALAGIGIGG
FT                   AYVILRNSAPAFATTFFAPLVDPSWPAEAYLWLFLPPLLFQAALSVDVRSMAPDAAPIL
FT                   MLAIVAVVVATGVIGLAAAAVTPFGIVTCLLLGAMIATTDPSAVIAVFRDVGAPARLIR
FT                   LVEGEALLNDAAAIAIMGVLLAMLTGHGGDATVGTGLRELARAFGGGVVFGLIAGRIAA
FT                   FLLPALRGIAQAEAAWTLALPYPLYLVAENMLGVSGVVSVVCAGLVIGALGRTRLTPRN
FT                   WSHLQLIWEQIAALAGAVVFLLAAVRVPELLHGAVWKDALWLAVIVLAALAARLAVLFG
FT                   LLPAMAWLKLSAPVSHAYKLAIAWGGLRGAVTLVLALGVAENQAVHAADRHFVTILATG
FT                   FVLVSVLFNGATLRWVMRWLGLDQLSPQEQALQGQALNMSTEEVESTMRRIGGHFHFTS
FT                   GATDRAAEVYRREVAAGALELNLEEALSERERLTIGLVSLATRERELIPEYGNGLVSIR
FT                   NLDAMMRNTADMIDAARTEGRLGYKRASRRILAKHAGYRFAVWLHRVAHIDRPLANALA
FT                   DRFELLICRQTVLERLRAYNRASLQPVLGERMADLLDGVLITRIEAAEEGLAELREKFG
FT                   GYSAALEKRLLVLFALYIGQSKIDTMLAETVISKEVYKQISSVIRRAWTAALPRPPLST
FT                   ALRMPAAPE"
FT   sig_peptide     562169..562234
FT                   /locus_tag="Rpic_4268"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.938) with cleavage site probability 0.682 at
FT                   residue 22"
FT   gene            complement(564308..565570)
FT                   /locus_tag="Rpic_4269"
FT   CDS_pept        complement(564308..565570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4269"
FT                   /product="Patatin"
FT                   /note="PFAM: Patatin; KEGG: rso:RS02397 putative
FT                   transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4269"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29366"
FT                   /db_xref="GOA:B2UIG5"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR021095"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIG5"
FT                   /protein_id="ACD29366.1"
FT                   /translation="MPAPKLRVAATKRPTPAESSRPADAPLTTAQRIVLPAYENIALVL
FT                   QGGGALGSYQAGVFEGLDEAGIVPNWIAGISIGALNTAIIAGNAPEHRQAKLREFWQII
FT                   TQPTFSPPLPDILENAWFDGNAHLRKWLTAMQAADTLLEGQRGFFTPRFPAPLPANEVD
FT                   PLEASYYDTAPLKATLERLCDFDRINDGGIRVSVGAVNVRTGNLEAFDNTERRLRAEHF
FT                   MASGALPPGFPPVLIDGEYYWDGGVVSNTPLSYVLGSKPRRDTLVFQVDLWSALGPVPN
FT                   TMIGVASRQKDLQYSSRTRLTTDWMERSQSTRRLIRKLLDHLPPKEFERTQWYKHAQEM
FT                   ACTKRYNVFHLIYAAKEHEGPGKDIQFGPSTMRDHWASGLADIRESLSHPEWLEMPDND
FT                   TGFITHDIHRHPGVEREDKRL"
FT   gene            complement(565602..566387)
FT                   /locus_tag="Rpic_4270"
FT   CDS_pept        complement(565602..566387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4270"
FT                   /product="3-hydroxybutyrate dehydrogenase"
FT                   /note="TIGRFAM: 3-hydroxybutyrate dehydrogenase; PFAM:
FT                   short-chain dehydrogenase/reductase SDR; KR domain protein;
FT                   KEGG: rso:RS02396 3-hydroxybutyrate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4270"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29367"
FT                   /db_xref="GOA:B2UIG6"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011294"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIG6"
FT                   /protein_id="ACD29367.1"
FT                   /translation="MSDLKGKVAVVTGAASGIGKQIALTLANSGAAIAIVDLNEDGAKA
FT                   VAKEITDAGGKAIGLRMDVTDEQAVDSGIDRVAEELGSVDILVSNAGIQIVNPFVSYSF
FT                   ADWKKMQAIHVDGAFLTTRAALRHMYKDDRGGVVIYMGSVHSHEGSPLKSAYVAAKHAL
FT                   LGLNKVLAKEGAAHNVRSHVVCPGFVRTPLVEKQIPEQAKELGISEDDVVKKVMLGDTV
FT                   DGVFTTVEDVAETVRFLATFPSAALTGQSFVVSHGWFMQ"
FT   gene            complement(566441..567184)
FT                   /locus_tag="Rpic_4271"
FT   CDS_pept        complement(566441..567184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4271"
FT                   /product="Acetoacetate decarboxylase"
FT                   /EC_number="4.1.1.4"
FT                   /note="PFAM: Acetoacetate decarboxylase; KEGG: rso:RSp1058
FT                   acetoacetate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4271"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29368"
FT                   /db_xref="GOA:B2UIG7"
FT                   /db_xref="InterPro:IPR010451"
FT                   /db_xref="InterPro:IPR023375"
FT                   /db_xref="InterPro:IPR023653"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2UIG7"
FT                   /protein_id="ACD29368.1"
FT                   /translation="MDIKTVRETAFAMPLTSPAYPPGPYRFIHREFFIITYRTDPAKLR
FT                   AMVPEPLEVPEPLVAYEFIRMADSTGFGDYTESGQVIPVTYEGKPGTYTLAMYLDDHPP
FT                   LAGGREMWGFPKKLASPKLVTDKDTLIGTLDYGPVRVATGTMGYKHRELDLAEQKRRLE
FT                   RPNFLLKIIPHVDGKTARICELSRNLMIDIDMKGAWTGPASLELAHHALAPVAELPVLE
FT                   IVEARHIIADLTLGMGEVVFDYLAQ"
FT   gene            complement(567377..568780)
FT                   /locus_tag="Rpic_4272"
FT   CDS_pept        complement(567377..568780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4272"
FT                   /product="transcriptional regulator, GntR family with
FT                   aminotransferase domain"
FT                   /note="PFAM: regulatory protein GntR HTH; aminotransferase
FT                   class I and II; KEGG: rso:RS02394 putative transcription
FT                   regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4272"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29369"
FT                   /db_xref="GOA:B2UIG8"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIG8"
FT                   /protein_id="ACD29369.1"
FT                   /translation="MQLELDPSHPQRTLVDQIVQGIRAAVDNHSLLPGTRLPSVRKLAQ
FT                   AHDVSTFTVAEAYTRLAALGAIVARPRSGYLVAARTPTQPAPVAPRWEPPTLNAAWLLS
FT                   DVFADRSISIKPGCGWLPNDWLDERGVQEAMRTVSRVSALRVAGYGHPWGYAPLGEYVA
FT                   QSLALRGLPVERSQVLLTSGATQALDLIVRTLFKAGDVVAVDDPGYCNVLQVLKLAGLR
FT                   VVGVPRTPDGLDTAALEAILRADDADRPRALFTSSVLQNPTGSSMTAQNAYRVLQLAEQ
FT                   HGLWIVEDDLHRELADPAAPMLTALDGLRRTLYVSGFSKTISPSLRAGYVVADAAITRE
FT                   LARTKMAVALTSSEITERIVHAFVTRPVYAEHVARLIARLGEAHTRVEALMRQHGAEPF
FT                   DTPGRGLFLWARLPGQADASALANRAIEHNIWLAPGQYFRPHDEPSPWLRFNVAYSAEP
FT                   ALWEFLLHA"
FT   gene            568936..570273
FT                   /locus_tag="Rpic_4273"
FT   CDS_pept        568936..570273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4273"
FT                   /product="aminotransferase class-III"
FT                   /note="PFAM: aminotransferase class-III; KEGG: rso:RS02393
FT                   beta alanine--pyruvate transaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4273"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29370"
FT                   /db_xref="GOA:B2UIG9"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIG9"
FT                   /protein_id="ACD29370.1"
FT                   /translation="MKPAPHPLETTDLSYFWMPFTANRQYKAAPRLLTSAQGMYYRDGD
FT                   GREVLDGTAGLWCVNAGHCRKEIVDAITTQAATLDFAPTFQMGHPLAFRAAEKVAEIMP
FT                   EGLNRIFFANSGSEAVDTALKIALAYHRARGEGQRTRLIGRERGYHGVGFGGISVGGIS
FT                   PNRKAFSANLLPGVDHLPHTHAPEHNAFSKGQPAWGEHLADELERLVTLHDASTIAAVI
FT                   VEPLAGSTGVLVPPKGYLQRLRALCDKHGILLIFDEVITGFGRLGAATAAEFFGVTPDL
FT                   LTMAKGINNAAVPMGAVAVRQSVHDTVVDAGAPGAIELFHGYTYSAHPLAAAAAVAALD
FT                   LYRSEGLFERARSLSPAFEAAAHSVKGAPHVKDIRNLGLVAGIELESRPGAVGARAYEV
FT                   FLKCLERGVLVRYTGDILAFSPPLIIEEAQIARIFDTVRTVLQEVA"
FT   gene            570275..571798
FT                   /locus_tag="Rpic_4274"
FT   CDS_pept        570275..571798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4274"
FT                   /product="methylmalonate-semialdehyde dehydrogenase"
FT                   /note="TIGRFAM: methylmalonate-semialdehyde dehydrogenase;
FT                   PFAM: Aldehyde Dehydrogenase_; KEGG: rso:RS02392 probable
FT                   transmembrane aldehyde dehydrogenase oxidoreductase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4274"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29371"
FT                   /db_xref="GOA:B2UIH0"
FT                   /db_xref="InterPro:IPR010061"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIH0"
FT                   /protein_id="ACD29371.1"
FT                   /translation="MNRPIDPAVTESVVSHYIGGQRHAGSGTRSADVFNPATGAVSAQV
FT                   LLGGKSEVDAAVAAAHAAAPDWAETSPLKRSRVLFKFKELLDQNHDALAAAITREHGKV
FT                   FSDAKGEVTRGIEVVEFACGIPNLLKTEFTDNIGGGIDNWNLRQPLGVVAGITPFNFPF
FT                   MVPMWMAPVALACGNTFILKPSERDPTPSLMIADLLKQAGLPDGVFNVVQGGKDAVDAL
FT                   LEHPDVQAISFVGSTPIAEYIYAEGTKRGKRVQALGGAKNHLVVMPDADLDQAVDALIG
FT                   AGYGSAGERCMAISVAVAVGDVADKLVPRLAERARALKIGNGMQADSEMGPLVTAAHKA
FT                   KVEGYIAKGVEEGAELVVDGRGHTVDGHAEGFFTGGTLFDHVKPGMTIYKEEIFGPVLS
FT                   VVRVHDLAEAVDLINAHEFGNGVSCYTSDGGVARAFARQIQVGMVGINVPIPVPMAWHS
FT                   FGGWKRSLFGDHHAYGEEGVRFYTRYKSVMQRWPDSIAKGAEFVMPTAK"
FT   gene            complement(571875..572081)
FT                   /locus_tag="Rpic_4275"
FT   CDS_pept        complement(571875..572081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4275"
FT                   /product="putative cold-shock DNA-binding domain protein"
FT                   /note="KEGG: rso:RS02391 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4275"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29372"
FT                   /db_xref="GOA:B2UIH1"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIH1"
FT                   /protein_id="ACD29372.1"
FT                   /translation="MASRIEENAVEYDPPAGAAAEMHAAPSFIRDSEIQFSRSQTFHEG
FT                   QRVSFDVEIGPDGELIAVNIKPI"
FT   gene            complement(572259..572462)
FT                   /locus_tag="Rpic_4276"
FT   CDS_pept        complement(572259..572462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4276"
FT                   /product="cold-shock DNA-binding domain protein"
FT                   /note="PFAM: Cold-shock protein DNA-binding; SMART: Cold
FT                   shock protein; KEGG: tbd:Tbd_0855 possible cold-shock
FT                   DNA-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4276"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29373"
FT                   /db_xref="GOA:B2UIH2"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIH2"
FT                   /protein_id="ACD29373.1"
FT                   /translation="MATGTVKWFNDAKGFGFITPDDGGEDLFAHFSAINSAGFKSLKEG
FT                   QKVSFEVTQGPKGKQASNIVPQ"
FT   gene            572814..574709
FT                   /locus_tag="Rpic_4277"
FT   CDS_pept        572814..574709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4277"
FT                   /product="K potassium transporter"
FT                   /note="PFAM: K potassium transporter; KEGG: rso:RSp1052
FT                   probable potassium uptake transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4277"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29374"
FT                   /db_xref="GOA:B2UIH3"
FT                   /db_xref="InterPro:IPR003855"
FT                   /db_xref="InterPro:IPR023051"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIH3"
FT                   /protein_id="ACD29374.1"
FT                   /translation="MTTAAASKTKKNPALMATMVGAIGVVFGDIGTSPLYALKECFNPE
FT                   HGVPFSDQTVFGILSMLFWAMTLVVSVKYVLFVMRADNNGEGGILALTALAMRASSGSA
FT                   RFTRTLMLLGLLGAAMFYGDAVITPAISVLSAIEGMEIMAPALQKWVLPLALIVLIALF
FT                   LIQRHGTHVVGRLFGPIMVIWFVLLGLMGLVSVVKSPQILVALSPVYAIEFGFRHTVLA
FT                   FIVFGSVFLALTGAEALYADMGHFGARPIRYAWFYIAMPCLLLNYFGQGALLLREPSAV
FT                   QNPFFLLMPNWAVGPMVVLATAATVIASQAVISGAFSMTAQAVHLGYAPRMKILYTSDV
FT                   EIGQIYVPVVNYVLLALVVAVVLAFGKSDNLAAAYGIAVTTTMVLTTGLVTVVMRNAWK
FT                   WRLSLVACIGAVFLAVDLSFFAANLLKIAAGGWFPLLLGGLIFFLMVTWHSGTQLLKAR
FT                   NVEGGIPLEPFMDGLLRHPPYRVDGTAVYLTPSIDFVPLALLHNLKHNHVLHKRVLFIH
FT                   FRTLAVPYVDPAKRLVIKTIGDDIHTAVVDFGFKETPAVDEIVRSVGERLGIVFEDMET
FT                   SFFITRATVVPSPLPGMAMWRESLFAWMQHNSAKPSDFFRIPANRLVELGSKVEI"
FT   sig_peptide     572814..572900
FT                   /locus_tag="Rpic_4277"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.990) with cleavage site probability 0.986 at
FT                   residue 29"
FT   gene            complement(574728..575543)
FT                   /locus_tag="Rpic_4278"
FT   CDS_pept        complement(574728..575543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4278"
FT                   /product="formate dehydrogenase family accessory protein
FT                   FdhD"
FT                   /note="TIGRFAM: formate dehydrogenase family accessory
FT                   protein FdhD; PFAM: formate dehydrogenase subunit FdhD;
FT                   KEGG: rso:RSp1050 probable formate dehydrogenase associated
FT                   protein (FdhD protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4278"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29375"
FT                   /db_xref="GOA:B2UIH4"
FT                   /db_xref="InterPro:IPR003786"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIH4"
FT                   /protein_id="ACD29375.1"
FT                   /translation="MTFLPHHPAGLPVVSTAATKRTRAGTQEDTPAAIADEAAVALVFN
FT                   GITHAVMMASPTDLEDFALGFALSEGIIDSRADWRGADVETHPHGLEVHAEIASHCFVR
FT                   LKERRRALAGPTGCGLCGIESLQTFEDAPQPLVPPAWLASLADAQVLDAMQAMTAHQPA
FT                   NALTGGLHAAGWVPADTHAPLHVLEDVGRHNALDKLIGRLARLGIRPSDGFIVMTSRAS
FT                   FELARKCVQLQVPLLATISAPSSLAIRHAKAGQLTLLAFCRGDSVTRFA"
FT   gene            complement(575540..575785)
FT                   /locus_tag="Rpic_4279"
FT   CDS_pept        complement(575540..575785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4279"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RS02386 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4279"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29376"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIH5"
FT                   /protein_id="ACD29376.1"
FT                   /translation="MPTEPAWSALQLALLAALRETDAGKPVSMPWLTKRVGERASTVLR
FT                   ALHPLADAGLLRVTMDDTRWLIALLDAGRVLPDFTA"
FT   gene            complement(575785..578124)
FT                   /locus_tag="Rpic_4280"
FT   CDS_pept        complement(575785..578124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4280"
FT                   /product="oxidoreductase alpha (molybdopterin) subunit"
FT                   /note="TIGRFAM: oxidoreductase alpha (molybdopterin)
FT                   subunit; PFAM: molybdopterin oxidoreductase; molydopterin
FT                   dinucleotide-binding region; KEGG: rso:RS02045 putative
FT                   formate dehydrogenase oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4280"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29377"
FT                   /db_xref="GOA:B2UIH6"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR010046"
FT                   /db_xref="InterPro:IPR037951"
FT                   /db_xref="InterPro:IPR041953"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIH6"
FT                   /protein_id="ACD29377.1"
FT                   /translation="MKHQKIEFYRHPAGGWGALKSVAHQLLSQGIAAKGAKTMLSANQP
FT                   DGFDCPGCAWPDRDHASTFEFCENGVKAVAAEATSRRTTPEFFAQHTVRELAEWSDYAL
FT                   EDQGRLTHPMVYDAGSDKYVPIDWDAAFALIAQHLRALPDPNQAIFYTSGRTSNEAAFL
FT                   YQLFVRAYGTNNFPDCSNMCHEPSGTGMRASIGVGKGTVTLDDFTKTDSIFIFGQNPGT
FT                   NHPRMLGELREASKRGAKIVSFNPLRERGLERFADPQSKIEMLTLGSTRISTEYHQVRI
FT                   GGDLATIKGIIKHVIERDDAARSRGEPAIIDHAFIAQHTGGYDAFAADVRTESWATIEA
FT                   ESGLPEHEIRQAGDTYIKAGSVIACWGMGITQHKHSVATIQMIVNLLLLRGNIGRPGAG
FT                   ACPVRGHSNVQGDRTMGIYEQPAPAFLDRLEQVFGIQVPREHGYDTVGAIEAMQQGAAR
FT                   VFFAMGGNFAAATPDTAATWAGLRQCDLTVHVTTKLNRSHIVHGKAALILPCLGRTEVD
FT                   QQAGGAQGVTVEDSMSMVHMSAGINPPASPHLLSEPAIVARLAEATLPESTIPWRWLVE
FT                   DYDRIRERIEAVFDDFAGFNEKIRVPGGFRLRNTASERVWNTPSGKAEFHAHAVPTDTP
FT                   VHRARERHADATVFTLATVRSHDQYNTTIYGMDDRYRGVFGQRRVVFINKEDLHTVRMK
FT                   DGEWVDMVTLSEDGTTRRADGFRLVAYDIPRGCLAAYYPETNPLVPLSSVADQARTPTS
FT                   KSIPVMLVPSQVARTADTQAATTAEA"
FT   gene            complement(578153..579880)
FT                   /locus_tag="Rpic_4281"
FT   CDS_pept        complement(578153..579880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4281"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   rso:RS02384 probable transporter transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4281"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29378"
FT                   /db_xref="GOA:B2UIH7"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIH7"
FT                   /protein_id="ACD29378.1"
FT                   /translation="MTGAAAPFHHVRHNTGSTYPGVDSMSEAVLHPFFSRERTVAAVGF
FT                   NRWLVPPAALAIHLCIGMAYGFSVFWLPLGRALGITKPLTCGADVSLVAELFTTTCDWR
FT                   VSSLGWMFTLFFVFLGASAAMWGGWLERVGPRKAGVVSAVCWCGGLLISALGIQIHQLW
FT                   LLWVGSGVIGGVGLGLGYISPVSTLIKWFPDKRGMATGMAIMGFGGGAMIGAPLADRLM
FT                   KLFATPESVGVSQTFIVLAGIYFVFMMAGALGYRVPPTGWKPAGWTPSPAKAKDTMVTQ
FT                   RHVHANEALKTPQFWLIWAVLCLNVSAGIGVLGMASPLLQEVFGGKLLGVTTSFMDLTA
FT                   AQKGQIAAIAAGFTGLLSLFNIGGRFFWASLSDRLGRKMTYAVFFVLGFVLYASIPWTS
FT                   HTGNIALFALAFCVILSMYGGGFATVPAYLADMFGTQMVGAIHGRLLTAWSTAGILGPV
FT                   LVNYLREYQIAHGVERAAVYDITMMILAGLLILGFICNLLVRPVNAKHFMTEAQLDEQR
FT                   HAAATKSPTPSVASPETSLEWQAHPGSAVAVVLAWAAVGLPLGWGVWITLQKAAVLFS"
FT   gene            complement(580089..580568)
FT                   /locus_tag="Rpic_4282"
FT   CDS_pept        complement(580089..580568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4282"
FT                   /product="Hpt protein"
FT                   /note="PFAM: Hpt domain protein; KEGG: rso:RS02382
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4282"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29379"
FT                   /db_xref="GOA:B2UIH8"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIH8"
FT                   /protein_id="ACD29379.1"
FT                   /translation="MATRGRGEQSASLIPTARTATMHPTSNVSPSVVAQFPLQVITTLT
FT                   ELFGTDLQQWRFIVDLFCETVEQDLANLANAIRTADDDTQIVEAAHRIVGSARMLGHQA
FT                   IGDAARCIERAAQSIGPYQQRVEDMQSALTCLRALASEFRQQASGCPWSDAAVAG"
FT   gene            complement(580661..583756)
FT                   /locus_tag="Rpic_4283"
FT   CDS_pept        complement(580661..583756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4283"
FT                   /product="heavy metal efflux pump, CzcA family"
FT                   /note="TIGRFAM: heavy metal efflux pump, CzcA family; PFAM:
FT                   acriflavin resistance protein; KEGG: pnu:Pnuc_1300 heavy
FT                   metal efflux pump, CzcA family"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4283"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29380"
FT                   /db_xref="GOA:B2UIH9"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004763"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIH9"
FT                   /protein_id="ACD29380.1"
FT                   /translation="MGFNPIAGILKRRLLIVFLAVALLVAGVLSFRELPLQAYPGVAPL
FT                   SVQAITQWPGRSTTEVEQQITIPIENALAGVPDVQSFRSVSLFGLSVVTLKFKEGTDSF
FT                   KARQNFSQYLASANLPTGVQSSLSPDSDATGEIMRFRLEGDGVDLTTLKSYQDYDISKG
FT                   LKHVQGVADVSSFGGKVKEYHIVPSPAKLQSYGITLSQLITAIGNANNNTGGNLLRDGE
FT                   QQFVVRGVGLLQTVDDIRNVVVNTNNGVPVRVRDIAEVEVGNVQRLGQVQYNDQPDVVE
FT                   GIVLLKRDANATEVLAKVREKVAELNNGVLPKSIQVKPFYDRQVLLDITMGTVEHTLVV
FT                   GISLVLAVLFVFLGNFRAAAVVAAVIPLALCVSFISMEHFHVPANLISLGAIDFGVIVD
FT                   AAVIVMENIMRHLEEGAEKLEDAIIKATNEVQRAMIFSTGIIIVAYSPLFFIGGVEGII
FT                   FKPMAFTMGFALMASIVLSLTFVPATTSFVFGKTLHPHSPAFIAAILRWYKPLLRKLIA
FT                   RPMAVFATAITALLLTLYSATFLGTEFLPTLEENNLWLRITLPNTVDLDYSASVANDLR
FT                   IYFTKQPEIKQVSVQIGRPDDGTDSTGVFNQEYGLYFAPPDQWEAGMTKGKLVERLSKH
FT                   LEKIPGIEYNFSQYIQDNVDEALSGVKGENSVKLFGNDLNMLEAKANEIQAQLKKVSGL
FT                   VDVGIFRELGQPTLNVSIDRQAAARFNINVSDVQNLVQYAIGGAPVTQILEGEKSFGLA
FT                   VRLNQQARASYDAIRELLIDTPDGQHIPLSMIAKVEMTDGPFFIYREEGKRYIAIKFGV
FT                   RGRDLGGAVDEAQHVVGSNVKLPEGYTVKWDGQFNEMKVAQGKLMVIVPLTILVIFLLL
FT                   YSTFGNFKDALMVVLNVPFAAIGGLLALHIANETLSISAGIGFLSLFGIAIQDGVILIS
FT                   YVNRLSQSENVREATVDGAALRLRPVIMTAMLAGLGLLPAALSHSIGSEAQRPLALVIV
FT                   GGMVTTTILTLLVLPVVFTWAHRHRRPPPRDSDVNPTAAMLP"
FT   gene            complement(583759..584907)
FT                   /locus_tag="Rpic_4284"
FT   CDS_pept        complement(583759..584907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4284"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; KEGG: pnu:Pnuc_1301 efflux transporter, RND
FT                   family, MFP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4284"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29381"
FT                   /db_xref="GOA:B2UII0"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:B2UII0"
FT                   /protein_id="ACD29381.1"
FT                   /translation="MKKFSPVVAVIALAAALAVGVVVGRKWPAAVPAETAKPEAGPASA
FT                   PAAASRPKPDSIEIPSGGFDPQQVKVAQASQLSVPVELSTPGKLAYNAERTKLASARVA
FT                   GRLDHILQFEGALVREGQPIAELYAPDYISAQKEYLLALNTARQLKGSNMKDLQEDADA
FT                   TVQSAAGRLHVLGMSDADVAQIAKRGTPAEHLTLRAPISGTIVKRNMDPGAFLNVGDSF
FT                   MSIVDTRVLWFTGNVYENDIASVRIGQPISLHTSAYPDREFTGRVSFIAPNIDPATHTL
FT                   TVRCDVPNNDGLLRPEMYATARIQTGTGQATVVPKSALVKDHGSYFVIVQSDATHFKRV
FT                   EVHGKDIGTDGNFAVTAGLEASSQVVVRGAALLNEMIVKAGA"
FT   sig_peptide     complement(584851..584907)
FT                   /locus_tag="Rpic_4284"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.356 at
FT                   residue 19"
FT   gene            complement(584912..586282)
FT                   /locus_tag="Rpic_4285"
FT   CDS_pept        complement(584912..586282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4285"
FT                   /product="outer membrane efflux protein"
FT                   /note="PFAM: outer membrane efflux protein; KEGG:
FT                   pnu:Pnuc_1302 outer membrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4285"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29382"
FT                   /db_xref="GOA:B2UII1"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:B2UII1"
FT                   /protein_id="ACD29382.1"
FT                   /translation="MKYRGAFHSRARAVLCAVACLPFAAAWAATPASAPAAASMPVPTM
FT                   PPIQPSVPGVTGAGFNLVELLQELKGNNPQLIQGRHTYLSAKSIPPQLASPNNPQLGYI
FT                   WNSIPKGFPLAVNRAGGSQYNLTQQIPFPGKKALAAEIADRQAESLNAQNDALYLQLYA
FT                   QLSTTYYQAIALQKQIDVQKLTITRLEQVKQITRVRYANNAAAYADFLNAQVMQSSAQN
FT                   DLFAAQRQYDSTLQTLNTLIGKDPSFPLVLRADDEAVHLPEEPLPELENQALREHPSIK
FT                   ASAELMDAARKSVTLARKAYLPDFQVIATVTTDNPPYGVRPNSYQIELDVIIPFWFLTK
FT                   EKYGVNQAVESQIATEANDVSVRQQTLLAVDTAYNTLRQTLAQLDFNKQRQLPQALAAY
FT                   RVTMTNYASNNADFNDLLTAQGALKNAELAVAQAQATALQAYHALLAATGRSPVQAQ"
FT   sig_peptide     complement(586196..586282)
FT                   /locus_tag="Rpic_4285"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.961 at
FT                   residue 29"
FT   gene            complement(586440..586841)
FT                   /locus_tag="Rpic_4286"
FT   CDS_pept        complement(586440..586841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4286"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="PFAM: regulatory protein MerR; Transcription
FT                   regulator MerR DNA binding; KEGG: pfo:Pfl_0677 possible
FT                   transcriptional regulator, MerR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4286"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29383"
FT                   /db_xref="GOA:B2UII2"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:B2UII2"
FT                   /protein_id="ACD29383.1"
FT                   /translation="MPAALPAPISNAHTGDLSIGDLAAATGVSRDGLRFYEARGLIRAR
FT                   RRSNGYRAYPPEIVELVQYVRTAQQLGFTLAEIREGMAQVWQQPDTVAAVTALLREKLA
FT                   TIDARIASLQAMREALATRVGMACPLAPA"
FT   gene            586943..587365
FT                   /locus_tag="Rpic_4287"
FT   CDS_pept        586943..587365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4287"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pfo:Pfl_0678 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4287"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29384"
FT                   /db_xref="GOA:B2UII3"
FT                   /db_xref="UniProtKB/TrEMBL:B2UII3"
FT                   /protein_id="ACD29384.1"
FT                   /translation="MVSESTFLRIVRASAWYDLIVTAPFATPWTFALLHQALSALAHAL
FT                   GIGSLPPFEPTHLLMANLMGSVVCVWSVLRIRQTSVVLGRYDAVARGLFAAWQAYALAS
FT                   GATLLVVPFLIAEIGFGLLQSLPVGRVPGRAGARAA"
FT   gene            complement(587379..587795)
FT                   /locus_tag="Rpic_4288"
FT   CDS_pept        complement(587379..587795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4288"
FT                   /product="transport-associated"
FT                   /note="PFAM: transport-associated; SMART:
FT                   Transport-associated and nodulation region; KEGG:
FT                   rso:RS02375 probable lipoprotein transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4288"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29385"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR014004"
FT                   /db_xref="UniProtKB/TrEMBL:B2UII4"
FT                   /protein_id="ACD29385.1"
FT                   /translation="MRFPQLSFAASAGVLAAIGAAALLTACAWGDSPNTAGARMLDDSL
FT                   LTYQVKAALDQDTALSTRQIRIRSSPDGKVILTGWVDTPEMARRAGDDVKRFVDSAKLD
FT                   NQLRVLSRMQVLGGGPYIPAGLPPEAPASAPAAR"
FT   sig_peptide     complement(587703..587795)
FT                   /locus_tag="Rpic_4288"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.848 at
FT                   residue 31"
FT   gene            complement(587857..588327)
FT                   /locus_tag="Rpic_4289"
FT   CDS_pept        complement(587857..588327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4289"
FT                   /product="DoxX family protein"
FT                   /note="PFAM: DoxX family protein; KEGG: rso:RS02374
FT                   probable transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4289"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29386"
FT                   /db_xref="GOA:B2UII5"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:B2UII5"
FT                   /protein_id="ACD29386.1"
FT                   /translation="MNTLTTTFAPLTRIRASLERLAGPQSMLCSIILLIARAYLFYVFF
FT                   RSGLTKLHDWDTTVLLFTEEYKVPLLPPALAAALGTFGELVFPSLMLAGIVPRLAAAGL
FT                   FFVNVVAAVSYWANLSASAIEFHLVWGVLIALVATVGPGWLAAQNLWQRRKH"
FT   gene            complement(588324..589082)
FT                   /locus_tag="Rpic_4290"
FT   CDS_pept        complement(588324..589082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4290"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RS02373 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4290"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29387"
FT                   /db_xref="InterPro:IPR018640"
FT                   /db_xref="UniProtKB/TrEMBL:B2UII6"
FT                   /protein_id="ACD29387.1"
FT                   /translation="MRLPDWEAHLIGALTHPVSDDETRGIAIYRNARLAILRNTLAGAY
FT                   PVCRALVGNDCFDALVRDTLAAQASTSPNLHRYGNALPDVIAQCPLAHSVPYLADVARL
FT                   EWCVHWAHYAPDAHVEAANATLLAQPADTVRAGLIEGVQWVASPWPVVSIWRAHQPGAT
FT                   IALNEIDLDAAEAAAIAVRGHRVAVLDLDAATAMFLAACEATPSLQTALETTLAELPAF
FT                   DLTASLSGLYRSGLLALSACHTTMPTGDTP"
FT   gene            complement(589069..589935)
FT                   /locus_tag="Rpic_4291"
FT   CDS_pept        complement(589069..589935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4291"
FT                   /product="protein of unknown function DUF692"
FT                   /note="PFAM: protein of unknown function DUF692; KEGG:
FT                   rso:RS02372 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4291"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29388"
FT                   /db_xref="InterPro:IPR007801"
FT                   /db_xref="UniProtKB/TrEMBL:B2UII7"
FT                   /protein_id="ACD29388.1"
FT                   /translation="MQTALPTCAGAGLRAPHFPALLHGEARFPWAEVHSENYLYGGPAR
FT                   AALLAARAHQPVSLHGVGMGLGNADGLDVEHVRAIAMLADAVAPAAISEHLCFNRSGAQ
FT                   VVNDLLPLPYSRESLDIVCANVMRAQDILKQPLLIENIAAYIDCRTLVDADEAISEGAF
FT                   LTALARRTGCGILLDLNNLYVNSVNHGVTVESVLTDIDPALVGEIHLAGFSVEDGMLID
FT                   THSAPVHAPVWALYNAWVAKHGARPTLIEWDAELPPVQVLLDEAARAQAVLNRHTNAMQ
FT                   ETRHATA"
FT   gene            complement(589957..590223)
FT                   /locus_tag="Rpic_4292"
FT   CDS_pept        complement(589957..590223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4292"
FT                   /product="putative signal peptide protein"
FT                   /note="KEGG: rso:RS02371 probable signal peptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4292"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29389"
FT                   /db_xref="InterPro:IPR018740"
FT                   /db_xref="UniProtKB/TrEMBL:B2UII8"
FT                   /protein_id="ACD29389.1"
FT                   /translation="MKQHAMIAAALGSLLALGALSTPVHAADAAGKEKCYGVAKAGQND
FT                   CASPGSAHACAGQSKIDKDPMSWKYVPAGTCAQMGGTMQTPSK"
FT   sig_peptide     complement(590143..590223)
FT                   /locus_tag="Rpic_4292"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 27"
FT   gene            complement(590452..590976)
FT                   /locus_tag="Rpic_4293"
FT   CDS_pept        complement(590452..590976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4293"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bmu:Bmul_1707 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4293"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29390"
FT                   /db_xref="UniProtKB/TrEMBL:B2UII9"
FT                   /protein_id="ACD29390.1"
FT                   /translation="MPERKTVERARADKRHGKAASTQAGNFVKEEMDHIREGKHGAKNT
FT                   KQAIAIGLSKARRSGVAIKPPGEGKASAATRKKAEHDVKAGSKKSSHASASASKESTAK
FT                   RSKTTTRTLQKEGHSAASKSSLSKQAHSAASKRSSSERSAAAKKGAATKGAAGRSAAAK
FT                   KAGRTRAAHAR"
FT   gene            complement(591097..591366)
FT                   /locus_tag="Rpic_4294"
FT   CDS_pept        complement(591097..591366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4294"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RS02370 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4294"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29391"
FT                   /db_xref="GOA:B2UIJ0"
FT                   /db_xref="InterPro:IPR001801"
FT                   /db_xref="InterPro:IPR037150"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIJ0"
FT                   /protein_id="ACD29391.1"
FT                   /translation="MKEGHPPEPGRETAIAWILEQMQTYDLSVDDLQAHGCFDAPPPPP
FT                   APPASIGPVYMSADGQHWDGSGDMPDWLQRAVNAGQSIEHFRVG"
FT   gene            complement(591525..592466)
FT                   /locus_tag="Rpic_4295"
FT   CDS_pept        complement(591525..592466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4295"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: mlo:mlr3911 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4295"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29392"
FT                   /db_xref="GOA:B2UIJ1"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIJ1"
FT                   /protein_id="ACD29392.1"
FT                   /translation="MRSFLHPMLKVVRMNDKTRGTVEMTTAMVISGTIGWFVVRSGQPV
FT                   ADVVFWRCVFGALTLLAVCAGLGLLRGAITWRRAAIATLGGVAIVINWLLLFAAYPRAS
FT                   ISIATAVYNTQPFMLVGLGAMFLSEKLTAAKLTWLAIAFIGVVLIVQVGPAASVGTDYL
FT                   AGIAMALGAAFAYAVAALLIKKLAGTPPHLIALIQVCVGVLMLAPLANLSHPPADAHTW
FT                   VMLVTVGVVHTGLMYILLYGAIQRLPTHLTGSLSFVYPIVAIVVDIVAFGHRLQLAQFL
FT                   GAGGILLAAAGMNLGWSPYRWLRARAESPVSK"
FT   gene            592562..593014
FT                   /locus_tag="Rpic_4296"
FT   CDS_pept        592562..593014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4296"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="PFAM: regulatory protein AsnC/Lrp family; KEGG:
FT                   mlo:mll3910 transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4296"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29393"
FT                   /db_xref="GOA:B2UIJ2"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIJ2"
FT                   /protein_id="ACD29393.1"
FT                   /translation="MNTIDALDQRILDVLLTDSRISLKQLAEQVGLSSPSVSERLRRLE
FT                   ERGVIRHYTIDIDPASLGYTLQAIVRVRPMPGKLHIVQKLIEEIPEIGECDKVTGEDCF
FT                   IARLYVRSIDQLDQILDRVAYHAETNTAIVKTQPVKRRAPPFASAE"
FT   gene            complement(593026..594233)
FT                   /pseudo
FT                   /locus_tag="Rpic_4297"
FT   gene            594314..594790
FT                   /locus_tag="Rpic_4298"
FT   CDS_pept        594314..594790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4298"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="PFAM: regulatory protein AsnC/Lrp family; KEGG:
FT                   mlo:mll7935 transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4298"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29394"
FT                   /db_xref="GOA:B2UIJ3"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIJ3"
FT                   /protein_id="ACD29394.1"
FT                   /translation="MAPQKSLELDAFDIAILNAVQRCYTTPLRVIGEEVNLSTAAVQRR
FT                   IKRMEEAGVIVGNVAVVHPERVGKPITVIVEVHAERTNTAAMAALKRALSGPEVQQCYY
FT                   VTGEADFVLILNVATMTEYEALARRLFDDNDNIKWYRTAVVLNRVKVGLEVPLG"
FT   gene            594934..596664
FT                   /locus_tag="Rpic_4299"
FT   CDS_pept        594934..596664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4299"
FT                   /product="gamma-glutamyltransferase"
FT                   /EC_number="2.3.2.2"
FT                   /note="KEGG: rso:RSp0274 probable
FT                   gamma-glutamyltranspeptidase signal peptide protein;
FT                   TIGRFAM: gamma-glutamyltransferase; PFAM:
FT                   gamma-glutamyltranspeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4299"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29395"
FT                   /db_xref="GOA:B2UIJ4"
FT                   /db_xref="InterPro:IPR000101"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIJ4"
FT                   /protein_id="ACD29395.1"
FT                   /translation="MQNPRTGMRWIAAAIASISITTVTHAASVAPVAAENGMVVAAQHL
FT                   ASKVGVEVLKRGGNAVDAAVAVGYALAVVYPAAGNLGGGGFMTIQLADGRKTFLDFREV
FT                   APKAATANMYLDKDGNVIKGASTKGHLAVGVPGTVSGMEYARQKYGTMQRAALIAPAIT
FT                   LAEKGFVLDQGDVDMLHTSTKDFQEDAASGAIFLNKGQPFQVGEKLVQHDLAKTLREIS
FT                   THGTDGFYKGWVGQAIAASSKAGGGLITQDDLVSYKTRELAPVECDYRGYHVVSAPPPS
FT                   SGGVIICEMLNILEGYPLKDLGWHSAQATHYQIEAMRHAYVDRNSYLGDPDFVKNPLDR
FT                   LLSKDYAAKIRAVIDPKKAGVSKDIKPGVEPHEGSNTTHYSIADKYGNAVSVTYTLNDW
FT                   FGAKVTAAKTGVILNDEMDDFTAKVGVPNLYGLVQGEANSIAPGKRPLSSMSPTIVTKD
FT                   GKPVMVVGTPGGSRIITAVMLTMINAIDYGMNVQEAVDMPRFHQQWLPDVTNVEPYALS
FT                   EDTRKILTSMGHNLGAPQPANHLAAIIVGAPSLGGKPVGNNRFYGANDPRRNTGLAAGY
FT                   "
FT   sig_peptide     594934..595014
FT                   /locus_tag="Rpic_4299"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.926 at
FT                   residue 27"
FT   gene            complement(596741..597814)
FT                   /locus_tag="Rpic_4300"
FT   CDS_pept        complement(596741..597814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4300"
FT                   /product="4-hydroxyphenylpyruvate dioxygenase"
FT                   /EC_number="1.13.11.27"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: bxe:Bxe_B2773
FT                   4-hydroxyphenylpyruvate dioxygenase (Hpd)"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4300"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29396"
FT                   /db_xref="GOA:B2UIJ5"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR005956"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="InterPro:IPR041736"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIJ5"
FT                   /protein_id="ACD29396.1"
FT                   /translation="MSRNADLPFKTAGLEFIEFATQAPAALGQVFASLGFKAIARHVSK
FT                   DVTLYRQGDMNFLVNAEADSFAHRWAEEYGVGICAIGIRVDDAQHAYDRAVELGAWPAE
FT                   AEPIGPSELVIPAIQGVGDTHLYFVDRWRGKHGARGGLGDISIYDIDFRPLDAATAHED
FT                   WHHAGVGLARVDHLTQTVGPGRLQDWIDFYRNQLGFSEIHELHANWHVAADSRVMVSSC
FT                   GMIRIPLYEEGTHRAHLMHAYLPDHPGEGVQHIALATDDILRTATSLAANGLTFVEPPA
FT                   HYYDTVDARLPGHGLDLQALRRYGILVDGEIVDGAPKLFLQTFVKRHPGEIFFEIVQRL
FT                   GHHGFGEGNLPVLTAAA"
FT   gene            complement(597896..599086)
FT                   /locus_tag="Rpic_4301"
FT   CDS_pept        complement(597896..599086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4301"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bch:Bcen2424_5897 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4301"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29397"
FT                   /db_xref="GOA:B2UIJ6"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIJ6"
FT                   /protein_id="ACD29397.1"
FT                   /translation="MTRRPLSFALLLPLLLSAQPVATDSYLPALPAIAQALGSASTSLT
FT                   VFALAFGIGQLPMGSLADRFGRRHVLLIGLACYALAALAGALATTASMLTAARALQGFS
FT                   MAAILVCARAAVRDLHPARDGPHVMARGLTGLGFVALMAPILGAFVAQHAGWRWVLVGM
FT                   SLYAIVLWAMCWYGFAETRQETHIQAGSVREIFASADFRAWGLLAATTYAGIFCFLLLS
FT                   PMVYIAYLGLSPELYGWIPAGGSLVYIVSTTGCRRLLRRQSLVRTVQQGATLSLVGAGI
FT                   QGLGCWLLPGQAWPLLLGHGIYCMGHGIHQPCGQAGAVGELPHLAGRAVSWSGFIMMLA
FT                   AFCLGQTAAAFDDTSHSLGAWPMVVPMMLAGTVLASIAFLWLPKLQSQPDPQSAAA"
FT   sig_peptide     complement(599018..599086)
FT                   /locus_tag="Rpic_4301"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.605 at
FT                   residue 23"
FT   gene            complement(599091..599924)
FT                   /locus_tag="Rpic_4302"
FT   CDS_pept        complement(599091..599924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4302"
FT                   /product="Shikimate dehydrogenase substrate binding domain
FT                   protein"
FT                   /note="PFAM: UBA/THIF-type NAD/FAD binding protein;
FT                   Shikimate/quinate 5-dehydrogenase; Shikimate dehydrogenase
FT                   substrate binding domain protein; KEGG: dac:Daci_4437
FT                   shikimate dehydrogenase substrate binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4302"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29398"
FT                   /db_xref="GOA:B2UIJ7"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIJ7"
FT                   /protein_id="ACD29398.1"
FT                   /translation="MISGKTTLIAHIGYPTETFKSPMIYNPWFEQKGIDAVVMPMGVKA
FT                   EDYPQSFASICRFTNLRGALITMPHKVTTVELVDEVTPAVRIAGACNAVLKRDDGTLLG
FT                   DQFDGAGFVRGVLRKGRQLEGARVLLSGAGGVGSAIAASLAAAGVGELALYDTRAESAE
FT                   SLGRRLLEHYPALAVGTGSNDPDGFDVVVNATPVGMKDDDPLPFDAARIAPSCFVGEVV
FT                   MKSEYTPLLRAALDKGCDVQVGTDMLFEMIPAYLEFFGFGTATADELRRSAAIAY"
FT   gene            complement(599944..601329)
FT                   /locus_tag="Rpic_4303"
FT   CDS_pept        complement(599944..601329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4303"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1; KEGG: dac:Daci_4438 major
FT                   facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4303"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29399"
FT                   /db_xref="GOA:B2UIJ8"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIJ8"
FT                   /protein_id="ACD29399.1"
FT                   /translation="MTAAPAHEPLGKHQSKKAAASGWIGSALEYYDFFIYATAAALIFP
FT                   QIFFPKGDPKTAIIASLATYGVGYIARPIGAFVLGHLGDTHGRKNVLLWCMFLMGFSTI
FT                   AVGLLPTYDQVGLWAPTLLVIMRLIQGFAVAGEISGASSMILEHAPFGRRGFFASFTLQ
FT                   GVQAGQILAAAVFLPLAHYMPADQFNSWGWRIPFLLSFVVIIAGYVIRREVHETPAFTA
FT                   EQQQQGRPRSPVIDAFKYSTPDMLRVVCMALMNVIPVVATIFGAAYAVQPAYGIGFAKD
FT                   IYLWIPVVGNIVAVLVIPYVGDLSDRIGRKPPIVLGSLLAGVLAFAYLYAISIKNVPLA
FT                   FGMSILMWGVVYQGYNAVFPSFYPELFPTRTRVSAMAISQNIGTAITAMLPALFTAVAP
FT                   PGATNIWLTVGAIAFGVTVIAAVAAMTARETYRIHMDDLGQPAAQPVDKAEYARQRAGA
FT                   LAA"
FT   gene            complement(601561..602328)
FT                   /locus_tag="Rpic_4304"
FT   CDS_pept        complement(601561..602328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4304"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="PFAM: regulatory protein IclR; Transcriptional
FT                   regulator IclR; KEGG: reu:Reut_B5034 regulatory protein,
FT                   IclR"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4304"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29400"
FT                   /db_xref="GOA:B2UIJ9"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIJ9"
FT                   /protein_id="ACD29400.1"
FT                   /translation="MTKEPLNRRDWIAGLEKGLAILEAFDHEHPRLTPTQAAELTGLTR
FT                   TAARRYLLTLEHLGYLTSEGTLFSLTPRVLKVGWSYFDSARLPRTVQPFLQQVTAAVGE
FT                   VAYLSVLDDWELVFISRTSTSRVMSTGFVLGARVPAPLASAGVMMLAAQPEQKVKAWLE
FT                   TCVLTPYTPYTILQRDRLFDEIRKAGRQDYAVVEQQLQIGVRGVAVPLRDRHGNVIAAL
FT                   SVNMQVGEETTEHALQRVLQVLQDTALSIMRVL"
FT   gene            602459..604345
FT                   /locus_tag="Rpic_4305"
FT   CDS_pept        602459..604345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4305"
FT                   /product="4-hydroxyphenylpyruvate dioxygenase"
FT                   /EC_number="1.13.11.27"
FT                   /note="PFAM: Xylose isomerase domain protein TIM barrel;
FT                   KEGG: reu:Reut_B5035 4-hydroxyphenylpyruvate dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4305"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29401"
FT                   /db_xref="GOA:B2UIK0"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="InterPro:IPR041736"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIK0"
FT                   /protein_id="ACD29401.1"
FT                   /translation="MNSLRAARYPKCIATVCLSGTLPEKLEAAAAAGFDGIEIFENDLL
FT                   NFDGSPDRVRQMAADLGLAIMLYQPFRDFEAMPRELFARNLARAERKFDVMAELGVETV
FT                   LVCSNVQDIAIDDPARAADDLRQMAEAAAGRGLRVGYEALAWGRHTRTWRQAWQIVQQA
FT                   DHPALGLILDSFHTLSLGDTLDGLHNVPADKLFFVQFADAPRLSMDVLSWSRHHRNFPG
FT                   QGDLPVTDFARDLLAAGYTGPLSLEVFNDDFRSAPARLTALDGMRSLLWLESEAGGAEL
FT                   PAAAQFEGVDFLEFAVDAAAGRELETRLRALGFAFAGHHRSKAVDLYRQGRVNVILNME
FT                   QDSAASEHFELHGPSVCAIGLKVDDAERAMARARVLCAQEWRGPVGPAERSIPALRAPD
FT                   GTLLYLIDDRQADRSIYESDFVLHPGMQDDAAGLASIDHVAHALPAHRLDSFVLFYRAI
FT                   FGMEAEPEQEIADPYGLVKSRAMVSPDRNVRIPLNVSESGRTATGRFIAAYAGSGVHHI
FT                   AFRTERLFETIEAIDRGAAHLQHVPENYYDDVAARLGLDDALLTRLHDDGLLYDRDPHG
FT                   DFLHTYTEPFRERFFFELVQRNGYLGYGAANAAVRMAVQAQLSRTTTNTADH"
FT   gene            604467..605531
FT                   /locus_tag="Rpic_4306"
FT   CDS_pept        604467..605531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4306"
FT                   /product="porin Gram-negative type"
FT                   /note="PFAM: porin Gram-negative type; KEGG: reu:Reut_B5031
FT                   porin, gram-negative type"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4306"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29402"
FT                   /db_xref="GOA:B2UIK1"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIK1"
FT                   /protein_id="ACD29402.1"
FT                   /translation="MNKTMIAALVLGATSLPAAAQTTGGVTLYGLIDTTIRYSTHENAA
FT                   GNSNLQMMDGVLTGSRWGLRGTEDLGGGTKAMFILESGFFPDTGGSQQGGRLFGRTAVV
FT                   GLEGDYGKLYLGRQYTLAHEVLSSYEAMAFANNSIVGYQGGNYTGLRYDNTVKYIKSFG
FT                   GLQLAGAWTFGEAAGSFSKSSAGAGSVVYSMGSAEVGAVYQVTRDVSSAFFGAVPAALA
FT                   SKQTVWGFGGKLDTSIATWYLGYTNSRLDVADYKNQAAYVGAKVPISGALSFIGTVQYD
FT                   WMKHLDSSGKRLTTAGMLDYAFSKRTDVYAEVDYTHLQGSWVALDSAAAFNNSGNLYGN
FT                   NSRLGVMLGVRHKF"
FT   sig_peptide     604467..604529
FT                   /locus_tag="Rpic_4306"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 21"
FT   gene            complement(605599..606852)
FT                   /locus_tag="Rpic_4307"
FT   CDS_pept        complement(605599..606852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4307"
FT                   /product="D-amino-acid dehydrogenase"
FT                   /EC_number="1.4.99.1"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   reu:Reut_B3726 D-amino acid dehydrogenase small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4307"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29403"
FT                   /db_xref="GOA:B2UIK2"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIK2"
FT                   /protein_id="ACD29403.1"
FT                   /translation="MTHIVIVGAGISGVTTAYTLSQLGYQVTVLDRHLYPAMETSFANG
FT                   GQLSASNAEVWNSTGTLLKGIKWMLRNDAPLLLNPKPSWHKYSWIGEFVASIAHYRRNT
FT                   IETTRMAIEARKHLFAMAEREQIDFDLQKRGILHVYHDKASFAAAGKANALLVAGGLER
FT                   HAVSPEEIAAIEPTLRGNYYGGYFTESDATGDIHKFTRGLAQACERRGVRFMQGVDVRD
FT                   VQTTEGGVSLLLQTTLDDRLSTSAANIVQDLAADAMVVCAGVGSRHIAQLVGDRINVYP
FT                   VKGYSITVHLDDEASVQGAPWVSLLDESAKIVTSRLGTGRFRVAGTAEFNGYNRDIRAD
FT                   RIEPLVAWTRRNFAIGTSRVVPWAGLRPMMPDMMPRVGRGRHARVFYNTGHGHLGWTLS
FT                   GATAAMVGDVIARDCPVH"
FT   misc_binding    complement(606897..606995)
FT                   /bound_moiety="glycine"
FT                   /note="gcvT element as predicted by Rfam (RF00504), score42
FT                   .51"
FT   misc_binding    complement(606998..607103)
FT                   /bound_moiety="glycine"
FT                   /note="gcvT element as predicted by Rfam (RF00504), score62
FT                   .14"
FT   gene            complement(607168..607959)
FT                   /locus_tag="Rpic_4308"
FT   CDS_pept        complement(607168..607959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4308"
FT                   /product="Ethanolamine ammonia-lyase"
FT                   /EC_number="4.3.1.7"
FT                   /note="PFAM: Ethanolamine ammonia-lyase light chain; KEGG:
FT                   reu:Reut_B5491 ethanolamine ammonia-lyase small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4308"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29404"
FT                   /db_xref="GOA:B2UIK3"
FT                   /db_xref="InterPro:IPR009246"
FT                   /db_xref="InterPro:IPR042251"
FT                   /db_xref="InterPro:IPR042255"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIK3"
FT                   /protein_id="ACD29404.1"
FT                   /translation="MPKHTLVQLNPWAHLRAFTDARIALGRAGNSQTTDAVLAFGVAHA
FT                   QARDAVHLPLDSAAVATALGEAGFTAVTAHSAAADRAEYLRRPDLGRRLDEASRARLGA
FT                   LRPAQPFDVVFVIADGLSALAVQSHAVPLLCSVRERLPAGWSIGPVAIAEQSRVALGDE
FT                   IGALLGARQVVMLIGERPGLSSPDSLGIYLTYAPRVGRSDAERNCISNVRPAGLTYDQA
FT                   ATRLVFLLNGALALGRSGVDLKDDTPAVAYGAARLAERHDP"
FT   gene            complement(607980..609362)
FT                   /locus_tag="Rpic_4309"
FT   CDS_pept        complement(607980..609362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4309"
FT                   /product="Ethanolamine ammonia lyase large subunit"
FT                   /note="PFAM: Ethanolamine ammonia lyase large subunit;
FT                   KEGG: reh:H16_B0096 ethanolamine ammonia-lyase heavy chain"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4309"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29405"
FT                   /db_xref="GOA:B2UIK4"
FT                   /db_xref="InterPro:IPR010628"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIK4"
FT                   /protein_id="ACD29405.1"
FT                   /translation="MHFDHTIGAQRHVFNDLKTLLAKASPSRSGDYLAGLAAASEGERM
FT                   AARMALADVPLSVFLNEALVPYEDDEVTRLILDRHDAQAFQPIASLTVGEFRNWLLLHE
FT                   TDSQTLASVATGVTPEMAAAVSKLMRNQDLVAVARKCRVVTRFRNTIGLPGRLSVRLQP
FT                   NHPTDDPKGIAASIIDGLLYGCGDATIGINPAGDNLGAIVSLLQLVDELRNRYAIPTQS
FT                   CVLTHVTNTVRAIDQGAPVDLMFQSVAGSEQANARFGISLALLAEAHDAAQSLARGTVG
FT                   NNVMYFETGQGSALSANAHHGVDQQTMEARAYAVARAFSPLLVNTVVGFIGPEYLYDGK
FT                   QIIRAGLEDHFCGKLMGLPMGCDVCYTNHAEADQDDMDTLLTLFGVAGIHFIMGVPGAD
FT                   DIMLNYQSTSFHDALYLRDMLGLRPAPEFEAWLQSMGIVDAAGRLQDATARQPLLQLAH
FT                   AL"
FT   gene            609487..610722
FT                   /locus_tag="Rpic_4310"
FT   CDS_pept        609487..610722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4310"
FT                   /product="chromate transporter, chromate ion transporter
FT                   (CHR) family"
FT                   /note="TIGRFAM: chromate transporter, chromate ion
FT                   transporter (CHR) family; PFAM: Chromate transporter; KEGG:
FT                   bxe:Bxe_B0092 chromate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4310"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29406"
FT                   /db_xref="GOA:B2UIK5"
FT                   /db_xref="InterPro:IPR003370"
FT                   /db_xref="InterPro:IPR014047"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIK5"
FT                   /protein_id="ACD29406.1"
FT                   /translation="MTASATPSRTHQAGSAMEVLAVFLKLGLTSFGGPVAHIGYFRREF
FT                   VERRRWLDDVTFTDLVGLCQFLPGPASSQVGFSVGLLRAGWRGGLAAWCGFTLPSVLLL
FT                   LAFAMLAPSLGGPFGAGLIHGLKLVAVAVVAQAVWDMARKLCPDWQRAGIAVLSIAVLG
FT                   ALTTVYAQLVVIALGAALGLVLCRTSLPASGSQRAGQEAAFRVSHVASIVSLALFCALL
FT                   FGLPVLTDLHPWMPAKVFDAFYRSGALVFGGGHVVLPLLEQQTVATGWVASNDFLAGYG
FT                   AAQAVPGPLFTFAAFLGWTIGPGLNHWAGAALATVGIFLPGLLLVIAALPYWQGLRARP
FT                   SMAALLAGVNAAVVGLLAFALYTPVWTSAVRSWLDFAVAAIAFLLLTQWKTPPLIVVAF
FT                   CAAAGVAAAMLG"
FT   gene            complement(610773..612170)
FT                   /locus_tag="Rpic_4311"
FT   CDS_pept        complement(610773..612170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4311"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="PFAM: helicase domain protein; DbpA RNA-binding
FT                   domain protein; DEAD/DEAH box helicase domain protein;
FT                   SMART: DEAD-like helicases; KEGG: rso:RSc0622 ATP-dependent
FT                   RNA helicase DbpA"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4311"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29407"
FT                   /db_xref="GOA:B2UIK6"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005580"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIK6"
FT                   /protein_id="ACD29407.1"
FT                   /translation="MTLEPTATPFSTLALAPAVLANLAQLGYTDMTPIQAASLPIALAG
FT                   HDLIAQAKTGSGKTAAFALALLARLDARSFDVQAMVLCPTRELADQVAQEIRRLARAEE
FT                   NVKVLTLCGGTPMRPQAASLEHGAHVIVGTPGRIMDHLERGNLALGALKTLVLDEADRM
FT                   LDMGFFDDIATVVRQCPADRQTLLFSATYPEGIAKLSQRILRNPKEVKLEERHDDSKIR
FT                   QRFYEVTDSQRLHAVGQLLKHYRPVSTLAFCNTKQQCRDLLDVLRAQGIHALALHGELE
FT                   QRERDQVLIQFANRSCSVLVATDVAARGLDIAQLEAVINVDVTPDPEVHVHRIGRTGRA
FT                   DENGWALSLASMDEMGRVGNIEEAMGREVEWHQLDELDTGNDAPLLPPMETLQILGGRK
FT                   EKIRPGDVLGALTGDAGFRGDQIGKINVTEFSTYVAVERGIARDALRKLNAGTLKGKKV
FT                   RVRLMDE"
FT   sig_peptide     complement(612105..612170)
FT                   /locus_tag="Rpic_4311"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.973) with cleavage site probability 0.883 at
FT                   residue 22"
FT   gene            complement(612185..612505)
FT                   /locus_tag="Rpic_4312"
FT   CDS_pept        complement(612185..612505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4312"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bam:Bamb_5099 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4312"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29408"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIK7"
FT                   /protein_id="ACD29408.1"
FT                   /translation="MQTPANGAAKPFVVEVPIWIHIGALAAPDYHLVIEAQHNIHLEKT
FT                   VFICINQSCGTQWQLSDVVIKDEGQGPLFRCALCGARNYVERFEAADGTVVYEQLEGKP
FT                   YK"
FT   gene            612968..614716
FT                   /locus_tag="Rpic_4313"
FT   CDS_pept        612968..614716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4313"
FT                   /product="Poly-beta-hydroxybutyrate polymerase domain
FT                   protein"
FT                   /note="PFAM: alpha/beta hydrolase fold;
FT                   Poly-beta-hydroxybutyrate polymerase domain protein; KEGG:
FT                   eba:ebA5073 putative poly-beta-hydroxyalkanoate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4313"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29409"
FT                   /db_xref="GOA:B2UIK8"
FT                   /db_xref="InterPro:IPR010941"
FT                   /db_xref="InterPro:IPR022211"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIK8"
FT                   /protein_id="ACD29409.1"
FT                   /translation="MRTAPVPSSPTAEQIDLPFHAALARASNSLSIASMQLALFDWALH
FT                   LAGSPGKRLDLWRLALTQAQQLEGYIRNCMASGPQNACLCVQPPARDRRFAADEWRLWP
FT                   FNVLHQSFLLTEQWWEAATRGVWGVAKHHEDVVAFAARQWLDMMSPGNQLATNPIVLRR
FT                   TFEQHGTNLVRGALNALDDLERSMSGAPAAGTERFMVGRDVAITPGKVVLRNRLIELIQ
FT                   YAPATGKVQAEPILIVPAWIMKYYILDLSPQNSLIRYLVEQGHTVFCISWKNPDEADRA
FT                   LDMDDYLKLGVFAALDAVNAIVPGQRVHAAGYCLGGTLLAIAAAAMARDGDARLASMTL
FT                   FAAQTDFCEPGELGLFIDEAQVSLLEAQMEQTGYLRASQMAGAFQMLRSYDLLWSRLVG
FT                   EYLLGDRAPMNDLMAWNADATRMPARMHSQYLRHLFLNDDLSEGHYPVNGKPVALNEID
FT                   LPIFVVGTLTDHVAPWRSVYKLHHLTEAELTFVLTSGGHNAGIVSPPTNSHRRFQMQTR
FT                   HTGETSAGPDDWLASAPATDGSWWPAWHAWLVAHASGSALVKPPKMGVPGLPPLADAPG
FT                   TYVLEK"
FT   gene            614772..614870
FT                   /pseudo
FT                   /locus_tag="Rpic_4314"
FT   gene            614881..615393
FT                   /locus_tag="Rpic_4315"
FT   CDS_pept        614881..615393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4315"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eba:ebA5072 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4315"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29410"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIK9"
FT                   /protein_id="ACD29410.1"
FT                   /translation="MDTPANVPLALQKAQIAFGLQTLGLLKATRQRWYELGAELLAADV
FT                   ARTESALADLQSVEDWNAFAALLPNAFWQSSQRAMDVLQGVLQTAISNQSSFVADYQRV
FT                   MLEWQQASVRALSTAGNAMPIHTALQGMLSTWGLPGDALPRSASEQSNPTLLRASGKGD
FT                   GQLRKTY"
FT   gene            615403..616848
FT                   /locus_tag="Rpic_4316"
FT   CDS_pept        615403..616848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4316"
FT                   /product="Phosphate butyryltransferase"
FT                   /EC_number="2.3.1.19"
FT                   /note="PFAM: phosphate acetyl/butaryl transferase; MaoC
FT                   domain protein dehydratase; KEGG: har:HEAR1516 bifunctional
FT                   enoyl-CoA hydratase/phosphate acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4316"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29411"
FT                   /db_xref="GOA:B2UIL0"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIL0"
FT                   /protein_id="ACD29411.1"
FT                   /translation="MGPDHLPAPPALLPGSDLSVVRNRTFDEIAVGDTAAILRTLTAED
FT                   IQLFAVLSGDVNPQHLDPEFAASTRFHGVIAHGMLGGALISALLGTRLPGPGTIYLGQT
FT                   LQFLAPVRVGDTLTIRVTVVSKEDERKRVTLACTCTNDSGTVAITGEAEVIAPTERIER
FT                   PRTTLPDVRITTGSDGMHRLLDHVRPLGAVRMAIVHPCDALSLTAVMDAHAEGLIVPCL
FT                   VAPYAKLMRVAADAGLDLRGIEIEDVPHSSAAATRAVELVTQGRAEALMKGSLHTDELM
FT                   AAVVRDEAGLRTKRRISHCFLMQSPAYPRPFIVTDAAINIAPTLDQKADIVRNAIDLAH
FT                   AIGVERPRVAILAAVETVNPRMPATLDAAALCKMADRGQIEGGVLDGPLAFDNAVSAAA
FT                   ARIKGIVSEVAGQADVLVVPDLESGNMLAKQLEYLGGAASAGIVLGARVPIVLTSRADS
FT                   RESRIASCALATLLAHRYRSLPP"
FT   gene            616845..618026
FT                   /locus_tag="Rpic_4317"
FT   CDS_pept        616845..618026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4317"
FT                   /product="acetate kinase"
FT                   /EC_number="2.7.2.1"
FT                   /note="KEGG: pla:Plav_3453 acetate kinase; TIGRFAM: acetate
FT                   kinase; PFAM: acetate and butyrate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4317"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29412"
FT                   /db_xref="GOA:B2UIL1"
FT                   /db_xref="InterPro:IPR000890"
FT                   /db_xref="InterPro:IPR004372"
FT                   /db_xref="InterPro:IPR023865"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIL1"
FT                   /protein_id="ACD29412.1"
FT                   /translation="MNDCIVVLNCGSSSIKFALFDATLDPLPRAPMWNGKVEGIGTEHP
FT                   TATEAGAPTQALELDGVQPYHAALMHIRQRVEQRLEGRRLKAVAHRVVHGGAKYFAPVR
FT                   VSAEVLSDLRSYIPLAPLHQPFALEAIEALLSGLPDVPQVACFDTAFHNTLPQVETMLP
FT                   LPYSAWERGLRRYGFHGLSYEYMSMALPERHGDIARGRTIVAHLGSGASLCAMHGLKSV
FT                   ATTMGFSALEGLMMGTRCGSLDPGAVLYMMETEHLSPAQVGHVLYHESGLLGVSGLSSD
FT                   PRDLIPREADNPRAQAALALYVRRIVREIGALVAVLGGLDLLVFTAGIGEHNAVLRERV
FT                   VGGLGYLGANLDGEANQAHAAIISSSASRIRVAVEPTNEEWVAARHAVQCNLQ"
FT   gene            618456..619955
FT                   /locus_tag="Rpic_4318"
FT   CDS_pept        618456..619955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4318"
FT                   /product="succinic semialdehyde dehydrogenase"
FT                   /note="TIGRFAM: succinic semialdehyde dehydrogenase; PFAM:
FT                   Aldehyde Dehydrogenase_; KEGG: bur:Bcep18194_C6772 succinic
FT                   semialdehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4318"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29413"
FT                   /db_xref="GOA:B2UIL2"
FT                   /db_xref="InterPro:IPR010102"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIL2"
FT                   /protein_id="ACD29413.1"
FT                   /translation="MQFNVMNHDTQATAALQARLRDPSLLETRAWLASGWQEASDGRSF
FT                   AVTNPATGEILARVASLSGAEVESAITASAQAQAVWQRRSSHERAKLLRAWFDLMIANA
FT                   DDLALIMTSEQGKPLAEARGEILYAASFVEWFAEEAKRIYGDVASHPQTDKRILVIRQP
FT                   VGVCAAITPWNFPAAMITRKVAPALAAGCSIIVRPADLTPLTALALAVLAERAGIPAGV
FT                   LQIVCGPSREIGAVLTASPVVRKLSFTGSTEVGRVLMSQSSPTIKRMSLELGGNAPFIV
FT                   FDDADLDAAIEGAMASKYRNSGQTCVCANRFLVQDGIHDRFVEALVRRVAELKVGNGVE
FT                   PGVQQGPLIQQSACEHLQAMIDDAVGKGARVVVGGKGHALGGTFFEPTVIAGATPDMRV
FT                   AREELFGPVAPVFRFRDEAEAIAMANDTEYGLAAYLYTRDNARIWRVGEALEYGMVGLN
FT                   TGLISNEVAPFGGVKQSGLGREGSRYGIDEYLEIKYLCAQV"
FT   gene            619991..621160
FT                   /locus_tag="Rpic_4319"
FT   CDS_pept        619991..621160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4319"
FT                   /product="iron-containing alcohol dehydrogenase"
FT                   /note="PFAM: iron-containing alcohol dehydrogenase; KEGG:
FT                   bur:Bcep18194_C6773 iron-containing alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4319"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29414"
FT                   /db_xref="GOA:B2UIL3"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIL3"
FT                   /protein_id="ACD29414.1"
FT                   /translation="MDQFQQPVRFDTVPSILQEWGAARRLGELLAAWTERRSVLVVTDG
FT                   GLHKAGVLESAKASLATAGFRVTVFDEVVADPPEAVLLRCVEHARAARVDLVIGLGGGS
FT                   SMDIAKLAAVLAVSEQPLAEMYGIGNVKGARVPLVQMPTTAGTGSEVTNISIVSVGETT
FT                   KMGIVAPQLYADRVILDAELTVGLPRQHTAATGIDAMVHAIEAYTSKHKKNAISDALAR
FT                   EALRLLSANLLAACENGNDRRAREAMLLGATLAGQAFANAPVAAVHALAYPLGGHFHIP
FT                   HGLSNALMLGPVLRFNAAAAAAQYAELAGALGIGEADRDDDARTAAFIAFMEDLMDRSG
FT                   APRRLRDAGVTRESLAMLAADAMQQQRLLQNNPIDVQQADALRLYEQAY"
FT   gene            621357..622820
FT                   /locus_tag="Rpic_4320"
FT   CDS_pept        621357..622820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4320"
FT                   /product="flavin-containing monooxygenase FMO"
FT                   /note="KEGG: bur:Bcep18194_C6774 flavin-containing
FT                   monooxygenase FMO"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4320"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29415"
FT                   /db_xref="GOA:B2UIL4"
FT                   /db_xref="InterPro:IPR000960"
FT                   /db_xref="InterPro:IPR020946"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIL4"
FT                   /protein_id="ACD29415.1"
FT                   /translation="MSQVETNGHYKVVILGAGFGGLGMAAQLKRAGIDDFVVLEKRPAL
FT                   GGVWRDNSYPGAACDTESHLYCYSFHPHLRVSAMYAGRDELLGYMESLATRFGLDSHLR
FT                   FNSEIRGAVWDKVDRLWRFELADGSRLTSRFFVPAWGQLNRPLIPKVPGLGTFKGQYFH
FT                   SADWRHDVDLRGKRVASIGNAASAVQYVPEIAPVVNHLTVFQRSANWIMPRNQIVFATE
FT                   QLDEFQRDPALFEKSRERLHAFRESGFERTRVGTDAQREGKRLALEHLERSVADPVLRA
FT                   KLTPDYEFACKRILRSDDYYPALTRDNVTLETAGIEAFVEEGILSKDGRVHAFEVVVFG
FT                   TGFESQAFQGDLQVSGLDGSLADAWADGPQAYLGMAVPGFPNLFMIYGPNTNLNHNSIL
FT                   SMLEIQQRYIIDAIRGIEASGVDACHVSRSLSDDYNRALQAAMSGSAFSADCSSWYKNA
FT                   KGKVINNWSGTVDEYRAMARWDLGAFEPI"
FT   gene            622834..623811
FT                   /locus_tag="Rpic_4321"
FT   CDS_pept        622834..623811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4321"
FT                   /product="Alpha/beta hydrolase fold-3 domain protein"
FT                   /note="PFAM: Alpha/beta hydrolase fold-3 domain protein;
FT                   KEGG: bur:Bcep18194_C6775 esterase/lipase/thioesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4321"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29416"
FT                   /db_xref="GOA:B2UIL5"
FT                   /db_xref="InterPro:IPR002168"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIL5"
FT                   /protein_id="ACD29416.1"
FT                   /translation="MSSERSWQPLAEVAEDARPLVQAFREAGGLHYGSLAPEPSRANFA
FT                   RACGLNGLNGIDGVGHRDIMVPVTDGEIRVRLYQPDEAEGAGDKGPLVVFLHGGGWVIG
FT                   SIDTHDGICRLLARQSGCVVASVEYRLAPEHQWPVPLRDCEQALGHLVANAAALSIDAS
FT                   RVVLAGDSAGGSMATIISNSPATGAYEVAGQVLLYPVTDLTASRPSYGRFLGGLPLVAE
FT                   SMQWFRELYVPAGTPLDQPTLSPLLHAEGRRQPPMFIATVGLDPLCDEGIEYAAMAARA
FT                   GGLLEHHHLPRHMHGIFTAAGRISSAQNLLELGGLFIRRLSRHS"
FT   gene            624474..624887
FT                   /locus_tag="Rpic_4322"
FT   CDS_pept        624474..624887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4322"
FT                   /product="Endoribonuclease L-PSP"
FT                   /note="PFAM: Endoribonuclease L-PSP; KEGG:
FT                   bch:Bcen2424_5817 endoribonuclease L-PSP"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4322"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29417"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="InterPro:IPR038743"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIL6"
FT                   /protein_id="ACD29417.1"
FT                   /translation="MAASNKRQSIIPAPFQGHYDAYHFSPATRVGDMVWVSGQVGVDAD
FT                   MKPAEGMQAQAQIAFECLKLVLNEAGASLADVVELTTFHTDLHGDIDAFIAVKDQFFPS
FT                   RYPSWSAVGVTQLALPGLLIEIRAMAVAGSGEE"
FT   gene            624947..626311
FT                   /locus_tag="Rpic_4323"
FT   CDS_pept        624947..626311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4323"
FT                   /product="protein of unknown function DUF1329"
FT                   /note="PFAM: protein of unknown function DUF1329; KEGG:
FT                   reu:Reut_C6388 protein of unknown function DUF1329"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4323"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29418"
FT                   /db_xref="InterPro:IPR010752"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIL7"
FT                   /protein_id="ACD29418.1"
FT                   /translation="MKKQRIEFVSAIAAAVCCVIGTAAMAEDLTPEGGDRAASKDGAVP
FT                   AYAGKQSPEAGWEWGKVRGDFWKHKSEKPLYSIDASNIDKYADKLTPGQIQLIKQKKGY
FT                   RMDVYPSHRECQVPDFVAQNSKANLTGAKLDSTGEQLQTATLPGVAFPQPKNGAEAILN
FT                   YIYRYHGEGLEWPKMVTSISPRPGGNEWIDVISPQHALLPWGKPGKTTPQDVDQLSSAA
FT                   FFKMESPPALAGQAFVQRQFFNKSSETFYYFPGQRRVRRMPAYTHDAPVIGMENQYLID
FT                   EANMFYGTIDRFNWKLVGKKELLVPYNAFGMYKFKTNLHDVATPDGVASGNRRYEMHRV
FT                   WVVEATLKPSARHVASKKVFYLDEDSWLALVGEDYDAQGKLWKVRESYPIPVWELGGTC
FT                   DNLPFAMYDLSNGRYVMDQTTFGQGKDIRWYEQINDPRFKTDFFTAETLRAVSER"
FT   sig_peptide     624947..625027
FT                   /locus_tag="Rpic_4323"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 27"
FT   gene            626386..628221
FT                   /locus_tag="Rpic_4324"
FT   CDS_pept        626386..628221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4324"
FT                   /product="protein of unknown function DUF1302"
FT                   /note="PFAM: protein of unknown function DUF1302; KEGG:
FT                   reu:Reut_C6389 protein of unknown function DUF1302"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4324"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29419"
FT                   /db_xref="InterPro:IPR010727"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIL8"
FT                   /protein_id="ACD29419.1"
FT                   /translation="MNTKKMSTRTAISLAVLAATTSAAYAYDFTLGTDDAVKGSLVSNI
FT                   TAGVATRTKSPSCALTGDPNANGCGAAANTDQWGAGDNGDLNYRKWKPYSTYLSATSEL
FT                   LLTMPSEGLKFMARGTGMYDFMAKNTERTPLSSDARAQVVYDAHVLDLWAQKDFTVADQ
FT                   NAHVRIGNQVINWGESMYAMGGINATNSLDIQKLLIPGSQLKQALLPAPMVSFATNLSH
FT                   GLSTEAYYQFIWNGNRMPPVGSFWSASNAVGRGAEPFTVNTTNFNANGPSAGTVAGQNG
FT                   LNSHDPGTIAAINNGLVNGDFAGPPSFSIGLPVSNKLPSKYKPQFGVKFNYVPTSIDAN
FT                   FAFYYENYTDKSPVLSSFTNNTAQWSYQQNRQLFGISANFPVGPWAVGTELSYRPRDAV
FT                   ALSGCYGAGGPMDLNVNPAGVDCQQWVDRKKLQFGINGILALTRSEYPFLKMIGADSAS
FT                   LTAEATMVYYPGLGGSVTRTINGVQVMQAPQAGYLTWLNNNSGTGYPIGMRQGTAASGG
FT                   VTVDFNWTYDGTLIPGWQVTPGVTFNAGLYGYTPTFNANYMQGAKSANFYVLFNQNPTV
FT                   WQAGINFTAFWGGHNTVGNPYSDRNFIGAFVTRNF"
FT   sig_peptide     626386..626466
FT                   /locus_tag="Rpic_4324"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 27"
FT   gene            628285..630645
FT                   /locus_tag="Rpic_4325"
FT   CDS_pept        628285..630645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4325"
FT                   /product="transporter, putative"
FT                   /note="KEGG: reu:Reut_C6390 transporter, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4325"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29420"
FT                   /db_xref="GOA:B2UIL9"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIL9"
FT                   /protein_id="ACD29420.1"
FT                   /translation="MLNRLVAGLEKAFFGHRMIVLAVIGLFTAGMAVFAVQLRMDAGFE
FT                   KQMPIGHEYIQTFQKYRNDLLGANRITVVVRAKKGSIWTPEGLTRLYNVTQAVIYLPNV
FT                   DRIGVRSLWTPNAFVNEITEEGFRAEPIISGNITPDQLTPEVVASIRRATTLGGYVGTL
FT                   VSHNEDSAMITAELNERDSAGKVLDYVAFNHTLEDKIRKPFEDAGYEVQIIGFAKQIGD
FT                   IADGAKGVLVFCVIALLLTALSVYWYCHSVRFTVLLIVCSLSSLVWQFGTLRLLGFGLD
FT                   PLAVLVPFLVFAIGVSHGVQQVNFIVREIARGNSSYDAARHSFSGLLIPGVLALVTAFV
FT                   SFITLLLIPIPMVRELAITASLGVAYKIVTNLILLPVAASCFNFTQAYAQSALKRAAWR
FT                   SAVLRPLSKVAQPKYAGVTLLITLMVFGLAVWQSRDRVIGTLQPGAPELREEARFNRDA
FT                   TSIAGNYDMGLDWLSVAVESTGKACNNPAVGLYEDEFTAAMRTEPGVVSAQSYSGMLRT
FT                   YNAGYNEDYPKMNVVPIDPENYGAVSVDVARLKGFMKADCSMTAVHLYLTDHKATTINR
FT                   ILEDIKQYRVSHPFPGVNIRLAAGNAGVLAATNDEVEHSELPMMLYVYAAIVILVFLAY
FT                   RDWRSMLACCVPLTVATFIGYWFMKELKIGLTVATLPVMVLAVGIGVDYALYIYNRLQR
FT                   HLAEGDPIERAMERALEFECVATIFTAITLAVGVATWSFSALKFQADMGKLLAFMFIVN
FT                   LVMAMTALPALASVLERWFPRRKPARAPGLLSH"
FT   sig_peptide     628285..628392
FT                   /locus_tag="Rpic_4325"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.846) with cleavage site probability 0.841 at
FT                   residue 36"
FT   gene            630659..631630
FT                   /locus_tag="Rpic_4326"
FT   CDS_pept        630659..631630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4326"
FT                   /product="glycosyl hydrolase, BNR repeat"
FT                   /note="KEGG: reu:Reut_C6391 glycosyl hydrolase, BNR repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4326"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29421"
FT                   /db_xref="GOA:B2UIM0"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR028203"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIM0"
FT                   /protein_id="ACD29421.1"
FT                   /translation="MMKTILTSIALCAAAAVFAQTPAEGTVATWSAKPAHTWPAPTNRM
FT                   LLDATRAGKRIVAVGEHGIVLLSDDEGQTYRQARTVPASATLSAVSFADERHGWAVGQW
FT                   GVILATSDGGETWQKQRMDTAVDQPLFSVLFTNDRDGIAIGLWSLMLQTHDGGKTWTKT
FT                   TLPKPPGGGRADRNLYHVFADGKGAFYISAEQGTVLKSTDGGATWDYLATGGKGSLWSG
FT                   VAMPDGRIVVGGLLGSLFQSSDGGANWQPLKAETKSSITGLVASGNGFVAVGLDGLVLK
FT                   QREDGAPLAVAQREDRAALTAAVIDAGGKPILFSKEGVLAGL"
FT   sig_peptide     630659..630718
FT                   /locus_tag="Rpic_4326"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 20"
FT   gene            631717..632547
FT                   /locus_tag="Rpic_4327"
FT   CDS_pept        631717..632547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4327"
FT                   /product="Phytanoyl-CoA dioxygenase"
FT                   /note="PFAM: Phytanoyl-CoA dioxygenase; KEGG:
FT                   reu:Reut_B5715 phytanoyl-CoA dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4327"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29422"
FT                   /db_xref="GOA:B2UIM1"
FT                   /db_xref="InterPro:IPR008775"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIM1"
FT                   /protein_id="ACD29422.1"
FT                   /translation="MQVTEQMKLELARDGATVARGLFSPERLKRMREAFDYGIAHPSPQ
FT                   HGYAFAGTPDEHFNDYGNFDNRDVHVATVKALGLDEFVASLWDSEHVWFIGEELFIKKG
FT                   GRAGRSPWHQDTSYYPFSGPQLLNIWTCFEKIPRKNALEVVRGSHLGAQYNGTSYNDPN
FT                   DHTKSLWVNTDWPLLPNIEADRARDPASWDVVSWDLEPGDALLFHSGSLHGGAPVTPDC
FT                   PDRHTLVYRFYGDKLFYRPLPTGGCNYGYDISNLNDPSLTPGEPFRAPYCTQVR"
FT   gene            complement(632726..634159)
FT                   /locus_tag="Rpic_4328"
FT   CDS_pept        complement(632726..634159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4328"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: reu:Reut_C6386
FT                   regulatory protein, TetR"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4328"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29423"
FT                   /db_xref="GOA:B2UIM2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIM2"
FT                   /protein_id="ACD29423.1"
FT                   /translation="MPNSAVKQGTPDHSEGAKSAVRPSTRRNREQRIREIIETARQVFQ
FT                   EDGYAGFAIRRVADRMGITHGNLQYYFRTTEELLRTALPAYMSEVMEDYAAIASRPGTG
FT                   AAQRCSALINRIFQNINETDLPKFMVEIWAFASHEAFVAELLDDMQARFRSIFAKLLSE
FT                   MHPTLSHEECLVRAAVIGAQMDGMTLFASHGDYPGRDYVELARVGKRAVKLVVSASAAT
FT                   LQSEVPLRRPRTQHDGSDARVSIFGSDGYLQPALLELRARQSTQDTFHYRPTAQGKRRE
FT                   LKINEIISTAANLLATEGYANFTLARVARELGTLPSALQNYFPTHDDLLRSTMEAVGQA
FT                   YLDRYSEIGKPSGKPALERVLEIAAENFEETCVPAVQQLWSEMWALAQHSDITREHVRN
FT                   GYAAYRVVWADLIREVDATATARECLARATLITALLDGVTVLRFDAQHQSVSEDRTFEL
FT                   VMVMTALIAQGRIAPNDVP"
FT   gene            634876..636237
FT                   /locus_tag="Rpic_4329"
FT   CDS_pept        634876..636237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4329"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   reu:Reut_C6399 twin-arginine translocation pathway signal"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4329"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29424"
FT                   /db_xref="GOA:B2UIM3"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIM3"
FT                   /protein_id="ACD29424.1"
FT                   /translation="MSTNLERGKERADLGKYRALGGWVEKPDDMQHALEGNVSADVVIA
FT                   GAGFAGLSAALELTRLGANVVVIERDFAGFGASGRNAGYLAGAMALEYDLMFRGLSKER
FT                   ATQIVRYYDDAVGFVEDKLKEHDIDCEYVQSGWIRAGVHPSQEKKIRADMLVGTEHGHK
FT                   SEFLDHAQMRARGIPPAFLFGEYTPAGGTLHPGKYVMGLRRAALRARVKLYENTPLLSY
FT                   TEGPVIQVKTPRGSVSAPVLLLATNAYTPQLGLLANKVVPLRISAIETESLSAVQLASL
FT                   DWPRREGIVTGHYSMESFRLTARNTIISTVKRIHYPYGSETPNVPAYDQYRALRANLHE
FT                   RLPTLKDVALRHCWSGYISTAGNALPVVGTTGANQNIYYTAGCSGHGLASQSMLGNMLA
FT                   QKIRGSEPPLLAALRYDTPTLPPEPFRWCLVNGALAAANTLDDRLNRKLRHAAA"
FT   gene            636324..637202
FT                   /locus_tag="Rpic_4330"
FT   CDS_pept        636324..637202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4330"
FT                   /product="Phytanoyl-CoA dioxygenase"
FT                   /note="PFAM: Phytanoyl-CoA dioxygenase; KEGG:
FT                   bur:Bcep18194_C6790 phytanoyl-CoA dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4330"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29425"
FT                   /db_xref="GOA:B2UIM4"
FT                   /db_xref="InterPro:IPR008775"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIM4"
FT                   /protein_id="ACD29425.1"
FT                   /translation="MSVKRFPNSAAPSELASVIEEDGGAIVKGFLSPSLLEHLKKDLLP
FT                   MLETTPNGVDEYFAGTQTRRLSRLFARTDHMVDVALNPLYLETARLILQKPIKLWSGEN
FT                   QVEVAPDIQVGVTQAIQIRPGQGMQPLHRDDSVWLWRHPGYKREARVQIMIAITDFSEE
FT                   NGGTLVIPGSHKWDDERMPKQEEAIPTSMEAGDALIFIGSTYHGGGQNRSNAPRTGLTM
FT                   SYDLAILRQEENHYLTLPIERVKRFPEEMQRLLGWSCSTTYAGFVERNGVMTDPHALLQ
FT                   QDDFVEVGHFD"
FT   gene            637396..638892
FT                   /locus_tag="Rpic_4331"
FT   CDS_pept        637396..638892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4331"
FT                   /product="Amine oxidase (flavin-containing)"
FT                   /EC_number="1.4.3.4"
FT                   /note="PFAM: amine oxidase; FAD dependent oxidoreductase;
FT                   KEGG: reh:H16_A0831 monoamine oxidase (flavin containing)"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4331"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29426"
FT                   /db_xref="GOA:B2UIM5"
FT                   /db_xref="InterPro:IPR001613"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIM5"
FT                   /protein_id="ACD29426.1"
FT                   /translation="MDDIAKKHDEAPEAAALTRRGFLGMAASVTAAATAAVLPNVASAV
FT                   TAASDSRDVLEVAIIGAGLAGLTAARDLKRAGCESFVVLEARDRVGGRTLNHDLGNGYF
FT                   SEAGGQWIGPGQTAIANLARELGVGTFLTHWEGDLVMLAGNARTTLANDGGFDTDPKLR
FT                   RELEEMARSVPTAAPWTSPRAAEFDAMSLADWLATKHLTPEDQIGWALAAQLTTGTAPE
FT                   KLSMLHYLSLINSADCNYRQLEAIKGGAQESRISGGSQILSIKMAEALGDKVRLSTPVL
FT                   RIENWQNGPVTIHTAKGVVRARSLIVALSPSLCNQIAFDPPLPEKRREMQRRWPAYAPM
FT                   RKTAHVYKKAFWRDKGLDGMLVQLKGPVQFAYDNSPEDVSFGVISAFVNNGVLPSDPKA
FT                   AETELSRIYAQAFGDEALHPVAYHEHDWGKADNWSLSCTSPIPPGFLTKYGDVLHPPIG
FT                   RLIWAGTETAEIWITTMDGAIRSGHKAALQALQAAAGGKA"
FT   gene            638892..639158
FT                   /locus_tag="Rpic_4332"
FT   CDS_pept        638892..639158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4332"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bch:Bcen2424_5824 cytochrome c, class I"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4332"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29427"
FT                   /db_xref="GOA:B2UIM6"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIM6"
FT                   /protein_id="ACD29427.1"
FT                   /translation="MNTNTTTKSRGRGKRILVLGGALLLAAVVVGGVMYGPEFYGLLQF
FT                   GKQLDQITQEDTRVGGPWPRVSEVCVSCHGYEGSCQDKANSLS"
FT   sig_peptide     638892..638987
FT                   /locus_tag="Rpic_4332"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.865 at
FT                   residue 32"
FT   gene            639276..642275
FT                   /locus_tag="Rpic_4333"
FT   CDS_pept        639276..642275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4333"
FT                   /product="transposase Tn3 family protein"
FT                   /note="PFAM: transposase Tn3 family protein; KEGG:
FT                   bvi:Bcep1808_7171 transposase Tn3 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4333"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29428"
FT                   /db_xref="GOA:B2UE95"
FT                   /db_xref="InterPro:IPR002513"
FT                   /db_xref="InterPro:IPR025296"
FT                   /db_xref="UniProtKB/TrEMBL:B2UE95"
FT                   /protein_id="ACD29428.1"
FT                   /translation="MATVERTAYPRFPKVFSTKELQACYTPTAEELDWATRSTRGQSPR
FT                   LGLLVLLKIFQQLHYFPYLDAIPTAVVDHVRVCAGLDPDTPFGYDRKVSPTLFRHYVVV
FT                   RQFLGVQPYIGTDANEVTIRAAREAAETMDQPVDIINATIDALILQQVELPAFSTLDTI
FT                   VEQIHARTQNAMFRRVARRLSEEDRQRLDKLLTREFANRQTAYNNIKRHARRPSRKHLN
FT                   LLIEHLEWLDSFGDLSGVLEGVPATKLRSLANQAMGLDAANLKETLPEKRYTLIVALLA
FT                   HMRVRSRDDLAEMFIRRMGAIHKRAQDELEYIQSRQRAKLEGLVTVLDGVVDIVADGGD
FT                   DARIGAQVRKLLAPNGDLEPLRERCAEVRAFSGNNYLPLLWRHFRAHRSVMLRLARVLE
FT                   WESTSQSRTLLAGLEVALENESLHREWIAAEVDLSFASERWRKLVRRAHHEGPPTNRRY
FT                   LELCVLSHMVNELRSGDLCVVGSDAFADYRGHLLPWRECERRLPEYCAKLDLPANAQEF
FT                   VAHLKQWLADAAQTLDKSFPDKRQHVTISADGEPLLKRTAARETPPSAVALQQALIRRM
FT                   PTRNLLDVLANIEHWTQFTRHFGPLSGNDPKIRNAAERYLLTIFAMGCNLGPTQAARHM
FT                   GDRVTPHMMSFVNRRHMSLEKLETAQRELIELYLRLDLPKHWGDGKTVAADGTQYDFYD
FT                   NNLLAGYHFRYHKMGAVAYRHVADNYIAVFRHFIPPGVWEAIYVIEGLLKANLSVEADT
FT                   VHADTQGQSAAVFAFTHLLGINLMPRIRNWKELDLYKPDAGVKYKHIDSLFSAVVDWDL
FT                   IAFHWQDLMQVALSIQAGTISSPLLLRRLGSESRKNRLYLAARELGNVVRTVYLLEWVG
FT                   SRELRQEVTATTNKIESYNGFAKWFSFGGDVIAENEPEEQQKRLRYNDLIASAVILQNT
FT                   ADLMQALRTMVSEGIKVNVADIEFLSPYLTHNIKRFGDYKLHLERVPEAWIRDGLFAGP
FT                   ARAVRRARHA"
FT   gene            642268..642603
FT                   /locus_tag="Rpic_4334"
FT   CDS_pept        642268..642603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4334"
FT                   /product="TnpC"
FT                   /note="KEGG: bvi:Bcep1808_7205 TnpC"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4334"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29429"
FT                   /db_xref="UniProtKB/TrEMBL:B2UE96"
FT                   /protein_id="ACD29429.1"
FT                   /translation="MPETKTPYGDVDSEALQGLRQSFDTRTILHAVELLDGIRARCAPD
FT                   GLRDDLLRLHGMAHTVINDASLAYSTDGPTLVEQVDAVLMELGDWLAALERMRQSLEPL
FT                   EHLSPAD"
FT   gene            complement(642769..643962)
FT                   /locus_tag="Rpic_4335"
FT   CDS_pept        complement(642769..643962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4335"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG: bmu:Bmul_5789
FT                   integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4335"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29430"
FT                   /db_xref="GOA:B2UE97"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:B2UE97"
FT                   /protein_id="ACD29430.1"
FT                   /translation="MTHPVPSFNGPAVAIEQLRIPPALSGLHGANRAREASRQITADDD
FT                   LAAVAAWLARYAGVPGTVATYRKEAERLILWAILQHGKPLSSLTHEDLLLYERFLADPQ
FT                   PAWRWVMASRKKLARSSPDWRPFAGPLSPTSVRHAMTILNALFAWLVQAGYLAGNPLSL
FT                   ARRRSAKTAPRVTRYLTHAHWDIVKATIETLPVATERDRLHAARCRWLFSVLYLAGLRL
FT                   AEIASTRMGAVFSRRDAAGVERWWIEVHGKGGKTRLVPATDELIAELARYRRICGLPPS
FT                   PQIGETRPLLLPVIGPEKPLSRAAIHLIVKEVFKLAADRVRAQGPEFGAQADVLASASS
FT                   HWLRHTAGSHMSDQQVDLRFVRDNFGHASLATTSVYLHAEDDARHQATQASHRLGWN"
FT   gene            complement(643997..644638)
FT                   /locus_tag="Rpic_4336"
FT   CDS_pept        complement(643997..644638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4336"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: kpn:KPN_pKPN3p05907 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4336"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29431"
FT                   /db_xref="UniProtKB/TrEMBL:B2UE98"
FT                   /protein_id="ACD29431.1"
FT                   /translation="MLEYRLTPNHAGVALWWDFAALERLHGFIHYVVQESVYIEDKEGF
FT                   VLGLAYDVRKAYSGQRSVDQRGDTKDDRCRIYGVEVLWPVLLTQVGVLRQAMAFIPTNK
FT                   LDQSIMFELEHVVESAVRAATPVLADEVIHRTRSAASATYVHLDSVLDSRCRYFIALPP
FT                   KQRLKMLPKVMATFDPMYGILAKSDITLRPDVIPPTAFVDSDEDWPDFEW"
FT   gene            complement(644653..644928)
FT                   /locus_tag="Rpic_4337"
FT   CDS_pept        complement(644653..644928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4337"
FT                   /product="plasmid stabilization system"
FT                   /note="PFAM: plasmid stabilization system; KEGG: sfl:CP0218
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4337"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29432"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:B2UE99"
FT                   /protein_id="ACD29432.1"
FT                   /translation="MELQWTSKAQEDLTRLYEFLAPVNRPAAARAVQALVKAPEILLTN
FT                   PRVGEQLFQFEPREVRRMLVGQYEMRYEIRGESIYLLRLWHTREDR"
FT   gene            complement(644928..645191)
FT                   /locus_tag="Rpic_4338"
FT   CDS_pept        complement(644928..645191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4338"
FT                   /product="transcriptional regulator, CopG family"
FT                   /note="PFAM: CopG domain protein DNA-binding domain
FT                   protein; KEGG: smd:Smed_6450 transcriptional regulator,
FT                   CopG family"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4338"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29433"
FT                   /db_xref="GOA:B2UEA0"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="UniProtKB/TrEMBL:B2UEA0"
FT                   /protein_id="ACD29433.1"
FT                   /translation="MSKAETRVLTAHVPVPLAEKVDQLADRLERSRGWIMKQALSAWIA
FT                   QEEERDRLTREALADVDAGRVIGHQAVQAWADSLGAGEPVPR"
FT   gene            complement(645243..645974)
FT                   /locus_tag="Rpic_4339"
FT   CDS_pept        complement(645243..645974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4339"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gvi:gll4023 unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4339"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29434"
FT                   /db_xref="InterPro:IPR021255"
FT                   /db_xref="UniProtKB/TrEMBL:B2UEA1"
FT                   /protein_id="ACD29434.1"
FT                   /translation="MTPNLMNLSDMPSTGTGWDRLEAAFKEERPLQPIRKIVVKGSVDM
FT                   VFRRADTPTLVVAGETADAVTSVRTAYKGDKLVIEREGVSIRFGSSHMTFHGTVGSVVL
FT                   GDIVNGKPTGPAISLHQPRAVVGIALPEFPAIKIKGSGDVTLLDLQQDALDLEIPGSGD
FT                   ITASGHVARLHVQVVGSGDVDASALIAESADLSVAGSGDIDAFVRTEVRARVAGSGDIV
FT                   VRGNPLRWDDHVAGSGTIKFR"
FT   gene            646188..647225
FT                   /locus_tag="Rpic_4340"
FT   CDS_pept        646188..647225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4340"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: reu:Reut_A1626 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4340"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29435"
FT                   /db_xref="InterPro:IPR021104"
FT                   /db_xref="UniProtKB/TrEMBL:B2UEA2"
FT                   /protein_id="ACD29435.1"
FT                   /translation="MTLDPASTAEDQALQADIAALRGRFTETRELYREVCALLFFRYGV
FT                   TPTANKLYSLVRKGSMSTPSHVLNRFWQDLRDKTRVTIDHPDLPEALKQVAAEAVLAIW
FT                   QAASSAAATELAALRAEARHQAHAAEAARDQATAESETARQATAVIQAQLDSVRGQLAA
FT                   LQEMLSAERQGHAATEARLQETRRQLDEAAQQLTQARVEFGAQLDRERARADAAEERAA
FT                   SHEKRALREIDQERTARQKSDKLADELRAQVVAARTAMQESAVTHANAIGTLRMELGAV
FT                   RQQAEGAATRQRETAEELVQTQSLLEEALRRAERAETEAETTRRLVSELKKATPGRVGQ
FT                   RTKAP"
FT   gene            complement(647610..647912)
FT                   /locus_tag="Rpic_4341"
FT   CDS_pept        complement(647610..647912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4341"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rme:Rmet_4495 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4341"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29436"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIN5"
FT                   /protein_id="ACD29436.1"
FT                   /translation="MSIKEAIDFLKQRGRFDSYAALARAAGMDRIRMQNIRAGVASPSV
FT                   KEEFALAEACGMKPADAVALLEAAKDPESRSFWKKYSEVFRRPLNAPNRGRLLKA"
FT   gene            648051..648356
FT                   /locus_tag="Rpic_4342"
FT   CDS_pept        648051..648356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4342"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rme:Rmet_4494 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4342"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29437"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIN6"
FT                   /protein_id="ACD29437.1"
FT                   /translation="MSKYKAQLITINSQDWAFDGKTGTRHQAQLVITSAREVEGKQVEE
FT                   TFVARKNLPEQFLGTPPGEYLLELAPFADGKGMLDFRIVAMQPYKQMPQAKAAATA"
FT   gene            648416..648592
FT                   /locus_tag="Rpic_4343"
FT   CDS_pept        648416..648592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4343"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4343"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29438"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIN7"
FT                   /protein_id="ACD29438.1"
FT                   /translation="MVDPHDKKTRQLPLISRSRARLFDFLEYREWAFFHHGPQINFYGK
FT                   ACLHGLGGLMGVW"
FT   gene            648610..648915
FT                   /locus_tag="Rpic_4344"
FT   CDS_pept        648610..648915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4344"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4344"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29439"
FT                   /db_xref="GOA:B2UIN8"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIN8"
FT                   /protein_id="ACD29439.1"
FT                   /translation="MGQMGAWDAVGLVVSLACLCTVATGFVWFMHHMSPARVLDRLAQG
FT                   CGAAWLEHLRWTRKDFVSSLRMREEAYSELDGAKLDLADEFLRDDLHRLGGLAGAW"
FT   gene            648984..649229
FT                   /locus_tag="Rpic_4345"
FT   CDS_pept        648984..649229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4345"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4345"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29440"
FT                   /db_xref="GOA:B2UIN9"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIN9"
FT                   /protein_id="ACD29440.1"
FT                   /translation="MAQCVVWQAGALVATTDAPEQCQGFLLMQTNEYATAMTLGSAFEM
FT                   PTADQIGAAWSVGFCLPVLCYLIARSCRSITDVFER"
FT   gene            649234..649443
FT                   /locus_tag="Rpic_4346"
FT   CDS_pept        649234..649443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4346"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4346"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29441"
FT                   /db_xref="GOA:B2UIP0"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIP0"
FT                   /protein_id="ACD29441.1"
FT                   /translation="MKYVRRLGYALPLIAIGSQAHAAGLDLTPLTSGFDATPIVAGILA
FT                   AAGVYALVIFAKFAGKKVVGFFGS"
FT   sig_peptide     649234..649302
FT                   /locus_tag="Rpic_4346"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 23"
FT   gene            649516..651111
FT                   /locus_tag="Rpic_4347"
FT   CDS_pept        649516..651111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4347"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dme:Dmel_CG31439 CG31439"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4347"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29442"
FT                   /db_xref="GOA:B2UIP1"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIP1"
FT                   /protein_id="ACD29442.1"
FT                   /translation="MDALRSVVGAALRWCGHVGLWLLKRVLFVVAVVTALGLLGRSAHA
FT                   AGCTVPGQMCIQGNSMGVDVSVRQSGNGTPQTPSAGVMNVLVPITVGVVAVGAAAVAIP
FT                   AVGGIAIAGDAMASVGMTAIRGGIIGGVALTSLLNYLGGDMVMGPDGKVSKAQHNASQG
FT                   DSGFDGALWISGNKTGDSPVAACSAYVAVAYPGMSITGYGGNGYCQGTLPPGSSMSCGG
FT                   GVCNIQVGHAGGCVSGYVASGSGCAVDPSSPVTYAPASDADIQSAISSHPASWPSIYND
FT                   MNCGPTLALTNGSTSDPCYGLYSDSRTGFGVSFSTGGSSWTNNGCAVNSTSCPSATVTT
FT                   APTTDSSTKTNADGSKTTTTNTTTKTTTVTGTNDRTNPVEAQTTTTTQTSTTVTNPDGS
FT                   TTTTTTTTTDQASPATAGNANQQQKDQTPATTATFAGGDWKLYTPKEKTMAQVMQAFVS
FT                   RVQAMPWYTVMSNFFTVNVSGSCPHWVVPASRYTPPLDGTQFFCASWAMSLYALGGVVT
FT                   MLVAAWYAWRIAFL"
FT   gene            651127..651456
FT                   /locus_tag="Rpic_4348"
FT   CDS_pept        651127..651456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4348"
FT                   /product="minor coat protein"
FT                   /note="KEGG: xcb:XC_2118 minor coat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4348"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29443"
FT                   /db_xref="GOA:B2UIP2"
FT                   /db_xref="InterPro:IPR019670"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIP2"
FT                   /protein_id="ACD29443.1"
FT                   /translation="MFDAVINALSAFANWLLSGFVAVFVALWQIEEDLFIDGFDLLLNG
FT                   FSSVLSILPTPTFLTAVSLQSLFGQLGSDALFFVGQFRVGEGLALVGAAFAFRMARKVV
FT                   TLFQW"
FT   gene            651461..652792
FT                   /locus_tag="Rpic_4349"
FT   CDS_pept        651461..652792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4349"
FT                   /product="Zonular occludens toxin"
FT                   /note="PFAM: Zonular occludens toxin; KEGG: xcb:XC_2117 pI
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4349"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29444"
FT                   /db_xref="GOA:B2UIP3"
FT                   /db_xref="InterPro:IPR008900"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIP3"
FT                   /protein_id="ACD29444.1"
FT                   /translation="MFIFHEGLPRSGKSYEAMVKRIIPALLKGRKVYARLNGINHEKVA
FT                   EAAGMPVEQVRALLFEIPESKVLLWHTIVENDSLVILDEMQNFWPESVRNIPQDQLKAI
FT                   TEHGHRGLDIVGMGQLLKGKGGVNANWVNRCDQKIVFEKQNAQGRDDHYRWTSYKGKLE
FT                   NGRIKFVKIASEVEKYDPKYFGTYATRVEGAENAETYKDDRTNILRSRLFRLWVPLGVV
FT                   AFAVCLGYLWHLLRGGGMEKSLLKNQPQHNVVTTTSTVSTPASGVVATSAQPMQQPSQA
FT                   AATTQPAKADALADDYIVAITGKWRPRLSGLIVGGRKARVVVEWYDDGYRVRERLSAAQ
FT                   LEEFGWLVVRSAYGEHVVLSKQGTHIAVTAWPMEPYAAVSEVQQGEIRNAGRNVGFGGG
FT                   EAPVPYGDVRQVAAAGGGDDPSWNGYGADGLIRHHKPVHSILSN"
FT   gene            653239..654120
FT                   /locus_tag="Rpic_4350"
FT   CDS_pept        653239..654120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4350"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rme:Rmet_4488 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4350"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29445"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIP4"
FT                   /protein_id="ACD29445.1"
FT                   /translation="MRHDIVGERATFEKGYCYQEGIAIRHRVFPDGQVEVNGFPTTDWS
FT                   RCKAMQAMPKAKRGESENRDTNVESAARRAKQALRLKCKAIGADHMLTLTTRANIEDLD
FT                   EFHKLFKRWARIMSTSKRLNYVAVPERQERGAWHLHVAINGKPARWRAIRVWLRVVGGK
FT                   GEGYVHLRSPDGGHYGQGWEQHKLAGYISKYIGKDVGVAALNRKRYWASQGIDVPAKAT
FT                   YCTWMGYPSMYEVLKVVMADLQHQFGVHDVVARVSARDGAFWLSTGPRPGHAFAPPSPF
FT                   VTEYERFLGARS"
FT   gene            complement(654356..655039)
FT                   /locus_tag="Rpic_4351"
FT   CDS_pept        complement(654356..655039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4351"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4351"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29446"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIP5"
FT                   /protein_id="ACD29446.1"
FT                   /translation="MPRLSVSKASGWATGAALLCSVLAPAAAAGRPAGTFESVFQSGDE
FT                   PAALFYRAEFTGSDGVHVLQVWRDGQVRLRRKTDEVLDTYVVRNSADPLEYQMTVVDYR
FT                   KRITTRIDRNNLIRLGHFSDWFDLAHGLRHPVGEYRLAPTSAPAGAPIPASACRWYVLS
FT                   QGNTLNRICWSAREHLPMVIWSDAKASAVWRVTQVEHRPIGDDVFVLHDTGFVRNDANA
FT                   DIEGD"
FT   sig_peptide     complement(654953..655039)
FT                   /locus_tag="Rpic_4351"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.657 at
FT                   residue 29"
FT   gene            complement(655017..657194)
FT                   /locus_tag="Rpic_4352"
FT   CDS_pept        complement(655017..657194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4352"
FT                   /product="type I phosphodiesterase/nucleotide
FT                   pyrophosphatase"
FT                   /note="PFAM: type I phosphodiesterase/nucleotide
FT                   pyrophosphatase; KEGG: bbt:BBta_4913 putative membrane
FT                   protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4352"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29447"
FT                   /db_xref="GOA:B2UIP6"
FT                   /db_xref="InterPro:IPR002591"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIP6"
FT                   /protein_id="ACD29447.1"
FT                   /translation="MKHMYGLAAALAGSVLVAACGGDSVLSNGTSAAQSQPTRTIVMVW
FT                   DGLRPDSVNATDTPNLYALRQAGVNFSDNHSTYPTFTMMNGSSFATGAFPKTSGFYGNT
FT                   FWTPPQGATNSIPAGNLGTPNSTKTAAASADYVDPIFTEDYQVLTTLNNYYGGQLLLVK
FT                   SLFAAAQATGLTTATVGKSGAAFIQDLGQGGYFLDENTVQPRSLVTELQSAGYALPFNT
FT                   QFGYSGSNAVTLAATNGDPTARAGYITFNTTAYDSASGVTAVAARDSSDTTQGAPEDAA
FT                   NKYMLSVFTNYILPMKQPMLSLIWFRTPDNVEHGYGPGSANAIAGLRSQDQRLGELVSA
FT                   LKANNLYASTNLIVVSDHGHSSVSGPLSLYPLRAITPSGTAPGGTPVNGATSGTDAAAI
FT                   GAVSATGYSFSGDVRSADLLTYRGFKAYDGSGCTTSAMYGLQANGTPTVPVKVDTTGSL
FT                   CGTANTKYQAISASLATPVASFKVPAPGNLTANGIVVAANGGSDYFYVPSHDATTVQNL
FT                   VKVLQQREEYGAIFVDSRYGALPGTLPMSMVNLENAQRQNNGQPDVVVSFNWDDQVAIK
FT                   GMPGIEFESAGGQRGMHGSFGTTDVHNTLIASGPSFRSSTVVTNPTGNVDVAPTVAYLL
FT                   GLSMPQADGRILNEALLNPASPTAPSVKASTVNPVSPATGLSFEVPTDPTGATKDAALT
FT                   QGSYTINLAVKDLSVDGKTYRYFDYAKAVRQ"
FT   sig_peptide     complement(657135..657194)
FT                   /locus_tag="Rpic_4352"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.585 at
FT                   residue 20"
FT   gene            657655..658620
FT                   /locus_tag="Rpic_4353"
FT   CDS_pept        657655..658620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4353"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="PFAM: regulatory protein MerR; KEGG:
FT                   bvi:Bcep1808_5897 putative transcriptional regulator, MerR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4353"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29448"
FT                   /db_xref="GOA:B2UIP7"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIP7"
FT                   /protein_id="ACD29448.1"
FT                   /translation="MKRLYKSLAPRHYRSGEAAKLARMSASTLRIWERKYAVVAPPKSA
FT                   SGQRLYTEEDIERLRLIRGLVDSGHAIGAVASLNVESLRALVRSSGTVHAAKGEPISLL
FT                   MVGPVPIAIANSASDSMYVCGHPGSLEEAFRDARAGLRADALLVAVPSLTEDTILRIVA
FT                   LAEAAHAKAISVIFTSGTPRAIERASLGGLRVVPQSDAEVRPESLIAELVDWATALRQA
FT                   DILNADTRSRAARRFDDKALAAFAGLTSTIQCECPRHLAELVIQLSAFQRYSDACLSRS
FT                   PRDALLHRRLGNVANRAVQLLETALAEVVRHEDLLNSAKR"
FT   gene            658733..659485
FT                   /locus_tag="Rpic_4354"
FT   CDS_pept        658733..659485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4354"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; KR domain protein;
FT                   KEGG: bmu:Bmul_5842 short-chain dehydrogenase/reductase
FT                   SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4354"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29449"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIP8"
FT                   /protein_id="ACD29449.1"
FT                   /translation="MGFVWITGASGAVGSALARRLNSSGIPLVLTARDQKKLEQLADAL
FT                   QPASVLVCPADVTDRSSAQLAIEAGVTRFGAPAGLAHCVGSIIVKPLHLTSEDDLKQAL
FT                   DANFFSAWNALRLFVQQAVHQKVHASAVLIGSVAATAGFPNHEAIASAKAAVAALAQSA
FT                   AATYADRNIRVNCIHPGLTSSAMSSRLTSVPTVAERLAKANPLGRLGQGDDTAALAEFL
FT                   LSPAASWITGQQIGVDGGHGRLVTPPKS"
FT   gene            659482..659937
FT                   /locus_tag="Rpic_4355"
FT   CDS_pept        659482..659937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4355"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bmu:Bmul_5841 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4355"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29450"
FT                   /db_xref="GOA:B2UIP9"
FT                   /db_xref="InterPro:IPR021836"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIP9"
FT                   /protein_id="ACD29450.1"
FT                   /translation="MSTHTTSVRGLAVLLGITGLIPFIVLTGLCLGDTSSRGEYQRSLL
FT                   VYATSITSFVGAVHWGLALRAETATRMHTLQLAWSIVPSLAAWAVAVSSEPPAALVRMA
FT                   IVLAICWLTDAGFARCGAIPAWYFRLRSVLTLVATASLALSGFASAR"
FT   sig_peptide     659482..659580
FT                   /locus_tag="Rpic_4355"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.655) with cleavage site probability 0.552 at
FT                   residue 33"
FT   gene            659967..660443
FT                   /locus_tag="Rpic_4356"
FT   CDS_pept        659967..660443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4356"
FT                   /product="succinate dehydrogenase, cytochrome b556 subunit"
FT                   /note="TIGRFAM: succinate dehydrogenase, cytochrome b556
FT                   subunit; PFAM: succinate dehydrogenase cytochrome b
FT                   subunit; KEGG: rso:RSc1996 putative transmembrane succinate
FT                   dehydrogenase (cytochrome b-556 subunit) oxidoreductase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4356"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29451"
FT                   /db_xref="GOA:B2UIQ0"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR014314"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIQ0"
FT                   /protein_id="ACD29451.1"
FT                   /translation="MLRQTKQSHLLRNLFEVCLEDHVAIDSKNGAVIYRNIGLGDIARY
FT                   RLPWAGKVSILHRASGALMFLLLPFVLYLFEQSLTSEISFAKFSALLSNGFAKVVVLAL
FT                   IWAYLHHFCAGVRYLILDLHIGIDKASASKSAVSVLIVSLLLTVVFGAKLFGLF"
FT   gene            660454..660819
FT                   /locus_tag="Rpic_4357"
FT   CDS_pept        660454..660819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4357"
FT                   /product="succinate dehydrogenase, hydrophobic membrane
FT                   anchor protein"
FT                   /note="TIGRFAM: succinate dehydrogenase, hydrophobic
FT                   membrane anchor protein; PFAM: succinate dehydrogenase
FT                   cytochrome b subunit; KEGG: rso:RSc1995 putative
FT                   transmembrane succinate dehydrogenase (hydrophobic membrane
FT                   anchor subunit) oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4357"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29452"
FT                   /db_xref="GOA:B2U702"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR014312"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:B2U702"
FT                   /protein_id="ACD29452.1"
FT                   /translation="MANNNIGPKRLVVGAHYGLKDFLAQRVTAVIMAVYTVVLLAAFLL
FT                   SKDTSYQSWAGLFSNQWMKMLTFLAFVSLTYHAWIGVRDIWMDYVKPVAVRLTLQVLTI
FT                   LWLVGCAGYAAQILWRV"
FT   gene            660823..662601
FT                   /locus_tag="Rpic_4358"
FT   CDS_pept        660823..662601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4358"
FT                   /product="succinate dehydrogenase, flavoprotein subunit"
FT                   /EC_number="1.3.99.1"
FT                   /note="KEGG: rso:RSc1994 succinate dehydrogenase
FT                   flavoprotein subunit; TIGRFAM: succinate dehydrogenase,
FT                   flavoprotein subunit; succinate dehydrogenase or fumarate
FT                   reductase, flavoprotein subunit; PFAM: fumarate
FT                   reductase/succinate dehydrogenase flavoprotein domain
FT                   protein; FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4358"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29453"
FT                   /db_xref="GOA:B2U701"
FT                   /db_xref="InterPro:IPR003952"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR011281"
FT                   /db_xref="InterPro:IPR014006"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:B2U701"
FT                   /protein_id="ACD29453.1"
FT                   /translation="MVAVKTGLPRRKFDVVIVGAGGSGMRASLQLAEAGLSVAVLSKVF
FT                   PTRSHTVAAQGGIGASLGNMSEDNWHYHFYDTVKGSDWLGDQDAIEFMCRQAPNVVYEL
FT                   EHFGMPFDRNADGTIYQRPFGGHTSNYGEKPVQRACAAADRTGHALLHTLYQRNVKAKT
FT                   HFFVEWMALDLIRDQDGDVLGVTALEMETGEVYILEAKTTLFATGGAGRIYAASTNAFI
FT                   NTGDGLGMAARAGVPLEDMEFWQFHPTGVAGAGVLITEGVRGEGGILRNKDGERFMERY
FT                   APTLKDLAPRDFVSRSMDQEIKEGRGCGPNGDYVLLDLTHVGAETIMKRLPSIREIGLK
FT                   FANVDAIKEPIPVVPTIHYQMGGIPTNYHGQVVVPKNGNPNEVINGFYAIGECSCVSVH
FT                   GANRLGTNSLLDLVVFGRSAGNHIIAQNLKNREHKPLPADAADRALSRLAKLDSSSSGE
FT                   YAQDVANDIRRNMQSHAGVFRTQKLMDEGVERILEVAERAGNIHLKDKSKVFNTARVEA
FT                   LEVANLVEVAKATMVSAAARKESRGAHAHSDFPNRDDENWMKHSLWYSEGNRLDYKPVQ
FT                   LKPLSVESVPPKARTF"
FT   gene            662624..663325
FT                   /locus_tag="Rpic_4359"
FT   CDS_pept        662624..663325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4359"
FT                   /product="succinate dehydrogenase and fumarate reductase
FT                   iron-sulfur protein"
FT                   /EC_number="1.3.5.1"
FT                   /note="KEGG: rso:RSc1993 succinate dehydrogenase
FT                   iron-sulfur subunit; TIGRFAM: succinate dehydrogenase and
FT                   fumarate reductase iron-sulfur protein; PFAM: ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4359"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29454"
FT                   /db_xref="GOA:B2U700"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:B2U700"
FT                   /protein_id="ACD29454.1"
FT                   /translation="MKRIFEVYRYDPDKDAAPRMQTYEVELDGHERMLLDALVKLKKLD
FT                   ESIAFRRSCREGVCGSDAMNINGKNGLACLTNMRELPEKIVLRPLPGLPVVRDLIVDMT
FT                   QFFNQYHSIKPYLINDEPPPEKERLQSPEEREELDGLYECILCASCSTSCPSFWWNPDK
FT                   FVGPAGLLQAYRFIADSRDQATSERLDNLEDPYRLFRCHTIMNCVDVCPKGLNPTKAIG
FT                   KIKELMVRRAV"
FT   gene            complement(663476..664207)
FT                   /locus_tag="Rpic_4360"
FT   CDS_pept        complement(663476..664207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4360"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_C6587 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4360"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29455"
FT                   /db_xref="GOA:B2UIQ4"
FT                   /db_xref="InterPro:IPR018764"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIQ4"
FT                   /protein_id="ACD29455.1"
FT                   /translation="MTPDRDLECAEYVLGLLDTEERSAVERALHEDAALQAAVDAWESR
FT                   LSPLGEAVTSRQPPARVWRRIEADLGLVERTGAPTTLPAGAQMRRFWNSIRFWRTLALA
FT                   TTFAMVAVVAVNLFLAAPTEAPSGLKSAYAAAAIADDDGVPHWTATVDKAKREIIVVPA
FT                   VAFQVSDSASTELWLIPENSKPISLGVFPSNRSTSIVLSKENAAKLNARSALAVSVEPK
FT                   GGSPTGQATGPVVGKGAMHET"
FT   gene            complement(664204..664836)
FT                   /locus_tag="Rpic_4361"
FT   CDS_pept        complement(664204..664836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4361"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: sigma-70 region 2 domain protein; sigma-70
FT                   region 4 domain protein; Sigma-70 region 4 type 2; KEGG:
FT                   bur:Bcep18194_C6588 sigma-24 (FecI-like)"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4361"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29456"
FT                   /db_xref="GOA:B2UIQ5"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIQ5"
FT                   /protein_id="ACD29456.1"
FT                   /translation="MGNRGTRNHMHVVGASLPEAEGTISARQEAVRERLVELLKQTGEG
FT                   SKSAFAELYTLTSPKLYSLAYGILRSSGEAEDVLQDIYVAIWQRADQFDPHRGTAMTWL
FT                   ISLARNKSIDRLRQSRETTGDEADWGQIVDERATPSEVADMSQEHRRLESCIRKLEGRQ
FT                   RGVIVEAFYTGATYAELAARLSVPVGTMKSWVRRSLLQLKMCLEQQS"
FT   gene            complement(664979..665563)
FT                   /locus_tag="Rpic_4362"
FT   CDS_pept        complement(664979..665563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4362"
FT                   /product="beta-Ig-H3/fasciclin"
FT                   /note="PFAM: beta-Ig-H3/fasciclin; KEGG: aav:Aave_3256
FT                   beta-Ig-H3/fasciclin"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4362"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29457"
FT                   /db_xref="InterPro:IPR000782"
FT                   /db_xref="InterPro:IPR036378"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIQ6"
FT                   /protein_id="ACD29457.1"
FT                   /translation="MKRYQLAGLSGVLVSFAIISGGYASVAAAAMGDSEATTMVGGAPM
FT                   YPSKNIIQNAVNSKDHTTLVAAVKAGGLVDTLSGAGPFTVFAPTNEAFAALPAGTVDKL
FT                   LKPESKPTLVKVLTYHVVPGRLTAQDLMKAVADGGGKAMLKTVEGDPLTVMQKGDHLTV
FT                   TDDKGGVAMVTIGNVYQSNGVIHVVDKVLMP"
FT   sig_peptide     complement(665474..665563)
FT                   /locus_tag="Rpic_4362"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.710 at
FT                   residue 30"
FT   gene            666070..666651
FT                   /locus_tag="Rpic_4363"
FT   CDS_pept        666070..666651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4363"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pna:Pnap_3162 globin"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4363"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29458"
FT                   /db_xref="GOA:B2UIQ7"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIQ7"
FT                   /protein_id="ACD29458.1"
FT                   /translation="MKRALLLVLTLTTATLSACGGGDDTPMAMASTASTAQFPQNADMW
FT                   AGLGGDASAPAAISKVVDDAVSGLLADPKEAPYFANIGKPGHDTVGRLKACLNLQFKAL
FT                   FGGPFSYPGQVAADGTTVMCDDMATAHSDVGIPGCVFDQFITDAAAVMKTDGVPDGYIS
FT                   RVAPVLTGLKSTIVSTMPQYLGPNTAQNCK"
FT   sig_peptide     666070..666132
FT                   /locus_tag="Rpic_4363"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.508 at
FT                   residue 21"
FT   gene            666648..667334
FT                   /locus_tag="Rpic_4364"
FT   CDS_pept        666648..667334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4364"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4364"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29459"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIQ8"
FT                   /protein_id="ACD29459.1"
FT                   /translation="MSPRSGLRRYALPSIAAFTVAIGLVGAMHLKAARPVLAMLGVPCP
FT                   VDNTTAEQVSALRASGLAHLRAVKLAPARPVPGGFVLDATTPEEARQWAHENRIACEDV
FT                   KHGYSYLRCRGVDANKLGLAGPPVSELWLSFGPNGHLIGVDVYRRGMSANDTTAAWDGA
FT                   SYALRDVLGVPTSTMGDASPAVLGGSPLQTARLQWRFSDYVAIVTASNLPYAGLAVREQ
FT                   YMSSRL"
FT   sig_peptide     666648..666746
FT                   /locus_tag="Rpic_4364"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.676) with cleavage site probability 0.555 at
FT                   residue 33"
FT   gene            667604..668074
FT                   /locus_tag="Rpic_4365"
FT   CDS_pept        667604..668074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4365"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: reh:H16_A1984 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4365"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29460"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIQ9"
FT                   /protein_id="ACD29460.1"
FT                   /translation="MANSRRTLIATASTALLLAWSCAAPAAGPSKEKKASSPAATTVQQ
FT                   GNADFDAQIAHLRAIRERMARADTPEERQALMNERMRVMQDMMAGMRQMGDRQPATRRG
FT                   QATQMATCRGMMERNTAVMQEMMQMMMDDQGTGMGMGMGRGMGPGTGGMMQK"
FT   sig_peptide     667604..667687
FT                   /locus_tag="Rpic_4365"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.883 at
FT                   residue 28"
FT   gene            complement(668002..668181)
FT                   /locus_tag="Rpic_4366"
FT   CDS_pept        complement(668002..668181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4366"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4366"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29461"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIR0"
FT                   /protein_id="ACD29461.1"
FT                   /translation="MLTRRRRSALDTAETELTLIASVAVMGDSSKLACRIYFCIMPPVP
FT                   GPIPRPMPMPIPVP"
FT   gene            complement(668197..669372)
FT                   /locus_tag="Rpic_4367"
FT   CDS_pept        complement(668197..669372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4367"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; KEGG: bte:BTH_II0064 efflux transporter, RND
FT                   family, MFP subunit subfamily, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4367"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29462"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIR1"
FT                   /protein_id="ACD29462.1"
FT                   /translation="MKRGGLRKTLALASAALALALALTYALWPVPAAVDTGRVTRGPLQ
FT                   VTIDEDGEIRAHDRYVITAPITGRLLRVELHEGDQIKAGQVIAVLVPVPMTPGERAAQR
FT                   ARVDAAEAIFSEAQARAAHARADYDQARRNLDRGETLLSSGAMSRQEVEQMRTMAASSA
FT                   SDLTAARARETSAAADVRVAMANLKALEAGQPVEVRAPTNTVLLRIEQQSERVVLAGAA
FT                   LMLLADPSRYELVVDVLSTDAVKISPGMRVSVVEWGGPWAVNATVRTVGPGAFTKVSAL
FT                   GVEEQRVHIVADLVDPPGRLNDGYRVQGRIVIWEQPDVLKLPIGALFRCGGNWCTFIVK
FT                   NGKAVQRIIQIGQRNAEEAQVLDGLQDHDTVVVYPPTTLSDSMSVRPLNAR"
FT   sig_peptide     complement(669268..669372)
FT                   /locus_tag="Rpic_4367"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.469 at
FT                   residue 35"
FT   gene            complement(669369..671738)
FT                   /locus_tag="Rpic_4368"
FT   CDS_pept        complement(669369..671738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4368"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   bte:BTH_II0063 permease, putative domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4368"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29463"
FT                   /db_xref="GOA:B2UIR2"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIR2"
FT                   /protein_id="ACD29463.1"
FT                   /translation="MVSMLVRLLWRDLWQMRAQVLAAVLVVGCGVATFVAMRSTYLALL
FT                   NAQQDYYASYRFADLFVHLKRAPLEIASRVAALPGVSHVDARVVSDVTVDIPGLSEPAT
FT                   ARLVSIPELGWPALNLLHLQSGRYIAPGREDEVLVSAAFADANSLRAGEYFSAILNGRW
FT                   KRLHIVGLAISPEYVYEAGAGSIFPDNRHYGIVWMGVNAVSAAFRMDGAFNDLVLSLDG
FT                   SVPAPHVIAQIDRTLLPYGGLGTISRDHQISNRFITDEIAQNRVTATYVPAIFFLVAMF
FT                   LLQNVLTRLIDTQRSQIGLMKAFGYGDLSVGLHYLQLGCVVAAAGTVVGIGGGLALGTY
FT                   LTDLYARYYRLAHLEFRADFSTMAWAFFISFGTAVGGAIASTAKAMRLMPVEALRAVVP
FT                   PAFSVGWVERAGIYRQMSVVWRMIARNIARQPVKSLLGSLAIACASAILVVGGFFFDSI
FT                   DFLFDTQFQQIERQDVTVAFSQPLSHRAIYAIERLPGVLKVEGFRDVPVKLSAGYRSRR
FT                   VSLSGIAQKADLHRLIDDEGRPLHMPPDGLVVSARLAAVLGIRPGDPITIEVLEGERQT
FT                   RQVTLMRLSGDLVGVAAYMDQHALAKLLGESGNWSGARLSVDQHAAAHLYATLKRLPAV
FT                   NAVAVRQSVIASFRKIMDESVRLSTSINFAFACVIAFGVAFNGMRIAYSERVQQLASLR
FT                   VLGFTQAEVAWILLGEQFVLTAIALPAGLLLGYGVCGLLSTRLATDLYRLPLVVHAATF
FT                   AYAFVVAGGAVVCSGLLVAAKIRRLDIVAVLKARES"
FT   gene            complement(671732..672436)
FT                   /locus_tag="Rpic_4369"
FT   CDS_pept        complement(671732..672436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4369"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bte:BTH_II0062 ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4369"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29464"
FT                   /db_xref="GOA:B2UIR3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIR3"
FT                   /protein_id="ACD29464.1"
FT                   /translation="METVFNIQAVSKVYPMGSVSVRALEHVDLELGPGEIVVLLGASGS
FT                   GKSTLLNLMGGLDTPTSGSIVYRDHDLSHAGDRGLTRFRREHVGFVFQFYNLIPSLTAR
FT                   ENVALVTDIAEHPLDPTEALNRVGIGTLADNFPSQMSGGEQQRVAIARAVAKRPDVLLC
FT                   DEPTGALDFRTGQLVLEVLEQVNREFGTLIVIVTHNAVIADMADRVVRMSSGTIVEHRR
FT                   NGQRARVGDLAW"
FT   gene            complement(672451..672741)
FT                   /locus_tag="Rpic_4370"
FT   CDS_pept        complement(672451..672741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4370"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rso:RS00827 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4370"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29465"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIR4"
FT                   /protein_id="ACD29465.1"
FT                   /translation="MSAWAIEQHRGCSIHILVVVGRCDGFKYAYTGFVCSPKQAALEYP
FT                   KLERFHHVSPDFDSVDVAIAAGMQVGRAIAERWTSHSAQHQTSERPTRPPS"
FT   gene            complement(672975..673619)
FT                   /locus_tag="Rpic_4371"
FT   CDS_pept        complement(672975..673619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4371"
FT                   /product="putative transmembrane protein"
FT                   /note="KEGG: rso:RSc0198 probable transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4371"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29466"
FT                   /db_xref="GOA:B2UIR5"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIR5"
FT                   /protein_id="ACD29466.1"
FT                   /translation="MTNLLALFATILLLNVMPAFAPPTWMVMSWVGFSRPDANPVLLAG
FT                   IAACAATLGRLVLARLSCTLVRNRWMREADRQNIDVVRAWLEDRKGMTVGLMLAYAFSP
FT                   FPSNYIFIAYGLTGMRLWLIGLPFFVGRWISYLTWTRIAQIGARYLDVETEIDGAYMGV
FT                   YFVVSQVVFLALVYGFAKLDWQHLLQTKHLRWRRRESIASSAKDTRTKVQR"
FT   gene            complement(673625..675916)
FT                   /locus_tag="Rpic_4372"
FT   CDS_pept        complement(673625..675916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4372"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /note="TIGRFAM: ATPase, P-type (transporting), HAD
FT                   superfamily, subfamily IC; cadmium-translocating P-type
FT                   ATPase; heavy metal translocating P-type ATPase; PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase; E1-E2
FT                   ATPase-associated domain protein; Hemerythrin HHE cation
FT                   binding domain protein; KEGG: reu:Reut_A1234 ATPase, E1-E2
FT                   type:heavy metal-(Cd/Co/Hg/Pb/Zn)-translocating P-type
FT                   ATPase:heavy metal translocating P-type ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4372"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29467"
FT                   /db_xref="GOA:B2UIR6"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIR6"
FT                   /protein_id="ACD29467.1"
FT                   /translation="MHSTRLLANVALLAVSALTLAAGLWARYLGADVLAWQLWLIGVVP
FT                   NWLTLVVTIVRSLMRRQAGVDVLAVISISFALLSGEVLVAAVIALMLATGRTLEDFAQA
FT                   RAQREMTALLGHAPKRANRFADGQWHQVSLEKVQAGDRLLVRHGEVVPVDGTLSGPADL
FT                   DESTLTGESLTRHRLTADAICSGVLNVGAAFEMIASASAEKSTFAGVVRLVSAAQSERS
FT                   PSVRLADRYAFAFGGVAVLLAGTSWILTGDSARCLAVLVVATPCPLILAVPVAIVSGLS
FT                   RCAKRGVLVKGGGALERLALADTLFFDKTGTLTSGFARLVDVECAPHYASDVVLGLAGS
FT                   IAQASNHVTAEAVAKAAREQGAKLRLPSGVVESPGAGVCGRVDGHVVSIGSLPYVLGSS
FT                   AEPSWVEAFAKRVSYAGASAVFVGVNGELVGALQLIDRVRLEAPRALRLLRREGIKRQA
FT                   MLTGDRADVAESVGSMLGVTEVHAALSPAAKLAVIRGARADGKVIMVGDGVNDAPALAA
FT                   ADIGVAMGARGAAASSEAADIVLLVDRLDRLVDAVRIAHRTRSVALQSVMIGMSLSLAA
FT                   MVVAALGHLPPLAGAMLQELIDVLAIASALRALLPTPDEATRSLVCADVERLKAEHAEL
FT                   EPILSRIRMVADSLPHMGGSAAKGALLSLNQSLADVLVPHERRDDTQLYPDVARLLGGD
FT                   DPMAAMSAMHREIFRVTNLLGRIVADVSADGPDAAVTQELQRLLYGLDAILRLHCAQED
FT                   ELFHVLGGEA"
FT   sig_peptide     complement(675851..675916)
FT                   /locus_tag="Rpic_4372"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.840 at
FT                   residue 22"
FT   gene            complement(675952..676476)
FT                   /locus_tag="Rpic_4373"
FT   CDS_pept        complement(675952..676476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4373"
FT                   /product="cytochrome B561"
FT                   /note="PFAM: cytochrome B561; KEGG: rso:RSc0199 probable
FT                   cytochrome b561 cytochrome transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4373"
FT