(data stored in ACNUC7421 zone)

EMBL: CP001074

ID   CP001074; SV 1; circular; genomic DNA; STD; PRO; 4513324 BP.
XX
AC   CP001074;
XX
PR   Project:PRJNA28021;
XX
DT   20-JUN-2008 (Rel. 96, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 5)
XX
DE   Rhizobium etli CIAT 652, complete genome.
XX
KW   .
XX
OS   Rhizobium etli CIAT 652
OC   Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales; Rhizobiaceae;
OC   Rhizobium/Agrobacterium group; Rhizobium.
XX
RN   [1]
RP   1-4513324
RA   Gonzalez V., Acosta J.L., Santamaria R.I., Bustos P.,
RA   Hernandez-Gonzalez I.L., Fernandez J.L., Diaz R., Flores M., Mora J.,
RA   Palacios R., Davila G.;
RT   "Genome diversity and DNA divergence of Rhizobium etli";
RL   Unpublished.
XX
RN   [2]
RP   1-4513324
RA   Gonzalez V., Acosta J.L., Santamaria R.I., Bustos P.,
RA   Hernandez-Gonzalez I.L., Fernandez J.L., Diaz R., Flores M., Mora J.,
RA   Palacios R., Davila G.;
RT   ;
RL   Submitted (24-APR-2008) to the INSDC.
RL   Genomica Evolutiva, Centro de Ciencias Genomicas, UNAM, Av Universidad s/n,
RL   Cuernavaca, Morelos 62210, Mexico
XX
DR   MD5; efb006f77b9d56e026d336c1135ed749.
DR   BioSample; SAMN02603107.
DR   EnsemblGenomes-Gn; EBG00001162268.
DR   EnsemblGenomes-Gn; EBG00001162269.
DR   EnsemblGenomes-Gn; EBG00001162270.
DR   EnsemblGenomes-Gn; EBG00001162271.
DR   EnsemblGenomes-Gn; EBG00001162272.
DR   EnsemblGenomes-Gn; EBG00001162273.
DR   EnsemblGenomes-Gn; EBG00001162274.
DR   EnsemblGenomes-Gn; EBG00001162275.
DR   EnsemblGenomes-Gn; EBG00001162276.
DR   EnsemblGenomes-Gn; EBG00001162277.
DR   EnsemblGenomes-Gn; EBG00001162278.
DR   EnsemblGenomes-Gn; EBG00001162279.
DR   EnsemblGenomes-Gn; EBG00001162280.
DR   EnsemblGenomes-Gn; EBG00001162281.
DR   EnsemblGenomes-Gn; EBG00001162282.
DR   EnsemblGenomes-Gn; EBG00001162283.
DR   EnsemblGenomes-Gn; EBG00001162284.
DR   EnsemblGenomes-Gn; EBG00001162285.
DR   EnsemblGenomes-Gn; EBG00001162286.
DR   EnsemblGenomes-Gn; EBG00001162287.
DR   EnsemblGenomes-Gn; EBG00001162288.
DR   EnsemblGenomes-Gn; EBG00001162289.
DR   EnsemblGenomes-Gn; EBG00001162290.
DR   EnsemblGenomes-Gn; EBG00001162291.
DR   EnsemblGenomes-Gn; EBG00001162292.
DR   EnsemblGenomes-Gn; EBG00001162293.
DR   EnsemblGenomes-Gn; EBG00001162294.
DR   EnsemblGenomes-Gn; EBG00001162295.
DR   EnsemblGenomes-Gn; EBG00001162296.
DR   EnsemblGenomes-Gn; EBG00001162297.
DR   EnsemblGenomes-Gn; EBG00001162298.
DR   EnsemblGenomes-Gn; EBG00001162299.
DR   EnsemblGenomes-Gn; EBG00001162300.
DR   EnsemblGenomes-Gn; EBG00001162301.
DR   EnsemblGenomes-Gn; EBG00001162302.
DR   EnsemblGenomes-Gn; EBG00001162303.
DR   EnsemblGenomes-Gn; EBG00001162304.
DR   EnsemblGenomes-Gn; EBG00001162305.
DR   EnsemblGenomes-Gn; EBG00001162306.
DR   EnsemblGenomes-Gn; EBG00001162307.
DR   EnsemblGenomes-Gn; EBG00001162308.
DR   EnsemblGenomes-Gn; EBG00001162309.
DR   EnsemblGenomes-Gn; EBG00001162310.
DR   EnsemblGenomes-Gn; EBG00001162311.
DR   EnsemblGenomes-Gn; EBG00001162312.
DR   EnsemblGenomes-Gn; EBG00001162313.
DR   EnsemblGenomes-Gn; EBG00001162314.
DR   EnsemblGenomes-Gn; EBG00001162315.
DR   EnsemblGenomes-Gn; EBG00001162316.
DR   EnsemblGenomes-Gn; EBG00001162317.
DR   EnsemblGenomes-Gn; EBG00001162318.
DR   EnsemblGenomes-Gn; EBG00001162319.
DR   EnsemblGenomes-Gn; EBG00001162320.
DR   EnsemblGenomes-Gn; EBG00001162321.
DR   EnsemblGenomes-Gn; EBG00001162322.
DR   EnsemblGenomes-Gn; EBG00001162323.
DR   EnsemblGenomes-Gn; EBG00001162324.
DR   EnsemblGenomes-Gn; EBG00001162325.
DR   EnsemblGenomes-Gn; EBG00001162326.
DR   EnsemblGenomes-Gn; EBG00001162327.
DR   EnsemblGenomes-Gn; EBG00001162328.
DR   EnsemblGenomes-Gn; EBG00001162329.
DR   EnsemblGenomes-Gn; EBG00001162330.
DR   EnsemblGenomes-Gn; EBG00001162331.
DR   EnsemblGenomes-Gn; EBG00001162332.
DR   EnsemblGenomes-Gn; EBG00001162333.
DR   EnsemblGenomes-Gn; EBG00001162334.
DR   EnsemblGenomes-Gn; EBG00001162335.
DR   EnsemblGenomes-Gn; EBG00001162336.
DR   EnsemblGenomes-Gn; EBG00001162337.
DR   EnsemblGenomes-Gn; EBG00001162338.
DR   EnsemblGenomes-Gn; EBG00001162339.
DR   EnsemblGenomes-Gn; EBG00001162340.
DR   EnsemblGenomes-Gn; EBG00001162341.
DR   EnsemblGenomes-Gn; EBG00001162342.
DR   EnsemblGenomes-Gn; EBG00001162343.
DR   EnsemblGenomes-Gn; EBG00001162344.
DR   EnsemblGenomes-Gn; EBG00001162345.
DR   EnsemblGenomes-Gn; EBG00001162346.
DR   EnsemblGenomes-Gn; EBG00001162347.
DR   EnsemblGenomes-Gn; EBG00001162348.
DR   EnsemblGenomes-Gn; EBG00001162349.
DR   EnsemblGenomes-Gn; EBG00001162350.
DR   EnsemblGenomes-Gn; EBG00001162351.
DR   EnsemblGenomes-Gn; EBG00001162352.
DR   EnsemblGenomes-Gn; EBG00001162353.
DR   EnsemblGenomes-Gn; EBG00001162354.
DR   EnsemblGenomes-Gn; EBG00001162355.
DR   EnsemblGenomes-Gn; EBG00001162356.
DR   EnsemblGenomes-Gn; EBG00001162357.
DR   EnsemblGenomes-Gn; EBG00001162358.
DR   EnsemblGenomes-Gn; EBG00001162359.
DR   EnsemblGenomes-Gn; RHECIAT_CH0000062.
DR   EnsemblGenomes-Gn; RHECIAT_CH0000063.
DR   EnsemblGenomes-Gn; RHECIAT_CH0000064.
DR   EnsemblGenomes-Gn; RHECIAT_CH0000065.
DR   EnsemblGenomes-Gn; RHECIAT_CH0000066.
DR   EnsemblGenomes-Gn; RHECIAT_CH0000067.
DR   EnsemblGenomes-Gn; RHECIAT_CH0000104.
DR   EnsemblGenomes-Gn; RHECIAT_CH0000229.
DR   EnsemblGenomes-Gn; RHECIAT_CH0000275.
DR   EnsemblGenomes-Gn; RHECIAT_CH0000483.
DR   EnsemblGenomes-Gn; RHECIAT_CH0000577.
DR   EnsemblGenomes-Gn; RHECIAT_CH0000598.
DR   EnsemblGenomes-Gn; RHECIAT_CH0000652.
DR   EnsemblGenomes-Gn; RHECIAT_CH0000662.
DR   EnsemblGenomes-Gn; RHECIAT_CH0000806.
DR   EnsemblGenomes-Gn; RHECIAT_CH0000861.
DR   EnsemblGenomes-Gn; RHECIAT_CH0000873.
DR   EnsemblGenomes-Gn; RHECIAT_CH0001111.
DR   EnsemblGenomes-Gn; RHECIAT_CH0001113.
DR   EnsemblGenomes-Gn; RHECIAT_CH0001127.
DR   EnsemblGenomes-Gn; RHECIAT_CH0001138.
DR   EnsemblGenomes-Gn; RHECIAT_CH0001360.
DR   EnsemblGenomes-Gn; RHECIAT_CH0001445.
DR   EnsemblGenomes-Gn; RHECIAT_CH0001485.
DR   EnsemblGenomes-Gn; RHECIAT_CH0001615.
DR   EnsemblGenomes-Gn; RHECIAT_CH0001671.
DR   EnsemblGenomes-Gn; RHECIAT_CH0001673.
DR   EnsemblGenomes-Gn; RHECIAT_CH0001674.
DR   EnsemblGenomes-Gn; RHECIAT_CH0001725.
DR   EnsemblGenomes-Gn; RHECIAT_CH0001730.
DR   EnsemblGenomes-Gn; RHECIAT_CH0001731.
DR   EnsemblGenomes-Gn; RHECIAT_CH0001734.
DR   EnsemblGenomes-Gn; RHECIAT_CH0001843.
DR   EnsemblGenomes-Gn; RHECIAT_CH0001890.
DR   EnsemblGenomes-Gn; RHECIAT_CH0001894.
DR   EnsemblGenomes-Gn; RHECIAT_CH0001928.
DR   EnsemblGenomes-Gn; RHECIAT_CH0001967.
DR   EnsemblGenomes-Gn; RHECIAT_CH0001968.
DR   EnsemblGenomes-Gn; RHECIAT_CH0001969.
DR   EnsemblGenomes-Gn; RHECIAT_CH0001974.
DR   EnsemblGenomes-Gn; RHECIAT_CH0001977.
DR   EnsemblGenomes-Gn; RHECIAT_CH0002040.
DR   EnsemblGenomes-Gn; RHECIAT_CH0002078.
DR   EnsemblGenomes-Gn; RHECIAT_CH0002114.
DR   EnsemblGenomes-Gn; RHECIAT_CH0002190.
DR   EnsemblGenomes-Gn; RHECIAT_CH0002231.
DR   EnsemblGenomes-Gn; RHECIAT_CH0002249.
DR   EnsemblGenomes-Gn; RHECIAT_CH0002332.
DR   EnsemblGenomes-Gn; RHECIAT_CH0002418.
DR   EnsemblGenomes-Gn; RHECIAT_CH0002464.
DR   EnsemblGenomes-Gn; RHECIAT_CH0002761.
DR   EnsemblGenomes-Gn; RHECIAT_CH0002862.
DR   EnsemblGenomes-Gn; RHECIAT_CH0002935.
DR   EnsemblGenomes-Gn; RHECIAT_CH0003076.
DR   EnsemblGenomes-Gn; RHECIAT_CH0003396.
DR   EnsemblGenomes-Gn; RHECIAT_CH0003502.
DR   EnsemblGenomes-Gn; RHECIAT_CH0003592.
DR   EnsemblGenomes-Gn; RHECIAT_CH0003642.
DR   EnsemblGenomes-Gn; RHECIAT_CH0003643.
DR   EnsemblGenomes-Gn; RHECIAT_CH0003644.
DR   EnsemblGenomes-Gn; RHECIAT_CH0003645.
DR   EnsemblGenomes-Gn; RHECIAT_CH0003646.
DR   EnsemblGenomes-Gn; RHECIAT_CH0003647.
DR   EnsemblGenomes-Gn; RHECIAT_CH0003689.
DR   EnsemblGenomes-Gn; RHECIAT_CH0003839.
DR   EnsemblGenomes-Gn; RHECIAT_CH0004014.
DR   EnsemblGenomes-Gn; RHECIAT_CH0004015.
DR   EnsemblGenomes-Gn; RHECIAT_CH0004016.
DR   EnsemblGenomes-Gn; RHECIAT_CH0004017.
DR   EnsemblGenomes-Gn; RHECIAT_CH0004018.
DR   EnsemblGenomes-Gn; RHECIAT_CH0004019.
DR   EnsemblGenomes-Gn; RHECIAT_CH0004047.
DR   EnsemblGenomes-Gn; RHECIAT_CH0004105.
DR   EnsemblGenomes-Gn; RHECIAT_CH0004264.
DR   EnsemblGenomes-Gn; RHECIAT_CH0004350.
DR   EnsemblGenomes-Tr; EBT00001751184.
DR   EnsemblGenomes-Tr; EBT00001751185.
DR   EnsemblGenomes-Tr; EBT00001751186.
DR   EnsemblGenomes-Tr; EBT00001751187.
DR   EnsemblGenomes-Tr; EBT00001751188.
DR   EnsemblGenomes-Tr; EBT00001751189.
DR   EnsemblGenomes-Tr; EBT00001751190.
DR   EnsemblGenomes-Tr; EBT00001751191.
DR   EnsemblGenomes-Tr; EBT00001751192.
DR   EnsemblGenomes-Tr; EBT00001751193.
DR   EnsemblGenomes-Tr; EBT00001751194.
DR   EnsemblGenomes-Tr; EBT00001751195.
DR   EnsemblGenomes-Tr; EBT00001751196.
DR   EnsemblGenomes-Tr; EBT00001751197.
DR   EnsemblGenomes-Tr; EBT00001751198.
DR   EnsemblGenomes-Tr; EBT00001751199.
DR   EnsemblGenomes-Tr; EBT00001751200.
DR   EnsemblGenomes-Tr; EBT00001751201.
DR   EnsemblGenomes-Tr; EBT00001751202.
DR   EnsemblGenomes-Tr; EBT00001751203.
DR   EnsemblGenomes-Tr; EBT00001751204.
DR   EnsemblGenomes-Tr; EBT00001751205.
DR   EnsemblGenomes-Tr; EBT00001751206.
DR   EnsemblGenomes-Tr; EBT00001751207.
DR   EnsemblGenomes-Tr; EBT00001751208.
DR   EnsemblGenomes-Tr; EBT00001751209.
DR   EnsemblGenomes-Tr; EBT00001751210.
DR   EnsemblGenomes-Tr; EBT00001751211.
DR   EnsemblGenomes-Tr; EBT00001751212.
DR   EnsemblGenomes-Tr; EBT00001751213.
DR   EnsemblGenomes-Tr; EBT00001751214.
DR   EnsemblGenomes-Tr; EBT00001751215.
DR   EnsemblGenomes-Tr; EBT00001751216.
DR   EnsemblGenomes-Tr; EBT00001751217.
DR   EnsemblGenomes-Tr; EBT00001751218.
DR   EnsemblGenomes-Tr; EBT00001751219.
DR   EnsemblGenomes-Tr; EBT00001751220.
DR   EnsemblGenomes-Tr; EBT00001751221.
DR   EnsemblGenomes-Tr; EBT00001751222.
DR   EnsemblGenomes-Tr; EBT00001751223.
DR   EnsemblGenomes-Tr; EBT00001751224.
DR   EnsemblGenomes-Tr; EBT00001751225.
DR   EnsemblGenomes-Tr; EBT00001751226.
DR   EnsemblGenomes-Tr; EBT00001751227.
DR   EnsemblGenomes-Tr; EBT00001751228.
DR   EnsemblGenomes-Tr; EBT00001751229.
DR   EnsemblGenomes-Tr; EBT00001751230.
DR   EnsemblGenomes-Tr; EBT00001751231.
DR   EnsemblGenomes-Tr; EBT00001751232.
DR   EnsemblGenomes-Tr; EBT00001751233.
DR   EnsemblGenomes-Tr; EBT00001751234.
DR   EnsemblGenomes-Tr; EBT00001751235.
DR   EnsemblGenomes-Tr; EBT00001751236.
DR   EnsemblGenomes-Tr; EBT00001751237.
DR   EnsemblGenomes-Tr; EBT00001751238.
DR   EnsemblGenomes-Tr; EBT00001751239.
DR   EnsemblGenomes-Tr; EBT00001751240.
DR   EnsemblGenomes-Tr; EBT00001751241.
DR   EnsemblGenomes-Tr; EBT00001751242.
DR   EnsemblGenomes-Tr; EBT00001751243.
DR   EnsemblGenomes-Tr; EBT00001751244.
DR   EnsemblGenomes-Tr; EBT00001751245.
DR   EnsemblGenomes-Tr; EBT00001751246.
DR   EnsemblGenomes-Tr; EBT00001751247.
DR   EnsemblGenomes-Tr; EBT00001751248.
DR   EnsemblGenomes-Tr; EBT00001751249.
DR   EnsemblGenomes-Tr; EBT00001751250.
DR   EnsemblGenomes-Tr; EBT00001751251.
DR   EnsemblGenomes-Tr; EBT00001751252.
DR   EnsemblGenomes-Tr; EBT00001751253.
DR   EnsemblGenomes-Tr; EBT00001751254.
DR   EnsemblGenomes-Tr; EBT00001751255.
DR   EnsemblGenomes-Tr; EBT00001751256.
DR   EnsemblGenomes-Tr; EBT00001751257.
DR   EnsemblGenomes-Tr; EBT00001751258.
DR   EnsemblGenomes-Tr; EBT00001751259.
DR   EnsemblGenomes-Tr; EBT00001751260.
DR   EnsemblGenomes-Tr; EBT00001751261.
DR   EnsemblGenomes-Tr; EBT00001751262.
DR   EnsemblGenomes-Tr; EBT00001751263.
DR   EnsemblGenomes-Tr; EBT00001751264.
DR   EnsemblGenomes-Tr; EBT00001751265.
DR   EnsemblGenomes-Tr; EBT00001751266.
DR   EnsemblGenomes-Tr; EBT00001751267.
DR   EnsemblGenomes-Tr; EBT00001751268.
DR   EnsemblGenomes-Tr; EBT00001751269.
DR   EnsemblGenomes-Tr; EBT00001751270.
DR   EnsemblGenomes-Tr; EBT00001751271.
DR   EnsemblGenomes-Tr; EBT00001751272.
DR   EnsemblGenomes-Tr; EBT00001751273.
DR   EnsemblGenomes-Tr; EBT00001751274.
DR   EnsemblGenomes-Tr; EBT00001751275.
DR   EnsemblGenomes-Tr; RHECIAT_CH0000062-1.
DR   EnsemblGenomes-Tr; RHECIAT_CH0000063-1.
DR   EnsemblGenomes-Tr; RHECIAT_CH0000064-1.
DR   EnsemblGenomes-Tr; RHECIAT_CH0000065-1.
DR   EnsemblGenomes-Tr; RHECIAT_CH0000066-1.
DR   EnsemblGenomes-Tr; RHECIAT_CH0000067-1.
DR   EnsemblGenomes-Tr; RHECIAT_CH0000104-1.
DR   EnsemblGenomes-Tr; RHECIAT_CH0000229-1.
DR   EnsemblGenomes-Tr; RHECIAT_CH0000275-1.
DR   EnsemblGenomes-Tr; RHECIAT_CH0000483-1.
DR   EnsemblGenomes-Tr; RHECIAT_CH0000577-1.
DR   EnsemblGenomes-Tr; RHECIAT_CH0000598-1.
DR   EnsemblGenomes-Tr; RHECIAT_CH0000652-1.
DR   EnsemblGenomes-Tr; RHECIAT_CH0000662-1.
DR   EnsemblGenomes-Tr; RHECIAT_CH0000806-1.
DR   EnsemblGenomes-Tr; RHECIAT_CH0000861.
DR   EnsemblGenomes-Tr; RHECIAT_CH0000873-1.
DR   EnsemblGenomes-Tr; RHECIAT_CH0001111-1.
DR   EnsemblGenomes-Tr; RHECIAT_CH0001113.
DR   EnsemblGenomes-Tr; RHECIAT_CH0001127-1.
DR   EnsemblGenomes-Tr; RHECIAT_CH0001138.
DR   EnsemblGenomes-Tr; RHECIAT_CH0001360.
DR   EnsemblGenomes-Tr; RHECIAT_CH0001445-1.
DR   EnsemblGenomes-Tr; RHECIAT_CH0001485.
DR   EnsemblGenomes-Tr; RHECIAT_CH0001615-1.
DR   EnsemblGenomes-Tr; RHECIAT_CH0001671-1.
DR   EnsemblGenomes-Tr; RHECIAT_CH0001673-1.
DR   EnsemblGenomes-Tr; RHECIAT_CH0001674-1.
DR   EnsemblGenomes-Tr; RHECIAT_CH0001725-1.
DR   EnsemblGenomes-Tr; RHECIAT_CH0001730-1.
DR   EnsemblGenomes-Tr; RHECIAT_CH0001731-1.
DR   EnsemblGenomes-Tr; RHECIAT_CH0001734-1.
DR   EnsemblGenomes-Tr; RHECIAT_CH0001843-1.
DR   EnsemblGenomes-Tr; RHECIAT_CH0001890-1.
DR   EnsemblGenomes-Tr; RHECIAT_CH0001894-1.
DR   EnsemblGenomes-Tr; RHECIAT_CH0001928-1.
DR   EnsemblGenomes-Tr; RHECIAT_CH0001967-1.
DR   EnsemblGenomes-Tr; RHECIAT_CH0001968-1.
DR   EnsemblGenomes-Tr; RHECIAT_CH0001969-1.
DR   EnsemblGenomes-Tr; RHECIAT_CH0001974-1.
DR   EnsemblGenomes-Tr; RHECIAT_CH0001977-1.
DR   EnsemblGenomes-Tr; RHECIAT_CH0002040.
DR   EnsemblGenomes-Tr; RHECIAT_CH0002078-1.
DR   EnsemblGenomes-Tr; RHECIAT_CH0002114.
DR   EnsemblGenomes-Tr; RHECIAT_CH0002190.
DR   EnsemblGenomes-Tr; RHECIAT_CH0002231.
DR   EnsemblGenomes-Tr; RHECIAT_CH0002249-1.
DR   EnsemblGenomes-Tr; RHECIAT_CH0002332-1.
DR   EnsemblGenomes-Tr; RHECIAT_CH0002418.
DR   EnsemblGenomes-Tr; RHECIAT_CH0002464.
DR   EnsemblGenomes-Tr; RHECIAT_CH0002761.
DR   EnsemblGenomes-Tr; RHECIAT_CH0002862-1.
DR   EnsemblGenomes-Tr; RHECIAT_CH0002935.
DR   EnsemblGenomes-Tr; RHECIAT_CH0003076-1.
DR   EnsemblGenomes-Tr; RHECIAT_CH0003396-1.
DR   EnsemblGenomes-Tr; RHECIAT_CH0003502.
DR   EnsemblGenomes-Tr; RHECIAT_CH0003592.
DR   EnsemblGenomes-Tr; RHECIAT_CH0003642-1.
DR   EnsemblGenomes-Tr; RHECIAT_CH0003643-1.
DR   EnsemblGenomes-Tr; RHECIAT_CH0003644-1.
DR   EnsemblGenomes-Tr; RHECIAT_CH0003645-1.
DR   EnsemblGenomes-Tr; RHECIAT_CH0003646-1.
DR   EnsemblGenomes-Tr; RHECIAT_CH0003647-1.
DR   EnsemblGenomes-Tr; RHECIAT_CH0003689-1.
DR   EnsemblGenomes-Tr; RHECIAT_CH0003839-1.
DR   EnsemblGenomes-Tr; RHECIAT_CH0004014-1.
DR   EnsemblGenomes-Tr; RHECIAT_CH0004015-1.
DR   EnsemblGenomes-Tr; RHECIAT_CH0004016-1.
DR   EnsemblGenomes-Tr; RHECIAT_CH0004017-1.
DR   EnsemblGenomes-Tr; RHECIAT_CH0004018-1.
DR   EnsemblGenomes-Tr; RHECIAT_CH0004019-1.
DR   EnsemblGenomes-Tr; RHECIAT_CH0004047-1.
DR   EnsemblGenomes-Tr; RHECIAT_CH0004105-1.
DR   EnsemblGenomes-Tr; RHECIAT_CH0004264-1.
DR   EnsemblGenomes-Tr; RHECIAT_CH0004350-1.
DR   EuropePMC; PMC4407392; 25903370.
DR   EuropePMC; PMC5739047; 29220487.
DR   EuropePMC; PMC6117902; 30165827.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00435; ROSE.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00517; serC.
DR   RFAM; RF00518; speF.
DR   RFAM; RF00519; suhB.
DR   RFAM; RF00520; ybhL.
DR   RFAM; RF00521; SAM_alpha.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01482; AdoCbl_riboswitch.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01793; ffh.
DR   RFAM; RF01849; alpha_tmRNA.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP001074.
DR   SILVA-SSU; CP001074.
DR   StrainInfo; 278818; 0.
XX
CC   Source DNA or Bacteria are available from: Universidad Nacional
CC   Autonoma de Mexico, Centro de Ciencias Genomicas, Departamento de
CC   Genomica Evolutiva, Phd. Victor Gonzalez,
CC   email: vgonzal@ccg.unam.mx.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4513324
FT                   /organism="Rhizobium etli CIAT 652"
FT                   /strain="CIAT 652"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:491916"
FT   gene            complement(123..500)
FT                   /locus_tag="RHECIAT_CH0000001"
FT   CDS_pept        complement(123..500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000001"
FT                   /product="hypothetical protein"
FT                   /note="yhch00001"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000001"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89004"
FT                   /db_xref="UniProtKB/TrEMBL:B3PVT1"
FT                   /protein_id="ACE89004.1"
FT                   /translation="MKEVRSVLHAIFRCLLKTLDDGELRRRGCLGQGKTCRLIHISNFA
FT                   GRFCPALWRMGTKSVCRTQVHKLSTGRRKSPVGQGFGIVSGLVFFRKSQRNRKILFEFG
FT                   CGRATNGIGSGWILILDRHRL"
FT   gene            474..1295
FT                   /locus_tag="RHECIAT_CH0000002"
FT   CDS_pept        474..1295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000002"
FT                   /product="hypothetical conserved protein"
FT                   /note="yhch00002"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000002"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89005"
FT                   /db_xref="GOA:B3PVT2"
FT                   /db_xref="InterPro:IPR005177"
FT                   /db_xref="InterPro:IPR026565"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3PVT2"
FT                   /protein_id="ACE89005.1"
FT                   /translation="MENRTNFFHLHLISDSTGETLISAGRAASAQFRSAQPIEHVYPLI
FT                   RNRKQLLPVLQAIDDAPGIVLYTIVDRELASLIDERCTEMGVASVNVLEPVMNAFQIYL
FT                   GAPSRRRVGAQHVMNAGYFARIEALNFTMDHDDGQMPDDYNDADVVIIGISRTSKTPTS
FT                   IYLANRGIKTANIPIVYGVPLPEGLLVATKPLIVCLIATTDRISQVRENRILGATQGFD
FT                   REHYTDRAAISEELKYARSLCARHNWPLIDVTRRSIEETAAAIVALRPKLR"
FT   gene            1329..1928
FT                   /locus_tag="RHECIAT_CH0000003"
FT   CDS_pept        1329..1928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000003"
FT                   /product="putative septum formation protein"
FT                   /note="ypch00001"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000003"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89006"
FT                   /db_xref="GOA:B3PVT3"
FT                   /db_xref="InterPro:IPR003697"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:B3PVT3"
FT                   /protein_id="ACE89006.1"
FT                   /translation="MTTTIILASSSPFRRMLMENAGLSFEAHAAKIDERALEAPLEKAG
FT                   ATPDAVALALARAKAEDVSRHFSDSLVIGSDQTMSLAERVFHKPKDMADAASHLHALSG
FT                   KTHRLNSAVAIVNNGVVLWEHLAHAELTMRPLTADFIARHLARVGDKALSSVGAYQLEG
FT                   QGIQLFEKIEGDYFTILGLPMLPLLKKLRELGAIDG"
FT   gene            1921..2778
FT                   /gene="aroE"
FT                   /locus_tag="RHECIAT_CH0000004"
FT   CDS_pept        1921..2778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroE"
FT                   /locus_tag="RHECIAT_CH0000004"
FT                   /product="shikimate 5-dehydrogenase protein"
FT                   /EC_number="1.1.1.25"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000004"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89007"
FT                   /db_xref="GOA:B3PVT4"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR011342"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3PVT4"
FT                   /protein_id="ACE89007.1"
FT                   /translation="MGDSRETFGPKAFVTGFPIKHSRSPLIHGYWLKTLGLPGSYRAHE
FT                   VAPEAFADFIASLKDGSSGFAGGNVTIPHKELAFRLADRPDALSQELGASNTLWLEDDL
FT                   LHATNTDGRGFTANLDERHPGWDRHDTAVIFGAGGASRAIIQAVRDRGFKTIHVVNRTV
FT                   GRARELADRFGPKVHAHPAGALAEVMKGAGLFINTTSLGMDGEAAPQLDFTPLTADAVV
FT                   TDIVYVPLKTPLLAQAQEQGFPIVDGLGMLLHQAVPGFEKWFGKRPVVDAALRALIIAD
FT                   MEAH"
FT   gene            2778..3389
FT                   /gene="coaE"
FT                   /locus_tag="RHECIAT_CH0000005"
FT   CDS_pept        2778..3389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coaE"
FT                   /locus_tag="RHECIAT_CH0000005"
FT                   /product="dephospho-CoA kinase protein"
FT                   /EC_number="2.7.1.24"
FT                   /note="GO_function: GO:0005524 - ATP binding"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000005"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89008"
FT                   /db_xref="GOA:B3PVT5"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3PVT5"
FT                   /protein_id="ACE89008.1"
FT                   /translation="MLTIGLTGSIGMGKSTAGKLFAEAGIPLNDSDAVVHDLYAGEAAP
FT                   LVEAAFPGTMKDGAVDRHELGRQLALDPAGFKRLEAIVHPLVRKRETEFLARHRAAGAE
FT                   MVLLDIPLLFETGAWERVDVIVVVSTDPQIQRQRVLAREDMTEEKFDMILSRQTPDAEK
FT                   RRRADYLIDTSHSIEQTRERVLEIVTDLKMRIAKGDFRNA"
FT   gene            3382..4107
FT                   /gene="dnaQ"
FT                   /locus_tag="RHECIAT_CH0000006"
FT   CDS_pept        3382..4107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaQ"
FT                   /locus_tag="RHECIAT_CH0000006"
FT                   /product="DNA polymerase III, epsilon chain protein"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000006"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89009"
FT                   /db_xref="GOA:B3PVT6"
FT                   /db_xref="InterPro:IPR006054"
FT                   /db_xref="InterPro:IPR006309"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B3PVT6"
FT                   /protein_id="ACE89009.1"
FT                   /translation="MREIIFDTETTGLDNRMDRIIEIGGIELFNHFPTGNTLHIYINPG
FT                   DQKVHPDALAVHGITDEFLKDKKAFAEVAEEILAFFGDAKWIAHNATFDMGFINAEFAR
FT                   IGLPPILPERVVDTLSMARRKHPMGPNSLDALCRRYGVDNSHRAKHGALLDSELLAEVY
FT                   IEMIGGRQAALGLGLSGQSGQTARGEMAMEDDGVISAVLERPRPLAPRLSQAEAQAHAA
FT                   LVSKLGDKGIWSKFASPPA"
FT   gene            complement(4220..4699)
FT                   /gene="secB"
FT                   /locus_tag="RHECIAT_CH0000007"
FT   CDS_pept        complement(4220..4699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secB"
FT                   /locus_tag="RHECIAT_CH0000007"
FT                   /product="protein-export translocase chaperone protein"
FT                   /note="GO_function: GO:0051082 - unfolded protein binding;
FT                   GO_process: GO:0015031 - protein transport; GO_process:
FT                   GO:0051262 - protein tetramerization"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000007"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89010"
FT                   /db_xref="GOA:B3PVT7"
FT                   /db_xref="InterPro:IPR003708"
FT                   /db_xref="InterPro:IPR035958"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3PVT7"
FT                   /protein_id="ACE89010.1"
FT                   /translation="MADDNNNGATNPTLSILAQYTKDLSFENPGAPRSLQARDKAPTIN
FT                   INVNVNANPLSDTDFDVVLSLNAEAKDDDKTVFHTELVYGGVFRVAGFPQEHMLPVLFI
FT                   ECPRMLFPFARQIIADVTRNGGFPPLMIDPIDFTQMFAQRVAEEQARAKVQAVPN"
FT   gene            complement(4801..5307)
FT                   /locus_tag="RHECIAT_CH0000008"
FT   CDS_pept        complement(4801..5307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000008"
FT                   /product="hypothetical conserved protein"
FT                   /note="yhch00003; GO_component: GO:0016020 - membrane"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000008"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89011"
FT                   /db_xref="GOA:B3PVT8"
FT                   /db_xref="InterPro:IPR007313"
FT                   /db_xref="UniProtKB/TrEMBL:B3PVT8"
FT                   /protein_id="ACE89011.1"
FT                   /translation="MRFSILPAFILLLPLGEIAGFVVVGRALGLALTLALVMASFVFGV
FT                   VLLRRQGIGILRRMSSEGRNGVMPGHDLLKPAMNVIAALLLIIPGFLTDIIAILILIPP
FT                   VRDLVWRSIAKRFVVVNAEGGFSTGPKPDVRDGNRNSKVVDLDEEDYHREPDRNSPWSG
FT                   KHLGD"
FT   gene            5438..6139
FT                   /locus_tag="RHECIAT_CH0000009"
FT   CDS_pept        5438..6139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000009"
FT                   /product="putative translocase transmembrane protein"
FT                   /note="ypch00002; GO_component: GO:0005744 - mitochondrial
FT                   inner membrane presequence translocase complex;
FT                   GO_function: GO:0015450 - protein translocase activity;
FT                   GO_process: GO:0006886 - intracellular protein transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000009"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89012"
FT                   /db_xref="GOA:B3PVT9"
FT                   /db_xref="InterPro:IPR007379"
FT                   /db_xref="InterPro:IPR016985"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR039544"
FT                   /db_xref="UniProtKB/TrEMBL:B3PVT9"
FT                   /protein_id="ACE89012.1"
FT                   /translation="MSSNDFITLFFLVAAVLIFFQLRSVLGRRTGNEKPPRDLYQPRDA
FT                   APAEAADAGKVVTLPRRDATAEDEDRFSAIDAVAAPGTPLNESLRALNKADASFTPKEF
FT                   LNGARMAYEMIVMAYADGDRKTLKNLLSREVYDGFDAAIGEREARGEKVKSTFVGIDKA
FT                   EITHAETKGTEAQITVRIVSQLISATYDKADVLIEGDAENVAEVNDLWTFAPRYPLARS
FT                   ELETCGDRIGT"
FT   gene            6136..7254
FT                   /gene="mltA"
FT                   /locus_tag="RHECIAT_CH0000010"
FT   CDS_pept        6136..7254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mltA"
FT                   /locus_tag="RHECIAT_CH0000010"
FT                   /product="membrane-bound lytic murein transglycosylase
FT                   protein"
FT                   /EC_number="3.2.1.-"
FT                   /note="GO_function: GO:0004553 - hydrolase activity,
FT                   hydrolyzing O-glycosyl compounds"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000010"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89013"
FT                   /db_xref="GOA:B3PVU0"
FT                   /db_xref="InterPro:IPR005300"
FT                   /db_xref="InterPro:IPR010611"
FT                   /db_xref="InterPro:IPR026044"
FT                   /db_xref="InterPro:IPR034654"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:B3PVU0"
FT                   /protein_id="ACE89013.1"
FT                   /translation="MSDHASDFVLQAISFDTLEGWKDDDPSGLFEVMRSCRRQITEVKP
FT                   YRIGSLGLSSQDLLPLLIAAEDFTPSSPASARGFFETHCRPFLIRRNDGNSGFVTAFYE
FT                   PEIEVSGQADDVFRFPFYRRPDDLIDLDESNRPAELDQAYAFGRLHDGRVSTYPDRQAI
FT                   DQGFLEGRGLEIAWAKSKVDVFFVHVQGAARLRYRDGHIGRITYAAKAGHAFSAIGKLL
FT                   IERGEIDRAEISMQSIRSWLAHNPERVDEVLWYNRSYIFFREAAVADPSAGPIAAAKVP
FT                   LLAGRSLAVDRLIHTFGFPFFIRAESLTHLDDGRAFARLMLALDTGSAIVGPARGDIFT
FT                   GSGDMAGERAGTVRNAADFVILIPNAAAGRFD"
FT   gene            7254..7823
FT                   /locus_tag="RHECIAT_CH0000011"
FT   CDS_pept        7254..7823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000011"
FT                   /product="putative DNA repair protein, Smr/mutS family"
FT                   /note="ypch00003"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000011"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89014"
FT                   /db_xref="InterPro:IPR002625"
FT                   /db_xref="InterPro:IPR036063"
FT                   /db_xref="UniProtKB/TrEMBL:B3PVU1"
FT                   /protein_id="ACE89014.1"
FT                   /translation="MAKDRKLSADERILWGKVARSTRPMPGKTDELSELDAFLAETEAA
FT                   VEREKAEKQTPVSFTAEQPATPSASKRPAGVQHPLERPVKRKIAKGRLALEARIDLHGL
FT                   VQSEAHVILLDFLIRAHERGMRHVLVITGKGSSMGSDGALKRAVPLWFSKPEFRYLISS
FT                   YEPAAQHHGGEGALYVRLSRRQGERP"
FT   gene            7820..8197
FT                   /locus_tag="RHECIAT_CH0000012"
FT   CDS_pept        7820..8197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000012"
FT                   /product="putative transcriptional regulator protein"
FT                   /note="ypch00004; GO_function: GO:0043565 -
FT                   sequence-specific DNA binding"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000012"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89015"
FT                   /db_xref="GOA:B3PVU2"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B3PVU2"
FT                   /protein_id="ACE89015.1"
FT                   /translation="MTPFGEAVRRLRARKGVSQKEMAAALNVSPAYLSALEHGKRGLPT
FT                   FDLLQRIAGYFNIIWDEAEELFLLARSSDPRVIIDTSGLPPEYTEFANRLARRIRKLDS
FT                   AEIARLSALLENGAKGDGKAS"
FT   gene            8333..10768
FT                   /gene="gyrB1"
FT                   /locus_tag="RHECIAT_CH0000013"
FT   CDS_pept        8333..10768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB1"
FT                   /locus_tag="RHECIAT_CH0000013"
FT                   /product="DNA gyrase protein, B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="GO_component: GO:0005694 - chromosome; GO_function:
FT                   GO:0003677 - DNA binding; GO_function: GO:0003918 - DNA
FT                   topoisomerase (ATP-hydrolyzing) activity; GO_function:
FT                   GO:0005524 - ATP binding; GO_process: GO:0006265 - DNA
FT                   topological change"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000013"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89016"
FT                   /db_xref="GOA:B3PVU3"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B3PVU3"
FT                   /protein_id="ACE89016.1"
FT                   /translation="MSDTSATENGVSTEYGADSIKVLKGLDAVRKRPGMYIGDTDDGSG
FT                   LHHMVYEVVDNAIDEALAGHADIVTVSLNPDGSVTVTDNGRGIPTDIHSGEGVSAAEVI
FT                   MTQLHAGGKFDQNSYKVSGGLHGVGVSVVNALSVWLKLKIRRHGKIHEMSFTHGVADAP
FT                   LKVTGDAPDATGTEVSFMPSSETFTMTEFDYGTLEHRLRELAFLNSGVRILLSDKRHSD
FT                   IKQEEMRYDGGLEAFVAYLDRAKKPLVDKPVAIRGEKDGITVEVAMWWNDSYHENVLCF
FT                   TNNIPQRDGGTHMAGFRAALTRQVVSYADNSGITKKEKVTLQGEDCREGLTAVLSVKVP
FT                   DPKFSSQTKDKLVSSEVRPVVESLVNEALSTWFEEHPSEAKILVGKVVEAAAAREAARK
FT                   ARELTRRKGALDIASLPGKLADCSERDPAKSEVFLVEGDSAGGSAKQGRSRENQAILPL
FT                   RGKILNVERARFDKMLSSQEIGTLITALGTGIGKDEFNAEKLRYHKIIIMTDADVDGAH
FT                   IRTLLLTFFFRQMPELIERGHLYIAQPPLYKVARGKSVQYLKDEKALEEYLIGQGLEDA
FT                   ALRLGSGEVRTGQDLREVILDALRMRALLDNLHSRYNRAVVEQAAIAGALNAELVSDAA
FT                   RARALASEVASRLDIIAEETERGWQGDLTSDGGLRLERMVRGVKEIVVLDMALIGSSDA
FT                   RHIDQLTSRLKEIYQTPPSLHRREGDIEISGPRALLDAIFASGRKGLTMQRYKGLGEMN
FT                   AEQLWETTLDPNVRSLLQVKVADATDADGLFARLMGDEVEPRREFIQDNALSVANLDI"
FT   gene            complement(10837..11436)
FT                   /locus_tag="RHECIAT_CH0000014"
FT   CDS_pept        complement(10837..11436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000014"
FT                   /product="probable oxidoreductase protein"
FT                   /note="ypch00005; GO_function: GO:0016491 - oxidoreductase
FT                   activity; GO_process: GO:0006118 - electron transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000014"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89017"
FT                   /db_xref="GOA:B3PVU4"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:B3PVU4"
FT                   /protein_id="ACE89017.1"
FT                   /translation="MTKSNSRESQYPIDPMFLDRWSPRAFTGEIIEEAQLLSLLDAAHW
FT                   APSSSNQQPWRFIYALKGSEHWEKFVALLVDANQEWAKNASALIFVVSRSFTGVAGSGE
FT                   EKPSYTHSFDAGAAWGHLALQARLSGFYAHGMGGIKHDDIMKTFGIPAGYRVEAGVAVG
FT                   RLADKSVLSERNQAREFPSQRKPLSEVAFNGGFVAN"
FT   gene            complement(11480..11764)
FT                   /locus_tag="RHECIAT_CH0000015"
FT   CDS_pept        complement(11480..11764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000015"
FT                   /product="hypothetical conserved protein"
FT                   /note="yhch00004"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000015"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89018"
FT                   /db_xref="InterPro:IPR014543"
FT                   /db_xref="UniProtKB/TrEMBL:B3PVU5"
FT                   /protein_id="ACE89018.1"
FT                   /translation="MHLSKATVRTEHASRYLQQLCKHWSHKFSVDFDPHKGRVPFNDSA
FT                   EVTFTADDAGLTMVLSVADPAQQVRMQGVIDDHLKRFAFREELDIVWTD"
FT   gene            11938..12891
FT                   /locus_tag="RHECIAT_CH0000016"
FT   CDS_pept        11938..12891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000016"
FT                   /product="putative glutathione-S-transferase protein"
FT                   /note="ypch00006"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000016"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89019"
FT                   /db_xref="GOA:B3PVU6"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR016639"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:B3PVU6"
FT                   /protein_id="ACE89019.1"
FT                   /translation="MLVNGKWTEDWQPVQAKDEKGGFVRQVSSFRNWVTPDGSAGPTGE
FT                   GGFKAEPDRYHLYVAYICPWASRTLIGRKLKGLEEVISVSVVEPVLTKQGWRFGDYPGA
FT                   TQDHVNGTTYMHEIYTRAAPEFTGRATVPVLWDKQAQTIVNNESADILRMLNSGFGNLA
FT                   KHSIDLYPAERRVEIDAFNDRIYPALNNGVYRAGFATTQIAYEEAFADVFSCLDWVEPQ
FT                   VEGRPFLFADHPTESDIRLFVTLVRFDAAYHGIFKCNLRRLSDYANLRAFCRRMLDWPG
FT                   IAETVNLDHIKRGYYSVESLNPTKIVPAGPDFSEIF"
FT   gene            12984..13826
FT                   /locus_tag="RHECIAT_CH0000017"
FT   CDS_pept        12984..13826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000017"
FT                   /product="2-hydroxyhepta-2,4-diene-1,7-dioate
FT                   isomerase/5-carboxymethyl-2-oxo-hex-3-ene-1,
FT                   7-dioatedecarboxylase"
FT                   /note="bifunctional ypch00007; GO_function: GO:0003824 -
FT                   catalytic activity; GO_process: GO:0008152 - metabolic
FT                   process"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000017"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89020"
FT                   /db_xref="GOA:B3PVU7"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:B3PVU7"
FT                   /protein_id="ACE89020.1"
FT                   /translation="MKLMRVGEAGREKPALLDADGKIRDLSGHVADIGGEAISPAGLAK
FT                   IAAIDPKSLPELAAGRIGACVAGTGKFICIGLNFSDHAAETGATVPPEPVIFMKATSAI
FT                   SGPNDTVLIPRGSEKTDWEVELGVVIGKTAKYVSEANALDYVAGYCVSHDVSERAFQTE
FT                   RAGQWTKGKSCDTFGPIGPWLVTKDEIADPQNLGMWLKVNGQTMQNGSSKTMVYGVAHI
FT                   VSYLSQFMSLHPGDVISTGTPPGVGMGMKPPRYLRDGDVVELGIEGLGSQKQSFVADR"
FT   gene            14029..15306
FT                   /locus_tag="RHECIAT_CH0000018"
FT   CDS_pept        14029..15306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000018"
FT                   /product="probable intracellular PHB depolymerase protein"
FT                   /note="ypch00008"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000018"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89021"
FT                   /db_xref="InterPro:IPR009656"
FT                   /db_xref="InterPro:IPR010915"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B3PVU8"
FT                   /protein_id="ACE89021.1"
FT                   /translation="MFYQLYELNHAAMAPFRAAADIMRFAYANPLNPFSHTPFGRTMAA
FT                   SLEMFERTTRRYGKPEFGLKQTTIDDRTVSVREEVVWSRSFCNLLHFARNVPPGRASDP
FT                   RILIVAPMSGHYATLLRGTVEALLPSADVYITDWIDARMVPMTEGRFDFDDYVDYVIEM
FT                   LHFLGHGTHVIAVCQPSVPVLVAAAVMEEANDPLSPSSMTLMGGPIDTRINPTAVNKLA
FT                   QERSLQWFSDNVIMNVPWPQPGFMRPVYPGFLQLSGFMSMNLDRHLVAHKEFFMHLVKN
FT                   DGEPEKHRDFYDEYLAVMDLTAEFYLQTVEQVFMKHSLPKGELMHRGKRVDAASIRNVA
FT                   LLTVEGENDDISGVGQTKAAQTICVNIPEDMRMHYLQPDVGHYGVFNGSRFRREIAPRI
FT                   VNFVRQHSRAAVKRPVQRVIKGGRTA"
FT   gene            15345..15887
FT                   /locus_tag="RHECIAT_CH0000019"
FT   CDS_pept        15345..15887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000019"
FT                   /product="hypothetical conserved protein"
FT                   /note="yhch00005"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000019"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89022"
FT                   /db_xref="GOA:B3PVU9"
FT                   /db_xref="InterPro:IPR021273"
FT                   /db_xref="UniProtKB/TrEMBL:B3PVU9"
FT                   /protein_id="ACE89022.1"
FT                   /translation="MSDFAGNRLEGGSCGNHIDFSVRHLAGRRTRGYRTMNQSALLRPD
FT                   WTPATIALMILGFMVFWPLGLAMLAYIIFGERLRGFKRDVNQATDGFFASCRRSHGHHR
FT                   PHFSTGNVAFDDWRKAELDRIEEERRKLDEMREEFDAYLRELRRAKDQEEFDRFMRERR
FT                   NAKRDDNGGPVAEFQTP"
FT   gene            15997..16755
FT                   /locus_tag="RHECIAT_CH0000020"
FT   CDS_pept        15997..16755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000020"
FT                   /product="putative zinc metallopeptidase protein"
FT                   /note="ypch00009"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000020"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89023"
FT                   /db_xref="InterPro:IPR002725"
FT                   /db_xref="UniProtKB/TrEMBL:B3PVV0"
FT                   /protein_id="ACE89023.1"
FT                   /translation="MFPLLKTRPKARKPAPPETRTLDVAGRLMPLTIKQHDQATRITLR
FT                   IEPGGRALRMTVPRGLAAREVNAFLDRHQGWLLTKLAKFSTDTGLRDGGKILLRGVSHR
FT                   IAHTGSLRGLTEVVSVDGSPVLRVSGMPEHVGRRIAAFLKKEARADLERLAAAHAATIQ
FT                   APIRSISMKDTRSRWGSCSSEGNLSFSWRIVMAPPSVIDYLAAHEVAHLKEMNHGPRFW
FT                   ALCKKLCPGMEEAKSWLKRHGSQLHALDFD"
FT   gene            16831..17499
FT                   /gene="trpF"
FT                   /locus_tag="RHECIAT_CH0000021"
FT   CDS_pept        16831..17499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpF"
FT                   /locus_tag="RHECIAT_CH0000021"
FT                   /product="n-5'-phosphoribosylanthranilate isomerase
FT                   protein"
FT                   /EC_number="5.3.1.24"
FT                   /note="GO_function: GO:0004640 - phosphoribosylanthranilate
FT                   isomerase activity; GO_process: GO:0006568 - tryptophan
FT                   metabolic process"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000021"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89024"
FT                   /db_xref="GOA:B3PVV1"
FT                   /db_xref="InterPro:IPR001240"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3PVV1"
FT                   /protein_id="ACE89024.1"
FT                   /translation="MKPDIKICGLKTPEAIDRALKRGATHIGFIFFEKSPRYIEPDLAA
FT                   KLAEPARGKAKIVAVVVDPTNDELDEIVSLLKPDILQLHGNESPEHVLTIKALYGLPVM
FT                   KVFSVRTAADLKRVEAYIGIADRFLFDAKAPKGSELPGGNGISFDWSLLSWLDGSIDYM
FT                   LSGGLNKDNVANALANTTARGIDVSSGVESAPGVKSVAMIDEFFDAVEGADAPVMASGS
FT                   "
FT   gene            17502..18722
FT                   /gene="trpB"
FT                   /locus_tag="RHECIAT_CH0000022"
FT   CDS_pept        17502..18722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpB"
FT                   /locus_tag="RHECIAT_CH0000022"
FT                   /product="tryptophan synthase protein, beta chain"
FT                   /EC_number="4.2.1.20"
FT                   /note="GO_function: GO:0003824 - catalytic activity;
FT                   GO_process: GO:0008152 - metabolic process"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000022"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89025"
FT                   /db_xref="GOA:B3PVV2"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR006653"
FT                   /db_xref="InterPro:IPR006654"
FT                   /db_xref="InterPro:IPR023026"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3PVV2"
FT                   /protein_id="ACE89025.1"
FT                   /translation="MNETPKPNSFRSGPDEDGRFGIYGGRFVAETLMPLILDLQDEWNK
FT                   AKTDPAFQAELQHLGAHYIGRPSPLYFAERLTAELGGAKIYFKREELNHTGSHKINNCI
FT                   GQILLAKRMGKTRIIAETGAGQHGVASATVAARFGLPCVVYMGATDVERQAPNVFRMKL
FT                   LGAEVKPVTAGSGTLKDAMNEALRDWVTNVEDTYYLIGTAAGPHPYPEMVRDFQSVIGA
FT                   EAKEQMLAAEGRLPDLVVAAVGGGSNAIGIFHPFLDDPSVKIVGVEAGGKGLQGDEHCA
FT                   SITAGSPGVLHGNRTYLLQDGDGQIKEGHSISAGLDYPGIGPEHSWLSDIGRVDYVPIM
FT                   DHEALEAFQTLTRLEGIIPALEAAHAIAEVIKRAPTMSKDEIILMNLSGRGDKDIFTVG
FT                   KILGMGL"
FT   gene            18726..19565
FT                   /gene="trpA"
FT                   /locus_tag="RHECIAT_CH0000023"
FT   CDS_pept        18726..19565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpA"
FT                   /locus_tag="RHECIAT_CH0000023"
FT                   /product="tryptophan synthase protein, alpha chain"
FT                   /EC_number="4.2.1.20"
FT                   /note="GO_function: GO:0004834 - tryptophan synthase
FT                   activity; GO_process: GO:0006568 - tryptophan metabolic
FT                   process"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000023"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89026"
FT                   /db_xref="GOA:B3PVV3"
FT                   /db_xref="InterPro:IPR002028"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018204"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3PVV3"
FT                   /protein_id="ACE89026.1"
FT                   /translation="MTARMDKRFAELKAEGRPALVTYFMGGDPDYDTSLGIMKALPEAG
FT                   SDIIELGMPFSDPMADGPAIQLAGQRALKGGQTLKKTLQLAADFRKTDDATPIVMMGYY
FT                   NPIYIYGVEKFLDDALTAGIDGLIVVDLPPEMDDELCIPAIRKGINFIRLATPTTDEKR
FT                   LPAVLKNTSGFVYYVSMNGITGSALPDPSLVSGAVQRIKQHTELPVCVGFGVKTAEHAK
FT                   VIGGSADGVVVGTAIVNQVATSLTKDGKATADTVQAVATLVRGLSSGTRSARLVAAE"
FT   gene            19605..20510
FT                   /gene="accD"
FT                   /locus_tag="RHECIAT_CH0000024"
FT   CDS_pept        19605..20510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accD"
FT                   /locus_tag="RHECIAT_CH0000024"
FT                   /product="acetyl-CoA carboxylase, carboxil transferase
FT                   protein, beta subunit"
FT                   /EC_number="6.4.1.2"
FT                   /note="GO_function: GO:0016874 - ligase activity"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000024"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89027"
FT                   /db_xref="GOA:B3PVV4"
FT                   /db_xref="InterPro:IPR000438"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3PVV4"
FT                   /protein_id="ACE89027.1"
FT                   /translation="MNWITNYVRPRINSMLGRREVPENLWIKCPETGEMVFHKDLESNK
FT                   WVIPASGYHMKMPAKARLADLFDNGEYESLPQPKVAQDPLKFRDSKKYIDRLRDSRVKT
FT                   EQEDTILAGLGKVRGLKLVAVVHEFNFIGGSLGIAAGEAIVKAFERATLEKCPLVMFPA
FT                   SGGARMQEGILSLMQLPRTTVAVDLLKESGQPYVVVLTNPTTGGVTASYAMLGDIHLAE
FT                   PGAEIGFAGKRVIEQTLREKLPEGFQTSEYLLEHGMVDMVVKRHDIPETLARLLKILTK
FT                   KPVSAANDMNGGAIALAASA"
FT   gene            20538..21890
FT                   /gene="folC"
FT                   /locus_tag="RHECIAT_CH0000025"
FT   CDS_pept        20538..21890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folC"
FT                   /locus_tag="RHECIAT_CH0000025"
FT                   /product="folC"
FT                   /function="folylpolyglutamate synthase"
FT                   /function="dihydrofolate syntase"
FT                   /note="bifunctional folC"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000025"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89028"
FT                   /db_xref="GOA:B3PVV5"
FT                   /db_xref="InterPro:IPR001645"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:B3PVV5"
FT                   /protein_id="ACE89028.1"
FT                   /translation="MIPRGQTAVSEAAHEIEKLMGLHPKGFDLSLDRITRLLDQLGNPH
FT                   RKLPPVIHVAGTNGKGSVTAFCRALLEAGGYSAHVHTSPHLVNWHERYRIGVAGGRGQL
FT                   VDDAVFADAVRRVAEANAGQHITVFEILTAVTFILFSEQPADAAIIEVGLGGRFDATNV
FT                   ISNPAVSVIMPISLDHQPYLGDRVELIAAEKAGIMKPGLPVVIGHQEYDAALDVLMSTA
FT                   ERLHCPSAVFGQDFMAHEEYGRLVYQDEYGLADLPLPRLPGRHQYANAAAAIRAVKAAG
FT                   FTVTETMMEKAMNSVEWPGRLQRLSDGRLLQHAPAGAEIWVDGGHNPGAGEVIAEAMAN
FT                   FEERQSRPLFLIIGMINTKDPVGYFKAFAGLVEKVFCVPIRGSDAMIDPVILSNAAYDA
FT                   GLVAEPMSTVGESLEAIKAVADPQALPPRILVGGSLYLVGDVLSDNGTPPK"
FT   gene            complement(21965..22285)
FT                   /gene="trxA1"
FT                   /locus_tag="RHECIAT_CH0000026"
FT   CDS_pept        complement(21965..22285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trxA1"
FT                   /locus_tag="RHECIAT_CH0000026"
FT                   /product="thioredoxin protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000026"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89029"
FT                   /db_xref="GOA:B3PVV6"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B3PVV6"
FT                   /protein_id="ACE89029.1"
FT                   /translation="MATVKVDINNFQSEVLESAEPVVVDFWAEWCGPCKMIAPSLEEIS
FT                   VEMEGKVKVAKLNIDENPELAAQFGVRSIPTLAIFKGGEVADISVGAKPKTALSNWISN
FT                   AA"
FT   gene            complement(22361..25912)
FT                   /locus_tag="RHECIAT_CH0000027"
FT   CDS_pept        complement(22361..25912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000027"
FT                   /product="probable ATP-dependent exonuclease V protein,
FT                   nuclease and helicase domains"
FT                   /EC_number="3.1.11.5"
FT                   /note="ypch00010; GO_function: GO:0003677 - DNA binding;
FT                   GO_function: GO:0004003 - ATP-dependent DNA helicase
FT                   activity; GO_function: GO:0005524 - ATP binding;
FT                   GO_process: GO:0006281 - DNA repair"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000027"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89030"
FT                   /db_xref="GOA:B3PVV7"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR014151"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:B3PVV7"
FT                   /protein_id="ACE89030.1"
FT                   /translation="MSEVSDLPTDDDPGAWIGWTTIQQAIASDPLRSAWVSANAGSGKT
FT                   HVLTQRVIRLLLAGARPSAILCLTYTKAAASEMSNRVFERLADWVVLDDDDLSRRIMQI
FT                   EGTAPDRIKLAEARRLFAKALETPGGLKIQTIHAFCEALLHQFPLEANVAGHFSVLDDR
FT                   AAAALLSDARRALLTATAPEEGSALAEAFAYVLNLGDESGLENLLGDIVANRNAIRRFA
FT                   AAAEQQGGVDMVLRKRLGLATDDTERGIAGEYWPLPELSGGTLELYLSMADQKGGAKAQ
FT                   EVAYGLRLAGRERDGARRAAMLEKIFLTAKGEPKTDSQFLVKAMLAEAPQLTEAIAAAR
FT                   AHVAASRDRLKLMRMHGATQAALVLADRLNHDYEELKKQRSQLDFEDLITRTADLLTKS
FT                   GVGPWIHYKLDRGIDHILVDEAQDTSPIQWSVIQSLAEDFFSGESARPIVRTLFAVGDE
FT                   KQSIYSFQGARPERFSEESDRTRRRVSDSGQSFSSVRLPLSFRSTADVLEAVDEIFRTA
FT                   DNARGLSAVGEPVVHRSSRIGHPGAVDLWDMVAPEAAVKEEDWTAPFDATPESAPAAIL
FT                   ARRIAHSIGALVGRETIVDKGKERLIEAGDILVLVRKRDAFVNALTRALKRRGDIPVAG
FT                   ADRLVLTSHIAVQDLLALGRFLLLPEDDLSLAAVLKSPLFDLSEEDIFAIAALRGDNES
FT                   AWSHLRKFAADGNERFRAAVEKLELFLRQSKNLSVHDFYARLLGSHGGRRQFLARLGTE
FT                   VSDILDEFLTFTLDHESSGLPGLQSFISTLELEAPEVKREQDKGRNEVRIMTVHASKGL
FT                   EAPIVFLVDGGSKAFTHTHLPKLRLIETEPDEPPMPAWVPVADLANSLTQNDAARIQIL
FT                   AEEEYRRLLYVAMTRAADRLVVCGYRGVRVNNDTWHMMISTALSEGHPHVEAASFSDPD
FT                   GEWPGIKWRVPRVERSFERINRSEARDNEISLPEGLLRPLPPQAELPRPLSPSGAGTII
FT                   DEDEGGLVVVSPLFSEKQGSDRSLEKGRLLHRMLQALPDIPPEERPGAAQRYAERAARF
FT                   WSEAERRKLVDSVLKLLDEKDLQPVLGEQARPEVSIMGTLTLDGRRYAVSGRIDRLAVL
FT                   ADRVVILDYKTNRVPPATEEAIPFAHRAQLAIYREILAPLYPGKRIDCMLVYTENASLY
FT                   TLSEKALGLALAGLKTK"
FT   gene            complement(25905..29099)
FT                   /locus_tag="RHECIAT_CH0000028"
FT   CDS_pept        complement(25905..29099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000028"
FT                   /product="hypothetical conserved protein"
FT                   /note="yhch00006"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000028"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89031"
FT                   /db_xref="GOA:B3PVV8"
FT                   /db_xref="InterPro:IPR014153"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:B3PVV8"
FT                   /protein_id="ACE89031.1"
FT                   /translation="MTERHQPRILTISAGLPFLKTLATTLCDGRLTPLFRHDVDDPLSL
FT                   ARVTIYLPTRRAVRVLRSEFVDLLGGRSAILPVIRPLGETDDDSGYFDEALPATIDLAQ
FT                   PLSNTARQLELARLILAWRNKLPEIVRHIHSDSPLVAPASPADAIWLARNLAELIDSIE
FT                   TEDLDWSELSKLDTGDYAAWWQLTAEFLQIASAFWPARLAELGKSSPARHRNAILRAEA
FT                   ARLSATKPGGPIIIAGSTGSVPATADLISAVANLREGVIVLPGLDLAMPEEHWQMVAPE
FT                   PVPGQHANPASRSHPQYGLSSLLKRLRLTRADVSTLDRPDADLDRRAEILSRALAPAEA
FT                   TSDWGIWKSELPGGALTSAFNDVSLIEAANEREEATAIAVALRLALERPGQDGESRAAL
FT                   ITPDRNLARRVMAELSRFGILADDSAGTPLSATPQGSLLQLLLEASLRPGDPVAIVSLL
FT                   KHPLARFGLERNALTFATEALELLALRGGVAEVDIGALEPLLTHQLAEQALDRHAPQWR
FT                   KALPTEAADAAFELAGRVSRATEPLAAALVRHRPEDRGKTASFTLSEWAQRTGRALEAV
FT                   AADPQGNLADLWSNEAGDALASLLGEVIDTDGQMEADGPQWIDITAALAAGHAVKPRAL
FT                   SHPRLFIFGTLEARLQSVDTLILGGLNEGSWPGQSANNPFIPRMMKTEIGLEPPERRIG
FT                   QLAHDFEMANGTRHLIYSRALRQGSTPTVASRWLQRLLALGGEAFEAELKGRGARFLQW
FT                   AGLVDRGGTQAPAQRPSPKPPLALQPQSYSFSEVGRLRRDPYAIYARRILRLDPIDAFN
FT                   RDPGAAERGTLYHKIIDRFIRAAHVAGTPEAAAAMELILTELFDMEKLPPHIDAVWRPR
FT                   FREVARAFLEWEAGRRPAIRRTLTEVRGGVELETINIRLNGVADRIDITGPNAADIIDY
FT                   KTGYNPSPAQARALLDPQLALEAAALRAGAFRDAGSLTPQDLLYVRLRPGNRFQVDMVN
FT                   NENAARSDKAKSAIDLAEESVDQLVKFVSLLQSGEKGFTSRLIPAQQFDFGGDYDHLAR
FT                   VSEWSTAENEEGGGDE"
FT   gene            complement(29103..29834)
FT                   /locus_tag="RHECIAT_CH0000029"
FT   CDS_pept        complement(29103..29834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000029"
FT                   /product="probable nucleotidyltransferase protein"
FT                   /note="ypch00011; GO_function: GO:0016779 -
FT                   nucleotidyltransferase activity; GO_process: GO:0009058 -
FT                   biosynthetic process"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000029"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89032"
FT                   /db_xref="GOA:B3PVV9"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B3PVV9"
FT                   /protein_id="ACE89032.1"
FT                   /translation="MTIRQAMVLAAGLGTRMRPITDTIPKPLVKIDGKPMIDYALDALV
FT                   AAGVERAVVNVHHHADQMLDHLGNYRGLEIIISDERDGLMNSGGGLAKGLRLLGRDNIF
FT                   VMNADLFWIGEQPGRPTNLQRLAGFFDAAQMDMALLCVRIEDTTGHNGKNDFGLAADGR
FT                   LRRYRDNPSNPVVYAGAIVMNPSLLDDAPTDAFNLNIYFDKAIARERLFGLVLDGHWLT
FT                   VGTPEAIGEAEETIRRLRAFA"
FT   gene            complement(29848..31359)
FT                   /locus_tag="RHECIAT_CH0000030"
FT   CDS_pept        complement(29848..31359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000030"
FT                   /product="hypothetical conserved protein"
FT                   /note="yhch00007"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000030"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89033"
FT                   /db_xref="GOA:B3PVW0"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR012180"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3PVW0"
FT                   /protein_id="ACE89033.1"
FT                   /translation="MTTTDTISLFLKDEAATIRLGEDLALALKAGDCLALSGDLGAGKS
FT                   SLARAILRAIADDDGLEVPSPTFTLVQSYDLRIPVSHFDLYRLGDASELTELGFDEALQ
FT                   NGICLVEWPEMAASEFPAERIALTLAHEGSGRRATIEAAGQQARRIRRVFAIREFLDAA
FT                   GYPEAKRRFLTGDASLRAYEAIYPDAAPRKILMDWRPHPEGPPVYDGKPYPKVAHLAQD
FT                   AYPFVAIADALRERGFAAPEIYKVDYEQGILLIEDLGTQGVLDDAGRPIAERYRQSVAC
FT                   LAHLHSMPFPQDIPVSDTHTHHIPDFDRTAMKMEVQLVLDWHIGWKRGSAPSDAERKEY
FT                   LAIWDALIDELAAAEKNLLLRDFHSPNIIWRPQEAGVGRVGLIDFQDAMIGPTAYDLAS
FT                   IVQDARVTIEPELFRQLMDDYLARRRAQGGFDEAGFMKAWAIMSAQRNCKLAGLWVRLL
FT                   QRDGKPDYLRHMPRTLAYLNVALEHEALAPLRDWCARAGIGQSES"
FT   gene            complement(31356..33941)
FT                   /locus_tag="RHECIAT_CH0000031"
FT   CDS_pept        complement(31356..33941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000031"
FT                   /product="probable two-component sensor histidine kinase
FT                   protein"
FT                   /note="ypch00012; GO_function: GO:0005524 - ATP binding"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000031"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89034"
FT                   /db_xref="GOA:B3PVW1"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B3PVW1"
FT                   /protein_id="ACE89034.1"
FT                   /translation="MSELKNSLPGQADDGARAHRRPLTAGQGYKSAAAHEAAKQEHGSL
FT                   ARFLKTCAAGTALAALARPVLAQGEQQAAASAHLFTSSQVIGVSVVIGVISAALLSTLW
FT                   LVRQRGNLENESREIRSALSDAQQRISQYQALIADKNRRIVIWDGNARPELLGQLPAET
FT                   GAPQDGEFLAFGLWLKSRSAADLEKAIDRLRDEAQSFDMVVETIRDEVLEAQGRVSGGR
FT                   AFVRFVALNNLRAELAELRIERDRLMTSISAFQTMLDAIDMPAWQRDPAGRLTWVNQAY
FT                   GDAVEARSPQQAINEGREMLTTVARERIRATTTPESPFHDTISTVVHGNRTFFDVVDVT
FT                   LPGGSAGMAVDVSDIEAVRAELDRTLKSHAETLDHLATPVAIFDGERRLQFYNQAFVAL
FT                   WELDIAFLEGRPDNSELLERLRAAKKLPDQLNWKSWKEAALSVYRALDTQSDLWHLPNG
FT                   QTLRVFATAHPQGGATWVFENLTEQVDLETRYNTLVKVQGETIDHLSEGVAVFGPDGRI
FT                   RLSNPAFRALWGITEAEAKPGTHIRALGEACAPSYDRPDGWKTFAELITSFDDERRSGQ
FT                   GTLELFSGLVLDYAVIPLPNAQTMLTFVNMTDSVRAERALTEKNEALRKADELKNDFVQ
FT                   HVSYELRSPLTNIIGFTDLLRTQGVGPLNERQAEYIDHISTSSSVLLTLVNDILDLATV
FT                   DAGIMRLNYAEIDLNDLLDDVSMQIADRLQESGVVLEITAPAYLGSIVADPQRLKQILL
FT                   KLLSNAANFSPEGSSISLECRREGTDFVFSVRDRGPGISPDMIATVFDRFATGAKSGKR
FT                   GGAGLGLSIVDSFVSLHHGDVTIDSEPGKGTTVVCRIPSVNIPHSAAAE"
FT   gene            complement(34145..35545)
FT                   /gene="ahcY"
FT                   /locus_tag="RHECIAT_CH0000032"
FT   CDS_pept        complement(34145..35545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ahcY"
FT                   /locus_tag="RHECIAT_CH0000032"
FT                   /product="S-adenosylhomocysteine hydrolase protein"
FT                   /EC_number="3.3.1.1"
FT                   /note="GO_function: GO:0004013 - adenosylhomocysteinase
FT                   activity; GO_process: GO:0006730 - one-carbon compound
FT                   metabolic process"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000032"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89035"
FT                   /db_xref="GOA:B3PVW2"
FT                   /db_xref="InterPro:IPR000043"
FT                   /db_xref="InterPro:IPR015878"
FT                   /db_xref="InterPro:IPR020082"
FT                   /db_xref="InterPro:IPR034373"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3PVW2"
FT                   /protein_id="ACE89035.1"
FT                   /translation="MSTEKDYVVADIGLADFGRKEITIAETEMPGLMSCRAEFGDAKPL
FT                   KGARITGSLHMTIQTAVLIETLVALGAEVRWASCNIFSTQDHAAAAIAAAGVPVFAIKG
FT                   ESLEDYWVYTDKIFQWADGGLSNMILDDGGDATMYILLGARAEAGEDVLSHPHSEEEEI
FT                   LFAQIKKRLAASPGWFTKQRDAIKGVTEETTTGVNRLYQLSQKGLLPFPAINVNDSVTK
FT                   SKFDNKYGCKESLVDGIRRGTDVMMAGKVAVVCGYGDVGKGSAASLSGAGARVKVTEAD
FT                   PICALQAAMDGYEVVLLEDVVSSADIFITTTGNKDVIRIDHMREMKDMAIVGNIGHFDN
FT                   EIEVAALRNLKWTNVKPQVDLIEFPKGNRIILLSEGRLLNLGNATGHPSFVMSASFTNQ
FT                   TLAQIELFTKPGQYENKVYILPKHLDEKVARLHLDKLGVKLTQLSEEQAAYIGVSPKGP
FT                   FKSDHYRY"
FT   gene            complement(35822..36097)
FT                   /locus_tag="RHECIAT_CH0000033"
FT   CDS_pept        complement(35822..36097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000033"
FT                   /product="putative phosphocarrier protein HPr protein"
FT                   /note="ypch00013; GO_function: GO:0005351 - sugar porter
FT                   activity; GO_process: GO:0009401 -
FT                   phosphoenolpyruvate-dependent sugar phosphotransferase
FT                   system"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000033"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89036"
FT                   /db_xref="GOA:B3PWG8"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/TrEMBL:B3PWG8"
FT                   /protein_id="ACE89036.1"
FT                   /translation="MTSLSRELLIINKRGLHARASAKFVQMVETFDAAITVSKDGMTVG
FT                   GTSIMGLMMLAASPGSSVVVSASGSQAEEALEALDQLIQNRFGEEM"
FT   gene            complement(36107..36508)
FT                   /locus_tag="RHECIAT_CH0000034"
FT   CDS_pept        complement(36107..36508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000034"
FT                   /product="probable protein-N(pi)-phosphohistidine-sugar
FT                   phosphotransferase protein (Enzyme II of the
FT                   phosphotransferase system)"
FT                   /EC_number="2.7.1.69"
FT                   /note="ypch00014; GO_component: GO:0016021 - integral to
FT                   membrane; GO_process: GO:0009401 -
FT                   phosphoenolpyruvate-dependent sugar phosphotransferase
FT                   system"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000034"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89037"
FT                   /db_xref="GOA:B3PWG9"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR033887"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="UniProtKB/TrEMBL:B3PWG9"
FT                   /protein_id="ACE89037.1"
FT                   /translation="MIGLVLVTHGKLAEEFRHAVEHVVGPQKFIETVCIGPEDDMDQRR
FT                   QDILQAVSGADDGHGVVILTDMFGGTPSNLAISVMSSGHTEVIAGVNLPMLIKLAGVRG
FT                   ENNMEKALVEASEAGRKYINVASRVLSGK"
FT   gene            complement(36659..37108)
FT                   /locus_tag="RHECIAT_CH0000035"
FT   CDS_pept        complement(36659..37108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000035"
FT                   /product="hypothetical conserved protein"
FT                   /note="yhch00008"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000035"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89038"
FT                   /db_xref="GOA:B3PWH0"
FT                   /db_xref="InterPro:IPR011104"
FT                   /db_xref="UniProtKB/TrEMBL:B3PWH0"
FT                   /protein_id="ACE89038.1"
FT                   /translation="MNEAANIHATAIVVGRTGLLFSGPSGWGKSMLAFTCMTEARRLGL
FT                   FTALVADDQVLLSEETGTVIATCPPSIAGLIELRGTGIVRQDHIPQAAMHYAVLPGSAS
FT                   GENRVPPDGEFVSFATGISLPALRLLTGVPSPLAVLMAKAPDIGD"
FT   gene            complement(37105..38883)
FT                   /gene="chvG"
FT                   /locus_tag="RHECIAT_CH0000036"
FT   CDS_pept        complement(37105..38883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="chvG"
FT                   /locus_tag="RHECIAT_CH0000036"
FT                   /product="two-component sensor histidine kinase protein"
FT                   /EC_number="2.7.3.-"
FT                   /note="GO_function: GO:0005524 - ATP binding"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000036"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89039"
FT                   /db_xref="GOA:B3PWH1"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR025908"
FT                   /db_xref="InterPro:IPR025919"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B3PWH1"
FT                   /protein_id="ACE89039.1"
FT                   /translation="MQERDLDDAEGVSTRRVRGRRWSHPFTLIRRIFGNAVFSSLTRRI
FT                   LFFNLVALVVLVGGILYLNQFREGLIDARAESLLTQGEIIAGAVSASASVDTNSITIDP
FT                   QKLLELQAGQSITPVPNDEDLEFPIDPEKVAPVLRRLISPTRTRARIFDADANLLLDSR
FT                   HLYSRGQVLRFDLPPVEEEKQTWSDWFATLFNKALQPGNLPLYKEAPGGDGSIYPEVMN
FT                   ALTGVRGAVVRTTEKGELIVSVAVPIQRFRAVLGVLLLSTQAGDIDNIVHAERLAIMRV
FT                   FGVATLVNVLLSLVLSSTIANPLRRLSAAAIRVRRGAKAREEIPDFSARQDEIGNLSIA
FT                   LREMTTALYDRIDAIESFAADVSHELKNPLTSLRSAVETLPLAKSEDSKKRLLDVIQHD
FT                   VRRLDRLISDISDASRLDAELARVDAASIDMEVLLRDLIEVSRQIRGSKKQVEIAYSIE
FT                   RKPNVKTRFLVNGHDLRIGQIVTNLIENARSFVPEKDGKITVRLMRTRSRCVTTIEDNG
FT                   PGIQAENIDRIFERFYTDRPESEGFGQNSGLGLSISRQIAEAHGGSLRAENITDADSGE
FT                   VLGARFILALPLDPAA"
FT   gene            complement(38974..39729)
FT                   /gene="chvI"
FT                   /locus_tag="RHECIAT_CH0000037"
FT   CDS_pept        complement(38974..39729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="chvI"
FT                   /locus_tag="RHECIAT_CH0000037"
FT                   /product="two-component response regulator protein"
FT                   /note="GO_function: GO:0000156 - two-component response
FT                   regulator activity; GO_process: GO:0000160 - two-component
FT                   signal transduction system (phosphorelay; GO_process:
FT                   GO:0006355 - regulation of transcription, DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000037"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89040"
FT                   /db_xref="GOA:B3PWH2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B3PWH2"
FT                   /protein_id="ACE89040.1"
FT                   /translation="MTETNTMPTIALVDDDRNILTSVSIALEAEGYKVETYTDGASALD
FT                   GLLARPPQLAIFDIKMPRMDGMELLRRLRQKSDIPVIFLTSKDEEIDELFGLKMGADDF
FT                   ITKPFSQRLLVERVRAVLRRASSREAAAAGGTSPSGAPKAGAVQQARSLERGQLVMDQE
FT                   RHTCTWKGEAVTLTVTEFLILHSLAQRPGVVKSRDALMDAAYDEQVYVDDRTIDSHIKR
FT                   LRKKFKMVDTDFDMIETLYGVGYRFREAA"
FT   gene            complement(39861..40070)
FT                   /locus_tag="RHECIAT_CH0000038"
FT   CDS_pept        complement(39861..40070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000038"
FT                   /product="hypothetical protein"
FT                   /note="yhch00009"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000038"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89041"
FT                   /db_xref="UniProtKB/TrEMBL:B3PWH3"
FT                   /protein_id="ACE89041.1"
FT                   /translation="MNSELFHGYFPSLRRVAVKTDCENKGRNFKTQETKIEKVQQYQII
FT                   NRFKFLGGILNRLKGRVATVGRAT"
FT   gene            40050..41660
FT                   /gene="pckA"
FT                   /locus_tag="RHECIAT_CH0000039"
FT   CDS_pept        40050..41660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pckA"
FT                   /locus_tag="RHECIAT_CH0000039"
FT                   /product="phosphoenolpyruvate carboxykinase protein"
FT                   /EC_number="4.1.1.49"
FT                   /note="GO_function: GO:0004612 - phosphoenolpyruvate
FT                   carboxykinase (ATP) activity; GO_function: GO:0005524 - ATP
FT                   binding; GO_process: GO:0006094 - gluconeogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000039"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89042"
FT                   /db_xref="GOA:B3PWH4"
FT                   /db_xref="InterPro:IPR001272"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="InterPro:IPR015994"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3PWH4"
FT                   /protein_id="ACE89042.1"
FT                   /translation="MEKFGVHNPATELATVGLGSAASVRYNFSAAALYEESIRRGEAEL
FT                   TAQGALRALTGQHTGRSPRDKFVVRDANTDGEIWWDNNKPLSPEHFALLRADMLAHAAG
FT                   KDLFVQDLVGGAEEGHALPTRVVTEFAWHSLFIRNLLIRPETAALATFVPKLTIIDLPS
FT                   FKADPARHGCRTETVIACDLTNGLVLIGGTSYAGEMKKSVFTVLNYLLPAKGVMPMHCS
FT                   ANVGPDGDAAVFFGLSGTGKTTLSADPARTLIGDDEHGWSENGIFNFEGGCYAKTIRLS
FT                   AEAEPEIYATTQRFGTVLENVVLNEGREPNFDDGSLTENTRCAYPMHFIPNASETGRAG
FT                   HPKTIIMLTADAFGVMPPIARLTPDQAMYHFLSGYTAKVAGTEKGVVEPEATFSTCFGA
FT                   PFMPRHPAEYGNLLKDLISRHGVNCWLVNTGWTGGAYGTGKRMPIKATRALLAAALSGE
FT                   LGQVEFRADPNFGFAVPVSVNGVDGGILDPRSTWADKTAYDVQAEKLVSMFIANFAKFE
FT                   DHVDGGVRDAAPGVKVAAE"
FT   gene            41782..42219
FT                   /locus_tag="RHECIAT_CH0000040"
FT   CDS_pept        41782..42219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000040"
FT                   /product="probable peptide chain release factor protein
FT                   (peptidyl-tRNA hydrolase protein)"
FT                   /note="ypch00015; GO_function: GO:0003747 - translation
FT                   release factor activity; GO_process: GO:0006415 -
FT                   translational termination"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000040"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89043"
FT                   /db_xref="GOA:B3PWH5"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="UniProtKB/TrEMBL:B3PWH5"
FT                   /protein_id="ACE89043.1"
FT                   /translation="MASDALYIDDRITISGWELTEQFVLAGGPGGQNVNKVSTAVQLFF
FT                   NLANSPSLNDRVKANAIRLAGRRMSKDGVLMIEASRFRSQDRNREDARERLKELILEAA
FT                   KPPPPPRKKTKPTKGSVERRLKEKSGRSEVKKMRGRPGGGD"
FT   gene            42221..42832
FT                   /gene="alkB"
FT                   /locus_tag="RHECIAT_CH0000041"
FT   CDS_pept        42221..42832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="alkB"
FT                   /locus_tag="RHECIAT_CH0000041"
FT                   /product="alkylated DNA repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000041"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89044"
FT                   /db_xref="GOA:B3PWH6"
FT                   /db_xref="InterPro:IPR004574"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR027450"
FT                   /db_xref="InterPro:IPR037151"
FT                   /db_xref="UniProtKB/TrEMBL:B3PWH6"
FT                   /protein_id="ACE89044.1"
FT                   /translation="MPELSNGVRHLPEYLDRSRQEALVEVIRAVVAEAPLFVPVMPGTG
FT                   KPMSVRMTNCGPLGWVTDKERGYRYQPTHPVTGRPWPAMPQQLLEIWNDVAGYEPPPEA
FT                   CLVNFYSDEARMGLHQDRDERNLQAPVVSISLGNSCLFRVGGVIRNDRTLSFKLSSGDL
FT                   VVLGGEGRLCFHGVDRIHPATSTLLKNGGRINLTLRRVNP"
FT   gene            complement(42856..43851)
FT                   /gene="coaA"
FT                   /locus_tag="RHECIAT_CH0000042"
FT   CDS_pept        complement(42856..43851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coaA"
FT                   /locus_tag="RHECIAT_CH0000042"
FT                   /product="pantothenate kinase protein"
FT                   /EC_number="2.7.1.33"
FT                   /note="GO_function: GO:0005524 - ATP binding; GO_function:
FT                   GO:0016301 - kinase activity; GO_process: GO:0009058 -
FT                   biosynthetic process"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000042"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89045"
FT                   /db_xref="GOA:B3PWH7"
FT                   /db_xref="InterPro:IPR004566"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3PWH7"
FT                   /protein_id="ACE89045.1"
FT                   /translation="MSIATEIIGVPETLDHFQSESFSPYHFFSSEQWAKFRADTPLTLT
FT                   SDEVKRLRSMGDPIDLDEVRRIYLSLSRLLSAHVESSQLLFEQRNRFLSLSDVTKTPFV
FT                   IGIAGSVAVGKSTTARILKELLGRWPSSPKVDLITTDGFLHPNAVLQREKLMQRKGFPE
FT                   SYDTAAILRFLSAIKAGRPDVQAPCYSHLVYDVLPDEYKIVDRPDILIFEGINVLQSRD
FT                   LPADGKIVPMVSDFFDFSIYIDAAEDQIHNWYVTRFMRLRETAFRDPNSYFHRYASISD
FT                   AEALEIAADLWTNINLKNLRQNILPTRPRADLILKKGKDHLIEQVALRKL"
FT   gene            complement(43848..44171)
FT                   /gene="hisE"
FT                   /locus_tag="RHECIAT_CH0000043"
FT   CDS_pept        complement(43848..44171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisE"
FT                   /locus_tag="RHECIAT_CH0000043"
FT                   /product="phosphoribosyl-ATP pyrophosphohydrolase protein"
FT                   /EC_number="3.6.1.31"
FT                   /note="GO_function: GO:0004636 - phosphoribosyl-ATP
FT                   diphosphatase activity; GO_process: GO:0000105 - histidine
FT                   biosynthetic process"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000043"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89046"
FT                   /db_xref="GOA:B3PWH8"
FT                   /db_xref="InterPro:IPR008179"
FT                   /db_xref="InterPro:IPR021130"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3PWH8"
FT                   /protein_id="ACE89046.1"
FT                   /translation="MSGFSLADLERIVDERSKASPEQSWTAKLVAGGQPKAAKKLGEEA
FT                   IEAVMAAATGDRDNLTYEAADVLYHLLVVLKIAEIPLENVMAELERRTAQSGLKEKANR
FT                   QSS"
FT   gene            complement(44189..44977)
FT                   /gene="hisF"
FT                   /locus_tag="RHECIAT_CH0000044"
FT   CDS_pept        complement(44189..44977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisF"
FT                   /locus_tag="RHECIAT_CH0000044"
FT                   /product="imadazoleglycerol-phosphate synthase protein"
FT                   /EC_number="4.1.3.-"
FT                   /note="GO_process: GO:0000105 - histidine biosynthetic
FT                   process"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000044"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89047"
FT                   /db_xref="GOA:B3PWH9"
FT                   /db_xref="InterPro:IPR004651"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B3PWH9"
FT                   /protein_id="ACE89047.1"
FT                   /translation="MTLKARVIPCLDVKDGRVVKGVNFLNLVDAGDPVEAAKAYDAAGA
FT                   DELCFLDITASSDNRETIFDVVSRTAEQCFMPLTVGGGVRTIADIRKLLLCGADKVSIN
FT                   SAAVSNPDFVAEAADKFGDQCIVVSIDAKRRLTQAVGGDNLSAWEIYTHGGRNATGIDA
FT                   IEFAQKMVARGAGELLVTSMDRDGTKVGYDLELTRAIADAVRVPVIASGGVGDLDDLVA
FT                   GVKDGHANAVLAASIFHFGTYSVSEAKHYMSKCGIDMRLD"
FT   gene            complement(44977..45723)
FT                   /gene="hisA"
FT                   /locus_tag="RHECIAT_CH0000045"
FT   CDS_pept        complement(44977..45723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisA"
FT                   /locus_tag="RHECIAT_CH0000045"
FT                   /product="phosphoribosylformino-5-aminoimidazole
FT                   carboxamide ribonucleotide isomerase protein"
FT                   /EC_number="5.3.1.16"
FT                   /note="GO_process: GO:0000105 - histidine biosynthetic
FT                   process"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000045"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89048"
FT                   /db_xref="GOA:B3PWI0"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR006063"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023016"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3PWI0"
FT                   /protein_id="ACE89048.1"
FT                   /translation="MILFPAIDLKGGQCVRLKLGDMQQATVYNTDPAAQAKSFEEQGFE
FT                   WLHVVDLDGAFAGHSANGDAVEAILKATKNPVQLGGGIRTLDHIEAWLARGLRRVILGT
FT                   VAVRNPDLVIEACRKFPGHVAVGIDAKGGKVAVEGWAEASELGVIELAQKFEGAGVSAI
FT                   IYTDIDRDGILAGINWASTLALAGAVSIPVIASGGLASLDDVRRMLEPDARKLEGAISG
FT                   RALYDGRIDPRQALALIKASRAKETA"
FT   gene            complement(45730..46287)
FT                   /locus_tag="RHECIAT_CH0000046"
FT   CDS_pept        complement(45730..46287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000046"
FT                   /product="hypothetical conserved protein"
FT                   /note="yhch00010"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000046"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89049"
FT                   /db_xref="GOA:B3PWI1"
FT                   /db_xref="UniProtKB/TrEMBL:B3PWI1"
FT                   /protein_id="ACE89049.1"
FT                   /translation="MIHEFLAGNENSQLRANGINAGDIAEAVLEFYIDGEDDLIGLLAY
FT                   ALYERQKRDFVLSYRKRNTGRSPNEAELAAVSGNYLSTDLRNTLRDRAAQILASYAETY
FT                   VEAMEPEIRLAAVNSQALRQVRDIEKSMKRRLGFWRQVRAGLTVTLLLFLLFGAATIAA
FT                   VFFRSDIVDAWNALMVSTTLRT"
FT   gene            complement(46284..46475)
FT                   /locus_tag="RHECIAT_CH0000047"
FT   CDS_pept        complement(46284..46475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000047"
FT                   /product="hypothetical conserved protein"
FT                   /note="yhch00011"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000047"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89050"
FT                   /db_xref="UniProtKB/TrEMBL:B3PWI2"
FT                   /protein_id="ACE89050.1"
FT                   /translation="MRSMPASRKSGKVFYRLRPSKEGLPPFSDIRLPDGTIIRRVDEAI
FT                   HRKALSKAARVLTERMDR"
FT   gene            complement(46519..47169)
FT                   /gene="hisH"
FT                   /locus_tag="RHECIAT_CH0000048"
FT   CDS_pept        complement(46519..47169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisH"
FT                   /locus_tag="RHECIAT_CH0000048"
FT                   /product="imadazoleglycerol phosphate synthase protein
FT                   subunit HisH"
FT                   /EC_number="2.4.2.-"
FT                   /note="GO_function: GO:0003824 - catalytic activity"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000048"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89051"
FT                   /db_xref="GOA:B3PWI3"
FT                   /db_xref="InterPro:IPR010139"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B3PWI3"
FT                   /protein_id="ACE89051.1"
FT                   /translation="MRVAIIDYGSGNLRSATKAFERAAREAGIDAQIDLTDKAEDVASA
FT                   DRIVLPGVGAYADCRRGLDAVPGMAEVLIEAVEKKARPFLGICVGMQLMSSRGLEKTVT
FT                   QGFGWIPGNVIEMTPDDPALKIPQIGWNTLDLKREHPLFDGIPTGAQGLHAYFVHSYHL
FT                   AAENAGDVIATVDYGGPMTALVGRDNMVGAQFHPEKSQKLGLALIANFLRWNP"
FT   gene            complement(47172..47654)
FT                   /locus_tag="RHECIAT_CH0000049"
FT   CDS_pept        complement(47172..47654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000049"
FT                   /product="hypothetical conserved protein"
FT                   /note="yhch00012"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000049"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89052"
FT                   /db_xref="GOA:B3PWI4"
FT                   /db_xref="InterPro:IPR024399"
FT                   /db_xref="UniProtKB/TrEMBL:B3PWI4"
FT                   /protein_id="ACE89052.1"
FT                   /translation="MTSSYIFLTPPGSAGTRLDETRVIRDGFTWLGLLFPWVWLLVHRL
FT                   WLYAAVAFLMQAIGGALMDEPGLWPAGAAITLGVNLLVGLEGQNIRIRALAGKGWNEEA
FT                   LIAADTIGIAEDVYFSDKAVQPDTDAAVPDWENKTRPNGPHGQATSLGLFGFDGGR"
FT   gene            complement(47677..48285)
FT                   /gene="hisB"
FT                   /locus_tag="RHECIAT_CH0000050"
FT   CDS_pept        complement(47677..48285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisB"
FT                   /locus_tag="RHECIAT_CH0000050"
FT                   /product="imidazoleglycerol-phosphate dehydratase protein"
FT                   /EC_number="4.2.1.19"
FT                   /note="GO_function: GO:0004424 -
FT                   imidazoleglycerol-phosphate dehydratase activity;
FT                   GO_process: GO:0000105 - histidine biosynthetic process"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000050"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89053"
FT                   /db_xref="GOA:B3PWI5"
FT                   /db_xref="InterPro:IPR000807"
FT                   /db_xref="InterPro:IPR020565"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR038494"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3PWI5"
FT                   /protein_id="ACE89053.1"
FT                   /translation="MAETAASRTGSVSRKTNETSISVSVNLDGTGKSKISTGVGFFDHM
FT                   LDQLARHSLIDMEIDAKGDLHIDDHHTVEDTGIAIGQAISKALGDRRGITRYASIDLAM
FT                   DETMTKAAVDLSGRPFLVWNVAFSAPKIGTFDTELVREFFQALAQNAGITLHILNHYGA
FT                   NNHHIAETCFKAVARALRTATEIDPRQAGRVPSTKGTLV"
FT   gene            48461..48988
FT                   /gene="hslV"
FT                   /locus_tag="RHECIAT_CH0000051"
FT   CDS_pept        48461..48988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslV"
FT                   /locus_tag="RHECIAT_CH0000051"
FT                   /product="ATP-dependent heat shock protease HslVU protein,
FT                   peptidase subunit HslV"
FT                   /EC_number="3.4.25.-"
FT                   /note="GO_component: GO:0005839 - proteasome core complex
FT                   (sensu Eukaryota; GO_function: GO:0004298 - threonine
FT                   endopeptidase activity; GO_process: GO:0006511 -
FT                   ubiquitin-dependent protein catabolic process"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000051"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89054"
FT                   /db_xref="GOA:B3PWI6"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR022281"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3PWI6"
FT                   /protein_id="ACE89054.1"
FT                   /translation="MTTIITVRKGGKVVMAGDGQVSLGQTVMKGNARKVRRIGKGEVVA
FT                   GFAGATADAFTLLERLEKKLEQYPGQLMRAAVELAKDWRTDKYLRNLEAMMLVADKSTT
FT                   LAITGNGDVLEPEHGTTAIGSGGNFAFAAARALMDTDKSAEEIARRALDIAADICVYTN
FT                   HNIVVESLDVEG"
FT   gene            49107..50414
FT                   /gene="hslU"
FT                   /locus_tag="RHECIAT_CH0000052"
FT   CDS_pept        49107..50414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslU"
FT                   /locus_tag="RHECIAT_CH0000052"
FT                   /product="ATP-dependent heat shock protease HslVU protein,
FT                   chaperone ATP-binding subunit HslU"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000052"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89055"
FT                   /db_xref="GOA:B3PWI7"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004491"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3PWI7"
FT                   /protein_id="ACE89055.1"
FT                   /translation="MTTFSPREIVSELDRYIIGQHEAKRAVAIALRNRWRRQQLDPSLR
FT                   DEVMPKNILMIGPTGVGKTEISRRLAKLAGAPFIKVEATKFTEVGYVGRDVEQIIRDLV
FT                   EVGIGLVREKKRAEVQAKAHVSAEERVLDALVGTTASPATRENFRKKLRDGELDDKEID
FT                   IEVADTGSGMGGFEIPGMPGANIGVLNLSEMFGKAMGGRTKKVRTTVKASYTDLIRDES
FT                   DKLIDNEVIQREAVRSTENDGIVFLDEIDKIAARDGGMGAGVSREGVQRDLLPLVEGTT
FT                   VSTKYGPVKTDHILFIASGAFHVSKPSDLLPELQGRLPIRVELRPLNKEDFRRILTETE
FT                   ASLIRQYRALMETESLSLDFTEDAIDALADVAVHLNSSVENIGARRLQTVMERVLDDIS
FT                   YNAPDRSGTAITIDAAYVREHVGDLAQNTDLSRFIL"
FT   gene            50603..51550
FT                   /locus_tag="RHECIAT_CH0000053"
FT   CDS_pept        50603..51550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000053"
FT                   /product="hypothetical conserved protein"
FT                   /note="yhch00013"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000053"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89056"
FT                   /db_xref="InterPro:IPR009842"
FT                   /db_xref="UniProtKB/TrEMBL:B3PWI8"
FT                   /protein_id="ACE89056.1"
FT                   /translation="MRRLLTSLLIAAALVNSAPAFAMQTVPAGNRHAEQPDIPGASVRR
FT                   TKGTKSSFDLKYEKVHELLATDRELMAKIRKVSGAYGINPIHVVGAIVGEHTYNVDAYD
FT                   RLQAYYVKAASYAGQSFRFAYDGESVDDFVARPQFAQCKGKSDSYTLWSCREDVWESDF
FT                   RGKTVGGESFPNNRFSAVFFQPFYAGQTFGLGQVNPLTALMLSDLVSRVSGYPKLNEKD
FT                   AGAVYKAIMDPDVSLAFVAASIRRSIDDYKEIAGMDISGNPGLTATLYNVGNSRQRAAA
FT                   LAAKNRSSGATVWPEENYYGWLINDKLDELKGLL"
FT   gene            51599..53011
FT                   /locus_tag="RHECIAT_CH0000054"
FT   CDS_pept        51599..53011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000054"
FT                   /product="probable cytochrome P450 protein"
FT                   /note="ypch00016; GO_function: GO:0004497 - monooxygenase
FT                   activity; GO_function: GO:0005506 - iron ion binding;
FT                   GO_function: GO:0020037 - heme binding; GO_process:
FT                   GO:0006118 - electron transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000054"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89057"
FT                   /db_xref="GOA:B3PWI9"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:B3PWI9"
FT                   /protein_id="ACE89057.1"
FT                   /translation="MDMRPDPFVPPAPLPRTVPPSRLDIIRIILRNPLELWGEPSYTLP
FT                   WIKTSFFGQHTLIVNDPGLIKHVLVDNANNYRMSDIRQLVLRPILRDGLLTAEGQVWKR
FT                   SRKAVAPVFTPRHAQGFAGQMLRQSEDYARKYESAGAAGAIFDISIDMTELTFAILADT
FT                   LFSGEIVTSSGSFADDVNALLHRMGRIDPMDLMRAPSWVPRVTRIGGQKVLEKFRAIVR
FT                   DTMDMRLAKMKADRAAAPDDFLTLLLEQAGPDGLTKEEIEDNILTFIGAGHETTARALA
FT                   WTLYCVSNSPHIREAMETEIDAVLATGAEPVEWLDLMPQTRAAFEETLRLYPPAPSINR
FT                   AAISDDSWTNPKGERIEIEAGVTVLIMPWTLHRHEFYWEKPRAYMPERFLPENRGSIGR
FT                   FQFLPFGAGPRVCIGATFALQEAVIALAVLMHRYRFDSTDETNPWPVQKLTTQPQNGLP
FT                   MRVTPRTVSSAV"
FT   gene            53097..55268
FT                   /gene="glcB"
FT                   /locus_tag="RHECIAT_CH0000055"
FT   CDS_pept        53097..55268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glcB"
FT                   /locus_tag="RHECIAT_CH0000055"
FT                   /product="malate synthase protein"
FT                   /EC_number="2.3.3.9"
FT                   /note="GO_function: GO:0004474 - malate synthase activity;
FT                   GO_process: GO:0006097 - glyoxylate cycle; GO_process:
FT                   GO:0006099 - tricarboxylic acid cycle"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000055"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89058"
FT                   /db_xref="GOA:B3PWJ0"
FT                   /db_xref="InterPro:IPR001465"
FT                   /db_xref="InterPro:IPR006253"
FT                   /db_xref="InterPro:IPR011076"
FT                   /db_xref="InterPro:IPR023310"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3PWJ0"
FT                   /protein_id="ACE89058.1"
FT                   /translation="MSRIDKNGLAVEAVLHDFLVQEVLPGLAIDADKFFADFSAIVHDL
FT                   APINRALLKKRDELQLKIDDWYRQHGAPTDMDDYQSFLRAIGYLLPEGSDFQVSTQNVD
FT                   PEIASIAGPQLVVPVMNARYALNAANARWGSLYDALYGTDAIPEGDGAEKGRGYNPKRG
FT                   EKVIAWVRDFLDTSVPLQDSRWKDVGSFAVRDGALIIRSTDGEQAMLRDGGHFAGYRGD
FT                   AATPTHILLKNNGIHIEIVIDAATAIGKTDPAHISDVWLESAITTIMDCEDSIAAVDAE
FT                   DKVVVYRNWLGLMKGDLQEEVAKGGASFIRKLNPDLDYTGPDGTTFELHRRSLMLVRNV
FT                   GHLMTNPAILDRDGNEVPEGIMDAVITGLIALYDIGPAGRKKNSRTGSMYVVKPKMHGP
FT                   EEVAFAVEVFSRVEDALGLARNTIKMGIMDEERRTTVNLKECIRAARERVVFINTGFLD
FT                   RTGDEIHTSMEAGPMIRKGDMRQAAWISAYENWNVDIGLECGLAGHAQIGKGMWAMPDL
FT                   MAAMLEQKIAHPKAGANTAWVPSPTAATLHATHYHRVNVAKVQQGLKDRARAKLSDILS
FT                   VPVAVRPNWSQEEIQRELDNNAQGILGYVVRWVDQGVGCSKVPDINNIGLMEDRATLRI
FT                   SAQHMANWLHHKVVSEAQIVETMKRMAAVVDRQNEQDPVYQPISGNFDGSIAFQAALDL
FT                   VLKGREQPNGYTEPVLHRRRLELKAKQAA"
FT   gene            complement(55345..56028)
FT                   /locus_tag="RHECIAT_CH0000056"
FT   CDS_pept        complement(55345..56028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000056"
FT                   /product="hypothetical conserved protein"
FT                   /note="yhch00014"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000056"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89059"
FT                   /db_xref="GOA:B3PWJ1"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:B3PWJ1"
FT                   /protein_id="ACE89059.1"
FT                   /translation="MRFRNAFPVFGLLTTLALAGCSTSSDSASVDDKGAGPTVQTAQIF
FT                   NDAYGVTKDAGYSLPAIPIDRVKPQFRRQVVSYQTTERPGTIIVNTRERFLYYILANGK
FT                   AMRYGIGVGKQGFAWAGTAYVAWKQEWPTWHPPKEMAERRPDVAKYVEDGMGPGLTNPL
FT                   GARAMYLFNEDGKDTLFRLHGTPEWASIGTAASSGCIRLMNQDVIDLYSRVRPGKDTSK
FT                   VIVIQ"
FT   gene            56208..56702
FT                   /locus_tag="RHECIAT_CH0000057"
FT   CDS_pept        56208..56702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000057"
FT                   /product="hypothetical conserved protein"
FT                   /note="yhch00015"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000057"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89060"
FT                   /db_xref="GOA:B3PWJ2"
FT                   /db_xref="InterPro:IPR009394"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/TrEMBL:B3PWJ2"
FT                   /protein_id="ACE89060.1"
FT                   /translation="MTILSVYNNNPLIDGRQSDRAMMVRKGTQILLHEMRHAVLPELPL
FT                   ASGRRADLITLSEKGEVWIIEIKTSIEDFRVDRKWPEYRLHCDRLFFATHQDVPLDIFP
FT                   EECGLFLSDGYGAHMIRDAPEHRMAPATRKSVTLNFSRAAAQRLMMAEWANGKPFTVDD
FT                   V"
FT   gene            complement(56713..57291)
FT                   /gene="actR"
FT                   /locus_tag="RHECIAT_CH0000058"
FT   CDS_pept        complement(56713..57291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="actR"
FT                   /locus_tag="RHECIAT_CH0000058"
FT                   /product="two-component response regulator protein"
FT                   /note="GO_function: GO:0000156 - two-component response
FT                   regulator activity; GO_process: GO:0000160 - two-component
FT                   signal transduction system (phosphorelay; GO_process:
FT                   GO:0006355 - regulation of transcription, DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000058"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89061"
FT                   /db_xref="GOA:B3PWJ3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B3PWJ3"
FT                   /protein_id="ACE89061.1"
FT                   /translation="MTEQNQDNFTASDEDHIGPDASLLIVDDDGPFLRRLARAMETRGF
FT                   QVETAESVAEGVAKSKGRPPKYAVVDLRLGDGNGLDVIEAIRQRRDDTRIIVLTGYGNI
FT                   ATAVTAVKLGAVDYLAKPADADDIFSALTQRPGEKAELPENPMSADRVRWEHIQRVYEM
FT                   CERNVSETARRLNMHRRTLQRILAKRAPK"
FT   gene            complement(57362..58672)
FT                   /gene="actS"
FT                   /locus_tag="RHECIAT_CH0000059"
FT   CDS_pept        complement(57362..58672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="actS"
FT                   /locus_tag="RHECIAT_CH0000059"
FT                   /product="two-component sensor histidine kinase protein"
FT                   /EC_number="2.7.3.-"
FT                   /note="GO_function: GO:0005524 - ATP binding"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000059"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89062"
FT                   /db_xref="GOA:B3PWJ4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B3PWJ4"
FT                   /protein_id="ACE89062.1"
FT                   /translation="MIDKAEGHTMEDRHSSRRLRLQTLVRLRWLAVGGQALTVFIVAFW
FT                   LKFPLPLIASSSLIAALAGVNFYLTIRYPPTHRLGPPAAFALLGFDLLQLCALLFITGG
FT                   LANPFAALVCVPVIISFASQPIRYSTALIGIAMVCITVLAFSPFPLPWFDGVEINVHNV
FT                   MQFGVWCSIASTMAFAAFYAYRVSMEASQLADALAATELVLQREKHLSQLDGLAAAAAH
FT                   ELGTPLATISVVAKEMERELKDDDRFREDVMLLRSQSERCRDILRRLTTLSSEDEAHMR
FT                   RLPLSSMIEEIVAPHREFGITLELIEKSPRKGEPVTDRNAGIMYGLGNLIENAVDYARE
FT                   KVTITVEHDHDKVLIVIEDDGNGYSPEILTRIGEPYVTKRQKEDTAGGLGLGLFIAKTL
FT                   LERSGASLVFENREAERAGARIRIEWPRMLIDANSTK"
FT   gene            complement(58700..61165)
FT                   /gene="helO"
FT                   /locus_tag="RHECIAT_CH0000060"
FT   CDS_pept        complement(58700..61165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="helO"
FT                   /locus_tag="RHECIAT_CH0000060"
FT                   /product="ATP-dependent helicase protein"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000060"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89063"
FT                   /db_xref="GOA:B3PWJ5"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR010225"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR013689"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3PWJ5"
FT                   /protein_id="ACE89063.1"
FT                   /translation="MTISPSLPELPVSHVLPAIGVALAEQKRAVLSAPPGAGKTTLVPL
FT                   YLLEQAWRGDGRIILLEPRRLAARAAASRMASLIGQQVGGTVGYRMRLDNRVSAATRIE
FT                   VVTEGVFARMVLDDPELSGISTVIFDEFHERSLDADFGLALALDVQSALREDLRILVMS
FT                   ATLDIERVAALLDYPPVIESLGRSFPIDIRYQDRPGGERIEDAVTRAIVDAHTSETGSI
FT                   LAFLPGQAEITRTAERLQGRFGPETLIAPLYGNLSQKEQDAAIRPAAAGLRKIVLATSI
FT                   AETSITIDGVRIVIDSGMQRLPVFEASTGITRLETVRVSRASADQRAGRAGRTEPGIAV
FT                   RLWHQGQTAALPAFTPPQILSSDLSGLVLDLAHWGVQDPASLAFVDQPPETTLQEARML
FT                   LGQLGALDKDGMLTARGKVMRDLALPPRLAAMVVSAGESGHARDAASIAVLLTEQGLGG
FT                   TSVDIEERLRRFKAERGERAEASRRLAGRLASGLDRVEAAAPALAGQLLLHAFPDRIAL
FT                   QRGGRGRYVMANGRGAELPETERLAGSQMLVIADLTGRAAQARVLAAAEVTRGDIEAEL
FT                   PGEIRTDDQIFFDRQSRQVRARRATRLGAIIFDETPLPRPSGAAVTQALMEGLRELGLD
FT                   QLAFSKEAIQLRERIGFLHRTIGDPWPDVGDAALLSRLDEWFAPFQSEARGLSDISAGG
FT                   LSTGLMSLVPHDLQRDLSRLAPTHFEAPTGQRHPIQYEGEEPVLTIRVQELFGLKQHPA
FT                   IAGGRLPLLLELTSPAHRPIQTTRDLPGFWAGSWRDVRAEMRGRYPRHPWPERPEEALP
FT                   TTRAKPRGT"
FT   gene            complement(61162..62109)
FT                   /gene="ocdch"
FT                   /locus_tag="RHECIAT_CH0000061"
FT   CDS_pept        complement(61162..62109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ocdch"
FT                   /locus_tag="RHECIAT_CH0000061"
FT                   /product="ornithine cyclodeaminase protein"
FT                   /EC_number="4.3.1.12"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000061"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89064"
FT                   /db_xref="GOA:B3PWJ6"
FT                   /db_xref="InterPro:IPR003462"
FT                   /db_xref="InterPro:IPR023401"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B3PWJ6"
FT                   /protein_id="ACE89064.1"
FT                   /translation="MLVLDEQQTRAALPWPELIAAIADMFGSDCVMPVRHHHEMEVPNE
FT                   ESATLLLMPAWVPGRYAGVKTVSVFPGNMRRGLPAISGTYLLSSGTTGEMLAAIDGGEL
FT                   TARRTAAASALAARYLARADAEEILVCGTGRLSLNLMLAHGTIRPIKRYRVWGRNAQAA
FT                   DKIAAEARALGLNAEAVANAEGAARKADIISCATLSSEPLISGEWLKPGAHLDLVGAFK
FT                   PSMRESDDEAIRRASVYVDTRAGAISEAGDIVQPLKSGVLRESDIRAELAELVSGAHGG
FT                   RGNETEITLFKSVGAALEDLAGAILAYETVTARK"
FT   gene            62757..64264
FT                   /locus_tag="RHECIAT_CH0000062"
FT   rRNA            62757..64264
FT                   /locus_tag="RHECIAT_CH0000062"
FT                   /product="16S Ribosomal RNA"
FT   gene            64564..64640
FT                   /locus_tag="RHECIAT_CH0000063"
FT   tRNA            64564..64640
FT                   /locus_tag="RHECIAT_CH0000063"
FT                   /product="tRNA-Ile"
FT                   /inference="ab initio prediction:tRNAscan-SE:1.23"
FT   gene            64713..64788
FT                   /locus_tag="RHECIAT_CH0000064"
FT   tRNA            64713..64788
FT                   /locus_tag="RHECIAT_CH0000064"
FT                   /product="tRNA-Ala"
FT                   /inference="ab initio prediction:tRNAscan-SE:1.23"
FT   gene            65282..68222
FT                   /locus_tag="RHECIAT_CH0000065"
FT   rRNA            65282..68222
FT                   /locus_tag="RHECIAT_CH0000065"
FT                   /product="23S ribosomal RNA"
FT   gene            68482..68600
FT                   /locus_tag="RHECIAT_CH0000066"
FT   rRNA            68482..68600
FT                   /locus_tag="RHECIAT_CH0000066"
FT                   /product="5S ribosomal RNA"
FT   gene            68702..68778
FT                   /locus_tag="RHECIAT_CH0000067"
FT   tRNA            68702..68778
FT                   /locus_tag="RHECIAT_CH0000067"
FT                   /product="tRNA-Met"
FT                   /inference="ab initio prediction:tRNAscan-SE:1.23"
FT   gene            complement(68837..69217)
FT                   /locus_tag="RHECIAT_CH0000068"
FT   CDS_pept        complement(68837..69217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000068"
FT                   /product="hypothetical protein"
FT                   /note="yhch00016"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000068"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89065"
FT                   /db_xref="GOA:B3PWJ7"
FT                   /db_xref="InterPro:IPR026851"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3PWJ7"
FT                   /protein_id="ACE89065.1"
FT                   /translation="MELRRLNGPRLVAYYTGASPPKLQKWLQDRIGTVHTFQGKEEDIV
FT                   FMVLGADADHRGAAGWAASKPNLLNVALTRAKRRFYIVGDRALWQTLPYFREAANALET
FT                   VQAREFLARNALVRDPNPVLWD"
FT   misc_feature    complement(69199..70791)
FT                   /note="yich00001; insertion sequence:Transposase, IS66"
FT   misc_feature    complement(70866..71210)
FT                   /note="yich00002; insertion sequence:Transposase
FT                   (putative), IS66 Orf2 like"
FT   misc_feature    complement(71207..71557)
FT                   /note="yich00003; insertion sequence:Transposase IS3/IS911"
FT   gene            complement(71673..74753)
FT                   /locus_tag="RHECIAT_CH0000069"
FT   CDS_pept        complement(71673..74753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000069"
FT                   /product="hypothetical conserved protein"
FT                   /note="yhch00017"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000069"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89066"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3PWJ8"
FT                   /protein_id="ACE89066.1"
FT                   /translation="MQTDADRAERERLLAILDFWHKIEFFIPYDLSRRLVPAEGRTVFW
FT                   LHAKTLLQDGAALSRPVIPEEKQITGFTLFLGVFSKSEIVDIRRHFDGVAADIAEYEDA
FT                   ERSDLDGDTCFTSLQLTPLGQPMFETFAVSTLPWALGRVQKSGLASLSHEAFADSKRQL
FT                   AELLQNFRAQRQLASSSFEASTDQPIDAAEILALHEMLCDWAGFVSRQEMPVAAVEIRY
FT                   RDKAERPDLISLQPQLEDNAPNADDAEDESADVEEDIGILNSFFVEDIERAMVRVKQGN
FT                   VPEPLRRYLTPLAREKRIDLYSQDGRAAIVRALHPANLNRGRWLSESHHTMSLMQQFAI
FT                   NSAIGDRSETGLFSVNGPPGTGKTTLLRDMFADNIVRRARILGRLETARDAFDGAPRRI
FT                   TFADRSTASISVLIPALAGFEMIVASSNNAAVENISRDLPKQSSTSQKSSFHYLQTVAH
FT                   KVACQKDNGGVIKLSDGDRPWGLIACALGNSRNRRAFKERFAFMEIPDRPKPGWSGAQK
FT                   PQTIWEWLKSYEGPTFAEASAAFHAADDVVRDKIGQYARYADLRDEIALVAQDAFCRET
FT                   LEKLAAAAGDLRHAQNRCDEVVAEMGRIKDSLSSLKEEEQLLDRSAPARWKRMLATNPA
FT                   RQHRQDVVANARKQLDLRKALAECEYRLAKAEKPVLERALRAHDQAERALRSRLKIWMA
FT                   KTEELERLGEILDHPAAPEHLADLDSDQVQIDGLWHGDELAALRSALFEAALTLHEAWL
FT                   AEVGRKGGGFGGNIVAISKLLSNNNPVDDKHIASIWQSLFMVVPVVSTTFASFARQFRG
FT                   LDAGSIGWVFIDEAGQAVPQAAVGALLRARRVMVIGDPQQIEPVFTLPSALISAASALS
FT                   PHTAQGQYSPNRVSVQMLADAANRYGTTLQDEEADGLWIGSPLRVHRRCIDPMFSLANQ
FT                   IAYQNKMIFGLAERRPAGDAPPFYGDSAWIDVKGKVSGKQAVAEQTNFIVDLLTATWRR
FT                   SDALPDLYIISPFKEVKNSLRRALVQARWIDQDGYTG"
FT   gene            75216..75998
FT                   /locus_tag="RHECIAT_CH0000070"
FT   CDS_pept        75216..75998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000070"
FT                   /product="probable transcriptional regulator protein, LuxR
FT                   family"
FT                   /note="ypch00017; GO_component: GO:0005622 - intracellular;
FT                   GO_function: GO:0003700 - transcription factor activity;
FT                   GO_function: GO:0043565 - sequence-specific DNA binding;
FT                   GO_process: GO:0006355 - regulation of transcription,
FT                   DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000070"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89067"
FT                   /db_xref="GOA:B3PWJ9"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B3PWJ9"
FT                   /protein_id="ACE89067.1"
FT                   /translation="MFMTGAGMENTDQARKSSHSGDTIVVVAKADLFSECMVEALAKKF
FT                   PNCDVPSISNTNPMLEKDTSELKLVLFYHIPQPELQEALKAVRENHPEASIGLVVEAID
FT                   MLEPYVSRLVEARIIDGVLPLNLRLDVFMAAVDLLMKGGEHFPSALLNRLANKSAQLEP
FT                   SLYQTKSVDVARNNALKLRRDSISALTTREVQILDLICKGTQNKIIADKLHLSENTVKV
FT                   HVRNIYKKMNVRNRTEAASRFFNEHPAGDDEMSSRWRN"
FT   gene            complement(76101..76457)
FT                   /locus_tag="RHECIAT_CH0000071"
FT   CDS_pept        complement(76101..76457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000071"
FT                   /product="hypothetical conserved protein"
FT                   /note="yhch00018"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000071"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89068"
FT                   /db_xref="UniProtKB/TrEMBL:B3PWK0"
FT                   /protein_id="ACE89068.1"
FT                   /translation="MHPEAPYARGLGMSKKQAAAQPKGWRLFHFAMLAWGTTLLAVGPT
FT                   ACAVVDDDIAAVAKKNVIVEAPRVAKAYAYPDNRAVRPAPASARVVAYHGSAPYICSPS
FT                   GFGQKSRCFARPSI"
FT   gene            76807..77829
FT                   /locus_tag="RHECIAT_CH0000072"
FT   CDS_pept        76807..77829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000072"
FT                   /product="probable dTDP-glucose 4,6-dehydratase protein"
FT                   /EC_number="4.2.1.46"
FT                   /note="ypch00018; GO_function: GO:0003824 - catalytic
FT                   activity; GO_function: GO:0050662 - coenzyme binding;
FT                   GO_process: GO:0044237 - cellular metabolic process"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000072"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89069"
FT                   /db_xref="GOA:B3PWK1"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B3PWK1"
FT                   /protein_id="ACE89069.1"
FT                   /translation="MRSFVPGASYSEVEGVPVLKNLGAALVNGGAGFLGSHLCERLLLR
FT                   GYSVICLDNFSTGRRVNVDHLQSNPRFRIIEHDVRQPFDIAASLIFNFASPASPPDYQR
FT                   DPVGTLLTNVLGAVNTLDCGRKTGAIVVQSSTSEVYGDPSQSPQRETYCGNVNPIGPRA
FT                   CYDEGKRSAETLFFDYHRTYGVDIKIGRIFNTYGPRMRLDDGRVVSNFIVQALRNADLT
FT                   IYGDGQQTRSFCYVDDLVEGFLRLSAAGSACHGPINLGNPGEFTVRRLAEIIRDLTNSR
FT                   SRIVHLPAVVDDPRQRRPDITRAMTELGWQPQIALEAGLARTVEYFDGLLARTERAEAV
FT                   "
FT   gene            77831..78814
FT                   /gene="galE1"
FT                   /locus_tag="RHECIAT_CH0000073"
FT   CDS_pept        77831..78814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="galE1"
FT                   /locus_tag="RHECIAT_CH0000073"
FT                   /product="UDP-glucose 4-epimerase protein"
FT                   /EC_number="5.1.3.2"
FT                   /note="GO_function: GO:0003824 - catalytic activity;
FT                   GO_function: GO:0050662 - coenzyme binding; GO_process:
FT                   GO:0044237 - cellular metabolic process"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000073"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89070"
FT                   /db_xref="GOA:B3PWK2"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR005886"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B3PWK2"
FT                   /protein_id="ACE89070.1"
FT                   /translation="MPRYILVTGGAGFIGSHICKALSRAGMTPVTYDNLSTGHADSVRW
FT                   GPLIRGELGDAVALRRTMAEFSPDCVIHCGANAYVGESVEMPRKYYRNNVVGSLTLLEA
FT                   CLDQDIDRIVFSSTCATYGVPASLPIREETPQQPVNPYGRTKLIFEMALEDFAAAYGIR
FT                   FAALRYFNAAGADPDGELAERHEPETHLIPRALLAAAGKLERLDIFGTDYSTADGTCVR
FT                   DYIHVSDLAQAHLAAVNHLMAGGGSLSVNLGSGRGISVREILAAIHRTTGREVPVRYRS
FT                   RRAGDPPILFANTARAKAELGFAPTLSDIDTIIRTAGPTFGLQVTA"
FT   gene            78811..80682
FT                   /locus_tag="RHECIAT_CH0000074"
FT   CDS_pept        78811..80682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000074"
FT                   /product="probable cellulose synthase protein"
FT                   /note="ypch00019"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000074"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89071"
FT                   /db_xref="GOA:B3PWK3"
FT                   /db_xref="InterPro:IPR025993"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B3PWK3"
FT                   /protein_id="ACE89071.1"
FT                   /translation="MSDASHIGYGLAPAKAATSTQAFDPVFTGRKRVAYGFGILCWLAA
FT                   LGFFWIWWCQSAHIISWTAFVLITAVLAWITLVPAYFILIFLDARTISSRVRPPEGRVA
FT                   MVVTKAPSEPFAVVRATLQAMLDQIGVEFDVWLADEDPSEETRRWCAEHGVLISTRKGV
FT                   AEYHRTTWPRRTRCKEGNLAYFYDHFGYARYDFVAQFDADHVPTPTYLREVLRPFADPD
FT                   VGYVSAPSICDANAAASWAARGRLYAEASLHGSLQIGYNNGWAPLCIGSHYAVRTSALR
FT                   EIGGLGPELAEDHSTTLMMNAGGWRGVHAVDAIAHGDGPANFVDLAVQEFQWSRSLVTI
FT                   LLQHSRRYLTHLPWRLKFQFVFSQLWYPLFSAFMAVMFLLPAAALLTGHVFVNVTYPDF
FT                   LLHFAPISIVLTLFAFFWRATATFRPHDAKLFGWEGLAFIFLRWPWSLAGSLAAVRDHV
FT                   SGSFVDFRITPKGRQQQQSLPLRVVAPYIGLAGLCAVAMVFATDVAAAQGFYIFAAMNL
FT                   SIYLLLTVLIVLRHAIENGLPLLPQSRGLWLATATGLAICITGGTQVGGHGLRSLEALS
FT                   HGQSFISFSQSQYAVAGAGLGGGKTRIVKFRLRWNGFGRMGRDEQGV"
FT   gene            80716..81237
FT                   /locus_tag="RHECIAT_CH0000075"
FT   CDS_pept        80716..81237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000075"
FT                   /product="hypothetical conserved protein"
FT                   /note="yhch00019"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000075"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89072"
FT                   /db_xref="InterPro:IPR009337"
FT                   /db_xref="UniProtKB/TrEMBL:B3PWK4"
FT                   /protein_id="ACE89072.1"
FT                   /translation="MRIGSRLYRAALALSLCLPLAAQAAEIAKKDEPTPLSAYELYRIY
FT                   GDRTWTWDTGGGRFIEDGRRFVAWVNDKGKQSFAEGKWVVDDLGQLCMRATWTNAEGAA
FT                   RASTCFGHRKIGNTIYQRRQPNGNWYVFRHSSVHQDDEFRKLVAADTVSDKAHDLKQLL
FT                   LDQELARKGG"
FT   gene            81241..82212
FT                   /locus_tag="RHECIAT_CH0000076"
FT   CDS_pept        81241..82212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000076"
FT                   /product="putative polysaccharide degradation protein"
FT                   /note="ypch00020"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000076"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89073"
FT                   /db_xref="GOA:B3PWK5"
FT                   /db_xref="InterPro:IPR000805"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR022790"
FT                   /db_xref="UniProtKB/TrEMBL:B3PWK5"
FT                   /protein_id="ACE89073.1"
FT                   /translation="MKKEMKNHLSTAAIALLLLCVADLPGRSEVQYAGIAPNQASAMRT
FT                   IIDKRPVVHADGIKFGAYDPHGDFGAQTNVTTEALFLPWEDVDLETLRIADAYAQARGR
FT                   NLLITVEPWSWDVDWRLTSDELRRKVLRGDYDVNMRAIAQMISQLKSPVIVRWGQEMED
FT                   KSGRFSWSGWNPQDYITAYKRMMDIVRDEAPGTELMWSPKGEPGLDAYYPGDDYVDLVG
FT                   LSVFGLQRYDELAYNKHRTFSEALKQGYDLVAGYGKPVWVAELGYEGGDAYMRPWIETA
FT                   TLKQSAFPNLQEVVYFNDRDVHAWPFNLGRPDWRVVESLAAN"
FT   gene            complement(82318..83604)
FT                   /locus_tag="RHECIAT_CH0000077"
FT   CDS_pept        complement(82318..83604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000077"
FT                   /product="putative sugar ABC transporter, substrate-binding
FT                   protein"
FT                   /note="ypch00021; GO_function: GO:0005215 - transporter
FT                   activity; GO_process: GO:0006810 - transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000077"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89074"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:B3PWK6"
FT                   /protein_id="ACE89074.1"
FT                   /translation="MQVNRRSFLMGSAGAAAGLAFGAGSAIPAFAADTSLRAMWWGSND
FT                   RAKRTLDVAKLYQSKTPGVTIVGESLSGDGYWTKLATQMAGRSIADVFQLEPGTISDYS
FT                   KRGACMPLDEFVPSALKVQSFGADMLKLTTIDGKLYGVGLGLNSFSMFFDTVEFEKAGI
FT                   PLPTPDLTWDEYAKLAVELAKSSGKSGGPYAARYAYVFDAWLRQRGKSLFAREGVGLGF
FT                   AADDATEWFDYWEKLRKAGGTVAADVQTLDQNTIDTNALGLGKSVIGMAYSNQMIGYQL
FT                   IIKNKLGITMLPREKKGGPSGHYYRPALIWSVGATTKNGEAAAKFIDFFVNDIEAGKIL
FT                   GVERGVPMSPTVREAILPQLNPTEQETVKYVNMLKDQVGEYPPPVPMGATQFDQRVLRP
FT                   ICDELAFERTSPADAATRLVEEGKATLKG"
FT   gene            83749..84780
FT                   /locus_tag="RHECIAT_CH0000078"
FT   CDS_pept        83749..84780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000078"
FT                   /product="probable transcriptional regulator protein, LacI
FT                   family"
FT                   /note="ypch00022; GO_component: GO:0005622 - intracellular;
FT                   GO_function: GO:0003700 - transcription factor activity;
FT                   GO_process: GO:0006355 - regulation of transcription,
FT                   DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000078"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89075"
FT                   /db_xref="GOA:B3PWK7"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B3PWK7"
FT                   /protein_id="ACE89075.1"
FT                   /translation="MNDQKIRRPRQADIATLAGVSVSTVSRVLANEPGISETVRRQILK
FT                   VAAEHGYPVKPATEAVAGGLALIASDGVTGGLSVFYEAIVEGLRVGAAEAGMPFEVRMV
FT                   REERITPDAARDYMQAAAAEGLFLVGIDPNDMLRDWLQDTMVPTVLVNGTDPGMRFDGV
FT                   SPANFFGAYQAAGRLTKAGHRRILHLSGSHRQTIHERIRGFEAAIAAVPGAEGRFVAMT
FT                   LQGSASREAHERTAAILAENAGFTAAFCMNDFIAVGVLEAVIEAGLRVPEDFAIVGFDD
FT                   LPCALMTNPQLSTMRVDRAALGREAISLMLSRFRDRTAPARHICQAVIPVAGGTVVNVE
FT                   PRE"
FT   gene            84785..86641
FT                   /locus_tag="RHECIAT_CH0000079"
FT   CDS_pept        84785..86641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000079"
FT                   /product="hypothetical conserved protein"
FT                   /note="yhch00020"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000079"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89076"
FT                   /db_xref="InterPro:IPR016624"
FT                   /db_xref="UniProtKB/TrEMBL:B3PWK8"
FT                   /protein_id="ACE89076.1"
FT                   /translation="MTYDPASANPLAGNPLETRADMSRALLDLFDPLLACFSKGNARVR
FT                   LSGAAAHFDRAAADLEGFARPLWGLAPLGAGNGDFAHWHRFAEGLANGTDPAHPEYWGT
FT                   VNGRDQRMVELAALGFALALVPEKIWEPLDGRARSNVIAYLKHARQFDYADNNWKFFRI
FT                   FVDIALDRLGADFDRSLTRQYLEELEGFYIGDGWYRDGNVRRIDHYIPFAMHFYGLIYS
FT                   KLVDDDYARRYRERAILFARDFRHWFAADGATIPFGRSLTYRFACAGFWSALAFAGVEA
FT                   LPWGEVKHLCLQHLRWWRDKPIADRDGVLSIGFGYPNLLMSESYNSAGSPYWALKAFLP
FT                   LAIPQDHPFWTAEERAPERSSAAVPQRHPGMVIMRAGGDVVALSSGQENLQMRFGTEKY
FT                   TKFAYSSRYGFSVESDERGFALAAFDSMLAFSDDGLHYRVRETNEEARLAGDVLYAKWS
FT                   PFPDVSIESWLAPAAPWHIRLHRIRAARPLRVAEGGFAIARRDFELDTLSASDGAAYAI
FT                   GEADFSGILDLGSSVERVGLAQKAQPNTNVIVAKTIVPQLRGQIRAGETILMTAVLALD
FT                   DPAAVASAWTRPPKAPDIAALEALVREKGVTVSAVEAPGQMP"
FT   gene            86638..87648
FT                   /locus_tag="RHECIAT_CH0000080"
FT   CDS_pept        86638..87648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000080"
FT                   /product="probable D-2-hydroxyacid dehydrogenase protein"
FT                   /note="ypch00023; GO_function: GO:0016616 - oxidoreductase
FT                   activity, acting on the CH-OH group of donors, NAD or NADP
FT                   as acceptor; GO_function: GO:0048037 - cofactor binding"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000080"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89077"
FT                   /db_xref="GOA:B3PWK9"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B3PWK9"
FT                   /protein_id="ACE89077.1"
FT                   /translation="MNRPAIVLAMEPSRTEHVLPDAILRRLDTIGRLLDPEPLQRLDDA
FT                   RARRLLSEAEILITGWGAAYVGPEIAAVAPRLRLIVHAAGTVKGIIDEAIFDAGITVSH
FT                   SAEANAVPVAEFTLAAILFAGKRAFRFRDLYVADRNRDRTYPMQREAIGNYGRTLGIIG
FT                   ASRIGRRVIELLKPFEYRLLLFDPMVDAAEAAGLGAEKVELDELMRRADIVSLHAPSLP
FT                   STQHMIDASRLSLLKDGATLINTARGILIDEAALLSELKTGRIDAVIDVTDPEIPEAGS
FT                   LFYDLPNVFLTPHIAGAIGLERARLGAMAADEVERFTTGRPLLYQIRRQDLENIA"
FT   gene            complement(87672..88949)
FT                   /locus_tag="RHECIAT_CH0000081"
FT   CDS_pept        complement(87672..88949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000081"
FT                   /product="putative oxidoreducatse protein"
FT                   /note="ypch00024; GO_function: GO:0016491 - oxidoreductase
FT                   activity"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000081"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89078"
FT                   /db_xref="GOA:B3PWL0"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B3PWL0"
FT                   /protein_id="ACE89078.1"
FT                   /translation="MEKRRFALIGTGNRGTTMWGKDLLAGWREHVDLTAIVEKNSLRGE
FT                   RARNMIGSNAPLYENIDSMLAEQKPDLVIVCTPDQTHDDIIVRALESGIDVITEKPMTT
FT                   SIEKIRRILDAEKRTGRRVDVSFNYRYAPTAAKIKELLNAGEIGRVTSVDFHWYLNTKH
FT                   GADYFRRWHAYTENSGSLFVHKATHHFDLLNWYLDSDPEAVTSFADLQNYGRKGPFRGP
FT                   RCKLCPHAHECDYYLDLEKDPFLDQLYEEPSKIDGYFRDGCVFREDIDIPDTMVVSLRY
FT                   RNNVHVSYSLNTFQPIEGHHLAFNGTKGRIEIRQYEAQPWEEPKEDTILLIRNFPNGKE
FT                   AVERIIVPHFTGGHYGGDDRMRNMIFKPDMEDRLSQRAGTRAGAMSVLCGIAALTSSRT
FT                   GKVVDIAELMPELANDGSPNSLRTPR"
FT   gene            complement(88991..89821)
FT                   /locus_tag="RHECIAT_CH0000082"
FT   CDS_pept        complement(88991..89821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000082"
FT                   /product="putative xylose isomerase domain protein"
FT                   /note="ypch00025"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000082"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89079"
FT                   /db_xref="GOA:B3PWL1"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:B3PWL1"
FT                   /protein_id="ACE89079.1"
FT                   /translation="MQVEGLSINLATIREQCGFAEAVDICLKHGITSIAPWRDQVAKAG
FT                   LDEAVRIVKSNGIKLTGLCRGGFFPAANEADWQKNLDDNRRAIDEAAAFSADCLVLVVG
FT                   GLPGASRDIVAARQMVFDGIAAVLPHAQASGVKLAIEPLHPMYAADRSCVNTLAQALDM
FT                   CEPLGEDVGVAIDVYHVWWDPDLANQIARAGRMKRIFAHHICDWLVPTKDMLLDRGMMG
FT                   DGVIDLKGIRRMIEAAGFFGAQEVEIFSAETWWKRPADQVIATCVERFRSCCQI"
FT   gene            complement(89852..91015)
FT                   /locus_tag="RHECIAT_CH0000083"
FT   CDS_pept        complement(89852..91015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000083"
FT                   /product="hypothetical conserved protein"
FT                   /note="yhch00021"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000083"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89080"
FT                   /db_xref="InterPro:IPR009334"
FT                   /db_xref="UniProtKB/TrEMBL:B3PWL2"
FT                   /protein_id="ACE89080.1"
FT                   /translation="MTTINLPLDGKIVPYTLTGAPIELKKRDAKAFPRIAFAAAHVVAD
FT                   PLVDNDPWLTPAIDWERTLAFRHRLWDLGLGVAEAMDTAQRGMGLGWPEARDLIRRALR
FT                   EAADRKDALIACGAGTDHLIPGPEVTIDTIIKAYEEQIETVEAAGGRIILMASRALAVA
FT                   SKGPDDYGRVYDRILRQVKEPVIIHWLGEMFDPALQGYWGNDDHLKAMETCLEVIEANA
FT                   GKVDGIKISLLSKEKEVTMRRRLPKGVRMYTGDDFNYAELIAGDEEGHSDALLGIFDAI
FT                   APAASAALDALGRKSNHEFFDLLEPTVPLSRHIFKAPTRFYKTGVVFLAYLNGLQDHFV
FT                   MVGGQQSTRSLTHLVELFRLADKARVLTDPELATARMKQVLAVHGVH"
FT   gene            complement(91019..92167)
FT                   /locus_tag="RHECIAT_CH0000084"
FT   CDS_pept        complement(91019..92167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000084"
FT                   /product="putative oxidoreductase protein"
FT                   /note="ypch00026; GO_function: GO:0016491 - oxidoreductase
FT                   activity"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000084"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89081"
FT                   /db_xref="GOA:B3PWL3"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B3PWL3"
FT                   /protein_id="ACE89081.1"
FT                   /translation="MARLGIILHGVTGRMGYNQHLVRSILAFRDQGGITLKSGEKLEID
FT                   PIIVGRNGAKMEELAKKHNIKRWSTDLDAALANPDDTIFFDAGTTLMRAELLSRALDAG
FT                   KHVYCEKPISDDLQVAIDLARKARRSGLKHGVVQDKLFLPGLRKLALLKDSGFFGKILS
FT                   VRGEFGYWVFEGDWGVPAQRPSWNYRKGDGGGIILDMLCHWRYVLDNLFGEVKAVSCLG
FT                   ATHIPRRIDEQGKPYDCDTDDAAYATFELEGGVIAQVNSSWAVRVRRDDLVTFQVDGTH
FT                   GSAVAGLTKCWSQHRVNTPKPVWNPDQPQTIDFYKTWDEVPDTQAFDNGFKAQWEMFIR
FT                   HVVEDAPWPYGLEAGAKGVQLAELGLKSWAERRWLDVPALEF"
FT   gene            complement(92298..92975)
FT                   /locus_tag="RHECIAT_CH0000085"
FT   CDS_pept        complement(92298..92975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000085"
FT                   /product="probable transcriptional regulator protein, TetR
FT                   family"
FT                   /note="ypch00027; GO_function: GO:0003700 - transcription
FT                   factor activity; GO_process: GO:0006355 - regulation of
FT                   transcription, DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000085"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89082"
FT                   /db_xref="GOA:B3PWL4"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039419"
FT                   /db_xref="UniProtKB/TrEMBL:B3PWL4"
FT                   /protein_id="ACE89082.1"
FT                   /translation="MNDSGGSRDKKQTRRPSTERTAQRDPERTRAAILEAATREFAENG
FT                   MGGARVDAIAERAGTNKRMLYHYFGDKEQLYLKVLEEAYVGIRTAERALHIGDRSPEEG
FT                   IGELALFTWRYFLQHPEFLSLLGTENLHRARWLRQSVRLKELHSHLIGELSEVLEQGKK
FT                   QGVFVETADPLHVYLTIASLGYFYLSNQYTLSTIFGRDLIEPANLNAWESHIVHVTLAS
FT                   IKR"
FT   gene            93238..94524
FT                   /locus_tag="RHECIAT_CH0000086"
FT   CDS_pept        93238..94524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000086"
FT                   /product="probable sugar ABC transporter, substrate-binding
FT                   protein"
FT                   /note="ypch00028; GO_function: GO:0005215 - transporter
FT                   activity; GO_process: GO:0006810 - transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000086"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89083"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:B3PWL5"
FT                   /protein_id="ACE89083.1"
FT                   /translation="MTLRVSRRNFVAGSAALLSLSALGTSALAEETRLRLLWWGSQPRA
FT                   DRTNKVSELYKTKNAGTSITGEFLGWADYWPRLATQVAGRNAPDIIQMDYRYIVEYARR
FT                   GALAPLESYMPSKLQLDDFDPAQIEGGKVDGHFYGVSLGANSAATVLNSAAFKEAGIDM
FT                   PTQKTTWEEFGKIGAEMTKAGKRKGYFGFADGSGVEPALENYLRQRGKALYTADAKIAF
FT                   GAEEATEWFDMWAKFREAGACVTPDIQALYKDTIDTSPLTLGKAACDYAHSNQFVGYQA
FT                   MVKDKLALTNYMRITPDSKGGHYRKPSMFFSVSAQSKVMDQAVDYINFFVKNPDAAMIL
FT                   DVERGIPESKAMRDVVATKLDETGKVPLDYVAGLGDLAGPLPPPPPTGAGESTLILRNI
FT                   AEQIAFGQISPADGGKQLVDGITQILARG"
FT   gene            94531..95490
FT                   /locus_tag="RHECIAT_CH0000087"
FT   CDS_pept        94531..95490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000087"
FT                   /product="probable sugar ABC transporter, permease protein"
FT                   /note="ypch00029; GO_component: GO:0016020 - membrane;
FT                   GO_function: GO:0005215 - transporter activity; GO_process:
FT                   GO:0006810 - transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000087"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89084"
FT                   /db_xref="GOA:B3PWL6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B3PWL6"
FT                   /protein_id="ACE89084.1"
FT                   /translation="MSNAMRTPAGAIPVERYQGAVAEGRFRRLWNANAPGYLFLLPWLI
FT                   GFFGLTLGPALISLYLSFTDFDMLRSPSWVGTANYVRIATADPKFSAAMHVTLTYVVFS
FT                   VPFKLTFALLVAMALNRGLRGLPIYRAIFYLPSLLGGSVAIAVLWRQLFASDGLVNAAL
FT                   LHFGIEGPSWISHPNYSIYTLVALSVWQFGSPMIIFLAGLRQIPQDMYEAASLDGASKF
FT                   RQFHKITLPLLTPVIFFNAVVQTIEAFKAFTPAFIISGGTGGPINSTLFYTLYLYQEAF
FT                   GNFRMGYASALAWILVVIIAIFTAFSFLTSRYWVHYDD"
FT   gene            95483..96370
FT                   /locus_tag="RHECIAT_CH0000088"
FT   CDS_pept        95483..96370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000088"
FT                   /product="probable sugar ABC transporter, permease protein"
FT                   /note="ypch00030; GO_component: GO:0016020 - membrane;
FT                   GO_function: GO:0005215 - transporter activity; GO_process:
FT                   GO:0006810 - transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000088"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89085"
FT                   /db_xref="GOA:B3PWL7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B3PWL7"
FT                   /protein_id="ACE89085.1"
FT                   /translation="MTEMTASVTAARPPSDITKRSLPASLIIHALLIAASLLMLYPLLW
FT                   MVSASVRPENEIFSSTSLIPSAVDFSSYVRGWTGLDVSFGRFFWNSLVISLLVVTGNVI
FT                   ACSLTAYAFARLRFAGRNFWFAIMLGTLMIPYHVTLIPQYVLFLDLGWVNTILPLVVPK
FT                   FLASDAFFIFLMVQFFRGIPRELDEAAMMDGCSAWRIYWKIMLPLSLPVLATAAIFSFI
FT                   WTWDDFFGPLIYLNDMNTYTIQLGLRTFVDSTSASDWGGLFAMSTLTLVPVFFFFLFFQ
FT                   RLLIEGIATTGMKR"
FT   gene            96394..97467
FT                   /locus_tag="RHECIAT_CH0000089"
FT   CDS_pept        96394..97467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000089"
FT                   /product="putative oxidoreductase protein"
FT                   /note="ypch00031; GO_function: GO:0016491 - oxidoreductase
FT                   activity"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000089"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89086"
FT                   /db_xref="GOA:B3PWL8"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B3PWL8"
FT                   /protein_id="ACE89086.1"
FT                   /translation="MSVKTVAIVGCGIGRSHIVEGYLPHADKFKVVAICDLNGERLQAV
FT                   GDEFGIERRTTSFAELLADETIDIIDICTPPGVHLEQVVAALAAGKHVVCEKPLTGSLA
FT                   AVDTIMAAEKAAKGVLMPIFQYRYGDGIQKAKRIIDAGIAGKAYTASVETFWLRKPEYY
FT                   AVPWRGKWATELGGVLVTHALHLHDMMMHLMGPAARVFGRVATRVNDIEVEDCASVSLL
FT                   MESGAFVSLSCTLGSQEQLSRLRLHFENVTFESSHEPYTPGKDPWKIIAANDDIREKIN
FT                   RVIADWQPVAPRFTTQMGQFHAFLSGQGPLPVTTVDARRALELVTAIYQSSDSGAEVSL
FT                   PVGPDSPKYADWRARTR"
FT   gene            97505..98581
FT                   /locus_tag="RHECIAT_CH0000090"
FT   CDS_pept        97505..98581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000090"
FT                   /product="probable sugar ABC transporter, ATP-binding
FT                   protein"
FT                   /note="ypch00032; GO_function: GO:0005524 - ATP binding;
FT                   GO_function: GO:0016887 - ATPase activity"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000090"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89087"
FT                   /db_xref="GOA:B3PWL9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005116"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040582"
FT                   /db_xref="UniProtKB/TrEMBL:B3PWL9"
FT                   /protein_id="ACE89087.1"
FT                   /translation="MATSVVLQKVEKRYGAMDVIHGIDLTIDPGEFVVFVGPSGCGKST
FT                   LLRMIAGLEEISGGGLLLDNERMNEVAPAKRGIAMVFQSYALYPHMSVYKNLAFGLETA
FT                   GYKKADIQPKVKRAAEILQIEKLLERKPKALSGGQRQRVAIGRAIVREPRIFLFDEPLS
FT                   NLDAELRVQMRVEISRLHRQLGNTMIYVTHDQVEAMTMADKIVVLNSGRIEQVGAPLDL
FT                   YNNPANRFVAGFIGSPKMNFLKARIEEVGETETSIHVCGNSVRLPRRLKSEPGEAVTFG
FT                   IRPEHLSLTQGAITLSTVNVDLVENLGGATMLYTTTPDGQLLTIALDGQQKVEPGANVQ
FT                   ALFDPARCHVFDAAGKTI"
FT   gene            98680..99555
FT                   /locus_tag="RHECIAT_CH0000091"
FT   CDS_pept        98680..99555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000091"
FT                   /product="putative ethanolamine kinase protein"
FT                   /EC_number="2.7.1.82"
FT                   /note="ypch00033"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000091"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89088"
FT                   /db_xref="GOA:B3PWM0"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:B3PWM0"
FT                   /protein_id="ACE89088.1"
FT                   /translation="MTPEDRIHALGIWQGPIEISPISGGITNRNYLVSDAVARCVVRLG
FT                   ADIPIHHILRQNELAASRAAHAAGLSPAVIHHSPGVLVLDYIEARALSPEDIRTPDMLA
FT                   RVVPLVRACHHDIARHFRGPAMIFWVFHVIRDYAASLKESGSPHLPLLPALIAKAERLE
FT                   AAAAPFEIAFGHNDLLAANFLDDGKRLWLIDWDYAGFNTPLFDLGGLASNNEFSQATEQ
FT                   MMLETYFDRPLTAELSCRYGAMKCASLLRETLWSMISEIHSTIQFDYAAYTAENLGRFE
FT                   RAYQAFEQER"
FT   gene            99556..102006
FT                   /locus_tag="RHECIAT_CH0000092"
FT   CDS_pept        99556..102006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000092"
FT                   /product="probable sarcosine dehydrogenase protein"
FT                   /EC_number="1.5.8.3"
FT                   /note="ypch00034; GO_function: GO:0016491 - oxidoreductase
FT                   activity; GO_process: GO:0006118 - electron transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000092"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89089"
FT                   /db_xref="GOA:B3PWM1"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="InterPro:IPR032503"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B3PWM1"
FT                   /protein_id="ACE89089.1"
FT                   /translation="MTKQLPKTAKAVVIGGGIIGCSTAYHLGKLGWTDTVLLERKKLTS
FT                   GTTFHAAGLVGQLRSSANITQLLGYSVDLYKRLEEETGLGTGWKMNGGLRLACNEERWT
FT                   EVKRQATTAQSFGLEMQLLTPQEAFDLWPLMTIDDLVGAAFLPTDGQANPSDITQALAK
FT                   GARMAGVSIFEDTEVLDLDIDKGRIRAVITAEGRIECERVVVCAGQWTRAFAARFGVNV
FT                   PLVSVEHQYIITESFGVPSNLPTLRDPDRLTYYKEEVGGIVMGGYEPNPIPWAEKAIPE
FT                   GFHYTLLDSNFDHFEQIMEQALGRVPALENVGVKQLLNGPESFTPDGNFILGEAPELKN
FT                   FFVGAGFNAFGIASAGGAGMALAEWVTKGEPPYDLWPVDIRRFGRPHFDTDWVRTRTLE
FT                   AYGKHYTMAWPFEEHSSGRPCRKSPLYDRLKAQGACFGEKLGWERPNWFGDLFANEEPK
FT                   DIYSYGRQNWFDAVGREHKAVREAAVIFDQTSFAKFVLKGSDAEAALSWIAANDVARPV
FT                   GSLIYTQMLNDKGGIECDLTVARIAENEYYIVTGTGFATHDFDWIARNIPAEMHAELID
FT                   VTSAYSVLSLMGPNARAVLEKVTGSDVSNTAIPFGQVKTIGISGCPVRALRITYVGELG
FT                   YELHVPIEYATAVYDALMASGGELGLVNAGYRAIESCRLEKGYRAWGSDIGPDHTPVEA
FT                   GLGWAVKIRKNIPFRGREAIERQLAGGVKKRLACFVPDDPDIVLLGRETIYRNGKRVGW
FT                   LSSGGFGYTLGKPIGYGYVRNADGVTEDFILSGSYELDVARERIPCKVSLAPLYDPDMA
FT                   RVKA"
FT   gene            complement(102290..103747)
FT                   /gene="uxuB"
FT                   /locus_tag="RHECIAT_CH0000093"
FT   CDS_pept        complement(102290..103747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uxuB"
FT                   /locus_tag="RHECIAT_CH0000093"
FT                   /product="D-mannonate oxidoreductase protein"
FT                   /EC_number="1.1.1.57"
FT                   /note="GO_function: GO:0016491 - oxidoreductase activity;
FT                   GO_function: GO:0050662 - coenzyme binding"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000093"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89090"
FT                   /db_xref="GOA:B3PWM2"
FT                   /db_xref="InterPro:IPR000669"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013118"
FT                   /db_xref="InterPro:IPR013131"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR023027"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B3PWM2"
FT                   /protein_id="ACE89090.1"
FT                   /translation="MTERLQTLSGLAPTAKLPAYDRSQLKSGILHLGPGAFFRAHFAPF
FT                   TDGALTAAGGDWGIEVASLRTPDVADNLSAQDGLYTTLIRDTSGTTAEVIGSILKAHVA
FT                   PRDPAGLLGRLEDPAIRIVSMTVTEKAYGFDPATGGLDLKHPDIVADLANRHAPRGVIG
FT                   YLVEGLARHRQKGIAPFTPLSCDNLPSNGAVLKRLVLEFTSRIDADLHRWIEANVPFPS
FT                   TMVDRITPASTDATYADAARLTGRTDMAAIETEPFTQWVIEDHFANGRPAWEKVRGALM
FT                   VEDVSAYEKMKLRMLNGAHSLLAYLGYIGGYEFIRDVMDDAALAALAYRHMHAAARTLD
FT                   PVPGINLDDYANELIARFANKAIAHRTYQIAMDGTQKLPQRLLEPACEALAHGDRAETY
FT                   AIAVAAWMRYAIGEHGNGERYELRDPRAAEIEALIADVPRTGPAISAALFTLPGLFPKT
FT                   LTEHRAWAQDVSDKLEILIQDDRLPLF"
FT   gene            complement(103744..105159)
FT                   /gene="uxaC"
FT                   /locus_tag="RHECIAT_CH0000094"
FT   CDS_pept        complement(103744..105159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uxaC"
FT                   /locus_tag="RHECIAT_CH0000094"
FT                   /product="glucuronate isomerase protein"
FT                   /EC_number="5.3.1.12"
FT                   /note="GO_function: GO:0008880 - glucuronate isomerase
FT                   activity; GO_process: GO:0006064 - glucuronate catabolic
FT                   process"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000094"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89091"
FT                   /db_xref="GOA:B3PWM3"
FT                   /db_xref="InterPro:IPR003766"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B3PWM3"
FT                   /protein_id="ACE89091.1"
FT                   /translation="MDAGNGFLHPDRLFPADPATRTIARDLYETVRNLPIVSPHGHTEP
FT                   SWFADDKPFEDAASLLVIPDHYLFRMLHSVGVPLDALGVPRLDGKPVAAGRAIWQTFAR
FT                   HYHLFRGTPSSLWVDHAMSAVLGCTEPLTPNNADALYDHINAQLARPEFRPRALHQRFG
FT                   IETIATTEGALDSLAHHQKMAADGWIGKVRTTYRPDSVTDPDSVGFRDNLIKFGEITGA
FT                   DVTRWEGLIEAHRRRRAYFRQFGATATDHGVPSALTADLPLAEKQALLDRALNGPLSAA
FT                   EAELFRGQMMTEMAGLSAEDGMVMQIHAGSRRNTDSGLFATRGPNMGADIPTRTDWVGG
FT                   LNALLSKYGHAPGLRVLLFTLDETTYARELAPMAGHWPCLMIGPPWWFHDSPLGIRRYL
FT                   DQVVETAGFANMAGFNDDTRALLSIPARHDVWRREVCRFLAALAAEHRISKRDAEIVAG
FT                   ELSYGNAKKAYKL"
FT   gene            105241..105549
FT                   /locus_tag="RHECIAT_CH0000095"
FT   CDS_pept        105241..105549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000095"
FT                   /product="hypothetical conserved protein"
FT                   /note="yhch00022"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000095"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89092"
FT                   /db_xref="InterPro:IPR007236"
FT                   /db_xref="UniProtKB/TrEMBL:B3PWM4"
FT                   /protein_id="ACE89092.1"
FT                   /translation="MRAVAPAIENIDEVAYFRFGRTICSAGVGKGGSMSDETNRITRLE
FT                   EMLAYQAKTIEELSDQLAEQWKIVEQMRTKLDRLTERFLSLEEQSLEAPAITRPPHY"
FT   gene            complement(105596..107077)
FT                   /gene="gabDch"
FT                   /locus_tag="RHECIAT_CH0000096"
FT   CDS_pept        complement(105596..107077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gabDch"
FT                   /locus_tag="RHECIAT_CH0000096"
FT                   /product="succinate-semialdehyde dehydrogenase (NAD(P)(+))
FT                   protein"
FT                   /EC_number="1.2.1.16"
FT                   /note="GO_function: GO:0016491 - oxidoreductase activity;
FT                   GO_process: GO:0008152 - metabolic process"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000096"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89093"
FT                   /db_xref="GOA:B3PWM5"
FT                   /db_xref="InterPro:IPR010102"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:B3PWM5"
FT                   /protein_id="ACE89093.1"
FT                   /translation="MAFTTALTRHVPFSSPFLRAAGYINGVWTSGDAAKTFDVLNPATG
FT                   ELLASLPDMGAAETRAAIDAAHAAQPAWAARPARERSAILRKWFDLMVANADELAAILT
FT                   AEMGKPFPEARGEILYAASYVEWYAEEAKRIYGETIPAPSNDKRMIVIKQPVGVVGTIT
FT                   PWNFPAAMIARKIAPALAVGCTVVSKPAEQTPLTAIALAVLAEQAGIPAGVFNLIVGID
FT                   GPAIGRELCGNDKVRKISFTGSTEVGRILMRQCADQIKKVSLELGGNAPFIVFDDADLD
FT                   AAVEGAIASKYRNAGQTCVCANRLYIQSAVYDAFAAKLAARVATMPVGDGFTAGVEIGP
FT                   LIDEQGLAKVEDHVSDAVAKGAKVLTGGKRIDGAGTFFAPTVLTGVERGMKVAREETFG
FT                   PVAPLFRFETAEDVIAQANDTEFGLAAYFYAGDLKKVWRVAEALEYGMIGINTGIMSSE
FT                   TAPFGGIKQSGLGREGSRHGADDYLELKYLCIGGV"
FT   gene            complement(107135..108415)
FT                   /gene="gabT"
FT                   /locus_tag="RHECIAT_CH0000097"
FT   CDS_pept        complement(107135..108415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gabT"
FT                   /locus_tag="RHECIAT_CH0000097"
FT                   /product="4-aminobutyrate aminotransferase protein"
FT                   /note="GO_function: GO:0008483 - transaminase activity;
FT                   GO_function: GO:0030170 - pyridoxal phosphate binding"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000097"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89094"
FT                   /db_xref="GOA:B3PWM6"
FT                   /db_xref="InterPro:IPR004632"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B3PWM6"
FT                   /protein_id="ACE89094.1"
FT                   /translation="MTATSLTDRKNAAISRGVGMTTQIYADRAENAEIWDKEGRRYIDF
FT                   AAGIAVLNTGHRHPKVIAAVKDQLDHFTHTCHQVVPYESYVSLAERLNALLPGDFEKKT
FT                   IFVTTGAEAVENAVKIARAATGRSAVIAFGGGFHGRTFMGMALTGKVVPYKVGFGAMPG
FT                   DVFHVPFPVELHGVTADQSLAALKKLFAADVDPQRVAAIIIEPVQGEGGFYPAPAAFMK
FT                   ALRELCDQYGILLIADEVQTGFARTGRMFAMDHHEVAADLTTMAKSLAGGFPLAAVTGR
FT                   AEIMDAPGPGGLGGTYGGNPLGIAAAHAVLDVIKDEDLCNRANQLGGRLKQRLESLRET
FT                   VPEIADIRGPGFMNAVEFNDRTTGLPSAEFANRVRLIALDKGLILLTCGVHGNVIRFLA
FT                   PITIQDEVLGEALDILEASMLEASAAK"
FT   gene            108579..109385
FT                   /locus_tag="RHECIAT_CH0000098"
FT   CDS_pept        108579..109385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000098"
FT                   /product="probable transcriptional regulator protein, MerR
FT                   family"
FT                   /note="ypch00035"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000098"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89095"
FT                   /db_xref="GOA:B3PWM7"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B3PWM7"
FT                   /protein_id="ACE89095.1"
FT                   /translation="MNDNGPVRYKVAEAARLAGVSASTLRLWESQGLVIPGRSETGHRQ
FT                   YSADDVARLKRISWYRVERGLNPAAIREALEGEDPAAEGEASQDSGLGRRLRSLRHAAG
FT                   KTLEQVAGDNGITASTLSTLERTSQGVGFKTLHDLADYYGTTVSRLSGEESGEVPVLVR
FT                   AGEWRSWPETTPGVTVQLLAEGPRMMDCHRFVLTPGAASEGAYRHEGEEFMHVLSGRLE
FT                   LVLDGDQFFDLGPGDSLYFESRRYHSWRNRHDGETVLLWINTPPTF"
FT   gene            109491..110117
FT                   /gene="rnd1"
FT                   /locus_tag="RHECIAT_CH0000099"
FT   CDS_pept        109491..110117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnd1"
FT                   /locus_tag="RHECIAT_CH0000099"
FT                   /product="ribonuclease III protein"
FT                   /EC_number="3.1.26.3"
FT                   /note="GO_component: GO:0005622 - intracellular;
FT                   GO_function: GO:0003676 - nucleic acid binding;
FT                   GO_function: GO:0008408 - 3'-5' exonuclease activity"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000099"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89096"
FT                   /db_xref="GOA:B3PWM8"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B3PWM8"
FT                   /protein_id="ACE89096.1"
FT                   /translation="MAATIRYHEGDISAADAARYTGAVAIDTETLGLVPRRDRLCVVQL
FT                   SPGDGTADVIRIAAGQKEAPNLVALLEDPTHQKIFHYGRFDIAVLFHTFGVTTTPVFCT
FT                   KIASRLSRTYTDRHGLKDNLKEMLDVDISKTQQSSDWGAETLSPAQLEYAASDVLYLHA
FT                   LRDKLTARLIRDGRFDHATACFAFLPTRAKLDLLGWEEADIFAHS"
FT   gene            110390..111940
FT                   /locus_tag="RHECIAT_CH0000100"
FT   CDS_pept        110390..111940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000100"
FT                   /product="hypothetical conserved protein"
FT                   /note="yhch00023"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000100"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89097"
FT                   /db_xref="UniProtKB/TrEMBL:B3PWM9"
FT                   /protein_id="ACE89097.1"
FT                   /translation="MLTPVRVASNASFSSQGQTAAIVASGLDRSVIAPAPVNAVEAADL
FT                   NSAIAGKLNILLLAARERMVEALLDVLDAAGRAISLDRGDDETNLAFASRLADAIRRLP
FT                   AASIDEVERQLGGEGHSLPLRMIAEALKNPTGPQAARIVAYLEIVRYKDRDLAARAVVR
FT                   SYGQNDASPMRADARPEIQLHEGSLPAAMRQPVERAPAPADTHVGAEPLMTDATTVAPE
FT                   AVEAAAEPKTPQPENNARSALATAEELAPENPVAPEAEAGQSMETAAVSDRRETAEPPA
FT                   IQPRVNSEKADPVIPRNWTGIVASMTEEVSEMIATIIREQDVDIVLADGPVEAAVEIDT
FT                   ILDDAVISDAAETLARQPVEVQEPDLRQAAALHPQPTEGEVAAAADRQPKEIAAQPQIL
FT                   PVPEAVEPSYVALAARMPDGVAYTQLPYQFAKDMPSNETAGETHHQPQHERDDAPEDQQ
FT                   QEDQKAQSGEEAEPDPAATDAAPARRTPRMIDADPAPQPAGAVADPVYALYQRMVGWE"
FT   gene            complement(112019..113722)
FT                   /gene="rpsA"
FT                   /locus_tag="RHECIAT_CH0000101"
FT   CDS_pept        complement(112019..113722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsA"
FT                   /locus_tag="RHECIAT_CH0000101"
FT                   /product="30S ribosomal protein S1"
FT                   /note="GO_function: GO:0003723 - RNA binding"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000101"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89098"
FT                   /db_xref="GOA:B3PWN0"
FT                   /db_xref="InterPro:IPR000110"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:B3PWN0"
FT                   /protein_id="ACE89098.1"
FT                   /translation="MSVATPSREDFAALLEESFAKNDLAEGYVTKGIVTGIEKDVAVVD
FT                   VGLKVEGRIALKEFGARAKDGSLKVGDEVEVYVERIENALGEAVLSREKARREESWIKL
FT                   EAKFEAGERVEGVIFNQVKGGFTVDLDGAIAFLPRSQVDIRPIRDVTPLMHNPQPFEIL
FT                   KMDKRRGNIVVSRRTVLEESRAEQRSEIVQNLEEGQVVDGVVKNITDYGAFVDLGGIDG
FT                   LLHVTDMAWRRVNHPSEILNIGQQVKVQIIRINQETHRISLGMKQLESDPWDGIQAKYP
FT                   EGKKISGTVTNITDYGAFVELEPGIEGLIHISEMSWTKKNVHPGKILSTSQEVEVVVLE
FT                   VDPSKRRISLGLKQTLENPWAAFARSHPAGTEVEGEVKNKTEFGLFIGLDGDVDGMVHL
FT                   SDLDWNRPGEQVIEEFNKGDVVKAVVLDVDVEKERISLGIKQLGKDAVGDAAASGDLRK
FT                   NAVVSCEIIAINDGGVEVKLVNHEDITSFIRRADLARDRDEQRPERFSVGQVVDARVTN
FT                   FSKKDRKIMLSIKALEIAEEKEAVAQFGSSDSGASLGDILGAALKNRGGE"
FT   gene            complement(113896..114543)
FT                   /gene="cmk"
FT                   /locus_tag="RHECIAT_CH0000102"
FT   CDS_pept        complement(113896..114543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cmk"
FT                   /locus_tag="RHECIAT_CH0000102"
FT                   /product="cytidylate kinase protein"
FT                   /EC_number="2.7.4.14"
FT                   /note="GO_function: GO:0004127 - cytidylate kinase
FT                   activity; GO_function: GO:0005524 - ATP binding;
FT                   GO_process: GO:0006139 - nucleobase, nucleoside, nucleotide
FT                   and nucleic acid metabolic process"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000102"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89099"
FT                   /db_xref="GOA:B3PWN1"
FT                   /db_xref="InterPro:IPR003136"
FT                   /db_xref="InterPro:IPR011994"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3PWN1"
FT                   /protein_id="ACE89099.1"
FT                   /translation="MTTKTFTIAIDGPAAAGKGTLSRRIAEQYGFHHLDTGLTYRATAK
FT                   ALLEAGLPLDDEAVAEKIAREVELGGLDRDMLSQHEIGEAASKIAVMPAVRRALVEAQR
FT                   RFSEKAPGTVLDGRDIGTVVCPDAPVKLYVTASPEVRARRRYDEIVSRGATADLDAIFE
FT                   DVKRRDERDMGRADSPLKPAVDAHLLDTSEMSIEAAFQAAQSIIDAVLSRNA"
FT   gene            114873..115256
FT                   /locus_tag="RHECIAT_CH0000103"
FT   CDS_pept        114873..115256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000103"
FT                   /product="hypothetical protein"
FT                   /note="yhch00024"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000103"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89100"
FT                   /db_xref="InterPro:IPR012644"
FT                   /db_xref="UniProtKB/TrEMBL:B3PWN2"
FT                   /protein_id="ACE89100.1"
FT                   /translation="MAKAELGTKRTDPETGKKFYDLNRDPIVSPYTGKSYPLSFFEETS
FT                   AIADAAEEDEVAEVDTENTEVELVSLEDADDAAGGDDIPDMGDDDVEIEGDDDDDTFLT
FT                   PDEDDDDDDMSDIIGVTGDEDEV"
FT   gene            115407..115482
FT                   /locus_tag="RHECIAT_CH0000104"
FT   tRNA            115407..115482
FT                   /locus_tag="RHECIAT_CH0000104"
FT                   /product="tRNA-Ala"
FT                   /inference="ab initio prediction:tRNAscan-SE:1.23"
FT   gene            115603..115842
FT                   /locus_tag="RHECIAT_CH0000105"
FT   CDS_pept        115603..115842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000105"
FT                   /product="putative excinuclease ABC protein, C subunit"
FT                   /note="ypch00036; GO_component: GO:0005622 - intracellular;
FT                   GO_function: GO:0004518 - nuclease activity; GO_process:
FT                   GO:0006281 - DNA repair"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000105"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89101"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="UniProtKB/TrEMBL:B3PWN3"
FT                   /protein_id="ACE89101.1"
FT                   /translation="MKYVYILHSHEFPDRYYVGVTGDLRSRLAKHNAGEVSHTSKYAPW
FT                   VLKTYVAFSDEPQAFAFEKYLKSASGRAFARKRL"
FT   gene            complement(115961..117784)
FT                   /locus_tag="RHECIAT_CH0000106"
FT   CDS_pept        complement(115961..117784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000106"
FT                   /product="hypothetical conserved protein"
FT                   /note="yhch00025"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000106"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89102"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:B3PWN4"
FT                   /protein_id="ACE89102.1"
FT                   /translation="MFAIGDLGEPMTSAGINRVVASQEDVQQQLERILSSREFRLPERA
FT                   RRFLEFVVTETLAGRRDYLKAFTIAQAVFGRDANFDAQQDPCVRIEAGRLRRELEHYYL
FT                   TAGAADRIIITIPKGGYAPVFDVIDTAGPADMELPEQPDQPGPSGDDGGEINTAADTVG
FT                   REQPDRRLSRPLYWLLAAGVAIILASAAALLQQLESPKSARKTATTIENRPTILVERFE
FT                   SVSDGGLASDISRGITDDIIEKLVRFNDIVVVTAMPRIKTGQVSSEPLYALQGSVRLEG
FT                   SQLRSTARLVRRVDAAVIWASNYDADMKVQGIPKTQASLAGDIAAAVARPFGVMFQTDT
FT                   AAIAGNADAFSCVLSYYSYRSEMTVQAHEAAKSCLQRAVEEAPADSNVAALLSLIHLDE
FT                   FRFSYQLHTKSTAATLGIAKDLAVRAVQLDPKNARALQALMLADFFGNDPAEALRAGAA
FT                   AYASNPNDTEVAGEYGLRLSMSGEWDKGCTLISEAVGKNAGPRGYYQVGMALCAFMRGD
FT                   TQAAELWSRMSDLNYNPMHRLVLLSILGALGKQQEAKEQLDWIRRESPALIPNIRREVV
FT                   SRLARPQDQQRFLAGIEAAGLSVQNGDAPGN"
FT   gene            118016..119131
FT                   /locus_tag="RHECIAT_CH0000107"
FT   CDS_pept        118016..119131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000107"
FT                   /product="putative fusion protein: hypothetical conserved
FT                   protein and adenylate cyclase protein"
FT                   /note="ypch00037; putative fusion protein: hypothetical
FT                   conserved protein (RL2865) and adenylate cyclase
FT                   (Smed_2780) protein; GO_function: GO:0004016 - adenylate
FT                   cyclase activity; GO_process: GO:0006171 - cAMP
FT                   biosynthetic process"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000107"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89103"
FT                   /db_xref="InterPro:IPR012042"
FT                   /db_xref="InterPro:IPR023577"
FT                   /db_xref="InterPro:IPR033469"
FT                   /db_xref="UniProtKB/TrEMBL:B3PWN5"
FT                   /protein_id="ACE89103.1"
FT                   /translation="MTSETSTSHPMTSAEDLRKRALELQLLEMERSEKIKAREAKKHAE
FT                   FVEDFFRKQIGETERAVIKRLVMKAAADGKYEALIYSFPSSFCTDSGRAINNNLSGWQN
FT                   TLQGKAKELLELFEEVARPQGYGLKAMIINFPDGMPRRRRLLPYLGAACRVTGRSSACT
FT                   SPAADSGSGITTCSEQREIQNVAASSARLYGRAALEGAIDLKATEIERKFLVRNDGWRR
FT                   CAGISHVLQQAYLSRDENAVRIRVIDGRSACLTIKFRTSKLAKDEFEYEIPVEEARELL
FT                   LHASGRVIEKTRYRVLHEGRIWDVDVFAGAYEGLTLAEIEMASEDDLPTLPQWLGREVT
FT                   GNKRYSNRAMAAAPHKPSLREWAAEDRALRL"
FT   gene            complement(119156..120094)
FT                   /locus_tag="RHECIAT_CH0000108"
FT   CDS_pept        complement(119156..120094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000108"
FT                   /product="hypothetical conserved protein"
FT                   /note="yhch00026"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000108"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89104"
FT                   /db_xref="InterPro:IPR021556"
FT                   /db_xref="UniProtKB/TrEMBL:B3PWN6"
FT                   /protein_id="ACE89104.1"
FT                   /translation="MRSQSIVIPLMLATALCAMPATPALSQGQTDLAEYKAAKPSPKFD
FT                   SPALALDRLKSVLASNNIDDLAELLGLNAERLRANNEAMVAYALIREGAGRQVILKDAE
FT                   GAKIVAIGDRLWPLPFPLTEDKDGKWSFDTQRGFEEIVNRRIGENELATIDTMHEYVAA
FT                   QYQYASDDRDGDGIYEFAKKLISSPGKLDGLYWDPSVYPEESPASALVETAAFGAAKRG
FT                   EGYFGYRYRILTAQGDNVLGGKQSYVINGYMTGGFALIAWPVKYRVTGVQTFIVNGRSA
FT                   IYQRDLGPETEQRAAAIKEFNPDANWTVVSE"
FT   gene            complement(120123..121508)
FT                   /locus_tag="RHECIAT_CH0000109"
FT   CDS_pept        complement(120123..121508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000109"
FT                   /product="hypothetical conserved protein"
FT                   /note="yhch00027"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000109"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89105"
FT                   /db_xref="InterPro:IPR021728"
FT                   /db_xref="UniProtKB/TrEMBL:B3PWN7"
FT                   /protein_id="ACE89105.1"
FT                   /translation="MKAISRKLLGGLSALAIIALQPVLPARAQAPAPAAAPAPATAEQP
FT                   ASALLSEDELEVLVARIALYPDELVAAISAASLFPLQIIEAQRFLEAKKKNAELKPKSD
FT                   WDGSVVSLLNYPDIVKMMSEDLDWTQSLADALANQQKDVLIAIQQLRDEAVAKNIIKTD
FT                   DKVTVVTENNNIIIRPTDPEKIYIPQYPPEMLYEPNYAAEPISYYPDYYDNYYYPGAGF
FT                   FAAAVTGLTWAAIVNWDDWGVWGGRWDGDIDIDCNNCLNNRNFNGKMKLNDVDWANVDR
FT                   SKLSLGKDQLGKLDRSAIKSGLQADNRNQLRNQAADRQASQRPGNRGTAARADDIRKST
FT                   AQGLKARPQADRPTAANRQNASRPDTRPNQSANRPSAKPAQKSVKKPNKPQMAARPDNR
FT                   GRQPSALGNVQSGRQQAVSSKRGAQSMGGHRQAARPVHHSRPMPSRGGGGGRGGGGGGR
FT                   GRR"
FT   gene            complement(121551..121865)
FT                   /locus_tag="RHECIAT_CH0000110"
FT   CDS_pept        complement(121551..121865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000110"
FT                   /product="hypothetical protein"
FT                   /note="yhch00028"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000110"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89106"
FT                   /db_xref="UniProtKB/TrEMBL:B3PWN8"
FT                   /protein_id="ACE89106.1"
FT                   /translation="MASGESGSTYSSALEAAEAYFPDQARLVQRLFDANEAFHSMCEDL
FT                   AAAAQALAHVEQLPDGVKELRRLEYAGLVDALLKEMREAMSQSKVVMLRQPPVAGPKSP
FT                   "
FT   gene            122209..122520
FT                   /locus_tag="RHECIAT_CH0000111"
FT   CDS_pept        122209..122520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000111"
FT                   /product="hypothetical conserved protein"
FT                   /note="yhch00029"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000111"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89107"
FT                   /db_xref="GOA:B3PWN9"
FT                   /db_xref="InterPro:IPR011223"
FT                   /db_xref="UniProtKB/TrEMBL:B3PWN9"
FT                   /protein_id="ACE89107.1"
FT                   /translation="MVFVGVTLFYAVIAIHDIPHLMAKARNHPHQDAIHVAGWVSLFTL
FT                   HAIWPFLFIWATLYREDRGWGIRQDGKLSAEAEANAEIARLHARIAELEAQTPEKETA"
FT   gene            122520..123677
FT                   /locus_tag="RHECIAT_CH0000112"
FT   CDS_pept        122520..123677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000112"
FT                   /product="probable protein secretion protein, HlyD family"
FT                   /note="ypch00038; GO_component: GO:0016020 - membrane;
FT                   GO_function: GO:0008565 - protein transporter activity;
FT                   GO_process: GO:0009306 - protein secretion"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000112"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89108"
FT                   /db_xref="GOA:B3PWP0"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:B3PWP0"
FT                   /protein_id="ACE89108.1"
FT                   /translation="MDLLLILTYAAICWTIFKIFRIPVNQWTLATAVLGGIFLISALLL
FT                   LMSYNHPYSSDGRIYFTSAPVIPVVGGQVVEVPVTPNVPLKKGDILFRIDPRPYQFSVD
FT                   QKKAALAEAEQTVLQLKAAVDAANSAVTGAEASRDRSLQAFEKFQQSNENAKSSGRGAV
FT                   FSELEVENRRGIYLTSEAAVDTARAQAVQAKLAYESEINGTNPTVARLQAELKNAEYEL
FT                   DQTVVRAPTDGYVTQVFLRPGMMANPLPLRPVMVFIDSQDRMLAAAFIQNSLQRVRVGD
FT                   EAEVSFKAVPGKIFKARVQEVIDVMAQGQLQPSGALIDPQSPERVAPGQTLARIELLES
FT                   TDEYQLPGGVVADVAVYTHHWHHVAVLRKVLLRMSSWMNYVFLEH"
FT   gene            123782..125482
FT                   /locus_tag="RHECIAT_CH0000113"
FT   CDS_pept        123782..125482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000113"
FT                   /product="putative sulfate transporter protein"
FT                   /note="ypch00039; GO_component: GO:0016021 - integral to
FT                   membrane; GO_function: GO:0005215 - transporter activity;
FT                   GO_process: GO:0006810 - transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000113"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89109"
FT                   /db_xref="GOA:B3PWP1"
FT                   /db_xref="InterPro:IPR001902"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:B3PWP1"
FT                   /protein_id="ACE89109.1"
FT                   /translation="MLRGLAGFNRDWLRSDIPAGLSIAAVGLPSAIAYPAIAGLPPETG
FT                   IYASIVAPIAYAIFGPSRILVVGPDAATMTVLAAAMGAIIAAEPATAGADRIAIASALA
FT                   LGVGVCCIVAKLLRLGVLASFLSRPILVGFFAGVSLSILVGQIGRFTGVKIQSDGLIPP
FT                   LVEMLAKSSLIHWPSLLLGLAMFALLWIVRAFRFKVPGPVLVVVLSVVLSAIFDFQGRG
FT                   IAVVGDIPSGLPSLSLPALQQMPLDKIVLGSAAIFLVSFGAGIVAARSFGSRTGEEVDA
FT                   NQELIGLGAANLAPGLFGSFPVSVSDSRTAINLSTGGVSQLAGLVSAATLIAALVFLHS
FT                   ALRILPIPALAAILATAAISLIDIHELKKIWRISRMEFIFALIAMWGAISFGVLNGVIV
FT                   AVAATLVYLLRQTMFPRDGLLGRIEGRHGFFDLARFPEARPVEGAAVFAIQGSILFYNA
FT                   DYVRTRLTSVAKGLPAETRCLVLDASAVTHVDSTGAAALDAVAELLAQRNIVFAMADLS
FT                   EESRGILDRAGVIKAIGVQNLFNGREEALRALIGTVGETDAAMSAGKPS"
FT   gene            125502..126347
FT                   /locus_tag="RHECIAT_CH0000114"
FT   CDS_pept        125502..126347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000114"
FT                   /product="putative polyphosphate kinase protein"
FT                   /note="ypch00040"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000114"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89110"
FT                   /db_xref="GOA:B3PWP2"
FT                   /db_xref="InterPro:IPR016898"
FT                   /db_xref="InterPro:IPR022486"
FT                   /db_xref="InterPro:IPR022488"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3PWP2"
FT                   /protein_id="ACE89110.1"
FT                   /translation="MDENYEPAQTDGGAGRVVKDNKKKKKSWDYDKEIGRLQVELAHLQ
FT                   AWIKKAGARVVIIFEGRDAAGKGGMIKRITEKVSPRVFRVVALPAPTDREKSQIYMQRY
FT                   IAHLPAAGEIVIFDRSWYNRAGVDRVMGFTSEKKAQRFLELAPRFEAAIVESGVILLKY
FT                   FLTVSEEEQERRFKRRIDDPVRQWKLSPMDVESYQRWWDYTRAYDEMLRMTDSNHAPWW
FT                   IVPSDDKKRARVNCISHILQSIPYERVKFDAPDLGKRQKRPADFMEDRSIRHVVPNAAS
FT                   "
FT   gene            126367..127524
FT                   /locus_tag="RHECIAT_CH0000115"
FT   CDS_pept        126367..127524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000115"
FT                   /product="hypothetical conserved protein"
FT                   /note="yhch00030"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000115"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89111"
FT                   /db_xref="GOA:B3PWP3"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:B3PWP3"
FT                   /protein_id="ACE89111.1"
FT                   /translation="MMENAGDTAAQGAGPGQISIEARISDLVRLGIIGLFAYWTMVLIA
FT                   PFALIVIWSAILAVALFPIFAALSGLIGNRPVIAAVVIVVFSLVLIIAPLALVAVNFAD
FT                   AAQALIGKLREGNFTLPAAPAAIREWPVVGERIHGAWNQIASDLAATIIKFQAPIREVT
FT                   AVIVAKLASIGGGVLSFVVSIVLSGIFLTRSASLAAAIQVLASRIAGEKGVGFARLAGT
FT                   TVRNVSRGVIGVAFLQALLCGLCFALFDIPAGGPLTFIVFVLCLMQLGPALVLLPVILW
FT                   AWFSWPTSIALVFTVVAIPIMIIDNILKPILMARGLSTPMPVILIGVIGGTLSQGLLGL
FT                   FLGPVVLSVFYELLRAWAWPSVSTAPENSRPASFEAPPERLEQTR"
FT   gene            complement(127587..127823)
FT                   /locus_tag="RHECIAT_CH0000116"
FT   CDS_pept        complement(127587..127823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000116"
FT                   /product="hypothetical conserved protein"
FT                   /note="yhch00031"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000116"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89112"
FT                   /db_xref="UniProtKB/TrEMBL:B3PWP4"
FT                   /protein_id="ACE89112.1"
FT                   /translation="MSQERGRRKLMLRLPDIRHLLASMTSEALQEMFESYDLAVDALER
FT                   FRTRSPREERLISEYEQLCLEIEQEVVVYCKNR"
FT   gene            complement(127963..128274)
FT                   /locus_tag="RHECIAT_CH0000117"
FT   CDS_pept        complement(127963..128274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000117"
FT                   /product="hypothetical conserved protein"
FT                   /note="yhch00032"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000117"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89113"
FT                   /db_xref="GOA:B3PWP5"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="UniProtKB/TrEMBL:B3PWP5"
FT                   /protein_id="ACE89113.1"
FT                   /translation="MRRLFFMALAKQLHVIWPILSGIVSIMVASGLAIWQIEDWRIDEA
FT                   LYFTFVTGLTIGYGDFTPKHVSARILALLIGFAGIVLTGVIAAITVKALNATDRDGGS"
FT   gene            complement(128328..129422)
FT                   /locus_tag="RHECIAT_CH0000118"
FT   CDS_pept        complement(128328..129422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000118"
FT                   /product="probable Na+/H+ antiporter protein"
FT                   /note="ypch00041; GO_component: GO:0016021 - integral to
FT                   membrane"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000118"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89114"
FT                   /db_xref="GOA:B3PWP6"
FT                   /db_xref="InterPro:IPR004798"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniProtKB/TrEMBL:B3PWP6"
FT                   /protein_id="ACE89114.1"
FT                   /translation="MSHLFKEIRDSPILWLLAAVPVVFLAAALFPEAHTALFVLSVLAI
FT                   VPLAALLSHATESVAAKTGDAAGGLLNATLGNLTELVIALAALQAGEYTLVKASIAGAI
FT                   VTNTLFMLGASFLLGGLKYHIQEFNRASARIQAGLLFLATIALLMPSALGELDTASVAP
FT                   VTQTLSLSLAALLIIGYGLGLFFTLGTHREFFSSAEHAEAGEAPWPIGLALSTLAGVTV
FT                   LVAFVSEIFVESVQEAAVAFGMTPAFVGFIVVALVGAAAEMASAFSGARKNRLDLSVGI
FT                   ALGSASQIALFVAPVLVLMSYIIGPSPMDLQFWPGAVTMMFLATVTAMFVTNSGRSAWF
FT                   VGVLVLMVYMIFAITLYVLPPAVR"
FT   gene            complement(129557..130480)
FT                   /locus_tag="RHECIAT_CH0000119"
FT   CDS_pept        complement(129557..130480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000119"
FT                   /product="putative amino acid ABC transporter,
FT                   substrate-binding protein"
FT                   /note="ypch00042"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000119"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89115"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:B3PWP7"
FT                   /protein_id="ACE89115.1"
FT                   /translation="MSGRNGCWGAIAASVLAMAAASAAALPAHAQTLDRVRTSSALKLG
FT                   YDPDARPFSFDAQGKPDGYAVALCNRIADSLRAQLNLSKLDVEWVPLSGDAKLRAIQDG
FT                   TADLVCAAEPVTLGRRQQVSFSLPIFPSGTGALLNASAPLALREVLQYGEPSSRPVWRG
FT                   APARTILEHKTFSSIAGTTSEDWLSDKIKTFQLAATATPVTDYQQGIARVLDGSSAVLF
FT                   GDMPLLMDAAARSDSSGNLIVLERHFTYEPLGLELTRGDEDFRLAVDRALSQAYAAQDF
FT                   RAFFTTWFGPPDDAVVTFFRQTALPE"
FT   gene            complement(130498..131856)
FT                   /locus_tag="RHECIAT_CH0000120"
FT   CDS_pept        complement(130498..131856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000120"
FT                   /product="probable amino acid ABC transporter, permease
FT                   protein"
FT                   /note="ypch00043; GO_component: GO:0016020 - membrane;
FT                   GO_process: GO:0006810 - transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000120"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89116"
FT                   /db_xref="GOA:B3PWP8"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR027566"
FT                   /db_xref="UniProtKB/TrEMBL:B3PWP8"
FT                   /protein_id="ACE89116.1"
FT                   /translation="MTDNTMHLAAEATTKKKMNLVQLTFIVAVNMMGSGIIMLPANMAQ
FT                   VGAISLLSWLVTAIGSMAIAYGFAQAGLFNQRPGGMSAYAEDAYGKDGYFMVFFLYFLS
FT                   LAVGNVAIGISAVGYLAGFFPVLTSTPIMTCVALIILLWLTTAANFGGPRITGRIGSVT
FT                   VWGVILPVGLLSIIGWLWFSSSTFGAAWNPKGLTLAQGMGSSISLTLWAFLGMESAAQN
FT                   SDAVENPKRDVPLACIFGTLGAAVIYILSTTVIQGIVPNADLATSTGPFALAYATMFNP
FT                   TIGSIVMALAVLACLGSLLGWQFTIAQTAKTAAEEKMFPSIFSRVNEMGAPVSGMIILG
FT                   IAQTCLALMTISPTLSEQFSALVNLAVVTNVLPYIIALSALFVMMKAARVPQAKYRLNA
FT                   IIAMVGMAYSVFAIYASGKDAVLGGMIVTGIGFIIYGLIAPRFASGLNQAQAE"
FT   gene            complement(131876..134239)
FT                   /locus_tag="RHECIAT_CH0000121"
FT   CDS_pept        complement(131876..134239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000121"
FT                   /product="probable ornithine decarboxylase protein"
FT                   /EC_number="4.1.1.17"
FT                   /note="ypch00044; GO_function: GO:0003824 - catalytic
FT                   activity"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000121"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89117"
FT                   /db_xref="GOA:B3PWP9"
FT                   /db_xref="InterPro:IPR000310"
FT                   /db_xref="InterPro:IPR005308"
FT                   /db_xref="InterPro:IPR008286"
FT                   /db_xref="InterPro:IPR011193"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036633"
FT                   /db_xref="UniProtKB/TrEMBL:B3PWP9"
FT                   /protein_id="ACE89117.1"
FT                   /translation="MIPRDVKSPTVAIPFHKMLKIVAIIDRDNSQAQELVSQIIDQGFE
FT                   VELRGDYSADVSEDADVGAYIGSVEGGRLSAARSFLRSVRDIGFRTPIWAMADTLTIKD
FT                   MDVVEMAGEVDGFVYLGQQTPTFYAKQIVSSAVNYGKSLLPPFFGGMMAYDGEANIAFD
FT                   CPGHQGGQFYRKSPAGQLFFKYFGESIFRNDLCNADVDLGDLLIHEGPAVEAQKQAARI
FT                   FGADRTYFILNGTSTSNKVVANAVLRSGDLVLFDRNNHKSLHQGALVQAGAIPIYLPTA
FT                   RNSFGMIGAVDWAAWDESWLRRKIEEHPLVTDKSRAKSDRPFRLACIQLATYDGTIYNV
FT                   SQVMEKIGHLCDYVLWDEAWIGYNAFHPLFEGHSPMRLKDLRADMPGLFSTQSVHKQGA
FT                   GFSQASQIHKRDEHISGQRRFVEHKRFNESLLMHVSTSPFYPLFASLDVNAKVHEGKAG
FT                   EMLWDRCIELGIEVRKKLRGFVQHYESNAASPEEQWFFDPFVPDKVSVSGSNHTNDLEG
FT                   TRWEDVPTDVLKREQQCWRFDPQATWHGYAGYAPGYTMVDPNKLTLLTPGIDRKTGEYR
FT                   EFGIPATVVANYLREQRVVAEKCDLNSLLFLLTPAEDESKLNTLVAKLVKFKNLWDRDA
FT                   PLQEVLPTVFAAHRERYAGYTVRQVCQEMHSFYREAGVKELQRRCFRAESFPEPAITPK
FT                   QAYEALVANNVDYVPLTQAAGRISATLALIYPPGIGVIVPGERWDERARPMRDYFLAFE
FT                   ESFNRFPGFNYEVQGVFQERIEGRIQFHTYVVRE"
FT   gene            complement(134236..136497)
FT                   /locus_tag="RHECIAT_CH0000122"
FT   CDS_pept        complement(134236..136497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000122"
FT                   /product="probable lysine decarboxylase protein"
FT                   /EC_number="4.1.1.18"
FT                   /note="ypch00045; GO_function: GO:0003824 - catalytic
FT                   activity"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000122"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89118"
FT                   /db_xref="GOA:B3PWQ0"
FT                   /db_xref="InterPro:IPR000310"
FT                   /db_xref="InterPro:IPR005308"
FT                   /db_xref="InterPro:IPR008286"
FT                   /db_xref="InterPro:IPR011193"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036633"
FT                   /db_xref="UniProtKB/TrEMBL:B3PWQ0"
FT                   /protein_id="ACE89118.1"
FT                   /translation="MEFQMAFPIAVIDEDFDGKSAAGRGMRDLADAIEKEGFRIVSGVS
FT                   YEDARRLVHIFNTESCWLVSVDGAEDKTTRWQLLGEVLAAKRQRNDRLPIFLFGDDTTA
FT                   EDVPAAVLRHANAFFRLFEDTAEFMARAIAQAARNYLDRLPPPMFKALMDYTLEGAYSW
FT                   HTPGHGGGVAFRKSPVGQLFYTFFGENTLRSDISVSVGSIGSLLDHVGPIAEGERNAAR
FT                   IFGTDETLFVVGGTSTANKIVWHGMVGRGDLVLCDRNCHKSILHSLIMTGATPIYLIPS
FT                   RNGLGIIGPISKDQFTPESIAHKIAASPFAAQTSGKVRLMVITNSTYDGLCYNVDAIKA
FT                   SLGDAVEVLHFDEAWYAYANFHEFYDGFHGISSNQPARSQNAITFATHSTHKLLAALSQ
FT                   ASMIHVQHAETKRLDITRFNEAFMMHTSTSPQYGIIASCDVAAAMMEQPAGRSLVQETI
FT                   DEAISFRRAMNRVKKQAEGSWWFDVWEPTVAEQTPSDTHADWVLKPGDAWHGFTGLAEN
FT                   HVMVDPIKVTILSPGLSASGAMDEHGIPAAVITKFLSSRRIEIEKTGLYSFLVLFSMGI
FT                   TRGKWSTLVTELINFKDLYDANAPLTRALPALAAAHPQAYAGVGLRDLCEKIHAIYRKD
FT                   DVPKAQREMYTVLPEMALRPADAYDRLVKSRIESVEIDELMNRILAVMIVPYPPGIPLI
FT                   MPGERITQSTKSIQDYLLYARDFDRKFPGFETDIHGLRFAPGDGGRRYLVDCIAGEEQE
FT                   "
FT   gene            complement(136654..137688)
FT                   /locus_tag="RHECIAT_CH0000123"
FT   CDS_pept        complement(136654..137688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000123"
FT                   /product="probable cation efflux protein"
FT                   /note="ypch00046; GO_component: GO:0016020 - membrane;
FT                   GO_function: GO:0008324 - cation transporter activity;
FT                   GO_process: GO:0006812 - cation transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000123"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89119"
FT                   /db_xref="GOA:B3PWQ1"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="UniProtKB/TrEMBL:B3PWQ1"
FT                   /protein_id="ACE89119.1"
FT                   /translation="MDDRGRQEIKADPSFQISSHLRDQQKRVDRGCRRWAMILGEQGFL
FT                   RISIATVVVATLGVVFGILSGSFSIAFDGVYSLADAAMTGLALWVSSLIIQSTQRDAQS
FT                   GRIRNRFTMGFWHLEPIVLMLNGCLLMTVAVYALISAIISILNGGHELQFGMAIAYSAA
FT                   TLLVCAVMAFLGIRLNARIKSDFISLDVKAWIMSGGIALALLIAFLIGMAVQATPAAWV
FT                   AGYMDPAVLALVCLVMIPLPIGTVWKALTEILLIAPVDLQEHVDRIASETVRRLGFLSH
FT                   RAYVARVGRAMQIELYFIVPEGLPAKTVEEWDALRDEIGNAIGDESANRWLTIAFTADA
FT                   EWAE"
FT   gene            complement(137768..138334)
FT                   /locus_tag="RHECIAT_CH0000124"
FT   CDS_pept        complement(137768..138334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000124"
FT                   /product="hypothetical protein"
FT                   /note="yhch00033"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000124"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89120"
FT                   /db_xref="GOA:B3PWQ2"
FT                   /db_xref="UniProtKB/TrEMBL:B3PWQ2"
FT                   /protein_id="ACE89120.1"
FT                   /translation="MRSGRPSPMAPQNHRRMARRFAFGAETIRKSGGNGQSACLNIIDR
FT                   TQCLASVPELSSQPNIMWFSGVRAMKMAMIIGLAVLTAATGIVPVEAQQTRREYRRMNW
FT                   SESLPEAVRTYHDRRFTIVSYRMADFSETGAHPTQGSEEHVKAIRDAIRANKWLTAQLK
FT                   TKKLTANDIEWVSRARNGNMTFYTK"
FT   gene            138438..139793
FT                   /locus_tag="RHECIAT_CH0000125"
FT   CDS_pept        138438..139793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000125"
FT                   /product="probable amino acid transporter, permease
FT                   protein"
FT                   /note="ypch00047; GO_component: GO:0016020 - membrane;
FT                   GO_process: GO:0006810 - transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000125"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89121"
FT                   /db_xref="GOA:B3PWQ3"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:B3PWQ3"
FT                   /protein_id="ACE89121.1"
FT                   /translation="MTTSPNGKSLGLAACTAIVVGNMVGSGFYLSPAAVAPYGNLAIIV
FT                   WIVMGAGAICLGLTFARLARLVPAVGGPYAYTRLAYGDFAGFLIAWGYWISIWTSLPVI
FT                   AIAFAGVMVDLFPALGNRFAATVLTLGVIWAIVLVNLRGVHAAGVFAQVTTYAKLLPFG
FT                   AVAIIGLLFIDTSHFSEFNPSGQSLLQSVATLAPLTMFAYLGLESATVPAGDVENAEHT
FT                   IPRSTVLGISIAAALYVLGTIVVMGLLPREQLVHSVAPFSQAAAIMWGRPGELAISIAV
FT                   LLSSIGALNGWTLLMGQVPMAAARDGLFPPLFARLSPRGVPAWGMIISASFATLLVLVQ
FT                   AIGSEGFAAVYRLMVGLSTMAAVIPYAFCSLAGSLVAGVTHGRMPRVSAIELIAFIFAI
FT                   FTLYGSGAEPVLYGLVLLMLGIPVYVWQRRNGAEVTAKETASAVPRQPAVSR"
FT   gene            complement(139809..140744)
FT                   /gene="arcC"
FT                   /locus_tag="RHECIAT_CH0000126"
FT   CDS_pept        complement(139809..140744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arcC"
FT                   /locus_tag="RHECIAT_CH0000126"
FT                   /product="carbamate kinase protein"
FT                   /EC_number="2.7.2.2"
FT                   /note="GO_process: GO:0008652 - amino acid biosynthetic
FT                   process"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000126"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89122"
FT                   /db_xref="GOA:B3PWQ4"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR003964"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:B3PWQ4"
FT                   /protein_id="ACE89122.1"
FT                   /translation="MRVVIALGGNALLRRGEAMTADTQRRNARIAAQAIAPLAAEHEIV
FT                   ITHGNGPQVGLLALQGAAYKPEEAYPLDVLGAETEGMIGYMLEQELGNLLPFEQPLATL
FT                   LTMVEVDADDPGFQNPTKFVGPVYDQAEADRIRTEKGWVFKQDGEKWRRVVASPVPKRI
FT                   FEIRPVRWLLEQRTIVICAGGGGIPTMYEKGANRKLVGVEAVIDKDLCSELLARELNAD
FT                   LLIMATDAEAVCLDWGKPSQKAIHRASPDDLAQFSFPAGSMGPKVDAACHFARSGTRTA
FT                   AIGSLADIAGLVRGERGTIINSGFAALSWH"
FT   gene            complement(140746..141750)
FT                   /gene="arcB"
FT                   /locus_tag="RHECIAT_CH0000127"
FT   CDS_pept        complement(140746..141750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arcB"
FT                   /locus_tag="RHECIAT_CH0000127"
FT                   /product="ornithine carbamoyltransferase protein"
FT                   /EC_number="2.1.3.3"
FT                   /note="GO_function: GO:0016597 - amino acid binding;
FT                   GO_function: GO:0016743 - carboxyl- and
FT                   carbamoyltransferase activity; GO_process: GO:0006520 -
FT                   amino acid metabolic process"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000127"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89123"
FT                   /db_xref="GOA:B3PWQ5"
FT                   /db_xref="InterPro:IPR002292"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR024904"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/TrEMBL:B3PWQ5"
FT                   /protein_id="ACE89123.1"
FT                   /translation="MSFNLRNRSLLTVQDYTPREFRYLLDLARDLKRAKYARTEQEHLK
FT                   GKEICLIFEKTSTRTRCAFEVACSDQGANVTYLDPSGSQIGHKESFKDTARVLGRMYDA
FT                   IEYRGSAQKGVETLAKYAGVPVYNGLTDEYHPTQMIADVMTMREHSDKPIAEIKYAYIG
FT                   DTRSNMGHSLLIVGCLLGMDVRICGPRSLWPSEEYMKIAKDLQQASGARLLVTEDPREA
FT                   VKGVDFIHTDVWVSMGEPKEVWRERIKLLTPYQVNKDLMKATGNPQTKFMHCLPAFHDT
FT                   ETTLGKQIAEDYGMDNGLEVTNDVFESEANVAFEQAENRLHTIKALLVATLGD"
FT   gene            complement(141788..143017)
FT                   /gene="arcA"
FT                   /locus_tag="RHECIAT_CH0000128"
FT   CDS_pept        complement(141788..143017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arcA"
FT                   /locus_tag="RHECIAT_CH0000128"
FT                   /product="arginine deiminase protein"
FT                   /EC_number="3.5.3.6"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000128"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89124"
FT                   /db_xref="GOA:B3PWQ6"
FT                   /db_xref="InterPro:IPR003876"
FT                   /db_xref="InterPro:IPR033199"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3PWQ6"
FT                   /protein_id="ACE89124.1"
FT                   /translation="MRGFGVHSEVGKLRTVMVCRPSLAHQRLTPANCHDLLFDDVLWVH
FT                   EAQKDHFDFVLKMQERGVEVLELHDLLGQTLANQQARDFLLDRRITPNVLGSQIAEAMR
FT                   PWLDEMPAAQLAAFMIGGIAISDLPEVRAKSLMLSALPETDFVIPPIPNTLFQRDPSCW
FT                   IYGGVTCNPMFWPARRAETLIQRAIYKFHPIFLGGDFQIWWGDSDQPFANASMEGGDVM
FT                   PIGNGTVLIGMGERTTYQAVGQVAQALFRSKAAKRVIGCLMPKSRAAMHLDTVFSFCDR
FT                   DVVTLFAEVVDQVRCYSMYPKDDDGTFEIHPENRPMLDVVAEALDLPQLRTVETGGNSY
FT                   QAEREQWDDGNNVVALEPGVVVAYDRNTYTNTLLRKAGIEVITIRGSELGRGRGGGHCM
FT                   TCPIWRDPAY"
FT   gene            143018..143713
FT                   /locus_tag="RHECIAT_CH0000129"
FT   CDS_pept        143018..143713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000129"
FT                   /product="hypothetical protein"
FT                   /note="yhch00034"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000129"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89125"
FT                   /db_xref="UniProtKB/TrEMBL:B3PWQ7"
FT                   /protein_id="ACE89125.1"
FT                   /translation="MVLLSAFWIAAAPPILRRPDYFGPLGHVIDRRQSVLRYLDSCLGA
FT                   VVTVLSSPSMKADTIVATVSPWAPMRGMNVEHFAADGIDPAIGTTLAGENQRVNAFIVD
FT                   DGEFYILFVRSFDGQPPHNRTPRGSTSVSRTREAGKSFAGMFWDRAPPGLPEPVGRCRV
FT                   SALKRCHAYLRLTIVEQRNGGIEPDQWRPNPTPGEGRQRLRRKNNRGYAILHGLAVRGW
FT                   YPLVIAGGK"
FT   gene            143758..145002
FT                   /gene="fixL"
FT                   /locus_tag="RHECIAT_CH0000130"
FT   CDS_pept        143758..145002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fixL"
FT                   /locus_tag="RHECIAT_CH0000130"
FT                   /product="two-component sensor histidine kinase nitrogen
FT                   regulation protein"
FT                   /note="GO_function: GO:0005524 - ATP binding"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000130"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89126"
FT                   /db_xref="GOA:B3PWQ8"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B3PWQ8"
FT                   /protein_id="ACE89126.1"
FT                   /translation="MPIKMEAPHAVAEVGPSEAAGQVFPVTSQTPHRETARAFREGNGG
FT                   PRMDWIRQLHEHMPDAVFFISDRHRISACNKAAVALFGYAERELIGRKIGFVWRPTPDI
FT                   RLNGRWADQGAVRAGLAITKSGAQFPTALTIIRKHDEKGVFTAAVFEDFRTEGEALRQV
FT                   RELQQEIARLARVTELGEMASTLAHELSQPLSSIAAYSEGCGHLVAGNRPGRSEELREA
FT                   LLEITHHALWAGSIVQNVREFAERGASERTPEAMHELIHKAARLALIGSRRKDLHTDFQ
FT                   LEAVQDTVLANRVQIVQVLTNLVRNALEATECVEQPRIAIRTAVDNFSYLVVDVSDNGC
FT                   GIAAEIEDSLFRPFVTGKPHGLGMGLALSKRIVEAHGGRIGARRRTESGSVFSFSLPLV
FT                   EIEADDERPDDPSRR"
FT   gene            144968..145636
FT                   /gene="fixJ"
FT                   /locus_tag="RHECIAT_CH0000131"
FT   CDS_pept        144968..145636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fixJ"
FT                   /locus_tag="RHECIAT_CH0000131"
FT                   /product="two-component response regulator nitrogen
FT                   regulation protein"
FT                   /note="GO_function: GO:0000156 - two-component response
FT                   regulator activity; GO_process: GO:0000160 - two-component
FT                   signal transduction system (phosphorelay; GO_process:
FT                   GO:0006355 - regulation of transcription, DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000131"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89127"
FT                   /db_xref="GOA:B3PWQ9"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B3PWQ9"
FT                   /protein_id="ACE89127.1"
FT                   /translation="MTNDLTIHLVDDEEALRRSLTFLLASAGFAVRAHSCANAFLDLLP
FT                   LSGRNCLVTDLRMPDVNGIELLQRLRQSSVNVPAIVITGQGDVAAAVQAMKAGASDFLE
FT                   KPLREETLIAAINLAMGQRRPGRSIADSESVAARLRQLTDREHQVLTGVLDGLQNKMIA
FT                   YQLGISSRTVEVHRANVMAKMGARNLAELMRMAVTVDMVEQSSEAGRISPVDPWPACAR
FT                   "
FT   gene            145731..147512
FT                   /locus_tag="RHECIAT_CH0000132"
FT   CDS_pept        145731..147512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000132"
FT                   /product="hypothetical conserved protein"
FT                   /note="yhch00035"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000132"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89128"
FT                   /db_xref="GOA:B3PWR0"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:B3PWR0"
FT                   /protein_id="ACE89128.1"
FT                   /translation="MRNATQVNIVSCPGPTAEQICRQVERILASAEFHAPQRGRNFLEF
FT                   VVNETLAGRAGFLKAFTIANVVFGREASFDPQNDPVVRIEAGRIRKALERYYLVAGQAD
FT                   EVVITVPKGGYVPHFEYLRDASAPPRPEKDRNAQIAALADQTYSPGETQRPALPTARGG
FT                   TALLAVLILPLLAFAFALFAARGGTPIRPLPSGALPPTVAVEVFAESSLLDSSSDIARG
FT                   LRDDVIGQLAQFDDLIVVADPLTGDQAAAADYALQGNIQMDGSRLRSVARLVRQTDGAV
FT                   IWANNFDADLRAQNKLEIQTNVARQIAGAIARPHGAIFQAETAMIAQSARKADQDAYAC
FT                   APVYSSYIETMTAKNHGAVRQCLEQAIRQRPDDATSWALLSLVYLDEVRFRYKLGTSSS
FT                   AEALALAAAAAQRAASLAPDNPRVLRAVMLVNFFQGDIDKAIAAGTAAYAANPDDVEVA
FT                   GEYGLRLAMSGKWQSGCELISIALDKNAGPRGYYEAGMAMCALMRGDIEAAEEWSRIAG
FT                   LDGNPMRHLALLSILGAAGKMDEAKLERDWLHMNAPALMTNIRQEISLRLQRPEDQEKF
FT                   FNGLRAAGVAVDLPSGE"
FT   gene            complement(147575..148546)
FT                   /locus_tag="RHECIAT_CH0000133"
FT   CDS_pept        complement(147575..148546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000133"
FT                   /product="hypothetical protein"
FT                   /note="yhch00036"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000133"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89129"
FT                   /db_xref="UniProtKB/TrEMBL:B3PWR1"
FT                   /protein_id="ACE89129.1"
FT                   /translation="MVPEEGGASQARQEPENVRAQLDRILASPEFLAPERGRRFLQYIV
FT                   EETLDGRGEQLKASTIAQAVFGRDASFDAQNDPVVRIEAGRIRRALERYYLVCGHSDPI
FT                   EITIPKGGYAPHFSSGEDSSNAEIAAAPNQENKQPQPGHEQGQPGRERPLRYRDLLLPI
FT                   GIPALFGAMAVLALIRPLESYLSPSNPAATTLASKTRIVVEPFVALGGTARGADLAKGL
FT                   ADQLIAKLMKVDSLVVLAPGRSGVETSGSLFNLQGSTLVEGTVLHLHVRLINGADGAVV
FT                   WANQYNRDLRDQTTLDVEDEIAAQITLEISTSRKLNGAGPLP"
FT   gene            148687..149346
FT                   /locus_tag="RHECIAT_CH0000134"
FT   CDS_pept        148687..149346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000134"
FT                   /product="putative nitrogen fixation transcriptional
FT                   regulator protein"
FT                   /note="ypch00048"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000134"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89130"
FT                   /db_xref="GOA:B3PWR2"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B3PWR2"
FT                   /protein_id="ACE89130.1"
FT                   /translation="MGATHMFQDRAIGKYTMVPGHHQGTACAAPRDQSIKLRADETIYS
FT                   EGEYARAIYQVEAGAVRIYRLTSNGQRHILSFCGKGEWFGLESGNVRTDFAEAICETRV
FT                   RSFRTNQDAVVPIDLLHIALTNLAKAQCKQLIISEQSALKRLAAFVHEMADRHPEDAEF
FT                   DMMMSRSDIADYLGLTVETVARSFTKLREKRILRLAGKSQRIVRLLDRDALVALTI"
FT   gene            149372..149731
FT                   /locus_tag="RHECIAT_CH0000135"
FT   CDS_pept        149372..149731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000135"
FT                   /product="hypothetical protein"
FT                   /note="yhch00037"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000135"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89131"
FT                   /db_xref="UniProtKB/TrEMBL:B3PWR3"
FT                   /protein_id="ACE89131.1"
FT                   /translation="MTHASRRKSIGLTKRVFAGLVGAGALVTVLQPAAAIAQDDPFSQF
FT                   PLVIHCKSNETYHAFYISRVSKDGVATYVASDRIAGTITLDGQAKAVGGKGGGSCVGKT
FT                   LAELRASQQAYDLKP"
FT   gene            complement(149768..151720)
FT                   /locus_tag="RHECIAT_CH0000136"
FT   CDS_pept        complement(149768..151720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000136"
FT                   /product="putative mechanosensitive ion channel protein"
FT                   /note="ypch00049; GO_component: GO:0016020 - membrane"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000136"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89132"
FT                   /db_xref="GOA:B3PWR4"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:B3PWR4"
FT                   /protein_id="ACE89132.1"
FT                   /translation="MKWLLSFTAAFFFALSALAQVPPAAPQQKIDELVRLLQDPEVKAW
FT                   LDSRKQESGAATPASPTGTSPLASTSPLANWEAGARARVHAILAAIPAIPTEVTAAAAR
FT                   ARSEAASRGYAPVFLIFGGLVAFGLAAEAVYRRFAARRESLLGRLIPVGIFAGAMGIIF
FT                   FAVEWPPLARVTLLAYLAAFILFRLAAALLSVAAMGLPLRRRLLILFGVICFAVATTAV
FT                   GEPLGVPPEVGKAITYCFSVVGLLLAIEAAWSVWEGSRARKAAITAFLVALWLIWCIDM
FT                   RGLFWIGIYALVLPGILNAVGRVALSFTSDPGSLRGILIARGARAAVIALAVGWLALVW
FT                   QLNPDTLGQRDPTIAALYYGGLKSVLILVVADLLWQVARGWIDRTLRISTSTTSLAPAD
FT                   AARRARFRTLLPIFRNALAVAVAVMAGLIVLAQLGVQIGPLIAGAGIFGVAIGFGSQTL
FT                   VKDVINGVFYMLDDAFRVGEYIQAKDYKGTVESFSLRSVRLRHHRGPVFTVPFSELGAV
FT                   ENMSRDWVIDKFRITVGFDTDIDKARKLTKKVGAELIEDPELGQHFIEPLKMKGVEQFA
FT                   DYGIVLSFAMTTVPGMQTYIRRKAYAKIREVFLANGIAFAQPTVQVGGDDKGGGVAAAA
FT                   QAIRTQQADAATSAK"
FT   gene            complement(151732..152943)
FT                   /locus_tag="RHECIAT_CH0000137"
FT   CDS_pept        complement(151732..152943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000137"
FT                   /product="hypothetical conserved protein"
FT                   /note="yhch00038"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000137"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89133"
FT                   /db_xref="InterPro:IPR010297"
FT                   /db_xref="InterPro:IPR014586"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B3PWR5"
FT                   /protein_id="ACE89133.1"
FT                   /translation="MARRCVALFLLLASCGHPDGVMTPVSISSTLPPASKVDMLVATTR
FT                   EPSGNPATLFNGERSPKPHLTQISISIPAKREAGTVQWPKRIPANPATDFAVTNVQQID
FT                   TVAQGRVWFRQHVNGGHALVFIHGFNNTYEDSVFRLAQIVHDSKMQATPVLFTWPSRAE
FT                   ITAYEYDKESTNYSRTALEQALRTLAADPNVKDITLMAHSMGTWLAMESLRQMGIRDGH
FT                   VNSKIHNVILASPDIDIQVFAKQYVEMGEPRPKFTIFVSQDDKALAVSSFITGRVSRLG
FT                   AINPAEEPYRTKLEKAGITAIDLTKVKTNDRLNHGKFAESPEIVQLIGQRLMTGQTLTD
FT                   SKVTLGQGITAVVGGTVTNIGTVAATAVAAPVVIVEQPVTRGRPPRSADETLEGDLKKQ
FT                   PLTQ"
FT   gene            153201..153923
FT                   /locus_tag="RHECIAT_CH0000138"
FT   CDS_pept        153201..153923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000138"
FT                   /product="hypothetical conserved protein"
FT                   /note="yhch00039"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000138"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89134"
FT                   /db_xref="GOA:B3PWR6"
FT                   /db_xref="InterPro:IPR010699"
FT                   /db_xref="UniProtKB/TrEMBL:B3PWR6"
FT                   /protein_id="ACE89134.1"
FT                   /translation="MTRARRRRIIRTRRTLTGIALVGAISFLAGMTDATGLLLTGDFVS
FT                   FMTGNTTRAALSLSDGNLYHAAVLISAILVFVLGNAAGIVIAHVSERRIFVVLGCVGLF
FT                   LALASMMTWQSMMLPSFYLIVCSMGMVNAAVEHIEGLPIGLTYVTGALSRFGRGIGRWI
FT                   IGDRRIEWTIQIVPWGGMIAGAIVGAILTRLTGAHALWLVSVFAMALAFAAMFIPRPLQ
FT                   RRFNQKLASHRSAAVRGN"
FT   gene            154095..154883
FT                   /locus_tag="RHECIAT_CH0000139"
FT   CDS_pept        154095..154883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000139"
FT                   /product="hypothetical conserved protein"
FT                   /note="yhch00040"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000139"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89135"
FT                   /db_xref="GOA:B3PWR7"
FT                   /db_xref="InterPro:IPR003848"
FT                   /db_xref="UniProtKB/TrEMBL:B3PWR7"
FT                   /protein_id="ACE89135.1"
FT                   /translation="MFLISKLVWIFCQPLSLAFLLVFFALIAGLLRWRVLSILGTGASA
FT                   LILFVTLYTTAGNLLMQGLEQRFAKPAADPENLQCMIVLGGAFENEVNTARHGIEFNGG
FT                   ADRFVEALRLAQKFPQSRILVSGGDGSMSGIYEGDAAASERFFPLFGIGRDRLIEETQS
FT                   RTTFENAVNTRDFLAGQGLSHCLLITSGFHMPRSVGIFRKLGIDIVPWPTDYRTDGQVR
FT                   PGLDFTQPNLNAQNMATAIREWYGLVGYYLAGRTSELYPD"
FT   gene            complement(154887..155360)
FT                   /locus_tag="RHECIAT_CH0000140"
FT   CDS_pept        complement(154887..155360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000140"
FT                   /product="hypothetical conserved protein"
FT                   /note="yhch00041"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000140"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89136"
FT                   /db_xref="UniProtKB/TrEMBL:B3PXD0"
FT                   /protein_id="ACE89136.1"
FT                   /translation="MKTLVLAVLNLLLLVIMPAAAFGQQSLISDPEIYEKKHFQAQCKA
FT                   AEFADGFVIRQDINNDGLIDAVVNEGELTCDGQKGPQCNDDGCTYNFYLQVAEGGYFMI
FT                   ATAQIYGYDFVQRFGNMVLAMKMHPRFCDRTEGDPCIVTARVRGTKFVTISKK"
FT   gene            155476..156111
FT                   /locus_tag="RHECIAT_CH0000141"
FT   CDS_pept        155476..156111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000141"
FT                   /product="hypothetical conserved membrane protein"
FT                   /note="yhch00042"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000141"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89137"
FT                   /db_xref="GOA:B3PXD1"
FT                   /db_xref="InterPro:IPR005115"
FT                   /db_xref="UniProtKB/TrEMBL:B3PXD1"
FT                   /protein_id="ACE89137.1"
FT                   /translation="MSLLVYLDYAGIALFAATGALAASRKQLDLIGFLFFAMVTGTGGG
FT                   TVRDIVLGRVPVFWVLNPAYILVCCVMGVIVFFTAHLLESRYRLLIWLDAIGLAAYCVL
FT                   GAAKGLAATGSPTIAIVTGTLTATFGGILRDLMANEPSVLLRPEIYVTAALVGAGVFTF
FT                   ANALGMPLYLASACGVAAAFAVRGGALWFGWTFPIYKHKPGRHPDDVM"
FT   gene            complement(156175..156594)
FT                   /gene="irr"
FT                   /locus_tag="RHECIAT_CH0000142"
FT   CDS_pept        complement(156175..156594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="irr"
FT                   /locus_tag="RHECIAT_CH0000142"
FT                   /product="iron transcriptional regulator protein"
FT                   /note="GO_function: GO:0003700 - transcription factor
FT                   activity; GO_process: GO:0006355 - regulation of
FT                   transcription, DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000142"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89138"
FT                   /db_xref="GOA:B3PXD2"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B3PXD2"
FT                   /protein_id="ACE89138.1"
FT                   /translation="MTGALPIAIEVRLRGAGLRPTRQRVALGDLLFAKGDRHLTVEELH
FT                   EEAVAAGVPVSLATVYNTLHQFTEAGLIRVLAVESAKTYFDTNVSDHHHFFVEGENEVL
FT                   DIPVSNLTIANLPEPPEGMEIAHVDVVIRLRAKQG"
FT   gene            156896..157411
FT                   /gene="fabA"
FT                   /locus_tag="RHECIAT_CH0000143"
FT   CDS_pept        156896..157411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabA"
FT                   /locus_tag="RHECIAT_CH0000143"
FT                   /product="3-hydroxydecanoyl-[acyl-carrier-protein]
FT                   dehydratase protein"
FT                   /EC_number="4.2.1.59"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000143"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89139"
FT                   /db_xref="GOA:B3PXD3"
FT                   /db_xref="InterPro:IPR010083"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B3PXD3"
FT                   /protein_id="ACE89139.1"
FT                   /translation="MTTRQSSFSYEELIACAHGKLFGPGNAQLPLPPMLMVHRITEISE
FT                   TGGAFDKGYLRAAYDVRPDDWYFPCHFEGNPIMPGCLGLDGMWQLTGFFLGWLGEEGRG
FT                   MALSTGEVKFKGMVRPHTKLIEYGIDFKRVMRGRLVLGTADGWLKADGETIYQAADLRV
FT                   GLSKDKAA"
FT   gene            157457..158689
FT                   /gene="fabB"
FT                   /locus_tag="RHECIAT_CH0000144"
FT   CDS_pept        157457..158689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabB"
FT                   /locus_tag="RHECIAT_CH0000144"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] synthase
FT                   protein"
FT                   /EC_number="2.3.1.41"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000144"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89140"
FT                   /db_xref="GOA:B3PXD4"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:B3PXD4"
FT                   /protein_id="ACE89140.1"
FT                   /translation="MRRVVVTGLGIVSSIGSDAAEVTESLRQAKSGISFSNDFAEHGFK
FT                   CQVWGSPKLGPAELAELVDRRAMRFLSQGGAWNHVAMKQAIADSGLEEKDYAQNERAGI
FT                   IMGSGGPSTRTLIEAADITVKNNSPKRIGPFAVPKAMSSTASATLATWFKIHGVNYSIS
FT                   SACSTSAHCIGNAAEMIQWGKQDVMFAGGHEDLDWTMSNLFDAMGAMSSKYNDTPDSAS
FT                   RAYDVNRDGFVIAGGAGVLVLEELEHAKARGAKIYAEIVGYGATSDGYDMVAPSGEGAV
FT                   RCMRQALATVKGDVDYINTHGTSTPVGDSKEIGAIREVFGARIPHIQSTKSLTGHSLGA
FT                   AGVQESIYSLLMMQQGFIGESAHISELDPEFEGVPIVRKRIDNAKIDIALSNSFGFGGT
FT                   NATLVFQRHNG"
FT   gene            158694..159500
FT                   /gene="fabI1"
FT                   /locus_tag="RHECIAT_CH0000145"
FT   CDS_pept        158694..159500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabI1"
FT                   /locus_tag="RHECIAT_CH0000145"
FT                   /product="enoyl-[acyl-carrier-protein] reductase (NADH)
FT                   protein"
FT                   /EC_number="1.3.1.9"
FT                   /note="GO_function: GO:0016491 - oxidoreductase activity;
FT                   GO_process: GO:0008152 - metabolic process"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000145"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89141"
FT                   /db_xref="GOA:B3PXD5"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR014358"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B3PXD5"
FT                   /protein_id="ACE89141.1"
FT                   /translation="MTGIMQGKRGLVMGVANNHSIAWGISKALAGQGADLAFTYQGDAL
FT                   GKRVKPLASEVGSDFVLPCDVEDIASVDSLVDAIEQRWGKLDFIVHAIGFSDKNELKGL
FT                   YADTTRENFSRTMVISCFSFTEIAKRCAPLMDDGGAMLTLTYNGSTRVIPNYNVMGVAK
FT                   AALEASVRYLAADYGPRGIRVNAISAGPIRTLAGAGISDARAILSWNQRNAPLRKTVTI
FT                   DQVGNSALYLLSDLSAGVTGEIHFVDAGFNVTSMPTLDTLRRADVE"
FT   gene            complement(159594..160610)
FT                   /locus_tag="RHECIAT_CH0000146"
FT   CDS_pept        complement(159594..160610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000146"
FT                   /product="probable rRNA (guanine-N(2)-)-methyltransferase
FT                   protein"
FT                   /EC_number="2.1.1.171"
FT                   /note="ypch00050; GO_function: GO:0008168 -
FT                   methyltransferase activity"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000146"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89142"
FT                   /db_xref="GOA:B3PXD6"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B3PXD6"
FT                   /protein_id="ACE89142.1"
FT                   /translation="MSRETLKTLFHPFASGTVEAPGEGERVLFLGAEAGFQLPEGFAAS
FT                   LSAVQGFRPLYRQLLAQRIDAKPEIDGEDYDAALVLCTKHKGENEANLAAAIARTRAGG
FT                   LIVVAGAKEDGIQPLRKRLEGFGLAIDHMPKYHGVAFWFGRPAEAGEIVTKLAKAPVRV
FT                   DDRFHATAGMFSHDRVDAGSELLASRLPQDFTGDVADFGAGWGYLSVEMVKRSRGLTRL
FT                   DLYEANHAALEAARGNMAENCPNAPARFFWHDLAGEPVKDKYDLVIMNPPFHEGHAAEP
FT                   SLGQAMIKTAATALRGGGRLMLVANRGLPYEPVLAAEFRESGETCRNARFKVLWAKK"
FT   gene            complement(160741..162861)
FT                   /gene="pnp"
FT                   /locus_tag="RHECIAT_CH0000147"
FT   CDS_pept        complement(160741..162861)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pnp"
FT                   /locus_tag="RHECIAT_CH0000147"
FT                   /product="polyribonucleotide nucleotidyltransferase
FT                   protein"
FT                   /EC_number="2.7.7.8"
FT                   /note="GO_function: GO:0000175 - 3'-5'-exoribonuclease
FT                   activity; GO_function: GO:0003723 - RNA binding;
FT                   GO_process: GO:0006396 - RNA processing"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000147"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89143"
FT                   /db_xref="GOA:B3PXD7"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR012162"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR015848"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="InterPro:IPR036456"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3PXD7"
FT                   /protein_id="ACE89143.1"
FT                   /translation="MEIEWAGRPLKLETGKIARQADGAVLATYGETVVLATVVSAKAPK
FT                   PGQDFFPLTVNYQEKTYAAGKIPGGYFKREGRPSENETLVSRLIDRPIRPLFPEGYKND
FT                   TQVVVTVIQHDLENNPDILSMVATSAALTLSGVPFMGPVGGARVGYINGEYVLNPHLDE
FT                   MDESSLDLVVAGTYDAVLMVESEAKELPEDVMLGAVMFGHKGFQPVLDAIIKLAEVAAK
FT                   EPRDFQPEDYSALESEMLGLAEAELREAYKITQKADRYAAVDAVKAKVKAHFLPEEGEA
FT                   KYTAEEVGAIFKHLQAKIVRWNILDTKSRIDGRDLETVRPIVSEVGLLPRTHGSALFTR
FT                   GETQAIVVATLGTGEDEQYVDSLTGMYKERFLLHYNFPPYSVGETGRMGSPGRREIGHG
FT                   KLAWRAIRPMLPSAEQFPYTLRVVSEITESNGSSSMATVCGTSLALMDAGVPLAKPVAG
FT                   IAMGLILEGDRFAVLSDILGDEDHLGDMDFKVAGTADGITSLQMDIKIAGITEEIMKVA
FT                   LSQAQGGRTHILGEMAKAITESRGQLGEFAPRIEVMNIPVDKIREVIGSGGKVIREIVE
FT                   KTGAKINIEDDGTVKIASSSGKEIEAARKWIHSIVAEPEIGQIYEGTVVKTADFGAFVN
FT                   FFGARDGLVHISQLASERVAKTQDVVKEGDKVWVKLLGFDERGKVRLSMKVVDQATGQE
FT                   IANEKKKEEAAE"
FT   gene            162865..163146
FT                   /locus_tag="RHECIAT_CH0000148"
FT   CDS_pept        162865..163146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000148"
FT                   /product="hypothetical protein"
FT                   /note="yhch00043"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000148"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89144"
FT                   /db_xref="UniProtKB/TrEMBL:B3PXD8"
FT                   /protein_id="ACE89144.1"
FT                   /translation="MCIKHILSFNAGARAIADIRAQRTVDRNQCDVSRARQREAFCLSF
FT                   LGNPCSRENRAKASGSSGRKHPAILPHDRSAVGLAEPAHPGSAGRSTA"
FT   gene            complement(163230..163499)
FT                   /gene="rpsO"
FT                   /locus_tag="RHECIAT_CH0000149"
FT   CDS_pept        complement(163230..163499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsO"
FT                   /locus_tag="RHECIAT_CH0000149"
FT                   /product="30S ribosomal protein S15"
FT                   /note="GO_component: GO:0005622 - intracellular;
FT                   GO_component: GO:0005840 - ribosome; GO_function:
FT                   GO:0003735 - structural constituent of ribosome;
FT                   GO_process: GO:0006412 - translation"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000149"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89145"
FT                   /db_xref="GOA:B3PXD9"
FT                   /db_xref="InterPro:IPR000589"
FT                   /db_xref="InterPro:IPR005290"
FT                   /db_xref="InterPro:IPR009068"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3PXD9"
FT                   /protein_id="ACE89145.1"
FT                   /translation="MSITAERKAALIKEYATAEGDTGSPEVQVAILTERINNLTEHFKD
FT                   HKKDNHSRRGLLTMVSSRRSLLDYLKKKDEGRYSKLINSLGIRR"
FT   gene            complement(163650..164501)
FT                   /locus_tag="RHECIAT_CH0000150"
FT   CDS_pept        complement(163650..164501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000150"
FT                   /product="putative hydrolase protein"
FT                   /note="ypch00051"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000150"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89146"
FT                   /db_xref="GOA:B3PXE0"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B3PXE0"
FT                   /protein_id="ACE89146.1"
FT                   /translation="MRAIAIGMLTFFSLFLTVAGARSAERWAELPAFPAMPAPKTSGMA
FT                   DVNDIKMYYAEYGEGDPILFIHGGLGNTGVWGHQIAEFARDHLVIVADSRGHGRSTRSQ
FT                   QPFGYDLMTSDYVALLDYLKIDKVTLVGWSDGGIIGIDMAMKHPEKLTRVIAQAANVTT
FT                   DGVKPDVMSNRTFNAYIKVAGEQYRTLSPTPNEYDAFVTQISRMWATQPNWTATELGKI
FT                   TLPVTLAIGDHDEAVKLDHTEMMAKEIPGAKLVILKDASHFAMLQDPAGYNAMIRDAMT
FT                   SR"
FT   gene            complement(164580..165512)
FT                   /gene="truB"
FT                   /locus_tag="RHECIAT_CH0000151"
FT   CDS_pept        complement(164580..165512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="truB"
FT                   /locus_tag="RHECIAT_CH0000151"
FT                   /product="tRNA pseudouridine synthase B protein"
FT                   /EC_number="5.4.99.12"
FT                   /note="GO_function: GO:0016439 - tRNA-pseudouridine
FT                   synthase activity; GO_process: GO:0006396 - RNA processing"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000151"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89147"
FT                   /db_xref="GOA:B3PXE1"
FT                   /db_xref="InterPro:IPR002501"
FT                   /db_xref="InterPro:IPR014780"
FT                   /db_xref="InterPro:IPR015240"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR032819"
FT                   /db_xref="UniProtKB/TrEMBL:B3PXE1"
FT                   /protein_id="ACE89147.1"
FT                   /translation="MSKPRKPKGRPISGWLILDKPVDFGSTEAVSKLKWLYKAQKAGHA
FT                   GTLDPLASGMLPIALGDATKTVPYVMDGRKIYEFTVSWGEERATDDLEGDVTQSSEKRP
FT                   TEQQIRDILPRYIGTISQVPPQFSAIKIAGERAYDLARDGEAVEIPSREVEIFRLTLLA
FT                   CPDANTAHFEVECGKGTYVRALARDFGRELGCYGHISGLRRTFVAPFAEEVMVPLANLV
FT                   ALEAIEDMDERLAALDALLIDTCEALSALPHLVINDDQAHRLKMGNPILVRGRDAPIAE
FT                   SEAYATARGRLIAIGEIGQGEFRPKRVFA"
FT   gene            complement(165525..165929)
FT                   /gene="rbfA"
FT                   /locus_tag="RHECIAT_CH0000152"
FT   CDS_pept        complement(165525..165929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbfA"
FT                   /locus_tag="RHECIAT_CH0000152"
FT                   /product="ribosome binding factor A, rRNA processing
FT                   protein"
FT                   /note="GO_process: GO:0006364 - rRNA processing"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000152"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89148"
FT                   /db_xref="GOA:B3PXE2"
FT                   /db_xref="InterPro:IPR000238"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR020053"
FT                   /db_xref="InterPro:IPR023799"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3PXE2"
FT                   /protein_id="ACE89148.1"
FT                   /translation="MTRPTSSAPSQRMLRVGEQVRAAITQVLQRGEVRDDIIEATVISI
FT                   SEVRMSPDLKIATAYVTPLGVSDHSIVIEALNRHAKFIRGRLGPQLRQMKYMPEVRFRD
FT                   DTSFDNYKKIDELLRSPEVSRDLDGDNDDQ"
FT   gene            complement(166091..168844)
FT                   /gene="infB"
FT                   /locus_tag="RHECIAT_CH0000153"
FT   CDS_pept        complement(166091..168844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infB"
FT                   /locus_tag="RHECIAT_CH0000153"
FT                   /product="translation initiation factor IF-2 protein"
FT                   /note="GO_function: GO:0003924 - GTPase activity;
FT                   GO_function: GO:0005525 - GTP binding"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000153"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89149"
FT                   /db_xref="GOA:B3PXE3"
FT                   /db_xref="InterPro:IPR000178"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006847"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR013575"
FT                   /db_xref="InterPro:IPR015760"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036925"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3PXE3"
FT                   /protein_id="ACE89149.1"
FT                   /translation="MTDSNDDKTLSVTGKKTLTLKPSGMSQGTVRQDMGRGRTKAVVVE
FT                   TRKRRPMRPEDEKPITPAAPAAPVRAAEPAPAPVQARPPQPTPAPRVHQPGSSQANQRP
FT                   QQSYQPQRSNDRPRPVVLNHLSPEEMDARRRALAESQARDAQDAIRRAEEEKRRAAEEA
FT                   IRKAAEAEEAARRAAEEAARQAEAPAAAEPAVAAAPAPVVTEARPTAPRPASPAPAARR
FT                   PDGAGAPAAARPAPGAGAPAGARGRRDDEGDDDRGAARGGPARGRVVRPEPAKPVTTRP
FT                   KTDDERRRGKLTITTADVDGEDTGRSRSLSAMRRRQEKFRRSQMQETREKISREVVLPE
FT                   TITIQELSQRMSERAVDVIKFLMKEGQMMKPGDVIDADLAELIAGEFGHTVKRVSESDV
FT                   ELGIFNIADVEGDRVSRPPVVTIMGHVDHGKTSLLDAIRHANVVAGEAGGITQHIGAYQ
FT                   VEQNGQKITFIDTPGHAAFTAMRARGAQATDIAILVVAADDSVMPQTIESINHAKAAGV
FT                   PIIVAINKIDKHEADPQKVRNQLLQHEVFVESMGGETLDVEVSAKTGKNLDKLLEAVLL
FT                   QAEILDLKANPNRTAEGTVIEAQLDRGRGSVATVLVQNGTLKPGQIIVAGDVWGRVRAL
FT                   VTDKGDHVKEAGPATPVEVLGLSGTPQAGDKFAVVESESRAREISEYRQRLARDKAAAR
FT                   QSGQRGSLEQMMTQMQSTGIKEFPLVIKGDVQGSIEAIAGALEKLGTDEVRARIVHSGA
FT                   GGITESDISLAEASNAAIIGFNVRANAQARQFAERQGIEIRYYNIIYDLVDDVKAAMSG
FT                   LLSPERRETFIGNAEILEVFNITKVGKVAGCRVVEGKVERGAGVRLIRNDVVVHEGKLK
FT                   TLKRFKDEVSEVPMGQECGMAFENYEDMRVGDVIECFRVEHITRTL"
FT   gene            complement(168947..169636)
FT                   /locus_tag="RHECIAT_CH0000154"
FT   CDS_pept        complement(168947..169636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000154"
FT                   /product="hypothetical conserved protein"
FT                   /note="yhch00044"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000154"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89150"
FT                   /db_xref="InterPro:IPR007393"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="InterPro:IPR035931"
FT                   /db_xref="InterPro:IPR037465"
FT                   /db_xref="UniProtKB/TrEMBL:B3PXE4"
FT                   /protein_id="ACE89150.1"
FT                   /translation="MTAHEPDALPQDDDLAGYDVNGRMCIVTRESGSPDELIRFVAAPD
FT                   GTVVADLKRELPGRGCWVKADRSLVDRAVAKKLFARALKSDVKAADDLGANVDRLLAAQ
FT                   LMQMMNMARKAGQFISGSSKVDAAVRSGAALAVFHATDAADDGVRKIDQARKAWHLGME
FT                   TEEEIPSYRFFSESEMEGLMGQNAFIHAAVLAGQAGEGVVKRAKMLEQYRIGGQSRAAG
FT                   GAGRQKR"
FT   gene            complement(169636..171237)
FT                   /gene="nusA"
FT                   /locus_tag="RHECIAT_CH0000155"
FT   CDS_pept        complement(169636..171237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusA"
FT                   /locus_tag="RHECIAT_CH0000155"
FT                   /product="N-utilization substance protein (transcription
FT                   elongation factor)"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000155"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89151"
FT                   /db_xref="GOA:B3PXE5"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR010213"
FT                   /db_xref="InterPro:IPR010214"
FT                   /db_xref="InterPro:IPR010995"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013735"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR025249"
FT                   /db_xref="InterPro:IPR030842"
FT                   /db_xref="InterPro:IPR036555"
FT                   /db_xref="UniProtKB/TrEMBL:B3PXE5"
FT                   /protein_id="ACE89151.1"
FT                   /translation="MAVSANRLELLQIADAVAREKVIDREIVLAAMADAIQKAARSRYG
FT                   TESNIRADINPKTGEIRLQRLLEVVDKAEDYSTQIPLELARDRNPDAALGDFIADPLPP
FT                   MDFGRIAAQSAKQVIVQKVREAERDRQFDEFKDRVGEIVNGTVKRVEYGNVIVDLGRGE
FT                   GIIRRDEMIPRENVRYGDRVRAYVYDVRREQRGPQIFLSRTHPQFMVKLFTMEVPEIYD
FT                   GIIQVKSVARDPGSRAKIAVISNDSSIDPVGACVGMRGSRVQAVVGELQGEKIDIIPWS
FT                   QDPATFVVNALQPAEVAKVVLDEDAERIEVVVPDEQLSLAIGRRGQNVRLASQLTGWDI
FT                   DIMTEAEESERRQKEFNERTNLFMDSLDVDEMVGQVLASEGFAAVEELAYVDLDEISSI
FT                   DGFDEDTAQEIQTRAREFLERLEAEMDEKRKALGVEDELRGIDGMTAQMMVALGEDGIK
FT                   TIEDFAGCAADDLVGWTERKNGETKKFEGLFSKFDVSRVEAEQMIVQARLAAGWITEED
FT                   LAKGTEEEVTEAEQEA"
FT   gene            complement(171298..171894)
FT                   /locus_tag="RHECIAT_CH0000156"
FT   CDS_pept        complement(171298..171894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000156"
FT                   /product="hypothetical conserved protein"
FT                   /note="yhch00045"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000156"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89152"
FT                   /db_xref="GOA:B3PXE6"
FT                   /db_xref="InterPro:IPR003728"
FT                   /db_xref="InterPro:IPR028989"
FT                   /db_xref="InterPro:IPR028998"
FT                   /db_xref="InterPro:IPR035956"
FT                   /db_xref="InterPro:IPR036847"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3PXE6"
FT                   /protein_id="ACE89152.1"
FT                   /translation="MTNADNELEPRLITETGLDQRLADIIEPVLVGMGFRLIRVRMLNQ
FT                   NGMTMQVMAERNDGTMTVQDCEEVSMAISPVLDVEDPIDKEYHLEVSSPGIDRPMVRKS
FT                   DFVRWQGHLVKCETSIMIGNRKRFRGKIVEADADGFTLERDQIAYGEEPKVSIPFTALS
FT                   DAKLILTDDLIRDALRADKLAKAQAANQNEADEQE"
FT   gene            172053..173768
FT                   /locus_tag="RHECIAT_CH0000157"
FT   CDS_pept        172053..173768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000157"
FT                   /product="putative ABC transporter, permease protein"
FT                   /note="ypch00052"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000157"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89153"
FT                   /db_xref="GOA:B3PXE7"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B3PXE7"
FT                   /protein_id="ACE89153.1"
FT                   /translation="MPRRGRVYSQRRSCAYIALGHNGKAGGNVAYTSSTLAPLRHDTYR
FT                   AIWFASLSSNFGGLIQAVGAAWMMTTITASEDMVALVQTSTALPIMLFSLISGALADNY
FT                   DRRRVMLTAQGTMLIVSALLTVTVLLGWITPWLLLFFTFLIGCGTALNNPSWQASVGDM
FT                   VPRADLPGAVTLNSMGFNITRSVGPAIGGAIVAAAGAAAAFAVNTLSYLPLIYALSRWR
FT                   PNTPVSTLPREALASAIFAGLRYVSMSPNLEKVLVRGLIFGIGASSILALLPVVALDLV
FT                   AGGPLTYGFMLGAFGVGAIGGAVLSARIRQTLSSETIIRLAFAGFALSAVIAAVSPSAV
FT                   LTSAGLLVAGACWVSALSLFNTIVQLSTPRWVVGRALSLYQTVTFGGIAGGSWLWGVAA
FT                   DRYGVADALLMSSVVLLVGIAIGLRFSMPAFASLNLDPLNRFTAPALSLDITPRSGPIV
FT                   IQVDYEIADDDLAEFMALMGERRRIRIRDGARHWALMRDLENPGLWTESYHTPTWVEYI
FT                   RHNQRRTQADAENIDRLRALHRGEGLPHVHRMIERQAIPPDNDVFHQAPIDLHH"
FT   gene            173777..174232
FT                   /locus_tag="RHECIAT_CH0000158"
FT   CDS_pept        173777..174232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000158"
FT                   /product="putative acetyltransferase protein"
FT                   /note="ypch00053; GO_function: GO:0008080 -
FT                   N-acetyltransferase activity; GO_process: GO:0008152 -
FT                   metabolic process"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000158"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89154"
FT                   /db_xref="GOA:B3PXE8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B3PXE8"
FT                   /protein_id="ACE89154.1"
FT                   /translation="MHNFRLARQADLAAIIRLLADDDLGSAREIVADPIDPRYLSAFAA
FT                   IEANANQMLAVASDASDRIAGCLQLSFIPGLSRTGMWRGQIESVRIARDLRGSGLGSAF
FT                   IEWAIVQCVERGCGLVQLTSDKTRTDSIRFYEKLGFVASHVGLKRSL"
FT   gene            complement(174237..175508)
FT                   /locus_tag="RHECIAT_CH0000159"
FT   CDS_pept        complement(174237..175508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000159"
FT                   /product="probable transglycosylase protein"
FT                   /note="ypch00054; GO_process: GO:0000270 - peptidoglycan
FT                   metabolic process"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000159"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89155"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR011970"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031304"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/TrEMBL:B3PXE9"
FT                   /protein_id="ACE89155.1"
FT                   /translation="MSGRTEGGALRRLWTIALAVMVALLPLSARATPSKADVEAQFESW
FT                   VQKDLWPEAKANGISEKSFKAAFSGVTLNWSLTDLAPPGFPPPKEQKQTQAEFSSPGPY
FT                   FNEDRLTRLAATGRGFAAQYSATLKRIEKTYGVPGSIVLAIWGRETGFGAAKIPNSAVE
FT                   VLATKAFMSTRKEMFRTELMAALHIIDGGDVAPADFKGSSAGALGQPQFMPTSYLKYAV
FT                   DFDGDGHRNIWTSVPDTLASIANFLVKKGWQRDRDWGFEVSIPEAVSCAQEGPDLAKPL
FT                   SHWASLGIDRISGKGFPSGEMKAQSMMLVPAGRDGPEFIVTPNFYIIKEYNNSDLYALY
FT                   IGNLADRIAYNGGAFEGRWGDVGKMLRSDVAAMQKALERQGYDVGGSDGLPGYKTRRSI
FT                   GQWQTKNGMKPTCFPEATMKDRLK"
FT   gene            complement(175694..176299)
FT                   /gene="recR"
FT                   /locus_tag="RHECIAT_CH0000160"
FT   CDS_pept        complement(175694..176299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recR"
FT                   /locus_tag="RHECIAT_CH0000160"
FT                   /product="DNA recombination protein"
FT                   /note="GO_function: GO:0003676 - nucleic acid binding;
FT                   GO_process: GO:0006304 - DNA modification"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000160"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89156"
FT                   /db_xref="GOA:B3PXF0"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3PXF0"
FT                   /protein_id="ACE89156.1"
FT                   /translation="MAKRVTGPEIEKLIQLLAKVPGLGPRSARRAALHLIKKKDQLLGP
FT                   LSNAMGEAYDKVKICSRCGNVDTVDPCTVCTDAQRDQSVIIVVEDVSDLWALERAGAMN
FT                   AAYHVLGGTLSPLDGIGPDDLNIRGLIDRIGEGGIRELIIAVNATVEGQTTAHYITDQL
FT                   QGLDVKITRLAHGVPVGGELDYLDEGTLAAALRARTVI"
FT   gene            176318..176974
FT                   /locus_tag="RHECIAT_CH0000161"
FT   CDS_pept        176318..176974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000161"
FT                   /product="hypothetical conserved protein"
FT                   /note="yhch00046; GO_function: GO:0003824 - catalytic
FT                   activity; GO_function: GO:0030151 - molybdenum ion binding;
FT                   GO_function: GO:0030170 - pyridoxal phosphate binding"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000161"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89157"
FT                   /db_xref="GOA:B3PXF1"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="UniProtKB/TrEMBL:B3PXF1"
FT                   /protein_id="ACE89157.1"
FT                   /translation="MQRKRNRGRIGRPMKILALCTGTPEKLTGKSYKTGIFKHAVNGAV
FT                   MIDAEGLVGDAICNRKHHGGVDQAVYIEGSLTLDWWSRELCRPYEPGTFGENMVISDLD
FT                   NRVVSVGDRFLSGDLVLEVTACRIPCATFAARMADPKFVKRYTAAARPGIYCRVIRGGI
FT                   AEVGTPLEHQPFPGEKVTMPELMETFGRRLSQVDRARYLAAPIHYKLRALLAAQP"
FT   gene            complement(177034..177357)
FT                   /locus_tag="RHECIAT_CH0000162"
FT   CDS_pept        complement(177034..177357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000162"
FT                   /product="hypothetical conserved protein"
FT                   /note="yhch00047"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000162"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89158"
FT                   /db_xref="GOA:B3PXF2"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/TrEMBL:B3PXF2"
FT                   /protein_id="ACE89158.1"
FT                   /translation="MRDIMGMMGKVKEMQAKMEQMQAEIAELTAEGKAGGGLVTVVISG
FT                   KGELKSLKIDPSLFKEDDVEILEDLIVAAHKDAKDKAEALAAEKTKALTAGLPIPPGFK
FT                   LPF"
FT   gene            complement(177379..179250)
FT                   /gene="dnaX"
FT                   /locus_tag="RHECIAT_CH0000163"
FT   CDS_pept        complement(177379..179250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaX"
FT                   /locus_tag="RHECIAT_CH0000163"
FT                   /product="DNA polymerase III, tau subunit protein
FT                   (DNA-directed DNA polymerase)"
FT                   /EC_number="2.7.7.7"
FT                   /note="GO_function: GO:0005524 - ATP binding"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000163"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89159"
FT                   /db_xref="GOA:B3PXF3"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022107"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3PXF3"
FT                   /protein_id="ACE89159.1"
FT                   /translation="MSDTERQSKDAASTGTGYRVLARKYRPKNFTDLMVGQEPMVRTLT
FT                   NAFETGRIAQAYMLTGVRGVGKTTTARILARALNYKTADVDKPTIDLRAPGEHCQAIME
FT                   GRHVDVIEMDAASHTGIDDIREIIEQVRYRPVSARYKVYIIDEVHMLSTQAFNGLLKTL
FT                   EEPPEHVKFIFATTEIRKVPITVLSRCQRFDLRRISASDLVGLFTTIAAKEGIEAEADA
FT                   LAMIARAAEGSARDGLSLLDQAIAHGAGVVQAEAVRGMLGLADRARIVDLFQHIVKGDV
FT                   AGALAEFQSQYEAGANPVVVLTDLADFTHLVTRLKYVPDAANDPSLSEIERTKAAELAK
FT                   GVAVTTLSRIWQMLLKGIPETEGSSRTAGAAEMVLIRLAHAAHLPAPEDAARRLAEFSG
FT                   DNAGSRPTSPPSGGGGGNGTRVPYQSSVAARAPEPTPRPQPSGPTAMLRAVPNPEPQAI
FT                   GRVETKPAEAPKPLVPVNTIGDIVDLAAEKRDVKLKALVRNFVRPVRIEPGRLDVNLTE
FT                   GAPGTLLNELAVKLKEWTGIHWIVSTSREEGGPTMVEAEAKAQQQRVSDARQDPDVAAI
FT                   LAQFPGAKIIDVRVRAPTPEEEAEEATPPAAAESEDGDILPGDDIEF"
FT   gene            179627..180163
FT                   /locus_tag="RHECIAT_CH0000164"
FT   CDS_pept        179627..180163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000164"
FT                   /product="hypothetical conserved protein"
FT                   /note="yhch00048"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000164"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89160"
FT                   /db_xref="GOA:B3PXF4"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR026026"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:B3PXF4"
FT                   /protein_id="ACE89160.1"
FT                   /translation="MAVELGYDARRSVDHPTPFEPTECFNLTRKGSSRWKRQEECPLNG
FT                   FTLDPRLEKDSISVMVTGLCDLRLSRDARWPWLILVPRRTGITEIFELTPLDQVLLTFE
FT                   TEMVVKALKEITGATKINVGALGNIVRQLHVHVIARFEGDANWPGPVWGFGRAEPYEDG
FT                   KRDELTAKLREALSS"
FT   gene            180160..181119
FT                   /locus_tag="RHECIAT_CH0000165"
FT   CDS_pept        180160..181119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000165"
FT                   /product="putative NTP pyrophosphohydrolase protein,
FT                   MutT/nudix family"
FT                   /EC_number="3.6.1.-"
FT                   /note="ypch00055; GO_function: GO:0016787 - hydrolase
FT                   activity"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000165"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89161"
FT                   /db_xref="GOA:B3PXF5"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015375"
FT                   /db_xref="InterPro:IPR015376"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:B3PXF5"
FT                   /protein_id="ACE89161.1"
FT                   /translation="MSHSLFDSDVPHPEPSNLTAFAGNDLNRDSEHRDEHSVEKALARE
FT                   GTHIFAFANDKLVLKHDGQVLDPLFARYELQELRPNWDETVLLGYRKSGEPRLAVPVGV
FT                   DVDDLASQYKPADGRTLFREMLIDEVLLGEFAQAASLIRWNGDNRFCGRCGSAMEIHIG
FT                   GYKRVCAACEHTIFPRTDPVVIMLTIDESRDLCLLGRSPHFAPGMYSCLAGFVEPGETI
FT                   ENAVRRETLEESGVRTGRIRYHASQPWPMPHSLMIGCYAEAKSTDINRDETELEDCRWF
FT                   TREETLEMLERPGANGKASPPKGAIAHRLMRDWVEWKR"
FT   gene            181124..181819
FT                   /locus_tag="RHECIAT_CH0000166"
FT   CDS_pept        181124..181819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000166"
FT                   /product="putative transcriptional regulator protein"
FT                   /note="ypch00056"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000166"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89162"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B3PXF6"
FT                   /protein_id="ACE89162.1"
FT                   /translation="MPVARSERLLTLLQTLRRYRRPVTGTVLARETGVSLRTLYRDIAS
FT                   LQAQGAMIEGEAGIGYVLKPGFMLPPMMFSEEELEALVLGSRWVARAAEPRLAGAGADA
FT                   LAKIAAVLPADMREMIDSAALFVGPKRRDEDKADVSAIRKAIRLERVLELHYGDEQGRI
FT                   SRRRVWPFALGYFEHVRVLMAWCELRQDFRHFRTDRIIDMALHEVRYPRRRTVLLKEWR
FT                   ETQDVPIES"
FT   gene            181892..182152
FT                   /locus_tag="RHECIAT_CH0000167"
FT   CDS_pept        181892..182152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000167"
FT                   /product="hypothetical protein"
FT                   /note="yhch00049"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000167"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89163"
FT                   /db_xref="UniProtKB/TrEMBL:B3PXF7"
FT                   /protein_id="ACE89163.1"
FT                   /translation="MVTPPAIQQAGDRFATNSFADIISAETFADARHSARFGLLQFAIG
FT                   LFRAGGGSRPKLDVEATPDHLKRDLGFIDGRNPRHEDRFPR"
FT   gene            182278..182646
FT                   /locus_tag="RHECIAT_CH0000168"
FT   CDS_pept        182278..182646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000168"
FT                   /product="putative glyoxalase/dioxygenase protein"
FT                   /note="ypch00057"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000168"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89164"
FT                   /db_xref="GOA:B3PXF8"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR026275"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B3PXF8"
FT                   /protein_id="ACE89164.1"
FT                   /translation="MTSPNLIILYVKDPGESAGFYRSLLNREPAVEAPNFVAFPLDGGF
FT                   TLGLWRRSKVEPQPSAIGNRGEVAFMVAGENAVAKQYEDWRQRGLPIAQELTELDFGPT
FT                   FVVLDPDGHRLRVCEPDK"
FT   gene            complement(182718..183572)
FT                   /gene="pheA"
FT                   /locus_tag="RHECIAT_CH0000169"
FT   CDS_pept        complement(182718..183572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheA"
FT                   /locus_tag="RHECIAT_CH0000169"
FT                   /product="prephenate dehydrogenase protein"
FT                   /EC_number="4.2.1.51"
FT                   /note="GO_function: GO:0004664 - prephenate dehydratase
FT                   activity; GO_process: GO:0009094 - L-phenylalanine
FT                   biosynthetic process"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000169"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89165"
FT                   /db_xref="GOA:B3PXF9"
FT                   /db_xref="InterPro:IPR001086"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR008242"
FT                   /db_xref="InterPro:IPR018528"
FT                   /db_xref="UniProtKB/TrEMBL:B3PXF9"
FT                   /protein_id="ACE89165.1"
FT                   /translation="MNIKTNRIAFQGEFGANSDMASRDMFPTMEPLPCQTFEDAFTAVD
FT                   NGDADIAMIPIENTIAGRVADIHHLLPESRLHIIGEYFMPIRFQLMVLPGVTKDEIRTV
FT                   HSHIHALGQCRKIVRAHGWKPVIAGDTAGAAKLVKETGDRSMAALAPRLAADLYGLEIV
FT                   AENVEDTENNVTRFVVLSRDEEWAQRNSAEEKVVTTFVFNVRNIPAALYKALGGFATNN
FT                   INMTKLESYQLGGKFVATQFYADIEGHPNDPNVRRALEELRFFSEKVRILGVYKGHAMR
FT                   GLL"
FT   gene            complement(183695..184450)
FT                   /gene="kdsB"
FT                   /locus_tag="RHECIAT_CH0000170"
FT   CDS_pept        complement(183695..184450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdsB"
FT                   /locus_tag="RHECIAT_CH0000170"
FT                   /product="3-deoxy-manno-octulosonate cytidylyltransferase
FT                   protein"
FT                   /EC_number="2.7.7.38"
FT                   /note="GO_process: GO:0009103 - lipopolysaccharide
FT                   biosynthetic process"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000170"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89166"
FT                   /db_xref="GOA:B3PXG0"
FT                   /db_xref="InterPro:IPR003329"
FT                   /db_xref="InterPro:IPR004528"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3PXG0"
FT                   /protein_id="ACE89166.1"
FT                   /translation="MSDSNLDEVLVLIPARMASTRLPGKPLADICGLPMIVQVAMRAKE
FT                   AAIGRVVVAVDDQQVFDAVSAAGFDVVMTSSDHQSGSDRIFEALTKVDPDGKAKFIVNV
FT                   QGDLPTIDPQTVRAALRPLENEAVDIGTLTTEIDDEDDKTAPHIVKIVGSPVSDTRLHA
FT                   LYFTRATAPHGKGPLYHHIGLYAYRRAALERFVSLGPSTLERRESLEQLRALEAGMRID
FT                   VEIVDTVPLGVDTPADLEKARRILSARTG"
FT   gene            184604..185170
FT                   /gene="cycM"
FT                   /locus_tag="RHECIAT_CH0000171"
FT   CDS_pept        184604..185170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cycM"
FT                   /locus_tag="RHECIAT_CH0000171"
FT                   /product="cytochrome c protein"
FT                   /note="GO_function: GO:0005506 - iron ion binding;
FT                   GO_function: GO:0009055 - electron carrier activity;
FT                   GO_function: GO:0020037 - heme binding; GO_process:
FT                   GO:0006118 - electron transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000171"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89167"
FT                   /db_xref="GOA:B3PXG1"
FT                   /db_xref="InterPro:IPR002327"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:B3PXG1"
FT                   /protein_id="ACE89167.1"
FT                   /translation="MNSYVNTAVGALLGTIFVLMSVSIASEGIFHSEAPEKEGFAIVAE
FT                   EAPAAGGEAAPAAAAVPIAQLLASADAKAGEAVFKKCQACHDGTKGGPNKVGPNLFGVV
FT                   DRPIASHEGFAYSSAMKDFSKGSSEKWTFEALNKFLTAPKKDVPGTAMGFAGLAKDQDR
FT                   ANVILYLHTLADSPVPLPDPKTATQ"
FT   gene            complement(185240..186187)
FT                   /locus_tag="RHECIAT_CH0000172"
FT   CDS_pept        complement(185240..186187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000172"
FT                   /product="probable ABC transporter, permease protein"
FT                   /note="ypch00058; GO_component: GO:0016021 - integral to
FT                   membrane"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000172"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89168"
FT                   /db_xref="GOA:B3PXG2"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="UniProtKB/TrEMBL:B3PXG2"
FT                   /protein_id="ACE89168.1"
FT                   /translation="MSAIILDVLPIFILILIGWVIVRSGLMASNVGDALSEFVFKIAVP
FT                   LLLFRTIAEADFHGASPFRLWIVYFSGVAITWTAGHIAATRLFHRDERIGVLAGVSSAF
FT                   ANNVFIGLPLVQRTVGDEGLVALSILLAVHLPVMMVAGTVLMEHAERKIAGKSDRSMVF
FT                   VLRQIAINLIRNPLVIGLAAGMAVHLSGLTMPAAVASVVGQIAGIAGPAALISLGMALE
FT                   RYGVSGNLGIASVTSSLKLLLLPCCVWTASRLLGLSPEWTAAIVLTSSVPTGVNAWLIA
FT                   NRFGVGHSLAASTISVTTALGAITVSLWAYFLGA"
FT   gene            186606..187598
FT                   /locus_tag="RHECIAT_CH0000173"
FT   CDS_pept        186606..187598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000173"
FT                   /product="putative sugar kinase protein"
FT                   /note="ypch00059"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000173"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89169"
FT                   /db_xref="GOA:B3PXG3"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:B3PXG3"
FT                   /protein_id="ACE89169.1"
FT                   /translation="MTRFDVLTIGNAIVDIIARCDDQFLIDNKITKAAMNLIDAERAEL
FT                   LYSRMGPALEASGGSAGNTAAGVANLGGKAAYFGNVASDQLGDIFTHDIRAQGVHYQTR
FT                   PKGTFPPTARSMIFVTEDGERSMNTYLGACVELGPEDVEADVVADAKVTYFEGYLWDPP
FT                   RAKEAIRDCARIAHENGREMSMTLSDSFCVDRYRGEFLDLMRSGTVDIVFANRQEALAL
FT                   YQTEDFEEALNRIAADCKIAAVTMSENGAVILKGQERYYVDAIRIREVVDTTGAGDLFA
FT                   SGFLYGYTQGRSLEDCGKLGCLAAGIVIQQIGPRPMTSLSEAAKHAGLI"
FT   gene            complement(187591..188130)
FT                   /locus_tag="RHECIAT_CH0000174"
FT   CDS_pept        complement(187591..188130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000174"
FT                   /product="hypothetical conserved protein"
FT                   /note="yhch00050"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000174"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89170"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="InterPro:IPR010466"
FT                   /db_xref="UniProtKB/TrEMBL:B3PXG4"
FT                   /protein_id="ACE89170.1"
FT                   /translation="MRSKVLKSCLAVAIALATSLGPIEFAHAQAAKGPSGLPLPRFVTL
FT                   KSKRVNLRIGPGTDYAVSWMYLKSGLPVEIIQEYDNWRRIRDADGTEGWVNQSLLSGQR
FT                   AAIAAPWMKTKGKGVFVNLRREAQPSASIIAKLEPGVMLTIGECNGDWCRAEADGATGW
FT                   VAQSEIWGAYPGEAFK"
FT   gene            188314..189315
FT                   /locus_tag="RHECIAT_CH0000175"
FT   CDS_pept        188314..189315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000175"
FT                   /product="probable D-2-hydroxyacid dehydrogenase protein"
FT                   /EC_number="1.1.1.26"
FT                   /note="ypch00060; GO_function: GO:0016616 - oxidoreductase
FT                   activity, acting on the CH-OH group of donors, NAD or NADP
FT                   as acceptor; GO_function: GO:0048037 - cofactor binding"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000175"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89171"
FT                   /db_xref="GOA:B3PXG5"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B3PXG5"
FT                   /protein_id="ACE89171.1"
FT                   /translation="MTAKKKPKVYITRKLPDAVETRMRELFDAELNIDDAPRSVPELMA
FT                   AVRTADVLVPTVTDRIDAALIEAAGPQMKLIASFSNGTDHIDVEAAARKGITVTNTPNV
FT                   LTEDTADMTMALILAVPRRLGEGARVLTDKPGEWAGWSPTWMLGRRIHGKRIGIVGMGR
FT                   IGTAVARRAKAFGLSIHYHNRKRVNPAVEDELEATYWESLDQMLARVDIVSVNCPSTPA
FT                   TFHLISARRLALLQPTAYLVNTARGDVVDESALIKCLREGKIAGAGLDVFENEPAVNPK
FT                   LVKLANEGKVVLLPHMSSATIEGRIDMGDKVIINIRTFIDGHRPPNRVLPGR"
FT   gene            complement(189322..189810)
FT                   /locus_tag="RHECIAT_CH0000176"
FT   CDS_pept        complement(189322..189810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000176"
FT                   /product="putative acetyltransferase protein"
FT                   /note="ypch00061; GO_function: GO:0008080 -
FT                   N-acetyltransferase activity; GO_process: GO:0008152 -
FT                   metabolic process"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000176"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89172"
FT                   /db_xref="GOA:B3PXG6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B3PXG6"
FT                   /protein_id="ACE89172.1"
FT                   /translation="MTILRLDRSFTRWDELLALILAAFASMNGRIDPPSSALKLTTRSL
FT                   AEKAEAEIGHVVIENERLIGCLFLRPEADCLYVGKLAILPEAQGKGLGKRLLAIAEETA
FT                   AALGLAALRLETRIELTENHAVFAAWGFSRTAEKAHPGFARTTFIEMRKLLAPRTPTV"
FT   gene            complement(189807..190631)
FT                   /gene="moeB"
FT                   /locus_tag="RHECIAT_CH0000177"
FT   CDS_pept        complement(189807..190631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="moeB"
FT                   /locus_tag="RHECIAT_CH0000177"
FT                   /product="molydopterin synthase sulfurylase protein"
FT                   /note="GO_function: GO:0003824 - catalytic activity"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000177"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89173"
FT                   /db_xref="GOA:B3PXG7"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:B3PXG7"
FT                   /protein_id="ACE89173.1"
FT                   /translation="MRKAAFPGVGHHDSIAAMEPLSPDEIARYHRHILLPEIGGAGQQR
FT                   LKAARVLVIGAGGLGAPILQYLAAAGVGTLGIVDDDRVSLSNLQRQVIHDSGTIGELKI
FT                   ESAALAIARLNPHVRLIRFEERFCAETAQRQLSGFDLLIDGSDNFDTRYAAADAAEAAR
FT                   IALVTGAVGRFDGSLTVLKPYETSEDGTANPRYRDLFPEAPPAGLVPSCAEAGIIGALT
FT                   GVIGTMMAMEAIKLITGAGEPLIGRLLLYDALSARFDTIRYKRRRERQGQAV"
FT   gene            complement(190628..191752)
FT                   /gene="recF"
FT                   /locus_tag="RHECIAT_CH0000178"
FT   CDS_pept        complement(190628..191752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="RHECIAT_CH0000178"
FT                   /product="DNA replication and repair protein"
FT                   /note="GO_component: GO:0005694 - chromosome; GO_function:
FT                   GO:0005524 - ATP binding; GO_process: GO:0006259 - DNA
FT                   metabolic process"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000178"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89174"
FT                   /db_xref="GOA:B3PXG8"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3PXG8"
FT                   /protein_id="ACE89174.1"
FT                   /translation="MPHKVSLSRLKLTDFRNYAAVSLALDGRHAVLTGNNGAGKTNLME
FT                   AVSLLSPGRGLRRAAYGDITRVGAAGGFSIFAALDGMEGEVEIGTGIEAGEETTTRKLR
FT                   INGTPAKTADELTDHLRLLWLTPAMDGLFTGASSDRRRFLDRLVLSLDPAHGRRASDFE
FT                   RAMRSRNKLLDEGRFDPSWLAGIEEQMASLGIAMALARQEMLGLLARLIEERPESSPFP
FT                   SASLQLSGFMDGQFSRPSVDLEDEYAAMLAESRYRDASAGRTLDGPHRADLIVHHREKA
FT                   MEAERCSTGEQKALLVGLVLAHARLVGNLTGHAPILLLDEIAAHLDEGRRAALFDLIDG
FT                   LGGQAFMTGTDQTMFSALADRAQFFTVADGKVFG"
FT   gene            191863..192045
FT                   /locus_tag="RHECIAT_CH0000179"
FT   CDS_pept        191863..192045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000179"
FT                   /product="hypothetical protein"
FT                   /note="yhch00051"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000179"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89175"
FT                   /db_xref="UniProtKB/TrEMBL:B3PXG9"
FT                   /protein_id="ACE89175.1"
FT                   /translation="MFPQMRLIPELFGTLFWQIPKNTTASKQSVIVSSAADSHRHCFQT
FT                   AGSQGIRSIFSGSLT"
FT   gene            192148..192516
FT                   /locus_tag="RHECIAT_CH0000180"
FT   CDS_pept        192148..192516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000180"
FT                   /product="putative transcriptional regulator protein,
FT                   Cro/CI family"
FT                   /note="ypch00062; GO_function: GO:0043565 -
FT                   sequence-specific DNA binding"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000180"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89176"
FT                   /db_xref="GOA:B3PXH0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B3PXH0"
FT                   /protein_id="ACE89176.1"
FT                   /translation="MPDPVDIIVGHNIRQLRALRRVSQLELGEALGLTFQQIQKYEKGT
FT                   NRVSASKLHQIAVFLDVEISVLFEGADMPQFGSRIELSPDAYALALSYDKLNSPAGKEA
FT                   VKTILTLISSGQAAENAA"
FT   gene            complement(192636..193007)
FT                   /locus_tag="RHECIAT_CH0000181"
FT   CDS_pept        complement(192636..193007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000181"
FT                   /product="hypothetical conserved protein"
FT                   /note="yhch00052"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000181"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89177"
FT                   /db_xref="UniProtKB/TrEMBL:B3PXH1"
FT                   /protein_id="ACE89177.1"
FT                   /translation="MALASFPNEFSLCRQRMTGDRHRFSKDQAQIGMMERSQPSFRALR
FT                   SVRGTTKTRVTAMAPAFSSQHDDVDVLAGAIYTWCAERNIKLRSQQGLSIANIAIDLYH
FT                   AGHQTQDDLLTALHEREFH"
FT   gene            complement(193193..194320)
FT                   /gene="dnaJ1"
FT                   /locus_tag="RHECIAT_CH0000182"
FT   CDS_pept        complement(193193..194320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaJ1"
FT                   /locus_tag="RHECIAT_CH0000182"
FT                   /product="molecular chaperone protein DnaJ"
FT                   /note="GO_function: GO:0051082 - unfolded protein binding;
FT                   GO_process: GO:0006457 - protein folding"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000182"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89178"
FT                   /db_xref="GOA:B3PXH2"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3PXH2"
FT                   /protein_id="ACE89178.1"
FT                   /translation="MAKADFYETLGVAKSADEKELKSAFRKLAMKYHPDKNPDDKDAER
FT                   KFKEINEAYEMLKDPQKRAAYDRYGHAAFEHGGMGGGGGGFAGGGFSDIFEDIFGEMMG
FT                   GGRARQRSSGGRERGADLRYNMEITLEEAFSGKTAQIRVPTSITCDVCSGSGAKPGTQP
FT                   KNCGTCQGSGRVRAAQGFFSIERTCPTCHGRGQIIPDPCPKCHGQGRVTEERSLSVNIP
FT                   AGIEDGTRIRLQGEGEAGARGGPAGDLYIFLSVKPHEFYQRDGADLYCAVPISMTTAAL
FT                   GGTFDVATLDGTKSRVTVPEGTQAGKQFRLKSKGMPVLRSAQTGDLYIQIQIETPQKLT
FT                   KRQRELLQEFEQISSKENNPESTGFFARMKEFFEG"
FT   gene            complement(194405..196324)
FT                   /gene="dnaK1"
FT                   /locus_tag="RHECIAT_CH0000183"
FT   CDS_pept        complement(194405..196324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaK1"
FT                   /locus_tag="RHECIAT_CH0000183"
FT                   /product="molecular chaperone heat shock protein (hsp70)"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000183"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89179"
FT                   /db_xref="GOA:B3PXH3"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3PXH3"
FT                   /protein_id="ACE89179.1"
FT                   /translation="MAKVIGIDLGTTNSCVAVMDGKDAKVIENAEGARTTPSMVAFSDD
FT                   GERLVGQPAKRQAVTNPTNTLFAVKRLIGRRYEDPTVEKDKHLVPFSIVKGDNGDAWVE
FT                   ANGKGYSPAQISAMILQKMKETAESYLGEKVEKAVITVPAYFNDAQRQATKDAGKIAGL
FT                   EVLRIINEPTAAALAYGLDKKDGKTIAVYDLGGGTFDISILEIGDGVFEVKSTNGDTFL
FT                   GGEDFDMRLVEYLVAEFKKDNGIDLKNDKLALQRLKEAAEKAKIELSSSQQTEINLPFI
FT                   TADASGPKHLTLKLTRAKLESLVDDLVQRTIAPCKAALKDAGVTAAEIDEVVLVGGMSR
FT                   MPKVQEVVKQLFGKEPHKGVNPDEVVALGAAIQAGVLQGDVKDVLLLDVTPLSLGIETL
FT                   GGVFTRLIERNTTIPTKKSQTFSTAEDNQQAVTIRVSQGEREMAADNKLLGQFDLVGLP
FT                   PSPRGVPQIEVTFDIDANGIVQVSAKDKGTGKEQQIRIQASGGLSDADIEKMVKDAESH
FT                   AAEDKKRREAVEAKNQAESLIHSTEKSLKDYGDKVSEADRTAISDAIAALKSATEATEA
FT                   DAEDIKAKTQTLMEVSMKLGQAIYEAQQAEGGAAADASAEEGGDNVVDADYEEIKDDDR
FT                   KKSA"
FT   gene            complement(196673..198997)
FT                   /locus_tag="RHECIAT_CH0000184"
FT   CDS_pept        complement(196673..198997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000184"
FT                   /product="probable penicillin binding protein"
FT                   /note="ypch00063; GO_component: GO:0009274 -
FT                   peptidoglycan-based cell wall; GO_function: GO:0003824 -
FT                   catalytic activity; GO_process: GO:0009252 - peptidoglycan
FT                   biosynthetic process"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000184"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89180"
FT                   /db_xref="GOA:B3PXH4"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:B3PXH4"
FT                   /protein_id="ACE89180.1"
FT                   /translation="MAGRGRSSDRIEPSFSGRPARDDDEFSLDADDRVVGSRSTRRGGS
FT                   RPPPQRAARQRRREPRERAGGGLFGFLRRVVYWCVVLFIWAGIGVAGLVVYYGSRMPSA
FT                   STWAIPERPPNVKITAVDGSVIANRGATGGEALSLENMSPYIPEAVIAIEDRRFYSHFG
FT                   VDPLGLGRAIVTNFTAGHMVQGGSTLTQQLAKNLFLSPERTLERKVQEVLLSLWLEQKY
FT                   TKDQILAMYLNRVFFGSNAYGVEAASRRYFNKSARDVNLGEAAVLAGLLKAPSRLSPAR
FT                   DAEAANARAQLVLAAMREQGFISDSEVKTAMSQTPASAKSYWSGAGHYVADMVMDELPG
FT                   LIGDVKEDVIVDTTIDKSLEKKAEQSLVDVLDKEGGKLDASQAALVSIDGTGAIRALVG
FT                   GRDYATSQFNRAVKAKRQPGSSFKPFVYAAALEKGLTPFSVFNDAPIRIGDWTPENYEK
FT                   KYNGEVTLATALSKSLNTVAAQLVMYDGPDQVIKLAHRLGIESELQPNASIALGTSEVS
FT                   LMELTASYAAFMNGGYKATPHVIRRVTTADGKVLYENTYDSPPRVLSEQIAAEMDAMMM
FT                   GVIDNGTGKSAKIPGWQAAGKTGTTQNSRDALFVGFTSNLTTGVWFGNDDGKPMKKVTG
FT                   GGLPAKAWKEFMIAAHKGLSPAPLFGNGQLIGDPDGQPMAQTAPDGGQPVTAEAPPPTT
FT                   IGGIISGVFGGNENANRYPQAPVRQQTAPSGNGPVPPADIAEGDGSGYGNVVPPGDVGT
FT                   PQTTSSVQPRRTTLLDLIMGQ"
FT   gene            complement(199245..199505)
FT                   /locus_tag="RHECIAT_CH0000185"
FT   CDS_pept        complement(199245..199505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000185"
FT                   /product="hypothetical conserved protein"
FT                   /note="yhch00053"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000185"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89181"
FT                   /db_xref="UniProtKB/TrEMBL:B3PXH5"
FT                   /protein_id="ACE89181.1"
FT                   /translation="MRIDPDPFEAGTLMTQDYLALFGLFGPRPAATDVTVWHKYNPILP
FT                   VRLTDGASLNPSGQIWRRFHLGEWEYKQDPETLDDYEARQY"
FT   gene            complement(199966..200655)
FT                   /locus_tag="RHECIAT_CH0000186"
FT   CDS_pept        complement(199966..200655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000186"
FT                   /product="hypothetical conserved protein"
FT                   /note="yhch00054"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000186"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89182"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="UniProtKB/TrEMBL:B3PXH6"
FT                   /protein_id="ACE89182.1"
FT                   /translation="MKNLIVKIAAAALLVLAPAMAHAAEGYSTANVNMRAGPSTRYPAV
FT                   AVIPAGSSVEIRGCLSNVNWCDVEFYGGRGWVSGQYVQAVYQQRRVYVGPEYYRPLGIP
FT                   MVTFSVGNYWDRYYRHRDFYRERDRWSRGPDYYYRDRDYSDRDYRRREYRDRDYQAREY
FT                   RDRDRDRRDDDRREERRREVRRDDDNRSSNFRDLPQFRGGKADTYNRPDPRASPFVCRP
FT                   GDPSCDN"
FT   gene            complement(201045..202433)
FT                   /gene="dapE1"
FT                   /locus_tag="RHECIAT_CH0000187"
FT   CDS_pept        complement(201045..202433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapE1"
FT                   /locus_tag="RHECIAT_CH0000187"
FT                   /product="succinyl-diaminopimelate desuccinylase protein"
FT                   /note="GO_function: GO:0008237 - metallopeptidase activity;
FT                   GO_process: GO:0006508 - proteolysis"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000187"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89183"
FT                   /db_xref="GOA:B3PXH7"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="UniProtKB/TrEMBL:B3PXH7"
FT                   /protein_id="ACE89183.1"
FT                   /translation="MTDVQQVLARADQNLSSSLEKLFELLRIRSISTDPAFKAECRKAA
FT                   EWLVAYLQGIGFDASVRDTPGHPMVVAHHAGASADAPHLLFYGHYDVQPVDPIELWEND
FT                   PFEPSIKDIGEGRKILTGRGTSDDKGQLMTFVEACRAYKEINGALPCRITILFEGEEES
FT                   GSPSLKPFLEANAAELKADYALVCDTGMWDRDTPAIAAALRGLVGEEVVVTAADRDLHS
FT                   GLFGGAAANPIHILVEALAGLHDETGRITLDGFYDGVEETPDNIKASWETLGKSAEKFL
FT                   GEVGLSIPSGEKGRSVLELTWARPTAEVNGIWGGYTGEGFKTVIAAKASAKVSFRLVGT
FT                   QDPTAIREAFRSYIRSKIPADCSVEFHPHGGSPAIHLSYDSPLLTKAKTALSDEWPKPA
FT                   IVIGMGGSIPIVGDFQKMLGMESLLVGFGLSDDRIHSPNEKYELVSYHKGIRSWVRILQ
FT                   ALAA"
FT   gene            202645..204978
FT                   /locus_tag="RHECIAT_CH0000188"
FT   CDS_pept        202645..204978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000188"
FT                   /product="putative sensory box/GGDEF family protein"
FT                   /note="ypch00064"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000188"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89184"
FT                   /db_xref="GOA:B3PXH8"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR005330"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B3PXH8"
FT                   /protein_id="ACE89184.1"
FT                   /translation="MFSVITCIRDDHDWRLVLAAAAVCLIGAMAAMLPLSRAQECDAGR
FT                   RKLWIGASAFAFGTGVWATHFIAMLAYDGGMPISYQLGLTALSFLLSVAGSWAAILVAS
FT                   KGRGRFSSIQGGVLMALGIAAMHLTGMQAIETQAEILYDPYMTVTAVLAGALLSSIAFH
FT                   AFFHLKGLRRLLASSITFVLAICALHFISMASITLVPDPGKEVPATVLDTSLLATIVVV
FT                   AATALILIAIAVAFFESHLTDLRGLANASQEGLVILREGRIIDTNERFQGLSGWKLADL
FT                   SGKAPSIVLTAVQGQNRPGETLLKTRNGREIAVEVNTSRIVYRGHNCDVLAVRDLTERR
FT                   QAEEIIEHLAHHDVLTDLPNRSLFDKRIRQALQMAKGKNSEVALFYIDLDRFKTVNDIF
FT                   GHAEGDRILCKVAAILRRVADERDTIARLGGDEFAIIQSAGQQPAAAQKLAAAILDEFA
FT                   AEMDMARDPTAVGVSLGIALYPADGSDPDEICNNADIALYRVKHGGRGKACFFNAEMDE
FT                   ATRARRQIESELRHAIIRNQIHVSYQPVLDAQSGEISGYEALMRWNRPGHGLSEPDIFI
FT                   PIAEESGSIVQLGEWVLQQACKEAARWPDPLRIAVNVSPVQFMLPNLCERIEAILKETG
FT                   LAPARLEIEITEAALIRDRDRVMATLQRLRSLGVHIVMDDFGTGFSSLSNLRTFPFDKI
FT                   KVDRSFTGMLEHDAAARSIVRAIIGLGHSLGMPVVTEGVETEAQRQIVVEEGCAQVQGF
FT                   LLGRPDVEPSIKLAAGESLLASTA"
FT   gene            complement(205143..205559)
FT                   /locus_tag="RHECIAT_CH0000189"
FT   CDS_pept        complement(205143..205559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000189"
FT                   /product="probable transcriptional regulator protein, MarR
FT                   family"
FT                   /note="ypch00065; GO_component: GO:0005622 - intracellular;
FT                   GO_function: GO:0003700 - transcription factor activity;
FT                   GO_process: GO:0006355 - regulation of transcription,
FT                   DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000189"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89185"
FT                   /db_xref="GOA:B3PXH9"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B3PXH9"
FT                   /protein_id="ACE89185.1"
FT                   /translation="MDSGAYLASQLAKGFARSLHRRAVGLGFSPGQFPILLELWGEDGL
FT                   TQKQLLERVDIEQATMANTLSRMVRDGLIERRPHPSDKRAQLIFLTPKARAMEAEAIES
FT                   AREADLALFKGFRTFERELTLEYIRRLLENAKAL"
FT   gene            205998..208991
FT                   /gene="polA"
FT                   /locus_tag="RHECIAT_CH0000190"
FT   CDS_pept        205998..208991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="polA"
FT                   /locus_tag="RHECIAT_CH0000190"
FT                   /product="DNA-directed DNA polymerase, DNA polymerase I
FT                   protein"
FT                   /EC_number="2.7.7.7"
FT                   /note="GO_function: GO:0003677 - DNA binding; GO_function:
FT                   GO:0003887 - DNA-directed DNA polymerase activity;
FT                   GO_process: GO:0006260 - DNA replication"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000190"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89186"
FT                   /db_xref="GOA:B3PXI0"
FT                   /db_xref="InterPro:IPR001098"
FT                   /db_xref="InterPro:IPR002298"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR018320"
FT                   /db_xref="InterPro:IPR019760"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="InterPro:IPR020046"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B3PXI0"
FT                   /protein_id="ACE89186.1"
FT                   /translation="MKKGDHLFLVDGSGFIFRAFHALPPLTRKTDGLPVGAVSGFCNML
FT                   WKLLRDARNTDVGVTPTHLAVIFDYSAKTFRKDLYDAYKANRSAPPEELVPQFGLIREA
FT                   TRAFNLPCIETEGFEADDIIATYARQAEAVGADVTIVSSDKDLMQLVTPNVHMYDSMKD
FT                   KQIGIPDVIEKWGVPPEKMIDLQAMTGDSVDNVPGIPGIGPKTAAQLLEEYGDLDTLLE
FT                   RATEIKQVKRRETILANIEMARISRELVRLRTDVPLDLDLDALVLEPQNGPKLIGFLKT
FT                   MEFTTLTRRVAEVCDCDASAIEPAVVRIEWGDAAHGPDLDAAEPAPVAGGIPEVSGQSV
FT                   PVPPRAKAGVEGAFSPADLAKARAEAFAALPFDHSAYVTIRDLATLDRWIADARDTGLV
FT                   AFDTETTSLDAMQAELVGFSMAIADNVADPTGTKIRAAYLPLAHKNGVGDLLGGGLAEN
FT                   QVPMRDALPRLKALLEDESVLKVAQNLKYDYLLLKRYGIETKSFDDTMLISYVLDAGTG
FT                   AHGMDPLSEKFLGHTPIPYKDVAGSGRANVTFDLVDIDRATHYAAEDADVTLRLWLVLK
FT                   PRLVAAGLTSVYERLERPLLPVLARMEARGITVDRQILSRLSGELAQGAARLEDEIYTL
FT                   AGERFNIGSPKQLGDILFGKMGLAGGSKTKTGQWSTSASVLEDLAAAGFELPRKIVDWR
FT                   QLTKLKSTYTDALPGYVHPETKRVHTSYSLASTTTGRLSSSEPNLQNIPVRTAEGRKIR
FT                   TAFISTPGHKLISADYSQIELRVLAHVAEIPQLTKAFEDGVDIHAMTASEMFGVPVEGM
FT                   PGEVRRRAKAINFGIIYGISAFGLANQLSIERSEAGDYIKKYFERFPGIRDYMESRKAM
FT                   ARDKGYVETIFGRRINYPEIRSSNPSVRAFNERAAINAPIQGSAADVIRRAMIKIEPAL
FT                   AEAGLAERVRMLLQVHDELIFEVEDEDVDKAMPIIVSVMENATMPALEMRVPLKVDARA
FT                   ATNWDEAH"
FT   gene            209162..211522
FT                   /gene="ftsK1"
FT                   /locus_tag="RHECIAT_CH0000191"
FT   CDS_pept        209162..211522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsK1"
FT                   /locus_tag="RHECIAT_CH0000191"
FT                   /product="cell division protein"
FT                   /note="GO_component: GO:0016021 - integral to membrane;
FT                   GO_function: GO:0000166 - nucleotide binding; GO_function:
FT                   GO:0003677 - DNA binding; GO_function: GO:0005524 - ATP
FT                   binding; GO_process: GO:0007049 - cell cycle; GO_process:
FT                   GO:0007059 - chromosome segregation; GO_process: GO:0051301
FT                   - cell division"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000191"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89187"
FT                   /db_xref="GOA:B3PXI1"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR018541"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B3PXI1"
FT                   /protein_id="ACE89187.1"
FT                   /translation="MRFPRTNLTDAADFSSGFETELAEENPGERPAAPIWQSNFSLAPN
FT                   VRFTRTPETLISRRRPPNEPVHDEPPLEQQAIRIEPVAVDVPFDIYLPEPSELAAAPAP
FT                   MIETPQPLASGRAETPALRAASELSSISDFAFWEVMAFEEGEPVRTPSIVVPKIETTPE
FT                   SITALFRVMEWRPGAPKPAPAASRPIQPPAARPAATALRPPAAISLEKAVRAPEPIVLA
FT                   PRGAPPVPQTGPMPQTAPVLQAAPLPQAAPAPRPTPPVAAVLPSPRLMARPEKVDASGY
FT                   EFPPRALLQEPPERLGEIMSQETLEQNAGLLESVLEDFGIKGEIIHVRPGPVVTLYEFE
FT                   PAPGVKSSRVIGLADDIARSMSALSARVAVVPGRNVIGIELPNVTRETVYFREMIESQD
FT                   FDKSGYKLALGLGKTIGGEPVIAELAKMPHLLVAGTTGSGKSVAINTMILSLLYRMTPE
FT                   QCRLIMVDPKMLELSVYDGIPHLLTPVVTDPKKAVMALKWAVREMEERYRKMSRLGVRN
FT                   IDGYNGRVCQAREKGETIHIMVQTGFDKGTGAPIEESQELDLAPMPYIVVIVDEMADLM
FT                   MVAGKEIEGAIQRLAQMARAAGIHLIMATQRPSVDVITGTIKANFPTRISFQVTSKIDS
FT                   RTILGEQGAEQLLGQGDMLHMQGGGRIARVHGPFVSDAEVEKVVAHLKTQGRPEYLDTV
FT                   TADEEEEPEEEEAGAVFDKSAMASEDGNELYEQAVKVVMRDKKCSTSYIQRRLGIGYNR
FT                   AASLVERMEKEGLVGPANHVGKREIVSGRGDGE"
FT   gene            complement(211668..212453)
FT                   /locus_tag="RHECIAT_CH0000192"
FT   CDS_pept        complement(211668..212453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000192"
FT                   /product="probable spermidine/putrescine ABC transporter,
FT                   permease protein"
FT                   /note="ypch00066; GO_component: GO:0016020 - membrane;
FT                   GO_function: GO:0005215 - transporter activity; GO_process:
FT                   GO:0006810 - transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000192"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89188"
FT                   /db_xref="GOA:B3PXI2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B3PXI2"
FT                   /protein_id="ACE89188.1"
FT                   /translation="MTIRLLKFLFGAATVIFLLAPLLAILPVAFTSSSFLAYPIPSLST
FT                   RWFAVLATEDAWRRSIVNSLLIGAGTTLLSTVLGILAALALRRRVVFAAALRTIFLLPM
FT                   VVPAVVLGVGLQILFAGLGFPNTFAAVIVAHTVVAVPFVLVSITASLEGIDYRTERAAA
FT                   SLGASPAKVFWKVTLPLAVPGVLSGAVLAFATSLDEVVLTLFVAGPNQLTLARQMFSSI
FT                   RENISPAIVAAAFLFIVGTILLGGLLAVVHKRAARSAAA"
FT   gene            complement(212455..213624)
FT                   /locus_tag="RHECIAT_CH0000193"
FT   CDS_pept        complement(212455..213624)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000193"
FT                   /product="probable spermidine/putrescine ABC transporter,
FT                   permease protein"
FT                   /note="ypch00067; GO_component: GO:0016020 - membrane;
FT                   GO_function: GO:0005215 - transporter activity; GO_process:
FT                   GO:0006810 - transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000193"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89189"
FT                   /db_xref="GOA:B3PXI3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B3PXI3"
FT                   /protein_id="ACE89189.1"
FT                   /translation="MNAFRRHTGTFALVLPLSLFLGVFFIWPLLTVLQQAVSDPVVSKN
FT                   LPRTTAAVSAWNLTSEPSDVMRTALVDDLKSLDDDQNLGEVVRRLNSAQPGFRTLMRKT
FT                   VAAVRDGTGPISLPEIDTRWNDAAFWRAIAEATEPYTDRNLLAAVDLQHDASGTIVAMP
FT                   AGESANQAILLRTFAVAAVVTLATCLIGLPYAMLAAAASGWRRQLLLAAVLLPLWTSLL
FT                   VRTAAWYVLLQDKGLINSLLVSLGFLNAPLPLLFNRTGVVIAMTHVLLPFMVLPIYSVL
FT                   IAIPRNLMPAAASLGARPIRAFLHILLPLALRGIASGGLLVFMAALGYYITPALIGGPK
FT                   DQMISSVIAFYATGSANWGMAGALGMVLLAVTIVLYGVYGWLSMKTTGA"
FT   gene            complement(213621..214763)
FT                   /locus_tag="RHECIAT_CH0000194"
FT   CDS_pept        complement(213621..214763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000194"
FT                   /product="probable spermidine/putrescine ABC transporter,
FT                   ATP-binding protein"
FT                   /note="ypch00068; GO_function: GO:0005524 - ATP binding;
FT                   GO_function: GO:0016887 - ATPase activity"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000194"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89190"
FT                   /db_xref="GOA:B3PXI4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005893"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3PXI4"
FT                   /protein_id="ACE89190.1"
FT                   /translation="MGASAHLRHFVCPRADNPNGGPPWLRRAYALKKFPNPLACIRSSK
FT                   TCRSTSRGANFVSLLGPSGSGKTTLLMMLAGFENPTAGGIFLDGRRIDHLPPHRREMGV
FT                   VFQNYALFPHMSIADNIAFPLRMRGVGRGEIEERVKRALEMVQLSAMSARKPAQLSGGQ
FT                   QQRVALARSLVFEPTVVLMDEPLGALDKQLREQMQLDIRALHKRLELTVVFVTHDQSEA
FT                   LTMSDRIAVFNRGNIEQIGSPRDIYDRPQTRAVAEFIGETNLIEGTVKMTGTAGTSVEI
FT                   ADGRHVIVPGSNSLAVGSRVHISVRPERISLAACGIGAAANALPAKILDSVYQGDHLRV
FT                   QLDEDAFRFVVRTDMRSAEWPVGADVVAHFTPDDCWVIAA"
FT   gene            complement(214808..215857)
FT                   /locus_tag="RHECIAT_CH0000195"
FT   CDS_pept        complement(214808..215857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000195"
FT                   /product="probable spermidine/putrescine ABC transporter,
FT                   substrate-binding protein"
FT                   /note="ypch00069; GO_function: GO:0005215 - transporter
FT                   activity; GO_process: GO:0006810 - transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000195"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89191"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:B3PXI5"
FT                   /protein_id="ACE89191.1"
FT                   /translation="MKFKNTSTITAIGLLSLALAAVPGATRDLTIASWGGNFQDAQREI
FT                   YFKPFSKVTGKPLLDEGWDGGIGVLQAKVKAGNPSWDAVEVEADELSLGCADGLFEKVD
FT                   WSKLGGKDAFLPSAVSDCGVGAIVWSTAIAYDGAKIGDGPKSWADFWDVKKFPGKRALR
FT                   KGPKYTLEFALMADGVPADKVYEVLATPEGIDRAFAKLDALKPNLVWWTSGAQPLQLLA
FT                   SGEVAMTSAYNGRITGINRSEGRQFKVVWPGSIYAVDSWVVLKGAENKDAAFDFIAFAS
FT                   KAENQAKLPQYIAYGLPNKEAGKSLPPDQLADLPTTQANMQEAVSLDTDFWIDNSEALT
FT                   KRFDAWLAQ"
FT   gene            216386..217285
FT                   /locus_tag="RHECIAT_CH0000196"
FT   CDS_pept        216386..217285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000196"
FT                   /product="putative transcriptional regulator protein, LysR
FT                   family"
FT                   /note="ypch00070"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000196"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89192"
FT                   /db_xref="GOA:B3PXI6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B3PXI6"
FT                   /protein_id="ACE89192.1"
FT                   /translation="MVRAFEAVSRLGSMRRAADDLNLSHTVISRHVRNLEAWFGTRLVD
FT                   AGPRGIRLTAEGRVFAETVGAAFDLIAKSTAELRPAVNRTVLRIWCVPGLATRWLTPRF
FT                   NQLQLALPGIDFVMRATDLEPDFTRYEADVDIRYSEEPRGNVRWILLERPRMFTVTSPE
FT                   WISRNAPIRTLDDLVRQPLIHEESRDQWRQWFRKAGFEHEVTLNGPRLWSANLTVDAAV
FT                   AGQGIALATRLIAADDLRAGRLVELLETDVRLGGYYFVGPRERWNEVTSARFRAWLQQS
FT                   IAETTGGHASHESGSPSR"
FT   gene            complement(217300..217803)
FT                   /locus_tag="RHECIAT_CH0000197"
FT   CDS_pept        complement(217300..217803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000197"
FT                   /product="hypothetical conserved protein"
FT                   /note="yhch00055"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000197"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89193"
FT                   /db_xref="InterPro:IPR007344"
FT                   /db_xref="UniProtKB/TrEMBL:B3PXI7"
FT                   /protein_id="ACE89193.1"
FT                   /translation="MRAINVVDYDPSWPRLFADISTEVAALLGSFVLSIDHIGSTSVPG
FT                   LAAKPKIDLDVVAISDDVLPAAIDAVSAADFVFHGDRGEKRWAFTRDHHGYGFKLYLCG
FT                   PANRAHRERLLFRDYLRDHPQRATAYAELKRRLAAEAGNDWDFYTGGKTAFVSETLRLA
FT                   RLRR"
FT   gene            complement(217823..218416)
FT                   /gene="phnN"
FT                   /locus_tag="RHECIAT_CH0000198"
FT   CDS_pept        complement(217823..218416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnN"
FT                   /locus_tag="RHECIAT_CH0000198"
FT                   /product="ATP-binding phosphonate metabolism protein
FT                   (ribose 1,5-bisphosphate phosphokinase)"
FT                   /EC_number="2.7.4.23"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000198"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89194"
FT                   /db_xref="GOA:B3PXI8"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR012699"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3PXI8"
FT                   /protein_id="ACE89194.1"
FT                   /translation="MTHEPHPGAGAERGIMVVVVGPSGAGKDTLMNLAARHFSGRADVH
FT                   FTRRVITRHRGAGGEDHLSVSLQGFAAMEQSGSFAVWWEAHGLKYGIPAEVSVALSKGH
FT                   IVVANGSRSALHRFQAAFPRLKVINVTASAEVLAGRLEARGRETHEDIMARLARGPLTV
FT                   RGDYDVTELDNSGSIEEAEQKMIAILDGLLAEVH"
FT   gene            complement(218413..219552)
FT                   /gene="phnM1"
FT                   /locus_tag="RHECIAT_CH0000199"
FT   CDS_pept        complement(218413..219552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnM1"
FT                   /locus_tag="RHECIAT_CH0000199"
FT                   /product="phosphonate metabolism protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000199"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89195"
FT                   /db_xref="GOA:B3PXI9"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR012696"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B3PXI9"
FT                   /protein_id="ACE89195.1"
FT                   /translation="MSKETVFSNARIVLEDDVLAGSILIRDGKIADISEGKSVAGEDFE
FT                   GDFIIPGLVELHTDHLEGHYQPRPGIRWNKTAAVQAHDAQIVTSGITTVFDCLRMGADE
FT                   DGGFEHGEMREMADAIQSAEKEGRLRAEHLLHLRCEVSADNVLEHFADFENDPHVRLVS
FT                   LMDHAPGQRQFQTMDQYIFYYQKKRGLSDEVFARFVAKRQAESARNSTPHRNAIAKVCA
FT                   ERGITVASHDDATLAHVDEAIDNGVRLAEFPTSFDAARASHEHGMSVLMGAPNIVRGKS
FT                   HSGNIAARELAEMGVLDVLSSDYVPLSLLHAPFILADEVESITLPKAIAMVTSTPARTV
FT                   SLDDRGRIATGLRADLVRVHRSHGVPVTRSVWRQGRRVA"
FT   gene            complement(219566..220387)
FT                   /locus_tag="RHECIAT_CH0000200"
FT   CDS_pept        complement(219566..220387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000200"
FT                   /product="hypothetical conserved protein"
FT                   /note="yhch00056"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000200"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89196"
FT                   /db_xref="InterPro:IPR009389"
FT                   /db_xref="UniProtKB/TrEMBL:B3PXJ0"
FT                   /protein_id="ACE89196.1"
FT                   /translation="MATGPPSSFCHGNLLAGEPACGSPPNHCTLRSPVSTIPRTKALRY
FT                   ALYFSPPKDDPLTGAASLWLGRDAFTGETYPAPAYEQLGQAEQFELTADPRRYGFHATI
FT                   KAPFALAASVTEKDLMAFAEDFAARTPAFEIPELVLGQLGRFFALVPGSLHQPLQDFAA
FT                   KVVKSFEPFRATLSEADIIRRNPEKLSDSQRANLQRWGYPYVMEDFGFHMTLSGQVPET
FT                   RAEVMKAILAERFAGFTGRPLSISSLAVFVEETRGAPFKVHSWLPLSGAKS"
FT   gene            complement(220401..221744)
FT                   /locus_tag="RHECIAT_CH0000201"
FT   CDS_pept        complement(220401..221744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000201"
FT                   /product="probable phosphonate ABC transporter, permease
FT                   protein"
FT                   /note="ypch00071; GO_component: GO:0016020 - membrane;
FT                   GO_function: GO:0005215 - transporter activity; GO_process:
FT                   GO:0006810 - transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000201"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89197"
FT                   /db_xref="GOA:B3PXJ1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005769"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B3PXJ1"
FT                   /protein_id="ACE89197.1"
FT                   /translation="MTVIDANRMHEIEARYPEYFHRSFRQRFGGLMIVIATLLYGLYAV
FT                   WFFDFPKLFAEAHWERVGIYLSQWVSYDVQPEFRIQNDGTIAVRYPRFSPLGDNPHPDW
FT                   VVDNPDGSITIAVSGAGLAVTVSKSETIVTAHGVSVPVDVSSGAPKVVGPVPAWMTVYD
FT                   DNVLADLGFAGDVSISVNRVKIRKRFLGWANFVFDTQSSFFDKPVGEVISLIVSGPRIK
FT                   PDQSNLSLAFDDIWNNSEWQHGDVWTKLFQTIVMAFLGTLLGALAAFPLAFMAARNITP
FT                   NRLLNQILKRFFDFLRSVDMLIWALFLTRAFGPGPLAGSGAIFLTETGTLGKLYSEGLE
FT                   NIDNKPREGIQSTGAQTVLVHRYGIMPQIVPVIVSQTLYQWESNVRGATIIGAVGAGGI
FT                   GLKLWEAMRTNANWENVAYMVILILIVVFLFDAASNALRHRLMGSRTH"
FT   gene            complement(221752..222711)
FT                   /locus_tag="RHECIAT_CH0000202"
FT   CDS_pept        complement(221752..222711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000202"
FT                   /product="probable phosphonate ABC transporter, permease
FT                   protein"
FT                   /note="ypch00072; GO_component: GO:0016020 - membrane;
FT                   GO_function: GO:0005215 - transporter activity; GO_process:
FT                   GO:0006810 - transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000202"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89198"
FT                   /db_xref="GOA:B3PXJ2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005769"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B3PXJ2"
FT                   /protein_id="ACE89198.1"
FT                   /translation="MTVADTQPHMQSTEEIGTAWGRMVAKRRFYTVLGLVILIAAFVSS
FT                   VRFADESNAGHFFDRLPHLFDFLSWLIPKDWNDVWRALFDIASVNDKGGEEFNFDKGRV
FT                   YVWGAFYIPEYFELMIITINVALLSTIIAFVFAVPLSFFAARNLTSSWPLRIFTKRLME
FT                   FLRAFPEIVIAGLFSAILSIGPVAAIIAITLHTIGALGKLFYEVAENIDMKPHEGMKAV
FT                   GANWWERVRFAALPQVLPNFTSYALLRLEINVRASTIIGAVGGGGIGEELKLSISRGFG
FT                   AKTVALVLLLFVTIVAVDQFSAWLRRRLVGAHAFLLQH"
FT   gene            complement(222777..223682)
FT                   /locus_tag="RHECIAT_CH0000203"
FT   CDS_pept        complement(222777..223682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000203"
FT                   /product="probable phosphonate ABC transporter,
FT                   substrate-binding protein"
FT                   /note="ypch00073"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000203"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89199"
FT                   /db_xref="GOA:B3PXJ3"
FT                   /db_xref="InterPro:IPR005770"
FT                   /db_xref="InterPro:IPR017797"
FT                   /db_xref="UniProtKB/TrEMBL:B3PXJ3"
FT                   /protein_id="ACE89199.1"
FT                   /translation="MLKKALFAATAMFALAGAANAADLKEFRIGILGGENETDRLRNYA
FT                   CLADHLKQEFGFEKVSLFPAADYDGVIQGLLGGTLDFAELGASGYAAVYIKDPKAVTPI
FT                   LTTQQKDGSTGYHSIGLALKSSGIKTIKDAKGKKLGYADPDSTSGYLVPLTQIPKDTGM
FT                   PNDKFFASTQFNGGHENNLLAAYDGKVDVAVDDSSGIGDFKDGYTSGTFRKEVDKGAVD
FT                   PNKLVEVWRSPLIPNGPLVVRNALGEEWQTKLAAFFTALPEKDHKCFAAVEGGDYKGYA
FT                   PVKHEFYNTVVEVRKAAIGG"
FT   gene            complement(223770..224615)
FT                   /locus_tag="RHECIAT_CH0000204"
FT   CDS_pept        complement(223770..224615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000204"
FT                   /product="probable phosphonate ABC transporter, ATP-binding
FT                   protein"
FT                   /note="ypch00074; GO_function: GO:0005524 - ATP binding;
FT                   GO_function: GO:0016887 - ATPase activity"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000204"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89200"
FT                   /db_xref="GOA:B3PXJ4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR012693"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3PXJ4"
FT                   /protein_id="ACE89200.1"
FT                   /translation="MFELKDVTRRFGKKLAVDTVTLTIPQGQMVGIIGRSGAGKSTLLR
FT                   MINRLQEPSSGSIHFAGVEVSGLRGRALRNWQRDCAMIFQQFNLVPRLDVLTNVMLGRL
FT                   NHRSTFLSLLNIFTREERVHAIAALERLGIEQTALQAAGTLSGGQQQRVAIARALMQNP
FT                   KMVLADEPIASLDPLNAKIVMDALRDINEREGITVITNLHTLDTARNYCERIVGMAGGR
FT                   VVFDGKPSELTADAVKAIYGTDKDGAGIDETMTSTSIDLASERSDNQSAGIQPLALAGL
FT                   "
FT   gene            complement(224734..225351)
FT                   /locus_tag="RHECIAT_CH0000205"
FT   CDS_pept        complement(224734..225351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000205"
FT                   /product="putative acetyltransferase protein"
FT                   /EC_number="2.3.1.-"
FT                   /note="ypch00075; GO_function: GO:0008415 - acyltransferase
FT                   activity"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000205"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89201"
FT                   /db_xref="GOA:B3PXJ5"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR017694"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="UniProtKB/TrEMBL:B3PXJ5"
FT                   /protein_id="ACE89201.1"
FT                   /translation="MSRRLGIEPYVHETASVSESSFGRYTEVSERCRISEATFGDYSYM
FT                   MQDGSVWCATIGKFVNIAAAVRINATNHPTWRATLHHFTYRAADYWPDGDMEEDFFAWR
FT                   RANRVTIGNDVWIGHGATILPGVSVGNGAVIGAGAVVSKNVAAYSIVGGVPAQLIRERF
FT                   PKAVGERMDRLAWWNWDHDRLRLALQDFRNLSAEDFLSRYEG"
FT   gene            complement(225348..226055)
FT                   /locus_tag="RHECIAT_CH0000206"
FT   CDS_pept        complement(225348..226055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000206"
FT                   /product="probable phosphonate ABC transporter, ATP-binding
FT                   protein"
FT                   /note="ypch00076; GO_function: GO:0005524 - ATP binding;
FT                   GO_function: GO:0016887 - ATPase activity"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000206"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89202"
FT                   /db_xref="GOA:B3PXJ6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR012701"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3PXJ6"
FT                   /protein_id="ACE89202.1"
FT                   /translation="MPTPLVVSEVSKSFTMHLRDGIRLPVVSDVAFSVASGECVVLGGP
FT                   SGIGKSSLLKMIYGNYAVDTGQILIRHDGRVVDLAAADPRTVLNVRRNTLGYVSQFLRT
FT                   VPRVAAIDVVAEPLVAHGEEAGAAREKAGALLARLNLPEALWQLPPATFSGGEQQRVNI
FT                   ARGFITDHTILLLDEPTASLDARNRAVVVSMISEKKQAGVALLGIFHDEEVREAVADRI
FT                   LDVQQFSPRKVAA"
FT   gene            complement(226093..226869)
FT                   /locus_tag="RHECIAT_CH0000207"
FT   CDS_pept        complement(226093..226869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000207"
FT                   /product="probable phosphonate ABC transporter, ATP-binding
FT                   protein"
FT                   /note="ypch00077; GO_function: GO:0005524 - ATP binding;
FT                   GO_function: GO:0016887 - ATPase activity"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000207"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89203"
FT                   /db_xref="GOA:B3PXJ7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR012700"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3PXJ7"
FT                   /protein_id="ACE89203.1"
FT                   /translation="MTETPLLKVNDLSKFYGNRIGCRNVSFELWPGEVLAIVGESGSGK
FT                   TTLLNCISTRLMPTSGGVEYHMRDGSYRDLYHMNEAERRFLMRTDWGFVHQNPADGLRM
FT                   TVSAGANVGERLMAIGDRHYGKIRSTAIDWLERVEIDADRIDDQPRAFSGGMRQRLQIA
FT                   RNLVTGPRLVFMDEPTGGLDVSVQARLLDLVRGLVNDLGLSAIIVTHDLAVARLLSHRM
FT                   MVMKDGYVIEHGLTDRVLDDPREPYTQLLVSSILQV"
FT   gene            complement(226866..227741)
FT                   /gene="phnJ"
FT                   /locus_tag="RHECIAT_CH0000208"
FT   CDS_pept        complement(226866..227741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnJ"
FT                   /locus_tag="RHECIAT_CH0000208"
FT                   /product="phosphonate metabolism protein, C-P
FT                   (carbon-phosphorus) lyase component"
FT                   /note="GO_process: GO:0042916 - alkylphosphonate transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000208"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89204"
FT                   /db_xref="GOA:B3PXJ8"
FT                   /db_xref="InterPro:IPR010306"
FT                   /db_xref="UniProtKB/TrEMBL:B3PXJ8"
FT                   /protein_id="ACE89204.1"
FT                   /translation="MSDLASYNFAYLDEQTKRMIRRAILKAIAIPGYQVPFASREMPMP
FT                   YGWGTGGVQVTASIIGPDDVLKVIDQGADDTTNAVSIRAFFQKVANVAVTTHTGEATII
FT                   QTRHRIPEERLKAGQVLVYQVPIPEPLRFLEPRETETRKMHALEEYGLMHVKLYEDIAR
FT                   NGRIATTYAYPVKVHGRYVMDPSPTPKFDNPKMHQSEALQLFGAGREKRIYAVPPYTDV
FT                   VSLDFEDHPFEIQRFGKPCALCGAEDVYLDEVILDDKGGRMFVCSDTDHCEDRRAHGHA
FT                   GEMLAREAAE"
FT   gene            complement(227738..228844)
FT                   /gene="phnI"
FT                   /locus_tag="RHECIAT_CH0000209"
FT   CDS_pept        complement(227738..228844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnI"
FT                   /locus_tag="RHECIAT_CH0000209"
FT                   /product="phosphonate metabolism protein"
FT                   /note="GO_process: GO:0015716 - phosphonate transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000209"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89205"
FT                   /db_xref="GOA:B3PXJ9"
FT                   /db_xref="InterPro:IPR008773"
FT                   /db_xref="UniProtKB/TrEMBL:B3PXJ9"
FT                   /protein_id="ACE89205.1"
FT                   /translation="MYVAVKGGEAAIANAHRLLADRRRGDRSLPAIGIDQIVAQLALAV
FT                   DRVMAEASLFDRTLAALAVRQSRGDMIEAIFLLRAYRTTLPRFGYSRPLDTADMTIERR
FT                   ISATYKDLPGGQLLGPTFDYTHRLLDPSLLADEAVEAPAQRAAETGRVMRVSEILGEEG
FT                   LIEADGDMPEDHEVGDLTREPMEFPMSRDLRLQALARGDEGFLLALGYSTQRGYGRNHP
FT                   FTGEIRIGEVEVEFDVPELGFAVSLGFIQITECQMVNQFKGSAKAPPQFTRGYGLVFGQ
FT                   SERKAMAMSLVDRALRAEELGEDITAPAQDEEFVISHSDNVQATGFVEHLKLPHYVDFQ
FT                   AELDLVRRMRREFEVARNRGEDLKEAAE"
FT   gene            complement(228849..229457)
FT                   /gene="phnH"
FT                   /locus_tag="RHECIAT_CH0000210"
FT   CDS_pept        complement(228849..229457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnH"
FT                   /locus_tag="RHECIAT_CH0000210"
FT                   /product="phosphonate metabolism protein, C-P
FT                   (carbon-phosphorus) lyase component"
FT                   /note="GO_process: GO:0015716 - phosphonate transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000210"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89206"
FT                   /db_xref="GOA:B3PXK0"
FT                   /db_xref="InterPro:IPR008772"
FT                   /db_xref="InterPro:IPR038058"
FT                   /db_xref="UniProtKB/TrEMBL:B3PXK0"
FT                   /protein_id="ACE89206.1"
FT                   /translation="MDFKTEALTGGFGEPVFHAQSVFKVLMDGMARPGTILTVQPDVAP
FT                   PVPLGIAAGAIALTLCDHDTPVWLSQGLAKSAVPEWLGFHAGAPLTAEKAEARFAFTEA
FT                   GATLCPFGLFASGTQEYPDRSTTLVIELSALEGGRRLALIGPGIQTVTEIAPVGLPETF
FT                   LRLWTENRALFPRGIDIVLTSAERFLCLPRTTKITATEI"
FT   gene            complement(229457..229933)
FT                   /gene="phnG"
FT                   /locus_tag="RHECIAT_CH0000211"
FT   CDS_pept        complement(229457..229933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnG"
FT                   /locus_tag="RHECIAT_CH0000211"
FT                   /product="phosphonate metabolism protein"
FT                   /note="GO_process: GO:0015716 - phosphonate transport;
FT                   GO_process: GO:0019634 - phosphonate metabolic process"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000211"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89207"
FT                   /db_xref="GOA:B3PXK1"
FT                   /db_xref="InterPro:IPR009609"
FT                   /db_xref="UniProtKB/TrEMBL:B3PXK1"
FT                   /protein_id="ACE89207.1"
FT                   /translation="MISADSNNAASQTASGRKRAADLLARAERSELSAAWNALPQKPAA
FT                   HPVRGPETGLVMVRGRIGGGGAPFNLGEVTVTRATVRLDSGSVGHAQALGTDREKARLA
FT                   AIFDALWQEEATKDFVERALLLPITERIADAERRKADETAATRVDFFTMVRGDN"
FT   gene            230112..230849
FT                   /locus_tag="RHECIAT_CH0000212"
FT   CDS_pept        230112..230849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000212"
FT                   /product="probable transcriptional regulator protein, GntR
FT                   family"
FT                   /note="ypch00078; GO_function: GO:0003677 - DNA binding;
FT                   GO_function: GO:0030528 - transcription regulator activity;
FT                   GO_process: GO:0045449 - regulation of transcription"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000212"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89208"
FT                   /db_xref="GOA:B3PXK2"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR012702"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B3PXK2"
FT                   /protein_id="ACE89208.1"
FT                   /translation="MAGLNQVQRQTGVALWRQIADRIREAIGNGAYDETGMVPPETVLA
FT                   LQFGVNRHTVRSALAALAQEGIVRAVQGRGTLIERKERLNFPITRRTRFTAGIGDQARE
FT                   MRGLLLDEVKEEASAEIARWLGLKPGAQVIRLETLREADRRPVSKATSWFPAERFAGIG
FT                   EAYRKHQSITKAFAELGLADYIRATTEVTAAHADTADLADLELSPGAILLIAKAMNTDL
FT                   DGVPVQYSISRFAADRVQFTIEN"
FT   gene            complement(230889..231524)
FT                   /gene="gpmA"
FT                   /locus_tag="RHECIAT_CH0000213"
FT   CDS_pept        complement(230889..231524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpmA"
FT                   /locus_tag="RHECIAT_CH0000213"
FT                   /product="phosphoglycerate mutase protein"
FT                   /EC_number="5.4.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000213"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89209"
FT                   /db_xref="GOA:B3PXK3"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR005952"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3PXK3"
FT                   /protein_id="ACE89209.1"
FT                   /translation="MSGTLVLVRHGQSDWNLKNLFTGWKDPDLTELGIQEANAGGAALA
FT                   EYGIKFDVAYTSALVRAQHTLKLILDKVGQPDLQTIRDQALNERDYGDLSGLNKDDARA
FT                   KWGEEQVHVWRRSYDVPPPGGESLRDTGARVWPYYLTEILPRVLHGEKVLVAAHGNSLR
FT                   SLVMVLDKLTKEGVLALNLATGVPMVYKLHADSTVASKEVLGDMSGAH"
FT   gene            complement(231545..232369)
FT                   /gene="dapB1"
FT                   /locus_tag="RHECIAT_CH0000214"
FT   CDS_pept        complement(231545..232369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapB1"
FT                   /locus_tag="RHECIAT_CH0000214"
FT                   /product="dihydrodipicolinate reductase protein"
FT                   /EC_number="1.17.1.8"
FT                   /note="GO_function: GO:0008839 - dihydrodipicolinate
FT                   reductase activity; GO_process: GO:0009089 - lysine
FT                   biosynthetic process via diaminopimelate"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000214"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89210"
FT                   /db_xref="GOA:B3PXK4"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR022663"
FT                   /db_xref="InterPro:IPR022664"
FT                   /db_xref="InterPro:IPR023940"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B3PXK4"
FT                   /protein_id="ACE89210.1"
FT                   /translation="MSDAAMKLVVVGAAGRMGQTLIRLIHSIEGATLHAAVERTGSPFV
FT                   GKDAGEIAGLGPTGVIIGDDPLNAFLHAEGVLDFTSPAGTVEFSGLAAQARIVHIVGTT
FT                   GCSEDDNARIAAAARHARIVKSGNMSLGVNLLSVLTEQASRALDPDDWDIEILEMHHKH
FT                   KVDAPSGTALLLGEAAAKGRGIDLASKSVKVRDGHTGAREAGTIGFATLRGGSVIGEHS
FT                   VLFAGEGEIVTLSHSAADRSIFARGAIKAALWARDKKPGLYSMLDVLGLSSQ"
FT   gene            complement(232385..234172)
FT                   /locus_tag="RHECIAT_CH0000215"
FT   CDS_pept        complement(232385..234172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000215"
FT                   /product="putative multidrug ABC transporter, ATPase and
FT                   permease protein"
FT                   /note="ypch00079; GO_function: GO:0005524 - ATP binding;
FT                   GO_function: GO:0016887 - ATPase activity"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000215"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89211"
FT                   /db_xref="GOA:B3PXK5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:B3PXK5"
FT                   /protein_id="ACE89211.1"
FT                   /translation="MEAAESRKQSVSSDTVTGILKRIIAENGRDHLWGYVFAIACLIIV
FT                   ALSTAFTAWIMRAIIDEAFANRRADVVWIICLSIFVAFVLRGFASYGQAVALSKVGNDI
FT                   VARYQRRLYAHLMTLSVGFFSEARSAHIAAQVSQNVSGIRDVLNLTITSTVRDLLTFVS
FT                   LIGVMVLQDPLLSLAVFIMAPPLLYALRYVSKRLRSATREAVHLNSHVLGAMQETIQGI
FT                   AIVKAFTMEEELERKVNKLIKGAENRANRIARLSERTSPLTESFAGFAVASVLAYAAYR
FT                   SIYYNVPPGAFFSFVTALLLAYDPARRLARLQVQMERAVVNARMIYELLDMEPRQRDLP
FT                   DAGPLTVTQARIEFRNVSFGYGNESVLSGVSFVAEGGETTALVGPSGAGKSTVISLIPR
FT                   FYDPREGQILIDGQDIAHITKKSLRQQLAYVSQQPYLFEGTIRDNIRYGRPEATDAEVE
FT                   EAARLAYAHDFISAQPQGYDTPVGENGVTLSGGQRQRLSIARALVRNAPILLLDEATSA
FT                   LDTESEAAVQKALDEAMTGRTVVVIAHRLSTVVRADKIVVMQQGRVVEEGNHETLAKVS
FT                   DGLYARLNNLQRPSASDLN"
FT   gene            complement(234296..235321)
FT                   /gene="glk"
FT                   /locus_tag="RHECIAT_CH0000216"
FT   CDS_pept        complement(234296..235321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glk"
FT                   /locus_tag="RHECIAT_CH0000216"
FT                   /product="glucokinase protein"
FT                   /EC_number="2.7.1.2"
FT                   /note="GO_function: GO:0004340 - glucokinase activity;
FT                   GO_function: GO:0005524 - ATP binding; GO_process:
FT                   GO:0006096 - glycolysis"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000216"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89212"
FT                   /db_xref="GOA:B3PXK6"
FT                   /db_xref="InterPro:IPR003836"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3PXK6"
FT                   /protein_id="ACE89212.1"
FT                   /translation="MPKPNHSTAPLPFPILIGDIGGTNARFSILTDAYAEPKQFPNVRT
FT                   ADFATIDEAIQKGVLDKTAVQPRSAILAVAGPINDDEIPLTNCDWVVRPKTMIEGLGIE
FT                   DVLVVNDFEAQALAVAALSDENRERIGDATGDMIASRVVLGPGTGLGVGGLVHAQHSWI
FT                   PVPGEGGHVDLGPRSKRDYQLFPHIETIESRVSAEQILCGRGLVNLYNAICIVDGIQPT
FT                   MKDPADITSHALAGSDKAAVETVSLFATYLGRVAGDMAMVFMARGGVYLSGGISQKILP
FT                   ALKKPEFRMAFEDKAPHTALLRTIPTYVVTHPLAALAGLSSYARMPANFGVSTEGRRWR
FT                   R"
FT   gene            complement(235339..235719)
FT                   /gene="mgsA"
FT                   /locus_tag="RHECIAT_CH0000217"
FT   CDS_pept        complement(235339..235719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mgsA"
FT                   /locus_tag="RHECIAT_CH0000217"
FT                   /product="methylglyoxal synthase protein"
FT                   /EC_number="4.2.3.3"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000217"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89213"
FT                   /db_xref="GOA:B3PXK7"
FT                   /db_xref="InterPro:IPR004363"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR018148"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3PXK7"
FT                   /protein_id="ACE89213.1"
FT                   /translation="MAGGKCLALIAHDQKKDDMAAFARANRDLLSRWKIVATGTTGGRV
FT                   LDAAPDLDVTRLKSGPLGGDQQIGALISTGEVDALIFFVDPLTPMPHDVDVKALMRLAI
FT                   VYDIPMALNHATAIKLLPTLEA"
FT   gene            complement(235803..236906)
FT                   /gene="mepA"
FT                   /locus_tag="RHECIAT_CH0000218"
FT   CDS_pept        complement(235803..236906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mepA"
FT                   /locus_tag="RHECIAT_CH0000218"
FT                   /product="murein endopeptidase protein"
FT                   /EC_number="3.4.24.-"
FT                   /note="GO_component: GO:0030288 - outer membrane-bounded
FT                   periplasmic space; GO_function: GO:0008931 - murein
FT                   DD-endopeptidase activity; GO_process: GO:0006508 -
FT                   proteolysis"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000218"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89214"
FT                   /db_xref="GOA:B3PXK8"
FT                   /db_xref="InterPro:IPR005073"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="UniProtKB/TrEMBL:B3PXK8"
FT                   /protein_id="ACE89214.1"
FT                   /translation="MAFGFAQAFRTFGKLALAGAIGAGLAAGDVGAEQKTPSPGSAKAL
FT                   FGGVSLPTQGPAQPIGFYAKGCMTGAVALPTDGPTWQAMRLSRNRRWGNPVTIALLERF
FT                   SQDAAKYAGWPGILVGDIAQPRGGPMASGHASHQIGLDADIWLTPMPARRMTAEEREDL
FT                   PFTSMLQKNKFLTIDPRVWTESHARLLMLAASYPQVERIFVNPAIKKKMCDTWTGDRTN
FT                   LGKLRPEYGHDSHFHIRLKCPPGVAGCTPQAPVAAGDGCDKSLAWWFTPAPWAPPKPPK
FT                   PDAKPPKPSREMMVSDLPKACAAVLDAASVASMQAATYGGPSAAGGPSAANGPSAASAL
FT                   AAAPATDDDDGELPDVGPVPNDKPALQ"
FT   gene            237134..238966
FT                   /locus_tag="RHECIAT_CH0000219"
FT   CDS_pept        237134..238966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000219"
FT                   /product="probable peptide ABC transporter,
FT                   substrate-binding protein"
FT                   /note="ypch00080; GO_function: GO:0005215 - transporter
FT                   activity; GO_process: GO:0006810 - transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000219"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89215"
FT                   /db_xref="GOA:B3PXK9"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:B3PXK9"
FT                   /protein_id="ACE89215.1"
FT                   /translation="MAVVWSKIGLFLSLAGALAPMTVAGQDQSFQIGSSVISEMKYKPG
FT                   FTHFDYVNPAAPKGGDLRLSASGAFDTFNPLLAKGQTAVGLTLVYDTLMKPADDELLVS
FT                   YGLLAEGLSFPADVSSATFRLRKEAKWADGQPVTPEDVVFSLDKTKELNPLTANYYAHV
FT                   VKAEKTGERDVTFTFDEKNNRELPNILGQLVVVPKHWWEAPGADGKPRDITKTTLEPVM
FT                   GSGPYKIAAFSPGATIRYELRDDYWGKDLNVNVGQNNFRNVIYTYFGDRDVEFEAFRAG
FT                   NSDYWQETTAARWATGYDFPAVKEGRVKKEEVKNPLRSTGILQALVPNMRRDLFKDIRV
FT                   REALNYGFDFEELNRTVAFNSYKRIDSYFWNTDLASSGLPQGRELEILQGLKDKVPPEI
FT                   FTTPYTNPVGGDPQKSRDNLRKAIALLKEAGWEIKNNRMVNTKTGQPMSFEILLSSPML
FT                   ERWAVPYANNLKKIGIDARVRTVDASQAVNRERSFDYDMIWNVWAETMNPGNEQADYWG
FT                   SGSANQQGSRNYAGIANPAVDELIRMIIFAPNRDEQVAAIKAMDRVLLANHYVIPLFYR
FT                   DTYNIAYWNTVTRPAEYPAYGLGFPDAWWSTSAK"
FT   gene            239117..240205
FT                   /locus_tag="RHECIAT_CH0000220"
FT   CDS_pept        239117..240205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000220"
FT                   /product="probable peptide ABC transporter, permease
FT                   protein"
FT                   /note="ypch00081; GO_component: GO:0016020 - membrane;
FT                   GO_function: GO:0005215 - transporter activity; GO_process:
FT                   GO:0006810 - transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000220"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89216"
FT                   /db_xref="GOA:B3PXL0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B3PXL0"
FT                   /protein_id="ACE89216.1"
FT                   /translation="MGAYIIRRLLLMIPTIVGIMAISFIVVQFAPGGPVEQVIAQLTGQ
FT                   ADSADQRLSGGGDLLGAGGGEENSKYRGAQGLDPELIAKLEKQFGFDKPPLTRFGEMMW
FT                   NYIRFDFGESFFRNTSVLDLIKEKLPVSISLGIWILIFSYAISIPLGIRKAVKDGSTFD
FT                   VWTSGVIVVGYAVPSFLFGILLIVLFAGGSFYDWFPLRGLVSDNFDQLAWWQKPLDYFW
FT                   HLTLPLISLSLAAFATTTLLTKNSFIEEIKKQYVVTARAKGLNERQVLYGHVFRNAMLI
FT                   IIAGFPGAFISAFFTGSLLIENIFSLDGLGRLGYLSVVNRDYPIVFATLYIFSLLGLFV
FT                   SLISDLIYTWIDPRIDFERRDV"
FT   gene            240205..241353
FT                   /locus_tag="RHECIAT_CH0000221"
FT   CDS_pept        240205..241353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000221"
FT                   /product="putative peptide ABC transporter, permease
FT                   protein"
FT                   /note="ypch00082; GO_component: GO:0016020 - membrane;
FT                   GO_function: GO:0005215 - transporter activity; GO_process:
FT                   GO:0006810 - transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000221"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89217"
FT                   /db_xref="GOA:B3PXL1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B3PXL1"
FT                   /protein_id="ACE89217.1"
FT                   /translation="MDAAANPAVATPVKPPRKGLLSPTNIRRWKNFRANGRGYWSLWLF
FT                   LLLFVLSLFAEFLANDRPIIASYKGEILFPVLIDYPEEKFGGFLAETDYRSSVIADEIN
FT                   ANGWMIWPPVRYSYRSVNSNIPHSAPTAPFWLMTKEERCSGYPEGVNDPACTLGNLNWL
FT                   GTDDQARDVLARVIYGFRISVLFGLALTICSAIIGVTAGAVQGYFGGWTDLLLQRFIEI
FT                   WSSMPVLYILLIIAAILPPGFFVLLGIMLLFSWVGFVGVVRAEFLRARNFEYVRAARAL
FT                   GVNNRTIMWRHLLPNAMVATLTFLPFILSGSITTLTSLDFLGFGMPPGSPSLGEMIAQG
FT                   KTNLQAPWLGLTAFFAMSIMLSLLIFIGEAVRDAFDPRKTFQ"
FT   gene            241359..242987
FT                   /locus_tag="RHECIAT_CH0000222"
FT   CDS_pept        241359..242987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000222"
FT                   /product="probable peptide ABC transporter, ATP-binding
FT                   protein"
FT                   /note="ypch00083; GO_function: GO:0005524 - ATP binding;
FT                   GO_function: GO:0016887 - ATPase activity"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000222"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89218"
FT                   /db_xref="GOA:B3PXL2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3PXL2"
FT                   /protein_id="ACE89218.1"
FT                   /translation="MTEPLLSVRNLSVAFHQGGEASLAVDRVSFDIAKGEVVALVGESG
FT                   SGKSVSANSILKLLPYPTASHPSGEILFKGKDLLKASERALREVRGNDITMIFQEPMTS
FT                   LNPLHSIEKQIAEILALHQGITGQAARQRVLELLNQVGIREPEKRLKAYPHELSGGQRQ
FT                   RVMIAMALANRPELLIADEPTTALDVTVQAQILELLRQLKAAHGMSMLFITHDLGIVRK
FT                   FADRVCVMTKGRIVETGTVAEVFANPKHDYTRHLLASEPRGEPPRADPTKPVVMEGSDI
FT                   RVWFPIKAGLMRRVVDHVKAVDGIDLSLRAGQTLGVVGESGSGKTTLGLALTRLISSQG
FT                   RIAFVGKDIAGYSFSEMRPLRNQLQIVFQDPYGSLSPRMSVGDIIAEGLKVHERALSAE
FT                   ERDQRVCWALEEVGLDPLTRWRYPHEFSGGQRQRIAIARAMVLKPRFVMLDEPTSALDM
FT                   SVQAQVVDLLRDLQKKHDLAYLFISHDLKVVKALANDVIVMRFGKVVEQGPSAEIFRAP
FT                   KDDYTKALMAAAFNIEAVPTPAVQQ"
FT   gene            242996..243955
FT                   /locus_tag="RHECIAT_CH0000223"
FT   CDS_pept        242996..243955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000223"
FT                   /product="putative 2-hydroxyacid dehydrogenase protein"
FT                   /note="ypch00084; GO_function: GO:0016616 - oxidoreductase
FT                   activity, acting on the CH-OH group of donors, NAD or NADP
FT                   as acceptor; GO_function: GO:0048037 - cofactor binding"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000223"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89219"
FT                   /db_xref="GOA:B3PXL3"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B3PXL3"
FT                   /protein_id="ACE89219.1"
FT                   /translation="MSTPPPVLVDIKFNPEGVARVLKTAFADRGSINLADPADRLRDLR
FT                   AAEYALLWKPDADLFQRAPNLKVIFSGGAGVDHIIGMDGLPEIPIVRFVDRSLTTRMSE
FT                   WVVMQCLMHLRGQYAHDISQRRGEWAKLIAPEAAEVTVGVMGLGVLGQDAVAKLKVMGF
FT                   NVIGWSRTRKEIDGIETFDARQLDAFLARTDILVGLLPLTPDTTGFYDCGLFKKLRRDG
FT                   ALGRPVFINAGRGRSQVEADIVSAIRDGILGGASLDVFEVEPLASDNPLWALKNVFITP
FT                   HDAAVSEENALFRHVETQIARFERGEPLQFVVDRAAGY"
FT   gene            244151..244507
FT                   /locus_tag="RHECIAT_CH0000224"
FT   CDS_pept        244151..244507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000224"
FT                   /product="hypothetical protein"
FT                   /note="yhch00057"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000224"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89220"
FT                   /db_xref="GOA:B3PXL4"
FT                   /db_xref="UniProtKB/TrEMBL:B3PXL4"
FT                   /protein_id="ACE89220.1"
FT                   /translation="MMAHQTETRWEKSDGKLHKEEQIPPVKAKQGRMGYRILTVLLVAL
FT                   ILAFVVWIPVEIWGNREANEVAPQQPGQQLQQSETAPAPAQQNSNAVPTDTPAMAPAPN
FT                   VAPAAPGQPAAPAR"
FT   gene            244675..245979
FT                   /gene="pncB"
FT                   /locus_tag="RHECIAT_CH0000225"
FT   CDS_pept        244675..245979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pncB"
FT                   /locus_tag="RHECIAT_CH0000225"
FT                   /product="nicotinate phosphoribosyltransferase protein"
FT                   /EC_number="6.3.4.21"
FT                   /note="GO_function: GO:0004516 - nicotinate
FT                   phosphoribosyltransferase activity; GO_process: GO:0019363
FT                   - pyridine nucleotide biosynthetic process"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000225"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89221"
FT                   /db_xref="GOA:B3PXL5"
FT                   /db_xref="InterPro:IPR006406"
FT                   /db_xref="InterPro:IPR007229"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR040727"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3PXL5"
FT                   /protein_id="ACE89221.1"
FT                   /translation="MAKTDIARRVYNHAWKLDPIIRSLIDTDFYKLLMLQMIWKLYPDV
FT                   NASFTLINRTKRVHLAEEIDEGELREQLDHARTLRLSKKEMIWLAGNSFYGRAQIFEPE
FT                   FLAWLSNFQLPEYELSKKDGQYVLDFHGAWKETTMWEIPALAIVNELRSRSAMKALGPF
FT                   TLDVLYARAKAKMWSKVERLRELPGLRISDFGTRRRHSFLWQRWCVEALKEGIGPAFTG
FT                   TSNVLLAMDSDLEAVGTNAHELPMVAAALAQTDEQLRNAPYKILRDWNKLYGGNLLIVL
FT                   PDAFGTAAFLRDAPEWVADWTGFRPDSAPPIEGGEKIIDWWKKMGRDPRQKLLIFSDGL
FT                   DVDAIIDTYRHFEGRVRMSFGWGTNLTNDFAGCAPTEISGLNPISVVCKVSDANGRPAV
FT                   KLSDNPQKATGEPAEVERYLKFFGTEDRVDQTVLV"
FT   gene            complement(245976..246248)
FT                   /locus_tag="RHECIAT_CH0000226"
FT   CDS_pept        complement(245976..246248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000226"
FT                   /product="hypothetical protein"
FT                   /note="yhch00058"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000226"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89222"
FT                   /db_xref="UniProtKB/TrEMBL:B3PXL6"
FT                   /protein_id="ACE89222.1"
FT                   /translation="MTMFEDLLEMQERGARDRALGRSLADNPMSKPDVLPITDLQEWFS
FT                   MFDAWRFGWSIEDAMTGHIDMPRDGHAMPRNGRAVPGDGRAAQRA"
FT   gene            complement(246572..246781)
FT                   /locus_tag="RHECIAT_CH0000227"
FT   CDS_pept        complement(246572..246781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000227"
FT                   /product="hypothetical protein"
FT                   /note="yhch00059"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000227"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89223"
FT                   /db_xref="InterPro:IPR025309"
FT                   /db_xref="UniProtKB/TrEMBL:B3PXL7"
FT                   /protein_id="ACE89223.1"
FT                   /translation="MEELSVKSKIIKSVYFSQEDGRLRICFKNGEERLFEGVPASEAHA
FT                   MTAAPSPGHYYLDRIRTQFRRLAA"
FT   gene            247436..247732
FT                   /locus_tag="RHECIAT_CH0000228"
FT   CDS_pept        247436..247732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000228"
FT                   /product="hypothetical protein"
FT                   /note="yhch00060"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000228"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89224"
FT                   /db_xref="UniProtKB/TrEMBL:B3PXL8"
FT                   /protein_id="ACE89224.1"
FT                   /translation="MLEAKEHHPWFVRALAEQAVYAANREGETIETTLAGVWGLYAFIT
FT                   KRNPEHFYEALAPELYLDMFKIGGAGFKENLMAWLEAHSLRADGVAGGPTPGE"
FT   gene            complement(247806..247895)
FT                   /locus_tag="RHECIAT_CH0000229"
FT   tRNA            complement(247806..247895)
FT                   /locus_tag="RHECIAT_CH0000229"
FT                   /product="tRNA-Ser"
FT                   /inference="ab initio prediction:tRNAscan-SE:1.23"
FT   gene            248123..248440
FT                   /locus_tag="RHECIAT_CH0000230"
FT   CDS_pept        248123..248440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000230"
FT                   /product="hypothetical conserved protein"
FT                   /note="yhch00061"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000230"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89225"
FT                   /db_xref="GOA:B3PXL9"
FT                   /db_xref="UniProtKB/TrEMBL:B3PXL9"
FT                   /protein_id="ACE89225.1"
FT                   /translation="MRFLLRLASLVALAAAVIAGTIDSIQSVAASAVVMTPMSDAWQDV
FT                   SPDTLTSLQSALSYYIHPRFYAFIFQWLMLQPAFAVFLVIALLLWMVGYKKPQVSGRFI
FT                   A"
FT   gene            complement(248501..248755)
FT                   /locus_tag="RHECIAT_CH0000231"
FT   CDS_pept        complement(248501..248755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000231"
FT                   /product="hypothetical protein"
FT                   /note="yhch00062"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000231"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89226"
FT                   /db_xref="UniProtKB/TrEMBL:B3PXM0"
FT                   /protein_id="ACE89226.1"
FT                   /translation="MLLFVRGPPASPFRTCLRNHRPPPGGLAGRILAWLTEKFTRNFSG
FT                   GKDLQQLLKISSPGLIFGHFAERHADFLADPRAVAKTGP"
FT   gene            248768..249760
FT                   /locus_tag="RHECIAT_CH0000232"
FT   CDS_pept        248768..249760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000232"
FT                   /product="probable outer membrane lipoprotein"
FT                   /note="ypch00085; GO_function: GO:0008289 - lipid binding"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000232"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89227"
FT                   /db_xref="GOA:B3PXM1"
FT                   /db_xref="InterPro:IPR003760"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B3PXM1"
FT                   /protein_id="ACE89227.1"
FT                   /translation="MKKSLLTLLAVAAMSTTALAADVKPALVYGTGGKFDKSFNEAAYN
FT                   GAEKFKAETGIAYRDFEPTGDTQGEQAIRNFASRGFNPVVAVSFAWTSAIEKVAAEFPD
FT                   TKFIIVDSVVDKPNVRSVVYKEEEGSYLVGILAGMASKTGKVGFVGGMDIPLIRKFECG
FT                   YEQGARAAKADIEVFQNMTGTTGAAWNDPVRGGELTKNQIDQGADVIYAAAGATGLGVL
FT                   QTAADNKKLSIGVDSNQNHLHPGSVLTSMVKRVDLAVYNAYTDTKNDKFTGGVQALGVK
FT                   EDGVGAAIDDNNKSLITPEMQAAVDKAKADIIAGTVKVHDYTSDNACPK"
FT   gene            249849..251360
FT                   /locus_tag="RHECIAT_CH0000233"
FT   CDS_pept        249849..251360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000233"
FT                   /product="probable sugar ABC transporter, ATP-binding
FT                   protein"
FT                   /EC_number="3.6.3.17"
FT                   /note="ypch00086; GO_function: GO:0005524 - ATP binding;
FT                   GO_function: GO:0016887 - ATPase activity"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000233"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89228"
FT                   /db_xref="GOA:B3PXM2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3PXM2"
FT                   /protein_id="ACE89228.1"
FT                   /translation="MTDKPAIELVGIDKKFGAVHANKDINLTVAKGTIHGIIGENGAGK
FT                   STLMSIIYGFYHADSGEIRVNGNPVTIRDSQAAIAAGIGMVHQHFMLVDNFTVLENIML
FT                   GVEGGSLLARGVASARAELKRLETEYGLEVNPDALIEQLPVGLQQRVEILKAMYRGAEI
FT                   LILDEPTGVLTPAEADHLFRILKVLRDQGKTIILITHKLREIMAITDTVSVMRRGEMVA
FT                   TRKTAETTVEELAELMVGRRVLLRVQKGEGHPGAAVLSVRNLTVKDNRGVIMVDNVSFD
FT                   VRVGEIVGVAGVAGNGQSELLEAIAGIRKPASGEILLDGQTIDKADPARLRDLGLAHIP
FT                   EDRHHMGLVLKFEEYENSVLGYHRRPGYSKGPLLDLDAIRKDAMEKIEKYDIRPPNPRL
FT                   KTANFSGGNQQKIVVAREIERDPKMLIIGQPTRGVDIGAIEFIHRRIIEMRDAGKAILL
FT                   VSVELDEIRALSDRILVMFAGNIVGEKTPDAGEQTLGLMMAGIAA"
FT   gene            251368..252471
FT                   /locus_tag="RHECIAT_CH0000234"
FT   CDS_pept        251368..252471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000234"
FT                   /product="probable sugar ABC transporter, permease protein"
FT                   /note="ypch00087; GO_component: GO:0016020 - membrane;
FT                   GO_function: GO:0005215 - transporter activity; GO_process:
FT                   GO:0006810 - transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000234"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89229"
FT                   /db_xref="GOA:B3PXM3"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B3PXM3"
FT                   /protein_id="ACE89229.1"
FT                   /translation="MSTASVPLPNWINYGLIPILNLIVAFLISGFVVWLIGESPLAALS
FT                   LLIEGAFGSGEGIGFTLYYATSFIFTGLSVAVAIHAGLFNIGSEGQAYIGGLGCALVAL
FT                   ALDKYVPWYVTMPLAIIGAGIFGAAWAFIPAFLQAKRGSHIVITTIMFNYIAAALMVYL
FT                   LVHVLIVPGKMAPETRTFLEGGQLPKLGWIMSMFGAKLGAAPFNVSFIIALLAAWFVWI
FT                   LIWRTKLGFEMRTLGVSSTAAAYAGIPYARIVIIAMLLSGALAGMMALNPVMGSSARLQ
FT                   VEFVGGAGFVGIAVSLMGRNHPLGIILAAILFGTLYQGGDWISFEMPNITREMILVIQG
FT                   LVILFAGALEYMFRPAMVHIYQQFKPA"
FT   gene            252482..253453
FT                   /locus_tag="RHECIAT_CH0000235"
FT   CDS_pept        252482..253453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000235"
FT                   /product="probable sugar ABC transporter, permease protein"
FT                   /note="ypch00088; GO_component: GO:0016020 - membrane;
FT                   GO_function: GO:0005215 - transporter activity; GO_process:
FT                   GO:0006810 - transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000235"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89230"
FT                   /db_xref="GOA:B3PXM4"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B3PXM4"
FT                   /protein_id="ACE89230.1"
FT                   /translation="MDYYEIFINVLSSTVRLSIPLIFTALAGLFSERAGVFDIGLEGKM
FT                   LGSAFAAACVAYLSGSAWLGLGAGIVCSVALSLVHGFASITNRGNQIVSGVAINFFIAG
FT                   ITIVLGQAWFGQGGRTPQLLPEARFAPIILPGADAIHNVPIIGPLYAGVISGNNILTYL
FT                   AFLAVPFSWWVLYRTRFGLRLRAVGENPGAVDTAGISVTWLRYRAVMCAGILCGFSGTY
FT                   LAIAQSAAFIKDMSAGKGYIALAALVFAKWKPVPVMLACLLFGFLDALANFMQGKQVPL
FT                   IGEVPVQIFQALPYVLTCILLAGFIGVATPPKAGGVPYTKER"
FT   gene            253456..253845
FT                   /gene="cdd"
FT                   /locus_tag="RHECIAT_CH0000236"
FT   CDS_pept        253456..253845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cdd"
FT                   /locus_tag="RHECIAT_CH0000236"
FT                   /product="cytidine deaminase protein"
FT                   /EC_number="3.5.4.5"
FT                   /note="GO_function: GO:0008270 - zinc ion binding;
FT                   GO_function: GO:0016787 - hydrolase activity"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000236"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89231"
FT                   /db_xref="GOA:B3PXM5"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR006262"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:B3PXM5"
FT                   /protein_id="ACE89231.1"
FT                   /translation="MSHDLFEAARGAMAFAHAPYSKFPVGAAIRAEDGKVYTGANIENL
FT                   SFPQGWCAEPTAISAMIMGGARKIVEMAVIAEKLPLCPPCGGCRQKISEFASKDTKIYL
FT                   CDEAGVQKTMTMEELLPFSFETELG"
FT   gene            253842..254642
FT                   /gene="deoD"
FT                   /locus_tag="RHECIAT_CH0000237"
FT   CDS_pept        253842..254642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="deoD"
FT                   /locus_tag="RHECIAT_CH0000237"
FT                   /product="purine-nucleoside phosphorylase protein"
FT                   /EC_number="2.4.2.1"
FT                   /note="GO_function: GO:0016763 - transferase activity,
FT                   transferring pentosyl groups"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000237"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89232"
FT                   /db_xref="GOA:B3PXM6"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR011268"
FT                   /db_xref="InterPro:IPR011269"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:B3PXM6"
FT                   /protein_id="ACE89232.1"
FT                   /translation="MKATVDLLAALIGAIKPHHGIVLGSGLGSLVDQLDGAVRIPYRDL
FT                   PGFPVSAVSGHAGEVVAGRLGGVPVIMLSGRVHYYEKGDANAMRLPLEVLKALGVEALI
FT                   LTNSAGSLREDMPPGSVMQITDHINYSGMNPLIGEESDQRFVGMTNAYDTDLAAAMRKA
FT                   AAKLKIELAQGVYMWFSGPSFETPAEIRMARILGADAVGMSTVPEVIIARMLGLRVAAA
FT                   SVITNYGAGMTGNELSHEETKDMAPIGGARLAAILKEMIAAGAR"
FT   gene            254757..255533
FT                   /gene="deoC"
FT                   /locus_tag="RHECIAT_CH0000238"
FT   CDS_pept        254757..255533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="deoC"
FT                   /locus_tag="RHECIAT_CH0000238"
FT                   /product="deoxyribose-phosphate aldolase protein"
FT                   /EC_number="4.1.2.4"
FT                   /note="GO_function: GO:0016829 - lyase activity"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000238"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89233"
FT                   /db_xref="GOA:B3PXM7"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR011343"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B3PXM7"
FT                   /protein_id="ACE89233.1"
FT                   /translation="MNSHSIRETAAVALSLLDLTNLKDDCTEAQIEALCARAQTPYGNS
FT                   AAICIWPRFVAQARNILGTGHAVRIATVVNFPAGEMEVADVAAETREAIADGADEIDLV
FT                   IPYRKFIAGDEKAVTDMVRAVRAECTGPVLLKVIIETGELKEAALIRRASELAIEAGAD
FT                   FIKTSTGKVAVNATLEAADIMIRAIRESGRKVGFKPAGGIGSVADAALYLSLAETIMAP
FT                   DWAMPSTFRFGASGLLDDILAVLSGAQPASAAASGY"
FT   gene            255535..256842
FT                   /gene="deoA"
FT                   /locus_tag="RHECIAT_CH0000239"
FT   CDS_pept        255535..256842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="deoA"
FT                   /locus_tag="RHECIAT_CH0000239"
FT                   /product="thymidine phosphorylase protein"
FT                   /EC_number="2.4.2.4"
FT                   /note="GO_function: GO:0016757 - transferase activity,
FT                   transferring glycosyl groups; GO_process: GO:0008152 -
FT                   metabolic process"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000239"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89234"
FT                   /db_xref="GOA:B3PXM8"
FT                   /db_xref="InterPro:IPR000053"
FT                   /db_xref="InterPro:IPR000312"
FT                   /db_xref="InterPro:IPR013102"
FT                   /db_xref="InterPro:IPR013465"
FT                   /db_xref="InterPro:IPR017459"
FT                   /db_xref="InterPro:IPR017872"
FT                   /db_xref="InterPro:IPR018090"
FT                   /db_xref="InterPro:IPR035902"
FT                   /db_xref="InterPro:IPR036320"
FT                   /db_xref="InterPro:IPR036566"
FT                   /db_xref="UniProtKB/TrEMBL:B3PXM8"
FT                   /protein_id="ACE89234.1"
FT                   /translation="MIPQEIIRRKRDGGELAAADIRSFIDALAAGRLSEGQIGAFAMAV
FT                   WFKGMSRQEIVALTLAMADSGDRLQWADIDRPIADKHSTGGVGDNVSLMLAPIAAACGL
FT                   AVPMISGRGLGHTGGTLDKLESIPGYMITPDADLFHRVVKQAGCAIIGQTGALAPADGR
FT                   LYAVRDVTATVDSIPLITASILSKKLAAGLQTLVLDVKVGNGAFMAERDQAEMLARSLV
FT                   EVANGAGVKTSALITDMNEPLADSAGNVVEMRNCLDFLAGRKGNTRLEAVVLAFAAEML
FT                   EKSGIAALPEEGEAMARRALSSGKAAEIFSRMVSMLGGPADLIENPDRYLARAPVEKPV
FT                   AAARSGWLAACDARGIGVSVIDLGGGRRHPADRIDHRVGFSELLPLGTRVNAGEPIALV
FT                   HAADDAAAERAAAALAAHYRITEDAPALNPIISGLI"
FT   gene            complement(256849..257382)
FT                   /locus_tag="RHECIAT_CH0000240"
FT   CDS_pept        complement(256849..257382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000240"
FT                   /product="hypothetical conserved protein"
FT                   /note="yhch00063"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000240"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89235"
FT                   /db_xref="GOA:B3PXM9"
FT                   /db_xref="InterPro:IPR001969"
FT                   /db_xref="InterPro:IPR011969"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="InterPro:IPR034122"
FT                   /db_xref="UniProtKB/TrEMBL:B3PXM9"
FT                   /protein_id="ACE89235.1"
FT                   /translation="MLVRTIIFASIAAVLATQVPSFFPGTGPQPADTLSANYISSESGM
FT                   PAAPAPVSGSNVIRLQADAQGHYTGNFKINGKPVQGLIDTGATYVALNETLARRMGFTA
FT                   NQLDFRYGVNTANGQTKAAQVTLDRIEIGGIRVRDVEAFVLKDEALTTTLVGMSFLKKL
FT                   ASYSVADGSLSLKQ"
FT   gene            complement(257547..258176)
FT                   /gene="upp"
FT                   /locus_tag="RHECIAT_CH0000241"
FT   CDS_pept        complement(257547..258176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="upp"
FT                   /locus_tag="RHECIAT_CH0000241"
FT                   /product="uracil phosphoribosyltransferase protein"
FT                   /EC_number="2.4.2.9"
FT                   /note="GO_process: GO:0009116 - nucleoside metabolic
FT                   process"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000241"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89236"
FT                   /db_xref="GOA:B3PXN0"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005765"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR034332"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3PXN0"
FT                   /protein_id="ACE89236.1"
FT                   /translation="MDGVTVIDHPLVQHKLTIMRRKETSTGSFRRLLREISTLLCYEVT
FT                   RDLELTMETIETPLQTIESPILEGKKLVFASILRAGNGLLEGMLDLVPSARVSHIGVYR
FT                   DHETLQPVEYYFKAPEDVAERLIIVVDPMLATGNSSIAAIDKLKERGAHNIRFLCLLAA
FT                   PEGIRNFRAAHPDVPVFTAAIDSHLNEKGYIVPGLGDAGDRMYGTK"
FT   gene            complement(258307..259275)
FT                   /gene="add"
FT                   /locus_tag="RHECIAT_CH0000242"
FT   CDS_pept        complement(258307..259275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="add"
FT                   /locus_tag="RHECIAT_CH0000242"
FT                   /product="adenosine deaminase protein"
FT                   /EC_number="3.5.4.4"
FT                   /note="GO_function: GO:0019239 - deaminase activity;
FT                   GO_process: GO:0009168 - purine ribonucleoside
FT                   monophosphate biosynthetic process"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000242"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89237"
FT                   /db_xref="GOA:B3PXN1"
FT                   /db_xref="InterPro:IPR001365"
FT                   /db_xref="InterPro:IPR006330"
FT                   /db_xref="InterPro:IPR028892"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3PXN1"
FT                   /protein_id="ACE89237.1"
FT                   /translation="MTSHLKKVELHCHLEGAAPPALTEAQARKYGIDMSEQLRDGAYVW
FT                   HDFASFLECYDKVSEVYKTEEDYALLTETYLDELAAINTIYSELIVSPDHGKRIGLGAD
FT                   AYISGVCEGIRRAKEKSGIEARLIVTGERHFGPDSVIGAAEYAAKAGNPLITGFNLAGE
FT                   ERMGRVADYSRAFDIARDAGLGLTIHAGEVCGAFSVADALDAVRPARIGHGVRAIEDLD
FT                   LVKRLADLGTVLEVCPGSNIALRVYPDFASHPLRRLKEAGVPVTISSDDPPFFHTSLER
FT                   EYALAAEAFGFDNAEIDAMTRTAIEAAFVDAQTRKALLARL"
FT   gene            complement(259272..260555)
FT                   /gene="deoB"
FT                   /locus_tag="RHECIAT_CH0000243"
FT   CDS_pept        complement(259272..260555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="deoB"
FT                   /locus_tag="RHECIAT_CH0000243"
FT                   /product="phosphopentomutase protein"
FT                   /EC_number="5.4.2.7"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000243"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89238"
FT                   /db_xref="GOA:B3PXN2"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR010045"
FT                   /db_xref="InterPro:IPR017849"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024052"
FT                   /db_xref="UniProtKB/TrEMBL:B3PXN2"
FT                   /protein_id="ACE89238.1"
FT                   /translation="MPGPQPLPISRRSAIGPFGGKMARAFLFVLDSFGVGGAPDAAAYG
FT                   DEGADTLGHIAEFCAAGAGDRAGLRSGPLCLPNMSELGLMHIARAASGQFPAGMPLPEK
FT                   VYGVYGTANEISRGKDTPSGHWEIAGTPVNFDWGYFPTEGDAFPPELIEALCQDGDVPG
FT                   ILGNCHASGTEIIARLGEEHIRTGKPICYTSSDSVFQVAAHEAHFGLDRLLAFCHIARG
FT                   LLDPYNIGRVIARPFIGQSASTFQRTGNRRDFSVLPPEPTLLDRLLQHGRHVHAVGKIG
FT                   DIFAHQGISRVIKATGNEALMDASLSAIDAANDGDLVFTNFVDFDMNYGHRRDVPGYAA
FT                   ALEAFDARLPDVHKKLKPGDLVVLTADHGCDPTWRGTDHTRERVPVIAYGPGIRSRSIG
FT                   VRRSYADIGESIARHLGIPAGPHGRSFL"
FT   gene            complement(260601..261182)
FT                   /locus_tag="RHECIAT_CH0000244"
FT   CDS_pept        complement(260601..261182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000244"
FT                   /product="hypothetical conserved protein"
FT                   /note="yhch00064"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000244"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89239"
FT                   /db_xref="GOA:B3PXN3"
FT                   /db_xref="InterPro:IPR012495"
FT                   /db_xref="UniProtKB/TrEMBL:B3PXN3"
FT                   /protein_id="ACE89239.1"
FT                   /translation="MALRNPFTRLALTARRLIRERKGAGAIEFAILFPVLIMLYIGAFE
FT                   ITIGLSVSKRATRAAGSIADLVTQQQSITKSTLTEMRSVATSIFVPYNSTSLTLKITGV
FT                   TVDASANAKVLWSWAQDGSAPYAKNTAVSDIPADMKTANSFLVRTELSIPYTMFLFAPN
FT                   FMPDGMRTITISRSYFYRQRQGESIPCGDC"
FT   gene            complement(261182..261817)
FT                   /locus_tag="RHECIAT_CH0000245"
FT   CDS_pept        complement(261182..261817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000245"
FT                   /product="hypothetical conserved protein"
FT                   /note="yhch00065"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000245"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89240"
FT                   /db_xref="GOA:B3PXN4"
FT                   /db_xref="InterPro:IPR012495"
FT                   /db_xref="UniProtKB/TrEMBL:B3PXN4"
FT                   /protein_id="ACE89240.1"
FT                   /translation="MTVVDQKTDGERAFAPFRFSQFRAAARSRDGAAAIEFALLAIPYF
FT                   VVIFAILETFIAFAAEELVSNAVDTMSRRMRTGQITYNLGRTTDMTQTQFRQAFCDEIS
FT                   ILISCSATEASTPNKLYLDVQTFATFSAIPTTIPKLSTDRYSDLNTAAIKYSPGGAGTI
FT                   NMLRAYYRWEIITDLVRPYITTIRPSDGSMPTTYLIIATAAFQNEQYP"
FT   gene            complement(261929..262339)
FT                   /gene="pilQ"
FT                   /locus_tag="RHECIAT_CH0000246"
FT   CDS_pept        complement(261929..262339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilQ"
FT                   /locus_tag="RHECIAT_CH0000246"
FT                   /product="pilus subunit transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000246"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89241"
FT                   /db_xref="GOA:B3PXN5"
FT                   /db_xref="InterPro:IPR032789"
FT                   /db_xref="UniProtKB/TrEMBL:B3PXN5"
FT                   /protein_id="ACE89241.1"
FT                   /translation="MSSSGKTVFFAGMIAVFGVSGISAAADDDMLRVYMDHARVLKLDR
FT                   PVSKVIVGNAKVADATVADAKTIVLTGRSFGTTNLVLLDADGNAILDERILVSIDEGNT
FT                   VRVYRQTERSVLSCTPNCEQHAQQAADSTTSP"
FT   gene            262719..262904
FT                   /gene="pilA"
FT                   /locus_tag="RHECIAT_CH0000247"
FT   CDS_pept        262719..262904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilA"
FT                   /locus_tag="RHECIAT_CH0000247"
FT                   /product="pilus subunit protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000247"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89242"
FT                   /db_xref="GOA:B3PY91"
FT                   /db_xref="InterPro:IPR007047"
FT                   /db_xref="UniProtKB/TrEMBL:B3PY91"
FT                   /protein_id="ACE89242.1"
FT                   /translation="MTKLFSRFLKDESGATAIEYGLIAALISVALITGATSLGSKIGNT
FT                   FNGLSTKMDGATSAAN"
FT   gene            263029..263541
FT                   /gene="cpaA"
FT                   /locus_tag="RHECIAT_CH0000248"
FT   CDS_pept        263029..263541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cpaA"
FT                   /locus_tag="RHECIAT_CH0000248"
FT                   /product="prepilin peptidase protein"
FT                   /EC_number="3.4.23.43"
FT                   /note="GO_component: GO:0016020 - membrane; GO_function:
FT                   GO:0008234 - cysteine-type peptidase activity; GO_process:
FT                   GO:0006508 - proteolysis"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000248"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89243"
FT                   /db_xref="GOA:B3PY92"
FT                   /db_xref="InterPro:IPR000045"
FT                   /db_xref="UniProtKB/TrEMBL:B3PY92"
FT                   /protein_id="ACE89243.1"
FT                   /translation="MIATGVFVVLPLCLAMAAFSDLFTMTIPNRVSLILIVSFLVLAPF
FT                   LGFGLQAIGMHLAAAAIVLAACFALFAFNVMGGGDAKLLSATALWFGLNQSLTLLMADV
FT                   AAVGGLITLLILLVRTQSNTILAIGLPLPDSVLVAKKIPYGIAIAIGGFMAFPSSPIFI
FT                   AALESLK"
FT   gene            263652..264467
FT                   /gene="cpaB"
FT                   /locus_tag="RHECIAT_CH0000249"
FT   CDS_pept        263652..264467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cpaB"
FT                   /locus_tag="RHECIAT_CH0000249"
FT                   /product="pilus assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000249"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89244"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="InterPro:IPR017592"
FT                   /db_xref="InterPro:IPR031571"
FT                   /db_xref="UniProtKB/TrEMBL:B3PY93"
FT                   /protein_id="ACE89244.1"
FT                   /translation="MKPARLIILAVAVVAAGLAGLLAMRMAGSGGVVTQVQSVIEKEPT
FT                   VNVLVSSGNLAVGQRLEEGSVHWMAWPQGGVVPGLITEIEKPDAIKDLQGAVVRLPIFE
FT                   GEPIRPEKVADSSSRILSSLLPAGKRAVATEISVATGAGGFILPNDRVDVIMVRKGTEA
FT                   NKLITETVLSNVRVLAIDQQIQEKDDGSKAVVGTTATLELTPDQTKVLAVAQQMADRLS
FT                   LALRSVADAQEQDTSAADYLLSGDNGSAIIQVIKSGSIVTDAGAAPKPE"
FT   gene            264480..265979
FT                   /gene="cpaC"
FT                   /locus_tag="RHECIAT_CH0000250"
FT   CDS_pept        264480..265979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cpaC"
FT                   /locus_tag="RHECIAT_CH0000250"
FT                   /product="pilus assembly secretion protein"
FT                   /note="GO_process: GO:0009306 - protein secretion"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000250"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89245"
FT                   /db_xref="GOA:B3PY94"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR032789"
FT                   /db_xref="UniProtKB/TrEMBL:B3PY94"
FT                   /protein_id="ACE89245.1"
FT                   /translation="MGNSTRRAKLLLTGSLSLAISVTGMAPATFGPLLAVDEARADSGN
FT                   LIRIAQTGPDAHRRLKLGLNKAVVVDLPEDAHDILVSDPSMADAVTRTSRRIYLFGKKV
FT                   GQTNIFVFGAGGQEIINLDIEIERDVSGLEANLRRFIPDSNINVEIVSDNIVLTGTVRT
FT                   PQDATQAADLAQVFLKGGEATTRTETASGTGGDSAVALFAEGRQTSQVVNLLKIEGEDQ
FT                   VTLKVTIAEVRREVLKQLGFDNLISNSSGMTVAQLGTPSADSATATVGGGLAALFKSSI
FT                   GKYDISTYLNALEQAKVVRTLAEPTLTAISGQAATFNSGGQQLYSTTDNDGNVTVVPFN
FT                   YGINLAFKPVVLSSGRISLEIKTNVSEPVAGSGNATYQRRSAETSVELPSGGSIALAGL
FT                   IRDNVSQTMGGTPGVSKIPLLGTLFRQKGFERQETELVIIATPYLVRPVARNQLNRPDD
FT                   NFSPENDGATFFLNRVNKVYGRREAPVADAQFHGSIGFIYK"
FT   gene            265976..266734
FT                   /gene="cpaD"
FT                   /locus_tag="RHECIAT_CH0000251"
FT   CDS_pept        265976..266734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cpaD"
FT                   /locus_tag="RHECIAT_CH0000251"
FT                   /product="pilus assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000251"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89246"
FT                   /db_xref="InterPro:IPR013361"
FT                   /db_xref="InterPro:IPR019027"
FT                   /db_xref="UniProtKB/TrEMBL:B3PY95"
FT                   /protein_id="ACE89246.1"
FT                   /translation="MSGEASAAMAQNRDQAMAFMNWTTPRLAISKALFVTAAVSVAVLS
FT                   GCAGPHDQLTTGGIPDDYRARHPIIVTEAEQTVDIPVASTDRRLTIAQRDLIRGFAANY
FT                   VSRASGPVYVLSPEGSPNSAAAHQLRNQVRAELASRGIASSKIINTSYAAAGAGDAAPI
FT                   RLSFTGTTAITTQCGQWPKDISNDFANQNYYNFGCATQNNLAAQVANPEDLVAPRGMTP
FT                   IDAQRRNNAIQEYRTTTTTIEDVAGSDSSF"
FT   gene            266749..268026
FT                   /gene="cpaE"
FT                   /locus_tag="RHECIAT_CH0000252"
FT   CDS_pept        266749..268026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cpaE"
FT                   /locus_tag="RHECIAT_CH0000252"
FT                   /product="pilus assembly, two-component response regulator
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000252"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89247"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3PY96"
FT                   /protein_id="ACE89247.1"
FT                   /translation="MSAIEYEIKNPSELRHAEEAVRMADLEAMRPLPRISVHAFCESET
FT                   LQNVMERCANDRRMAKVSLRITSGGIAAAANMFSGAPTPNLIILETKANVGSLLAELAP
FT                   LAAVCDPTTKVVIVGYYNDIGLYRELIRNGISEYMVQPVAMPDILAAMASIFVDPEAEP
FT                   LGRSIAFIGSKGGVGASTIAHNCAFGISNLFSTETILADLDLPYGTANIDFDQDPAQGI
FT                   AEAVFAPDRLDEVFLDRLLTKCSEHLSLLAAPSLLDRAYDFDGQAFQPVLDVLQRSAPV
FT                   TVLDVPHAWSEWTRSVLASVDEVVIAAVPDLANLRNTKNMLDALRKMRPNDKPPHLILN
FT                   QVGMPKRPEISPSDFCEPLEIDPIAIIPFDINLFGNAANSGRMISEVDPRSPTAETFSQ
FT                   ISHIVTGRAAIRKAKKGGLLGLLKRK"
FT   gene            268049..269527
FT                   /gene="cpaF"
FT                   /locus_tag="RHECIAT_CH0000253"
FT   CDS_pept        268049..269527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cpaF"
FT                   /locus_tag="RHECIAT_CH0000253"
FT                   /product="pilus assembly secretion ATP-binding protein"
FT                   /note="GO_component: GO:0005622 - intracellular;
FT                   GO_function: GO:0005524 - ATP binding; GO_process:
FT                   GO:0006810 - transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000253"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89248"
FT                   /db_xref="GOA:B3PY97"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3PY97"
FT                   /protein_id="ACE89248.1"
FT                   /translation="MFGKRGNEGFGKAGGAIASPPPAPAAPAPVASSPSILVEPARENQ
FT                   RQQVTPPPMQAPQRKRPVRTDEYYDTKQQVFSALIDTIDLSQLSKLDGESAREEIRDIV
FT                   NDIITIKNFAMSISEQEELLEDICNDVLGYGPLEPLLARDDIADIMVNGAGQTFIEVGG
FT                   KTIESEIRFRDNAQLLSICQRIVSQVGRRVDESSPICDARLPDGSRVNVIAPPLSIDGP
FT                   ALTIRKFKKDKLTLDQLVRFGAITPEGATVLQIIGRVRCNVIISGGTGSGKTTLLNCLT
FT                   NYIDRDERVITCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERII
FT                   VGEVRGPEVFDLLQAMNTGHDGSMGTIHANTPRECLSRIESMIAMGGFTLPAKTVREII
FT                   STSVDVIIQAARLRDGSRRITQITEVIGMEGDVIITQDLMRYEIEGEDAGGRLIGRHMS
FT                   TGVGKPHFWDRARYFNEEKRLAAALDAMEAKTKD"
FT   gene            269532..270539
FT                   /locus_tag="RHECIAT_CH0000254"
FT   CDS_pept        269532..270539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000254"
FT                   /product="probable pilus assembly protein"
FT                   /note="ypch00089; GO_component: GO:0016020 - membrane;
FT                   GO_process: GO:0009306 - protein secretion"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000254"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89249"
FT                   /db_xref="GOA:B3PY98"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:B3PY98"
FT                   /protein_id="ACE89249.1"
FT                   /translation="MFGFDPIVLAIVVLAAVSAAAVAYALMFSRIEADKKSASRINRVK
FT                   SAEVDRVKVKAARDRVQELSKRRKSVQDNLKDLEKRQHEKTRKTLSMKSRLLQAGLPIS
FT                   VGKFYLISAVFASVLLFVAFVVGASWMVMIGIAVVAGLGLPRWVLGFLIKRRQNKFLNE
FT                   LPNALDVITRSIKSGLPLNDAIRLIGTEGTEPVKSEFRRVIEAQQVGLSIPDACARMTL
FT                   HMPLQEVNFFAIVIAIQSQAGGNLSEAIGNLSKVLRERRKMKAKVSALSMEAKASAVII
FT                   GALPFIVATLVYLTSPNYMMILFTDPRGHLIMGISAVWMSIGIFVMRNMVNFDI"
FT   gene            270554..271540
FT                   /gene="tadC"
FT                   /locus_tag="RHECIAT_CH0000255"
FT   CDS_pept        270554..271540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tadC"
FT                   /locus_tag="RHECIAT_CH0000255"
FT                   /product="pilus component protein"
FT                   /note="GO_component: GO:0016020 - membrane; GO_process:
FT                   GO:0009306 - protein secretion"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000255"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89250"
FT                   /db_xref="GOA:B3PY99"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:B3PY99"
FT                   /protein_id="ACE89250.1"
FT                   /translation="MSQDLAATLTNPGMLIAVFVAIAVFATFYTIAIPFFERGDLTKRM
FT                   KAVSTEREQIRARERARMNANPGAGKASLRSQNNRSVRQIVERFNLRQALVDENTVNKL
FT                   RAAGFRSENALNTFLVARFLLPFLFLALAAFWVFGLGNLAERGMPIRLFAVIGIGYVGF
FT                   YAPNIYISNRMGKRQHSIKRAWPDALDLMLICVESGISIEAAMRRVSEELGEQSPPLAE
FT                   EMVLTTAELSFLPDRRVALENLATRTQIELVRSVTQALIQADRYGTPVAQALRVLAQEG
FT                   RDERMNEAEKKAAALPPKLTVPMILFFLPVLIAVILGPAGIQVADKF"
FT   gene            271663..272295
FT                   /locus_tag="RHECIAT_CH0000256"
FT   CDS_pept        271663..272295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000256"
FT                   /product="probable amino acid efflux protein, LysE family"
FT                   /note="ypch00090; GO_component: GO:0016020 - membrane;
FT                   GO_function: GO:0005293 - lysine permease activity;
FT                   GO_process: GO:0006865 - amino acid transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000256"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89251"
FT                   /db_xref="GOA:B3PYA0"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:B3PYA0"
FT                   /protein_id="ACE89251.1"
FT                   /translation="MSSIGIFISIMAALAVGAVSPGPSFVVVSRIAISRSRLDGLAAAL
FT                   GMGAGGVVFAALALAGLTALLSQFEWLYLLLKVAGGAYLLYIAVNIWRGAAQPLAVSDT
FT                   VNGRRAPMRSFTTALLTQLSNPKTIIVYASLFAALLPRTVPLDLIIALPLGVFAVEAGW
FT                   YSIVALAFSARRSRRFYLAAKSWIDRAAGAVMGGLGLRLILSGLSAR"
FT   gene            complement(272333..273172)
FT                   /locus_tag="RHECIAT_CH0000257"
FT   CDS_pept        complement(272333..273172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000257"
FT                   /product="putative pilus assembly protein (contains TPR
FT                   repeats)"
FT                   /note="ypch00091"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000257"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89252"
FT                   /db_xref="GOA:B3PYA1"
FT                   /db_xref="InterPro:IPR011717"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR014596"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:B3PYA1"
FT                   /protein_id="ACE89252.1"
FT                   /translation="MPASLTIISTNRFLQGVAASLIVLALAGCSTTTKDRMTTGSVPKL
FT                   TKPVEEMDATELRSATDRLGQAYEKNPRDPVTGVSYANLLRMNGRDAQALAVMQQVAIA
FT                   NPGDRNVLAAYGKAQAAAGQFQQALDTIGRAQTPDRPDWKLVSAQGAILDQMGRASEAR
FT                   QRYRDALDIQPNEPSILSNLGMSYVLTGDLRTAETYLRSAAGQPNADSRVRQNLALVVG
FT                   LQGRFAEAEQIARRELSPQQADANVAYLRGMLSQQNSWQKLAAKDKAPAAAGDSNTN"
FT   gene            273315..274706
FT                   /locus_tag="RHECIAT_CH0000258"
FT   CDS_pept        273315..274706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000258"
FT                   /product="probable leucyl aminopeptidase protein"
FT                   /EC_number="3.4.11.1"
FT                   /note="ypch00092; GO_component: GO:0005622 - intracellular;
FT                   GO_function: GO:0004177 - aminopeptidase activity;
FT                   GO_process: GO:0006508 - proteolysis"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000258"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89253"
FT                   /db_xref="GOA:B3PYA2"
FT                   /db_xref="InterPro:IPR000819"
FT                   /db_xref="InterPro:IPR011356"
FT                   /db_xref="UniProtKB/TrEMBL:B3PYA2"
FT                   /protein_id="ACE89253.1"
FT                   /translation="MAPYQFIERPTPFNTKGGSTLPIFAVTPAHIETGTIDPIALDWAK
FT                   KAGYKAESGSLLLIPTAEGHLGGALFGLGTNPSEQPYITGRLARALPAGDWHIETAPLT
FT                   ANRLALGFGLGSYRFDRYKSEKSAAATMLIPSDADGADIKRQLAGVFLARDLINTPTND
FT                   MGPDQLEAAFRGLAQHYKAEVSVITGDALLEQNFPLVHTVGRASADAPRLLELRWGKKG
FT                   HRKVTLVGKGVCFDTGGLDIKPAASMLLMKKDMGGAANVMGLALMIMDAKLKVDLRVIV
FT                   PVVENAISSNAFRPGDIYRSRKGLTVQIDNTDAEGRLILADALAYADEEEPELLIDMAT
FT                   LTGAARVALGPDLPPFFTDDANLAHDLTEASLETDDPIWRLPLYPGYEKDIRAKFADLT
FT                   NAPAGGMAGAITAALFLKRFVSKAKSWAHFDIYGWAQSERPHSPGGGEAQAIRALFHHI
FT                   RTGLR"
FT   gene            274943..275293
FT                   /locus_tag="RHECIAT_CH0000259"
FT   CDS_pept        274943..275293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000259"
FT                   /product="probable transcriptional regulator protein, MarR
FT                   family"
FT                   /note="ypch00093; GO_component: GO:0005622 - intracellular;
FT                   GO_function: GO:0003700 - transcription factor activity;
FT                   GO_process: GO:0006355 - regulation of transcription,
FT                   DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000259"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89254"
FT                   /db_xref="GOA:B3PYA3"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B3PYA3"
FT                   /protein_id="ACE89254.1"
FT                   /translation="MPIELTASQALGLWHGVALDQVRLDDRDLTLRQMAILLHIYLVPP
FT                   PHTVRGLAATLGVTKPVITRALDTMGEMGLVDRVRDNADRRNVIIKRTVGGALYLEKLG
FT                   DLVRDQGRRLPI"
FT   gene            275317..276174
FT                   /locus_tag="RHECIAT_CH0000260"
FT   CDS_pept        275317..276174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000260"
FT                   /product="putative endopeptidase-related protein"
FT                   /note="ypch00094"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000260"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89255"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR036028"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:B3PYA4"
FT                   /protein_id="ACE89255.1"
FT                   /translation="MTMFDRRLHAYRPDLAEADLEGKVEASRFVQGTPARVAVPVIGLR
FT                   PQPELARGIDTELLLGEQVTVFDRADGWCWVKAASDGYVGYLPADALSQIDPVPTHIVT
FT                   VPRTFLYPEPELRKPHLTTLSMGSRVHVASEAEVRGNHYVVLADGTAIFARHVRPIGAL
FT                   DGADYVEIAGRLLETPYLWGGRSGLGIDCSGLVQLAMLMTGRQAPRDADMQAAGLGEAI
FT                   DRSEIRRGDLVFWKGHVAIFEDPQTILHANGHSMTVARENFEAAVARIGSLYQQPTGYR
FT                   RPFK"
FT   gene            complement(276167..277558)
FT                   /gene="gatA1"
FT                   /locus_tag="RHECIAT_CH0000261"
FT   CDS_pept        complement(276167..277558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatA1"
FT                   /locus_tag="RHECIAT_CH0000261"
FT                   /product="glutamyl-tRNA amidotransferase protein, A
FT                   subunit"
FT                   /EC_number="3.5.1.4"
FT                   /note="GO_function: GO:0004040 - amidase activity"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000261"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89256"
FT                   /db_xref="GOA:B3PYA5"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:B3PYA5"
FT                   /protein_id="ACE89256.1"
FT                   /translation="MAETDLTIRALIRRFADKSLSPLDYWLALEDHIAAWEPSISALYL
FT                   YDPEAARAQAKASAARWAKGRPLGALDGIPVTLKELIATKGQPVPFGTKAVELKPAEAD
FT                   APAAARLREDGAVIFAKTTCPDYGMLSSGLSSFHALSRNPWNITQNPGGSSAGAAGAAA
FT                   AGYGPLHIGTDIGGSVRLPAGWTGIFGFKPSHGRIPADPYYVGRCLGPMTRRVEDAAFS
FT                   MATLSRPDWRDGTSLPPNDFDWMDLGIDMSGMKIGLMLDAGCGLAVDDEIRDAVEAAAR
FT                   SFEKAGATVLSVQPVLTRAMLDGLDSFWRARLWSDIAGLDEERRDSILPYIGDWAKAGA
FT                   EVSGVDAVRGFNQTIEMRRSCGRLFTTIDALLSPTNPIISYPAEWASPTNDPARPFEHI
FT                   AFTVPWNMSEQPAASINCGFSRSGMPIGLQIVGPRFDDMRVLRLSKAFEDWTGGVSAWP
FT                   RPPVT"
FT   gene            complement(277594..278457)
FT                   /locus_tag="RHECIAT_CH0000262"
FT   CDS_pept        complement(277594..278457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000262"
FT                   /product="probable ABC transporter, permease protein"
FT                   /note="ypch00095; GO_component: GO:0016020 - membrane;
FT                   GO_function: GO:0005215 - transporter activity; GO_process:
FT                   GO:0006810 - transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000262"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89257"
FT                   /db_xref="GOA:B3PYA6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B3PYA6"
FT                   /protein_id="ACE89257.1"
FT                   /translation="MVPIAAIAMSSGRRPFGLSRRRNLISGAVIVGLLIAVALLSLVWT
FT                   PLPPEKMQIIHKLQPPLAFGLLGTDQFGRDVLSMLMAGCWNSLSIAISAVAIGGTLGSI
FT                   AGVSAAAIRGPFEALLMRICDVIFALPPILSAMMLGAFLGPGRFTAIAAIAVFMIPVFA
FT                   RVTLATSLQAWSRDYVTAARAIGNTRLTISLRHVLPNIIGQIIVHGAIQLGLAILTEAG
FT                   LGFLGLGMAPPAPTWGRMLADAQTYLALAPWLAVLPGLAIALAVLGFNLLGDGLRDLLD
FT                   PREASR"
FT   gene            complement(278460..279407)
FT                   /locus_tag="RHECIAT_CH0000263"
FT   CDS_pept        complement(278460..279407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000263"
FT                   /product="probable ABC transporter, permease protein"
FT                   /note="ypch00096; GO_component: GO:0016020 - membrane;
FT                   GO_function: GO:0005215 - transporter activity; GO_process:
FT                   GO:0006810 - transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000263"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89258"
FT                   /db_xref="GOA:B3PYA7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B3PYA7"
FT                   /protein_id="ACE89258.1"
FT                   /translation="MIALLARRFAGLVITLVIVSLLIFLVMDLLPGDPASILLGTSASP
FT                   ETLAALRHDLGLDQPLVLRYGQWLAGVLSGDLGRSYTYGVPVKGLIVERLAVTLPLALM
FT                   AIALSVAIALPLGVLAASRRGRVFDIAAALFSQISIAMPAFWVALLLIILFSTMLRLMP
FT                   AGGFPGWGAGLLPALQALVLPAVALAMPQAGVLTRVARSAVLETMHEDFARTAVAKGLS
FT                   RSAVLWRHVVPNALIPILTMIGLQFTFLVAGAVLVENVFNLPGLGRLALQALSQRDIIV
FT                   MQDVVLFFAALVIVVNFIVDLSCLAIDPRIRKAA"
FT   gene            complement(279717..281246)
FT                   /locus_tag="RHECIAT_CH0000264"
FT   CDS_pept        complement(279717..281246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000264"
FT                   /product="probable ABC transporter, substrate-binding
FT                   protein"
FT                   /note="ypch00097; GO_function: GO:0005215 - transporter
FT                   activity; GO_process: GO:0006810 - transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000264"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89259"
FT                   /db_xref="GOA:B3PYA8"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:B3PYA8"
FT                   /protein_id="ACE89259.1"
FT                   /translation="MNKVSFAPSARFVRRLSLGVALSAGLMVTAMTPAEAANTGLKLGM
FT                   SVEPTGLDPTIAAPVAIGQVTWQNVFEGLVRIDQTGKVQPQLAKSWEVSPDGLTYAFKL
FT                   QTGVKFHDGEAFDAASAKFSLDRARGADSVNPQKRFFASIASIDTPDAETLVLHLSAPT
FT                   GSLIYWLGWPASVMVAPKTAADDRVTPIGTGPFKFVSWAKGDRVELARNADYWNKDAAA
FT                   KLDKVTFRFIADPQAQAAALKSGDLDAFPEFAAPELMSSFDGDARLVTRIGNTELKVVA
FT                   GMNNAKKPFDDKRVRQALMMAIDRKTVIDGAWSGLGTPIGSHYTPNDPGYQDTTGVLPY
FT                   DVGKAKALLAEAGYPNGFTFTIKSPQMAYAPRSAQVMQAMFAEIGVTMNIEPTEFPAKW
FT                   VQDIMKDRNFDMTIVAHAEPLDIDIYARDPYYFNYKNPAFNALMKKVQETTDPAAQNAI
FT                   YAQAQKILAEDVPALYLFVMPKLGVWDRKLKGLWENEPIPSNVLSGVSWEE"
FT   gene            complement(281364..282389)
FT                   /locus_tag="RHECIAT_CH0000265"
FT   CDS_pept        complement(281364..282389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000265"
FT                   /product="putative peptidase protein"
FT                   /note="ypch00098"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000265"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89260"
FT                   /db_xref="InterPro:IPR005321"
FT                   /db_xref="InterPro:IPR016117"
FT                   /db_xref="UniProtKB/TrEMBL:B3PYA9"
FT                   /protein_id="ACE89260.1"
FT                   /translation="MQSYRRPFVHKDPPLPDLLNLITDIDGVAVGHATDLALGSGVTVI
FT                   VFDEPAVASGTVLGGAPGGRDTGLLDPSMTVSAVDAFVFSGGSAFGLDAAGGVQAGLRE
FT                   VGRGFAVGSVRIPIVPQAILMDLLNGGNKDWGIHSPYRDMGYAALKAAAKGVFALGTTG
FT                   AGTGATTATFKGGLGSASAVSSAGHRIAAVVAVNALGSATIGDGPHFWAAPFEKDGEFG
FT                   GLGMPAVSDHRMRLKGMNTPATTIGAVVTDARLTKAEAHRLSLAGHDGFARALLPAHLP
FT                   LDGDTVFAASTGRHRRDDMASLMELCHLATLVMARAIARGVYEASALPAEGAQKAWRDR
FT                   S"
FT   gene            complement(282473..282748)
FT                   /locus_tag="RHECIAT_CH0000266"
FT   CDS_pept        complement(282473..282748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000266"
FT                   /product="hypothetical conserved protein"
FT                   /note="yhch00066"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000266"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89261"
FT                   /db_xref="UniProtKB/TrEMBL:B3PYB0"
FT                   /protein_id="ACE89261.1"
FT                   /translation="MTFVLLSTVPDKSIRHGCACRAAGVLSMKKQVIEYAGVPVGIVIP
FT                   DEDRLKFIAVKFHVHDLDEQRFGSPDEVRLAIHDLMTRRHPKPLHA"
FT   gene            complement(283188..286115)
FT                   /locus_tag="RHECIAT_CH0000267"
FT   CDS_pept        complement(283188..286115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000267"
FT                   /product="probable aminotransferase protein"
FT                   /EC_number="2.6.1.-"
FT                   /note="ypch00099; GO_function: GO:0008483 - transaminase
FT                   activity; GO_function: GO:0030170 - pyridoxal phosphate
FT                   binding"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000267"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89262"
FT                   /db_xref="GOA:B3PYB1"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B3PYB1"
FT                   /protein_id="ACE89262.1"
FT                   /translation="MTDEALVDRMALPRPDVTVADAEEILPDHYGLSGTVIELGSQQDR
FT                   NYRVDSDRGRYVLKICHAAYETRELEAQNAAIHHLKGKPDAPRVPNVVATNDGREILVL
FT                   TVRGQGYQVRLLEYLEGSGLTELTYVAPASVAALGALCARLAQALADFDHPGLDRSLQW
FT                   DLRRAGPVAVQLLSAITDSAARDRIAKTMVMAVRRIQPLAPSLRLQAVHHDVTGDNVVG
FT                   HRDARGHTIPDGVIDFGDIIRGWLVGDLAVTCASLLHQANGDPFHILPAVTAYQAIYPL
FT                   SDDELKALWPLIVARAVILVASSEQQISVEPDNDYVRGNLDAERVIFDTAMSVPFELME
FT                   AAILKAAGADVAAPQTSEWLPLLPDIDTAAIAYIDLGVRSPHFSAGNWLNTDMDWRLLA
FT                   RAATESGAAATRYGEYRLSRAALGSSKEQPTCALHVDICLAAGSAVAAPFAGRIGWKDQ
FT                   HLTLTCETMTLHLDGLDPSIEDGAVLAAGDPLGSVSGEASSLGGLRLQLCNVAGLEPPL
FT                   FATPREAAAWSVLCPSPSPLLDRQADAPQPETAGLLIKRQAHLASAQKHYYAAPPQIER
FT                   GWKEHLFDVEGRAYLDMVNNVTILGHGHPRFAAAIGAQWLRLNTNSRFHYGAIAEFSER
FT                   LAALAPEGLDTVFLVNSGSEANDLAIRLAQVHSGARDMLCLLEAYHGWSAASDAVSTSI
FT                   ADNPQALTTRPDWVHAVVSPNTYRGAFRGPDTAASYLGAVTPMLETIDAGGQGLAGFIC
FT                   ESVYGNAGGIPLPDGYLREIYAQVRARGGLCIADEVQVGYSRLGHYVWGFEQQGVVPDI
FT                   ITIAKGMGNGHPLGAVITTRAIAQSLEKQGPFFSSTGGSPVSCIAGIAVLDIMAEEKLQ
FT                   ENARTVGDHLKERLAALINRHPIVGAVHGMGLYLGLEFVRDRTTLEPATEETAAICDRL
FT                   LRLGVIMQPTGDHQNVLKIKPPLCLSIESADFFADMLEKVLDEGW"
FT   gene            complement(286236..287120)
FT                   /gene="purUch1"
FT                   /locus_tag="RHECIAT_CH0000268"
FT   CDS_pept        complement(286236..287120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purUch1"
FT                   /locus_tag="RHECIAT_CH0000268"
FT                   /product="formyltetrahydrofolate deformylase protein"
FT                   /EC_number="3.5.1.10"
FT                   /note="GO_function: GO:0016742 - hydroxymethyl-, formyl-
FT                   and related transferase activity; GO_process: GO:0009058 -
FT                   biosynthetic process"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000268"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89263"
FT                   /db_xref="GOA:B3PYB2"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004810"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="UniProtKB/TrEMBL:B3PYB2"
FT                   /protein_id="ACE89263.1"
FT                   /translation="MRSYVLTVSCKSTRGIVAAISSYLAEKGCNIIDSSQFDDLDTGKF
FT                   FMRVSFISEEGLAGSAISADFAAVAAPFEMDYEFHDSESRMKVLLMVSRFGHCLNDLLY
FT                   RWKIGALPIDIVGVVSNHFDYQKVVVNHDIPFHHIKVTKENKPQAEAQLVELVNQTGTE
FT                   LIVLARYMQVLSDQLCKQMSGKIINIHHSFLPSFKGANPYKQAYERGVKLIGATAHYVT
FT                   ADLDEGPIIEQDTARITHAQSAEDYVSIGRDVESQVLARAIHAHIHHRTFINGNRTVVF
FT                   PASPGSYASERMG"
FT   gene            complement(287338..288354)
FT                   /gene="exoZ"
FT                   /locus_tag="RHECIAT_CH0000269"
FT   CDS_pept        complement(287338..288354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="exoZ"
FT                   /locus_tag="RHECIAT_CH0000269"
FT                   /product="exopolysaccharide production protein"
FT                   /EC_number="2.3.1.-"
FT                   /note="GO_function: GO:0016747 - transferase activity,
FT                   transferring groups other than amino-acyl groups"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000269"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89264"
FT                   /db_xref="GOA:B3PYB3"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:B3PYB3"
FT                   /protein_id="ACE89264.1"
FT                   /translation="MLVQLQYLRAIAALMVVYFHAILQLAKVNPAVDATAFLYGETGVD
FT                   IFFVLSGFVMWLTTSGRVMSPIDFARRRIRRIVPLYWLATLFSAVVALAAPSLLKSTVF
FT                   DVPHLIASLFFLPWANAADPGTITPVVVPGWTLNYEMFFYLVFALLLPLQETRRIPAMF
FT                   AVFAVILIACRLLPETTATRFYGEPIMLEFLAGVVLGWLYGQKALLPNRWAWGVLATGF
FT                   AFLLVNEALMQPENRFYAWGIPAVFIVFGAVSIDFSRLPALGWLNYLGDCSYAIYITHA
FT                   FTLAFLRVVADRLPIGILQQPVLFIILSLVLSSVGGAIVHEITTPRRKVAVASRPPA"
FT   gene            complement(288411..289691)
FT                   /locus_tag="RHECIAT_CH0000270"
FT   CDS_pept        complement(288411..289691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000270"
FT                   /product="probable polysaccharide biosynthesis protein"
FT                   /note="ypch00100"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000270"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89265"
FT                   /db_xref="GOA:B3PYB4"
FT                   /db_xref="UniProtKB/TrEMBL:B3PYB4"
FT                   /protein_id="ACE89265.1"
FT                   /translation="MAAVDQKAPTFAVAGNRLDPAARASHVDHPVLWLGLLSVLYNGIL
FT                   AFINHNIMPLSLTHVAASEGLIMASAIIYILHKGIYETDLPAFLFLLFTLVVTIYVSVL
FT                   NRVPFVDHFRNVLIIFCFSGLGGWSNEKTMKLAFRWASLAVLIFLIFEIVSVPFYVSIV
FT                   HPSDYFANTRGLLPLSYNKTGLFQNALGFPERFSFGIIDHRSSSIFLEQVSLANFCGVI
FT                   AIYLISMWERISRWDRLLFIATAVLILVTNDTRTMLIFCFACIVGYFVFPKIPKNFNLA
FT                   LMPLIVVAGFLVYTMKPNATGDNFTGRINLTMKKIMELDPLAVLGLSVGRVAEFADSGY
FT                   VYLIYAATVFGVIAFWLFVCLFPAGRTAAQRRCAHSLSLFIFLNMMIGGTAVFSMKIAG
FT                   LLWFVVGYMRFHDSPRIRQGRAADVES"
FT   gene            complement(289694..290743)
FT                   /locus_tag="RHECIAT_CH0000271"
FT   CDS_pept        complement(289694..290743)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000271"
FT                   /product="probable carboxymethyl cellulase protein"
FT                   /EC_number="3.2.1.4"
FT                   /note="ypch00101; GO_function: GO:0004553 - hydrolase
FT                   activity, hydrolyzing O-glycosyl compounds; GO_process:
FT                   GO:0005975 - carbohydrate metabolic process"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000271"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89266"
FT                   /db_xref="GOA:B3PYB5"
FT                   /db_xref="InterPro:IPR001547"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018087"
FT                   /db_xref="UniProtKB/TrEMBL:B3PYB5"
FT                   /protein_id="ACE89266.1"
FT                   /translation="MRTTRHLTAPLLAAALIASPALGADKPCYRGVNLSGGEYGERDAT
FT                   YGTNYLYPSEATIGYFAKKGMTIIRLPFRWERLQAALGGRFDAEELTRIKETVALIRKH
FT                   GMAVLLDPHNFGYYDKIQIGTAPATDAAFADFWARLAVEFANEDGVLFGLMNEPHDIKA
FT                   TDWLDAANAAIRSIRAIGARNLILVPGTAWSGAHSWEKDVIGGANGTVMLGVRDPLDFY
FT                   AYEVHQYLDIDSSGTHPTCEGATAAVEAIAGVTAWLKQNHKRGFLGEFGASADKDCMGG
FT                   LKEIYATMSGNSDVWLGWSYWAAGEWWPADEPFNVQPHQGPERPQMRLLAESAKADRGA
FT                   CTTVKPAGN"
FT   gene            290880..292490
FT                   /locus_tag="RHECIAT_CH0000272"
FT   CDS_pept        290880..292490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000272"
FT                   /product="probable succinoglycan biosynthesis transport
FT                   protein"
FT                   /note="ypch00102; GO_component: GO:0016020 - membrane;
FT                   GO_process: GO:0009103 - lipopolysaccharide biosynthetic
FT                   process"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000272"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89267"
FT                   /db_xref="GOA:B3PYB6"
FT                   /db_xref="InterPro:IPR003856"
FT                   /db_xref="InterPro:IPR032807"
FT                   /db_xref="UniProtKB/TrEMBL:B3PYB6"
FT                   /protein_id="ACE89267.1"
FT                   /translation="MSQYDRNRVSRLPGWRSYEPPQTAPEGLRLRSPVVRPDDFARPAP
FT                   EPAPPPFVPPPANVAQTRRSEQPSPPPAVPPAADLPPQSTSAPGAPLLDLRSSIAAIWS
FT                   RRLVVLALALVGAVAGGAVAPFIGQKYTAVSSLYFDPRQIGLAEAGAQSSGPSPEMISA
FT                   LIDSQVQILTSGNVLRRVVEAMKLDQDPEFTGGRTDGAAVIGTLQKALVITRQATTYVV
FT                   SLAATTNDPEKSARLANQVVTAFTEEENSASNGLYENTSSTLDGRLDDLRQKVLEAEQA
FT                   VETFRADNDMAATEGNLISDQRLGSLNTLLVTAQEKTIQAKARADAVANLRVEDIVAGN
FT                   QTEGGATSPLVSLRQQYAAQAAAVGSLESQMGTRHPRLQAARSSLQSISGEIKGELQRL
FT                   ATSARGEYEQAKAAEDSIAKELAVQKALQATTSDKQVELNELQRKATAARDIYETVLKR
FT                   SSQTSEEQNLSQSNIRVISPAEPPVKADGPGKKILLVAGIIGGLLAGFVVGAGFAILAG
FT                   LFSHPIIRSYFRKPPAAAA"
FT   gene            292487..292885
FT                   /locus_tag="RHECIAT_CH0000273"
FT   CDS_pept        292487..292885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000273"
FT                   /product="hypothetical conserved protein"
FT                   /note="yhch00067"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000273"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89268"
FT                   /db_xref="UniProtKB/TrEMBL:B3PYB7"
FT                   /protein_id="ACE89268.1"
FT                   /translation="MIAIPGFPTSYQRRNDAGRRISMRLVMMFPILLVALSGLAPASAF
FT                   AVDWTKPVTSDVQALYPYKGLPGVKAQPDKKEEESYNCRTETVQVRRRYDDIFRSGGMP
FT                   TLMYVCERDGFVTMGGKVPLRGHYQPVR"
FT   gene            complement(293073..293537)
FT                   /locus_tag="RHECIAT_CH0000274"
FT   CDS_pept        complement(293073..293537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000274"
FT                   /product="hypothetical protein"
FT                   /note="yhch00068"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000274"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89269"
FT                   /db_xref="UniProtKB/TrEMBL:B3PYB8"
FT                   /protein_id="ACE89269.1"
FT                   /translation="MPNQRSIGWRDSRPSGRHVRRRFPAVGNHRQDHDTGFSGGAQKQV
FT                   PEFVHSGLPDYGIGANLHSRDIFLSVVKRPFDHQNLGCVTERPDDLSPAPNKENERRKI
FT                   HRCVPLHGTFSTRIRILVIMQLACRARRKRHRCRTELPTQFSATAERTRR"
FT   gene            complement(293662..293746)
FT                   /locus_tag="RHECIAT_CH0000275"
FT   tRNA            complement(293662..293746)
FT                   /locus_tag="RHECIAT_CH0000275"
FT                   /product="tRNA-Leu"
FT                   /inference="ab initio prediction:tRNAscan-SE:1.23"
FT   gene            293914..294333
FT                   /locus_tag="RHECIAT_CH0000276"
FT   CDS_pept        293914..294333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000276"
FT                   /product="hypothetical conserved protein"
FT                   /note="yhch00069"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000276"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89270"
FT                   /db_xref="GOA:B3PYB9"
FT                   /db_xref="InterPro:IPR012413"
FT                   /db_xref="UniProtKB/TrEMBL:B3PYB9"
FT                   /protein_id="ACE89270.1"
FT                   /translation="MPASRTFLLAALLAVLSPAIAAADSLKVGKPGLGPVNTGSTLCDF
FT                   RGCFGFGTQQWHRPAYVQPNYRPRGAGPTYYLPGAAGRPQLTYDPPPVRRVQPAARDMN
FT                   KHIAWCTNEYRSYNSRTDHFLTYEGVYRVCRSPYR"
FT   gene            complement(294336..294629)
FT                   /locus_tag="RHECIAT_CH0000277"
FT   CDS_pept        complement(294336..294629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000277"
FT                   /product="hypothetical conserved protein"
FT                   /note="yhch00070"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000277"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89271"
FT                   /db_xref="InterPro:IPR011893"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B3PYC0"
FT                   /protein_id="ACE89271.1"
FT                   /translation="MTEKPRVSILYCTQCNWLLRSAWMAQELLHTFSDSLGEVALIPGT
FT                   GGNFEIRVNGDLIWERKRDGGFPGPKELKQRVRDIVEPGRDLGHVDRASLES"
FT   gene            294756..295493
FT                   /locus_tag="RHECIAT_CH0000278"
FT   CDS_pept        294756..295493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000278"
FT                   /product="probable glutamine amidotransferase protein"
FT                   /note="ypch00103; GO_function: GO:0003824 - catalytic
FT                   activity"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000278"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89272"
FT                   /db_xref="GOA:B3PYC1"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B3PYC1"
FT                   /protein_id="ACE89272.1"
FT                   /translation="MRVAVVENMKNTGLGALARALDEAGAEIEWFRVWQDGILPLDIAG
FT                   HDALVVLGGEQSALDDETHPYLPELARLARRFGDAGKAVLGICLGSQILARAYGADNHL
FT                   GTAREFGWHRIGLTGEGRADPLLSALGGEFTIFEWHADTFTLPESAVRLAASPVAENQA
FT                   FRIGRAVYGTQFHFEADRTVVEQWKAEFPDTIARIAPGWLENHAELAAHHGVAADAAGL
FT                   AIARAWVSLIEPAEIGLLSEAPA"
FT   gene            295505..296062
FT                   /gene="nodL"
FT                   /locus_tag="RHECIAT_CH0000279"
FT   CDS_pept        295505..296062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nodL"
FT                   /locus_tag="RHECIAT_CH0000279"
FT                   /product="maltose O-acetyltransferase protein"
FT                   /EC_number="2.3.1.79"
FT                   /note="GO_function: GO:0008415 - acyltransferase activity"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000279"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89273"
FT                   /db_xref="GOA:B3PYC2"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR024688"
FT                   /db_xref="UniProtKB/TrEMBL:B3PYC2"
FT                   /protein_id="ACE89273.1"
FT                   /translation="MPASEYEKMAAGEWYCCLDDELDRLRQQARRAVHAHNTLPPDERG
FT                   AVAPALRALFAGAAPDIFIEAPFHCSYGINIVLGERVYFNAGCTILDSGRVTVGDRTMF
FT                   GPGVQIYCAEHHKDPALRSQGIEIARPVSIGSDVWIGGAAAILGGVTIGDGAIVGAGAV
FT                   VTRDVPAGTTVVGNPARPMNRL"
FT   gene            296135..296587
FT                   /locus_tag="RHECIAT_CH0000280"
FT   CDS_pept        296135..296587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000280"
FT                   /product="putative glutathione-dependent
FT                   formaldehyde-activating protein"
FT                   /note="ypch00104; GO_function: GO:0016846 - carbon-sulfur
FT                   lyase activity; GO_process: GO:0008152 - metabolic process"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000280"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89274"
FT                   /db_xref="GOA:B3PYC3"
FT                   /db_xref="InterPro:IPR006913"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniProtKB/TrEMBL:B3PYC3"
FT                   /protein_id="ACE89274.1"
FT                   /translation="MTAQNLPMEGGCRCGRVRLKISAPPLLTMACHCTGCQRMTASAYS
FT                   LSAAIPSEGFEVTKGEPVIGGLHGTTKHYFCPHCMSWMFTRPEGMDWFVNLRVTMLDDP
FT                   SWFTPFIETWTSEKLAFAETGAVHSYAALPEMAAYEGLVKEYMARG"
FT   gene            complement(296590..296889)
FT                   /locus_tag="RHECIAT_CH0000281"
FT   CDS_pept        complement(296590..296889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000281"
FT                   /product="hypothetical conserved protein"
FT                   /note="yhch00071"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000281"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89275"
FT                   /db_xref="GOA:B3PYC4"
FT                   /db_xref="InterPro:IPR002712"
FT                   /db_xref="InterPro:IPR011067"
FT                   /db_xref="UniProtKB/TrEMBL:B3PYC4"
FT                   /protein_id="ACE89275.1"
FT                   /translation="MARFHVYNLIHTNALALDLQSDLHGDLTTRIMAPMLPLEALPKIM
FT                   RQLNPQFVINGVPYVMATQFIGAISIKEIGVAAADLTADSDRIISALDFLFQGF"
FT   gene            complement(296889..297119)
FT                   /locus_tag="RHECIAT_CH0000282"
FT   CDS_pept        complement(296889..297119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000282"
FT                   /product="hypothetical conserved protein"
FT                   /note="yhch00072"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000282"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89276"
FT                   /db_xref="InterPro:IPR009956"
FT                   /db_xref="UniProtKB/TrEMBL:B3PYC5"
FT                   /protein_id="ACE89276.1"
FT                   /translation="MAQHARKAANLSLDEGLVSQARELKINISRAAEDGIAKAIKAERE
FT                   RLWRIENAEAIAASNAYVEKHGLPFQKYRQF"
FT   gene            complement(297178..299010)
FT                   /gene="lepA"
FT                   /locus_tag="RHECIAT_CH0000283"
FT   CDS_pept        complement(297178..299010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lepA"
FT                   /locus_tag="RHECIAT_CH0000283"
FT                   /product="GTP-binding elongation factor protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000283"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89277"
FT                   /db_xref="GOA:B3PYC6"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006297"
FT                   /db_xref="InterPro:IPR013842"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035654"
FT                   /db_xref="InterPro:IPR038363"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3PYC6"
FT                   /protein_id="ACE89277.1"
FT                   /translation="MARMSTNSTTPLSHIRNFSIVAHIDHGKSTLADRLIQTTGGLAER
FT                   EMSEQVLDNMDIERERGITIKAQTVRLHYQANNGEKYILNLIDTPGHVDFAYEVSRSLS
FT                   ACEGSLLVVDASQGVEAQTLANVYQAIDNNHELVTVLNKIDLPAAEPDRIKEQIEEVIG
FT                   IDASEAVLISAKTGLGIPDVLEAIVRKLPAPKSPGGEKAPLKALLVDSWYDTYLGVMVL
FT                   VRIIDGVLTKGQTIRMMGTDAKYQVERVGVLTPKMVNVDSLGPGEIGFITASIKEVADT
FT                   RVGDTITEDKRPTAQALPGFKPAQPVVFCGLFPVDAADFEDLRAAMGKLRLNDASFSFE
FT                   MESSAALGFGFRCGFLGLLHLEIIQERLEREFDLDLIATAPSVVYKMYMTDGTERELHN
FT                   PADMPDVVKISEIHEPWIRATILTPDDYLGGILKLCQDRRGIQIELTYVGTRAMLTYDL
FT                   PLNEVVFDFYDRLKSISKGYASFDYTLTDHREGNLVKMSILVNGEPVDALSMMVHRTAA
FT                   EKRGRDMCEKLKELIPKHMFKIPIQAAIGGNVIARETISALRKDVTAKCYGGDATRKRK
FT                   LLDKQKAGKKRMRQFGKVEIPQEAFIAALKMGDE"
FT   gene            complement(299088..299786)
FT                   /locus_tag="RHECIAT_CH0000284"
FT   CDS_pept        complement(299088..299786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000284"
FT                   /product="probable transcriptional activator regulator
FT                   protein, TenA family"
FT                   /note="ypch00105"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000284"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89278"
FT                   /db_xref="GOA:B3PYC7"
FT                   /db_xref="InterPro:IPR004305"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="InterPro:IPR027574"
FT                   /db_xref="UniProtKB/TrEMBL:B3PYC7"
FT                   /protein_id="ACE89278.1"
FT                   /translation="MDASTQSTELTGSFTAAAWDRIAPIMAEIEALPLLTRLSDGTLPP
FT                   EIFRHYILQDALYLKHYARCLAIVAAKAPDNAQVLRFLGSAQKAITVEQGLHAGFLTQF
FT                   GITAADLTSAEPSPTCFAYTNFLLATAYHRSYAVALSAILPCFWIYWHVGEAIKNQPVV
FT                   EGNAFQAWINTYGDPQFAAGAREVIALTDIAARAASPAERTEMTDAFVRASQYEWMFWD
FT                   SAWRLETWPV"
FT   gene            299921..300490
FT                   /locus_tag="RHECIAT_CH0000285"
FT   CDS_pept        299921..300490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000285"
FT                   /product="probable transcriptional regulator protein, LacI
FT                   family"
FT                   /note="ypch00106; GO_function: GO:0043565 -
FT                   sequence-specific DNA binding"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000285"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89279"
FT                   /db_xref="GOA:B3PYC8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B3PYC8"
FT                   /protein_id="ACE89279.1"
FT                   /translation="MEEQLEQAIGIRIRKLRLEKGLTLDDLATASGVSRAMISRIERAE
FT                   ASPTASLLARICAALGLSLSAFFAEEGQQASPLARRQDQQVWRDPETGYLRRSVSAPGT
FT                   ASDVDIVEVEFPAGARVSFPPHAASHGMTQHVWLFDGELEMTAGETVYRLRPGDCLSMP
FT                   VGDGHVFHNPGNAPARYCVVLDRGGR"
FT   gene            300515..301030
FT                   /locus_tag="RHECIAT_CH0000286"
FT   CDS_pept        300515..301030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000286"
FT                   /product="probable acetyltransferase protein"
FT                   /note="ypch00107; GO_function: GO:0008080 -
FT                   N-acetyltransferase activity; GO_process: GO:0008152 -
FT                   metabolic process"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000286"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89280"
FT                   /db_xref="GOA:B3PYC9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B3PYC9"
FT                   /protein_id="ACE89280.1"
FT                   /translation="MPDIRTLSAEEARAAIPALSQVLADCVAGGASVGFMQPYTPEDAE
FT                   PYWCDVADAVAAGGNLLLVAELAGSIVGTVQVGAAQMPNQPHRGDLKKLLVHRSARGRG
FT                   LARLLMEAAEREARKRGKTLLVLDTATGSDAEAIYPRLGWERVGVIPDYALWPQGGFCD
FT                   TTLFYKRL"
FT   gene            complement(301046..301657)
FT                   /locus_tag="RHECIAT_CH0000287"
FT   CDS_pept        complement(301046..301657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000287"
FT                   /product="putative haloacid dehydrogenase hydrolase
FT                   protein"
FT                   /note="ypch00108; GO_function: GO:0003824 - catalytic
FT                   activity; GO_process: GO:0008152 - metabolic process"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000287"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89281"
FT                   /db_xref="GOA:B3PYD0"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B3PYD0"
FT                   /protein_id="ACE89281.1"
FT                   /translation="MKVLMVDVDGVLIHGRPADGLPHFTFLERDLGLRLDLLQQAFFQT
FT                   HWSEIIIGREALEPRLSAVLAEIAPHVTAATLIDYWFENDSRLDLNLLEELAALRQSGV
FT                   ALFLATNQEHRRARYLMEEAGLGAHVDGIIYSAALGHRKPSPDFFRLASERAGALPGDI
FT                   AFIDDMAENIEAARQFGWHAAQWTAGTTLAGAFPGLRRPA"
FT   gene            301791..302816
FT                   /gene="aphA"
FT                   /locus_tag="RHECIAT_CH0000288"
FT   CDS_pept        301791..302816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aphA"
FT                   /locus_tag="RHECIAT_CH0000288"
FT                   /product="acetylpolyamine aminohydrolase protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000288"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89282"
FT                   /db_xref="GOA:B3PYD1"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="InterPro:IPR023801"
FT                   /db_xref="InterPro:IPR037138"
FT                   /db_xref="UniProtKB/TrEMBL:B3PYD1"
FT                   /protein_id="ACE89282.1"
FT                   /translation="MRVIYSEDHKLRDARTELYAGQLVTPFEAPFRAEWILAAVKEAGF
FT                   ADVVAPDAHGLETAKKVHDPAYLDFLATVWDRWVAAGFEGEAIANSFPVRRTSQRVPDN
FT                   IVGAIGHYANAADTSITKGSYEAAIASMRCAVTGADRLAEGHRFAFALCRPPGHHAGID
FT                   LFGGYCFINNAGVAAQRLLDRGAARVAVLDVDFHHGNGTQDLFYHRGDVFTASLHGDPM
FT                   HAFPYFLGHANEEGEGAGTGTNRNYPMPPGTPFEVWSSALADALARIKAFGAEAIVLAL
FT                   GVDTFERDPISFFRLTSDDFIRMGAMISAAGLPVLACMEGGYGVPEIGLNVANVLKGLE
FT                   A"
FT   gene            302826..303377
FT                   /gene="recX"
FT                   /locus_tag="RHECIAT_CH0000289"
FT   CDS_pept        302826..303377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recX"
FT                   /locus_tag="RHECIAT_CH0000289"
FT                   /product="DNA repair transcriptional regulator protein"
FT                   /note="GO_process: GO:0006282 - regulation of DNA repair"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000289"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89283"
FT                   /db_xref="GOA:B3PYD2"
FT                   /db_xref="InterPro:IPR003783"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B3PYD2"
FT                   /protein_id="ACE89283.1"
FT                   /translation="MTDQTVPSDIPTPRMLSWARNSAIYRLERRMMTEKQLFDAITRKA
FT                   REKFEDISAGQLKAVADFAVTFAYDNKLLDDGAYAEISTRSAVRGGKSKRAIAQKLAAK
FT                   GVASDKVEAALGEADDLYAATIFARKRAFGPFRRGDLDDKRKAKELSAFARNGFSFEIG
FT                   RKVFDMSVEDAEEVILSGRL"
FT   gene            303470..304366
FT                   /locus_tag="RHECIAT_CH0000290"
FT   CDS_pept        303470..304366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000290"
FT                   /product="probable permease protein"
FT                   /note="ypch00109; GO_component: GO:0016020 - membrane"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000290"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89284"
FT                   /db_xref="GOA:B3PYD3"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B3PYD3"
FT                   /protein_id="ACE89284.1"
FT                   /translation="MKDGTNDGAGVLALETPATSSGLAAGGLMCLLSMSSIQFGAALSS
FT                   HAIATYGPAGASWLRLVFAAIILVVAVRPRLFSYSREQWTSALVLGTTTALMTMSFFAA
FT                   IERIPLGLAVAIDFLGPLSVATIGYGLSRRLVWPLIAALGVLALAHDGEGWIGDMWGIL
FT                   FAGGAGTGWAIYIVLTKKIGASFKGLEGLSMSLMVAAVVATPFGFSGAAPALDTSGLIE
FT                   MAGLAVLVPLLPYTLELIALRRMPTTSFGILMSLEPAIAALAGFVILMQPMTLLQMAGT
FT                   ALVVAASAGATFSARTG"
FT   gene            complement(304481..304948)
FT                   /locus_tag="RHECIAT_CH0000291"
FT   CDS_pept        complement(304481..304948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000291"
FT                   /product="hypothetical conserved protein"
FT                   /note="yhch00073"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000291"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89285"
FT                   /db_xref="GOA:B3PYD4"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="UniProtKB/TrEMBL:B3PYD4"
FT                   /protein_id="ACE89285.1"
FT                   /translation="MDNDIQGRPAHVAAIRERAEAEMRAMGVDEAFIGRLVETFYGRVL
FT                   AHADLGPVFDARLSGRWPEHMEKMKSFWSAVAFRSGAYGGKPVQAHTGVADLTPDLFPK
FT                   WLALFAATLDDVAPSPEAKAWFMATAERIAKSLTLSLFYNPALDDPAKKAG"
FT   gene            305226..306209
FT                   /locus_tag="RHECIAT_CH0000292"
FT   CDS_pept        305226..306209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000292"
FT                   /product="hypothetical conserved protein"
FT                   /note="yhch00074; GO_function: GO:0046872 - metal ion
FT                   binding; GO_process: GO:0006118 - electron transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000292"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89286"
FT                   /db_xref="GOA:B3PYD5"
FT                   /db_xref="InterPro:IPR003251"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR017040"
FT                   /db_xref="UniProtKB/TrEMBL:B3PYD5"
FT                   /protein_id="ACE89286.1"
FT                   /translation="MLARFFRSSKRSFQSLSEQEILALAIASEEDDARIYLAYADKLRP
FT                   EFPASAKVFEDMAEVEDTHRKSLIEIYRQRFGERIPLIRREHVEGFYERKPDWLRANLS
FT                   LDAMRQETEAMEEQAYRFYVEAVKRTSDASTRKLLGDLALAEQGHEDIARMLGDKHTPE
FT                   DVRRDEDETAHRQFVLTYVQPGLAGLMDGSVSTLAPIFAAAFATQDTWQTFLVGLSASV
FT                   GAGISMGFTEAAHDDGKISGRGSPIKRGLACGIMTALGGLGHALPYLIPHFWTATITAA
FT                   IIVFFELWAIAFIQNRYMETPFLRAAFQVVLGGGLVLGAGILIGNG"
FT   misc_feature    complement(306480..307805)
FT                   /note="yich00004; insertion sequence:Transposase, IS4-like"
FT   gene            complement(308237..308749)
FT                   /locus_tag="RHECIAT_CH0000293"
FT   CDS_pept        complement(308237..308749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000293"
FT                   /product="putative transglutaminase-like cysteine peptidase
FT                   protein"
FT                   /note="ypch00110"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000293"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89287"
FT                   /db_xref="InterPro:IPR010319"
FT                   /db_xref="UniProtKB/TrEMBL:B3PYD6"
FT                   /protein_id="ACE89287.1"
FT                   /translation="MVTGNATSQPIGHYDFCQTHSSECGANRNAGPVEMTPAKWSLVRS
FT                   VNTMVNRTITPMTDKEIYGKDEVWAYPTTAGDCEDFALLKRRILIQRGISAADLLMTVV
FT                   RKPDGEGHAVLTLRTSEGDFVLDNLATDVKPWFATPYSFVKRQSSYNAGRWVTIENGRD
FT                   VLVGALR"
FT   gene            complement(308983..309813)
FT                   /locus_tag="RHECIAT_CH0000294"
FT   CDS_pept        complement(308983..309813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000294"
FT                   /product="putative hydrolase protein"
FT                   /note="ypch00111"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000294"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89288"
FT                   /db_xref="GOA:B3PYD7"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B3PYD7"
FT                   /protein_id="ACE89288.1"
FT                   /translation="MSDQMPNAQPQFLTVGEGEAAREIAMLVRPAQAGNNAPALVWLSG
FT                   YRSDMSGTKALELDGLAGELGTACIRLDYSGHGLSGGSFRDGTISRWLEEALAVIRHVA
FT                   PDRIILVGSSMGAWIALRLAQELARLDGPKLAGPKLEGMVLIAPAPDFTSELIEPNLKG
FT                   KERKSLAERGYFEERSQYSPEPNVYTLALIEDGRKNRVLDGIIETGCPVHILQGMKDPD
FT                   VPHAHAMKLVEHLPADDVVLTFIRDGDHRLSRPGDIALILGAVKGIIRTATAGQ"
FT   gene            310022..310528
FT                   /gene="infC"
FT                   /locus_tag="RHECIAT_CH0000295"
FT   CDS_pept        310022..310528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infC"
FT                   /locus_tag="RHECIAT_CH0000295"
FT                   /product="translation initiation factor IF-3 protein"
FT                   /note="GO_function: GO:0003743 - translation initiation
FT                   factor activity; GO_process: GO:0006413 - translational
FT                   initiation"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000295"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89289"
FT                   /db_xref="GOA:B3PYD8"
FT                   /db_xref="InterPro:IPR001288"
FT                   /db_xref="InterPro:IPR019814"
FT                   /db_xref="InterPro:IPR019815"
FT                   /db_xref="InterPro:IPR036787"
FT                   /db_xref="InterPro:IPR036788"
FT                   /db_xref="UniProtKB/TrEMBL:B3PYD8"
FT                   /protein_id="ACE89289.1"
FT                   /translation="MKDGPRSNREIRIPKVQLIAADGQNMGIVPTDQALRMAEEAGLDL
FT                   VEISPNAEPPVCKILDLGKLKYANQKKAAEARKKQKIVEVKEIKMRPNIDTHDYEVKMK
FT                   AMGRFFDEGDKVKVTLKFRGREMAHQELGMKLLQQVKADTTEIAKVEAEPKLEGRQMMM
FT                   VLAPK"
FT   gene            complement(310650..310838)
FT                   /locus_tag="RHECIAT_CH0000296"
FT   CDS_pept        complement(310650..310838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000296"
FT                   /product="hypothetical protein"
FT                   /note="yhch00075"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000296"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89290"
FT                   /db_xref="UniProtKB/TrEMBL:B3PYD9"
FT                   /protein_id="ACE89290.1"
FT                   /translation="MLLLLSSLRASSKKPSREVRFSGRRNKVRERLLLICGFGDEPFRK
FT                   HSKLPRHALPVSSDARL"
FT   gene            310840..311043
FT                   /gene="rpmI"
FT                   /locus_tag="RHECIAT_CH0000297"
FT   CDS_pept        310840..311043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmI"
FT                   /locus_tag="RHECIAT_CH0000297"
FT                   /product="50S ribosomal protein L35"
FT                   /note="GO_component: GO:0005622 - intracellular;
FT                   GO_component: GO:0005840 - ribosome; GO_function:
FT                   GO:0003735 - structural constituent of ribosome;
FT                   GO_process: GO:0006412 - translation"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000297"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89291"
FT                   /db_xref="GOA:B3PYE0"
FT                   /db_xref="InterPro:IPR001706"
FT                   /db_xref="InterPro:IPR018265"
FT                   /db_xref="InterPro:IPR021137"
FT                   /db_xref="InterPro:IPR037229"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3PYE0"
FT                   /protein_id="ACE89291.1"
FT                   /translation="MPKMKTKSSAKKRFKITATGKVKAAAAGKRHGMIKRTNKFIRDAR
FT                   GTMVLAEPDGRKVIKNYLPNGL"
FT   gene            311082..311486
FT                   /gene="rplT"
FT                   /locus_tag="RHECIAT_CH0000298"
FT   CDS_pept        311082..311486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplT"
FT                   /locus_tag="RHECIAT_CH0000298"
FT                   /product="50S ribosomal protein L20"
FT                   /note="GO_component: GO:0005622 - intracellular;
FT                   GO_component: GO:0005840 - ribosome; GO_function:
FT                   GO:0003723 - RNA binding; GO_function: GO:0003735 -
FT                   structural constituent of ribosome; GO_process: GO:0006412
FT                   - translation"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000298"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89292"
FT                   /db_xref="GOA:B3PYE1"
FT                   /db_xref="InterPro:IPR005813"
FT                   /db_xref="InterPro:IPR035566"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3PYE1"
FT                   /protein_id="ACE89292.1"
FT                   /translation="MARVKRGVTAHAKHKKVLKAAKGFYGRRKNTIRAAKAAVDRSKQY
FT                   AYRDRKVNKRNFRALWIQRINAAVREFGLTYGRFIDGLNKAGIEVDRKVLSDMAIHEPE
FT                   AFGALVNAAKKALEYLKETGTANEFEGAVR"
FT   gene            311634..312716
FT                   /gene="pheS"
FT                   /locus_tag="RHECIAT_CH0000299"
FT   CDS_pept        311634..312716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheS"
FT                   /locus_tag="RHECIAT_CH0000299"
FT                   /product="phenylalanyl-tRNA synthetase protein, alpha
FT                   subunit"
FT                   /EC_number="6.1.1.20"
FT                   /note="GO_function: GO:0004826 - phenylalanine-tRNA ligase
FT                   activity; GO_function: GO:0005524 - ATP binding;
FT                   GO_process: GO:0006432 - phenylalanyl-tRNA aminoacylation"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000299"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89293"
FT                   /db_xref="GOA:B3PYE2"
FT                   /db_xref="InterPro:IPR002319"
FT                   /db_xref="InterPro:IPR004188"
FT                   /db_xref="InterPro:IPR004529"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR022911"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3PYE2"
FT                   /protein_id="ACE89293.1"
FT                   /translation="MSDIDQLNSSLLAEIAATNDEPALEAVRVAALGKKGSISELLKTL
FT                   GAMTPEERQTRGAAINALKNAVTDAIAERKSVLKMAAVNARLKAETVDVSLPVRSSPAE
FT                   RGRIHPISQIVDEITAIFADMGFSIAEGPDIETDYYNFTALNFPEGHPAREMHDTFFFN
FT                   PDENGERKVLRTHTSPVQVRTMEAQKPPIRIIIPGKTYRQDSDATHSPMFHQVEGLVID
FT                   KKANVANIRWVLEEFCKTFFEVDSVTMRFRPSFFPFTEPSFEVDIQCDRSGPIVKFGEG
FT                   TDWMEILGCGMVHPNVLRYGGLDPDEYQGFAWGMGLDRIAMLKYGMPDLRDFFNADVRW
FT                   MTHYGFRPLDMPTLFGGLSA"
FT   gene            312733..315156
FT                   /gene="pheT"
FT                   /locus_tag="RHECIAT_CH0000300"
FT   CDS_pept        312733..315156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheT"
FT                   /locus_tag="RHECIAT_CH0000300"
FT                   /product="phenylalanyl-tRNA synthetase protein, beta
FT                   subunit"
FT                   /EC_number="6.1.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000300"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89294"
FT                   /db_xref="GOA:B3PYE3"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004532"
FT                   /db_xref="InterPro:IPR005121"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="InterPro:IPR005147"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR020825"
FT                   /db_xref="InterPro:IPR033714"
FT                   /db_xref="InterPro:IPR036690"
FT                   /db_xref="UniProtKB/TrEMBL:B3PYE3"
FT                   /protein_id="ACE89294.1"
FT                   /translation="MKFTLSWLKEHLETDATLDEICTRLTEIGLEVEEVDDKAAFKPFV
FT                   IARVVSAEKHPQADRLKVLMVDTGSGAPVQVVCGAPNARAGLVGAFAAPGTYVPGIDVT
FT                   LAVGNIRGVESRGMMCSEKEMQISDNHDGIIDLPDDAPVGQSYASYAHLDDPVIEINLT
FT                   PNRPDCTSIHGIARDLAASGLGTLKTRAAPSFAVEGETPVKLTLDLDDPKLCPGFSLRL
FT                   VRGVRNGPSPRWMQQRLTAIGLRPINALVDITNYMTFDQGRPMHVFDAAKVTGNLTVRR
FT                   AREGETVLALDQREYKLGPNNVVISDEDGIESIGGIMGGEHSGCDENTVDVLIESALWD
FT                   PMNIAKSGRSLGIITDARYRFERGVDPEYMVPGLERTTELVLDLCGGTPARAEVVGYKG
FT                   YEPKVVDFPYSEVRRLTGLEVSTEESNAILARLGFTVSGTGERVSVAVPSWRPDVDGKA
FT                   DLVEEVMRIHGVDNIKPAPLESHAAVNGRILTTLQIRTRAAKRALASRGMLEAVTWSFI
FT                   PEDQAKLFGGGSPALRLANPIAAEMSDMRPSLLPGLLTAAQRNADKGYGDVAIFEVSGT
FT                   YENDRPDGQRRVAGGIRRGTASLAGGGRMWSNAVKGGGKPVDVFDAKADALAVIEACGL
FT                   PMGNIQIEQGGPEWYHPGRSGTIKMGPKVVLGYFGEFHPLTLEALDVSGALCGFEVYLD
FT                   AMAEPKKKATRTKPALELSPFQAVKRDFAFVVDKTVESGAIIKAATGADRKLVTGVNVF
FT                   DIFEGASVGEGKKSVAIEVQIQPVERTLTDEDFEALTQKIVASVAKFTGGVLRS"
FT   gene            complement(315210..315569)
FT                   /locus_tag="RHECIAT_CH0000301"
FT   CDS_pept        complement(315210..315569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000301"
FT                   /product="hypothetical conserved protein"
FT                   /note="yhch00076"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000301"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89295"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR039437"
FT                   /db_xref="UniProtKB/TrEMBL:B3PYE4"
FT                   /protein_id="ACE89295.1"
FT                   /translation="MSDRQAVEQTVHLYVEGMAFANAAALKKAFHPKSSIIGYYQNAVE
FT                   WLTRDEFITAILAEEPAPPGTQPFMDIQSVDVEGDAASVKVTDDFAGMRFTDYLSLLKI
FT                   DGRWVIVSKLYHLHT"
FT   gene            complement(315660..316655)
FT                   /locus_tag="RHECIAT_CH0000302"
FT   CDS_pept        complement(315660..316655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000302"
FT                   /product="probable oxidoreductase protein, aldo/keto
FT                   reductase family"
FT                   /note="ypch00112; GO_function: GO:0016491 - oxidoreductase
FT                   activity"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000302"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89296"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:B3PYE5"
FT                   /protein_id="ACE89296.1"
FT                   /translation="MKTRKLGNDLTVSAVGLGCMGMSFAYGASDEAESIRTLNRAVDLG
FT                   VTFFDTAEVYGPFTNETLLGKALKPHRDRVVIATKFGFKIDTSQTGAAAIAGVDSRPEH
FT                   VRAVAEASLKRLGIETIDLLYQHRVDPNVPIEETVGVMAELVREGKVRALGLSEAGSAT
FT                   IRRAHAVHPIAALQSEYSLWTRDPEEDVLATCRELGIGFVPYSPLGRGFLTGAIRKADD
FT                   LAADDFRRQVPRFQAENFDANAALVATLERLAAEKGVTAAQLALAWVLSQGDDIVPIPG
FT                   ARKLHHLEQNAAAADISLSAAELRQLGEAIPAAQVAGKRYSDASLAMTNL"
FT   gene            316836..317744
FT                   /locus_tag="RHECIAT_CH0000303"
FT   CDS_pept        316836..317744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000303"
FT                   /product="probable transcriptional regulator protein, LysR
FT                   family"
FT                   /EC_number="4.2.1.1"
FT                   /note="ypch00113"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000303"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89297"
FT                   /db_xref="GOA:B3PYE6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B3PYE6"
FT                   /protein_id="ACE89297.1"
FT                   /translation="MNRTQLSQLAVLAAVSEHRSFRAAARELLVAPSAISHAISSLEES
FT                   LGVRLLARTTRSVAPTEEGRLLLERLRPALEEIDIALEAVRDTRAKPAGNLRITAPRFA
FT                   SDILLAPRLGDFLNLYPDITLEIANEDGFTDIVKEGFDAGLRLEESLEADMIAVRFSPN
FT                   LTTVIAASPDYFERHPKPEHPRDLVHHRCIKRRFTNGSIYRWEFEKDGQELVVAVDGPL
FT                   IVSEDRLALLAALNGAGLAYLFDIRVHAELAAGKLVRVLEDWCAPYPGPFLYYPTRRQM
FT                   RPALRAFIDFFRYVERDAGGR"
FT   gene            complement(317771..318268)
FT                   /locus_tag="RHECIAT_CH0000304"
FT   CDS_pept        complement(317771..318268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000304"
FT                   /product="hypothetical conserved protein"
FT                   /note="yhch00077"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000304"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89298"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR010287"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:B3PYE7"
FT                   /protein_id="ACE89298.1"
FT                   /translation="MAKEKTLEDLFYDTLKDIYFAERQILRALPKMARAAQSSELKAGF
FT                   QKHLEETEGQVERLQQVFEKIGKRAQGKTCEAIQGIIAEGEDIMEEFKGTPALDAGLIS
FT                   AAQAVEHYEIARYGTLKTWAATLGLKDIVSLLDQTLQEETATDKTLSQLATTAANQKAK
FT                   AA"
FT   gene            318414..319031
FT                   /locus_tag="RHECIAT_CH0000305"
FT   CDS_pept        318414..319031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000305"
FT                   /product="hypothetical conserved protein"
FT                   /note="yhch00078"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000305"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89299"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="UniProtKB/TrEMBL:B3PYE8"
FT                   /protein_id="ACE89299.1"
FT                   /translation="MRKPGSMKGLEDLGRVRLSRNFFFRDFLHSEIADFYRIPNIPEDP
FT                   DLAIEAGKRLCEDLLEPLEATFGRLHIRSGYRSPDVNRFGNENKLNCSTNAATSAHHIW
FT                   DMRDFDGCMGAAVCIAVPWMIDRYRDESDWQRLAWWIHDHLPYASLCFFPKLWAFNIQW
FT                   HERPKRIIQSYVSPRGILTKPGMTNWAGNHGAFYEGFPRLRS"
FT   gene            complement(319021..319464)
FT                   /locus_tag="RHECIAT_CH0000306"
FT   CDS_pept        complement(319021..319464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000306"
FT                   /product="putative acetyltransferase protein"
FT                   /note="ypch00114; GO_function: GO:0008080 -
FT                   N-acetyltransferase activity; GO_process: GO:0008152 -
FT                   metabolic process"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000306"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89300"
FT                   /db_xref="GOA:B3PYE9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR032962"
FT                   /db_xref="UniProtKB/TrEMBL:B3PYE9"
FT                   /protein_id="ACE89300.1"
FT                   /translation="MTVTIRDARPEDEAGWRQLWAAYLDFYDVTVEADITDQTWRRIFD
FT                   PASAIAMCVAEIDGRIIGFALYLTHEGTWIRGRDCYLEDLFVDADARGKGVGRALMDDL
FT                   VALGKAEGWSRLYLHTSENNKTARALYDSYVESDGHIRYRISF"
FT   gene            complement(319461..320423)
FT                   /locus_tag="RHECIAT_CH0000307"
FT   CDS_pept        complement(319461..320423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000307"
FT                   /product="putative oxidoreductase protein"
FT                   /note="ypch00115; GO_function: GO:0016491 - oxidoreductase
FT                   activity"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000307"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89301"
FT                   /db_xref="GOA:B3PYF0"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:B3PYF0"
FT                   /protein_id="ACE89301.1"
FT                   /translation="MEMRRLGKTGLSVAPIVIGGNVFGWTADEKTSFAILDAFFDAGLN
FT                   AIDTADVYSAWVPGNKGGDSEEIIGRWLKQSAVSRDKAVIITKVGSDMGQGKTLKAGYI
FT                   LKAVEASLSRLQTDYIDLYLSHWPDADTPHEETLGAFAKLKQQGKIRAIGCSNYDATLL
FT                   QASFDAAEKAALPRYDVLQPEYNLCERASFEGPLAELCVEEDLGVITYFSLAAGFLTGK
FT                   YRSKADTAGRAREGRVSRYLDAKGLRVLAALDKVSAETGAKPAEISLAWLLRKKGVTAP
FT                   IASATRLSQLESLAKAATLSLSDEAMALLDEAGAEGTEP"
FT   gene            320659..321645
FT                   /locus_tag="RHECIAT_CH0000308"
FT   CDS_pept        320659..321645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000308"
FT                   /product="probable oxidoreductase protein"
FT                   /note="ypch00116; GO_function: GO:0016491 - oxidoreductase
FT                   activity"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000308"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89302"
FT                   /db_xref="GOA:B3PYF1"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B3PYF1"
FT                   /protein_id="ACE89302.1"
FT                   /translation="MLRFGIISTAKIGRDNVVPAIQDAENCVVTAIASRDLGRAREMAD
FT                   RFSVPHAFGSYEEMLASDVIDAVYIPLPTSQHIEWSIKAADAGKHVLCEKPLALKAGEI
FT                   DAVIAARDRNRVVVTEAYMITYSPVWQKVRSLIDEGAIGSLRHVQGAFTYFNRDAANMR
FT                   NIPELGGGGLPDIGVYPVMSTRFSTGKEPLRIQAITERDPDFGTDIYSSVKADFADFEL
FT                   SFYVSTQMANRQIMVFHGTDGYIEVKSPFNANRWGPEEIELADRSHNESRIFRFQDSRQ
FT                   YRREVEAFARAVENGKEEIVTLENSKLNQKVIDAIYRASEKDGWEAV"
FT   gene            complement(321649..322023)
FT                   /locus_tag="RHECIAT_CH0000309"
FT   CDS_pept        complement(321649..322023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000309"
FT                   /product="hypothetical conserved membrane protein"
FT                   /note="yhch00079; GO_component: GO:0016021 - integral to
FT                   membrane; GO_process: GO:0000271 - polysaccharide
FT                   biosynthetic process; GO_process: GO:0006810 - transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000309"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89303"
FT                   /db_xref="GOA:B3PYF2"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="UniProtKB/TrEMBL:B3PYF2"
FT                   /protein_id="ACE89303.1"
FT                   /translation="MKKLIRFAIAGGIGFLVDAGVLSALLSLTPLGPFVARLIAIALAM
FT                   ASTWVFNRNFTFDRSGRSLAAEGFRYGSVGITAALVNYGLYSALLLSLPGLQPLAAMVV
FT                   ASIAAMVFSFFGYSRLVFRA"
FT   gene            complement(322020..323027)
FT                   /locus_tag="RHECIAT_CH0000310"
FT   CDS_pept        complement(322020..323027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000310"
FT                   /product="probable glycosyltransferase protein"
FT                   /EC_number="2.4.1.83"
FT                   /note="ypch00117"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000310"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89304"
FT                   /db_xref="GOA:B3PYF3"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B3PYF3"
FT                   /protein_id="ACE89304.1"
FT                   /translation="MAQSRRGNPEIAVLLPCYNEAATIGSVVRGFRATLPEAAIHVYDN
FT                   NSTDGTALQAMLAGAHVVRERRQGKGHVVRRMFADIEADIYIIADGDGTYAPGDAEELV
FT                   RTLLTERADMVVGTRRGVHADAGRQGHALGNRLFNLLYRTIFGPDFTDIFSGYRAFSRR
FT                   FVKSFPAVSGGFEIETEMSVHASRLKLPVSELELDYGRRPEGSHSKLSTFRDGGKILWM
FT                   FAMLMKETRPFAFFSAISTAFMLASLGFMTPVLAEYFATGLVSRMPTWVLSMALMMISF
FT                   MLFTAGVILDSVARARAEQLRIHYMSLETPSAAKLPDREPAPTSRPGRGKADAA"
FT   gene            323186..325033
FT                   /locus_tag="RHECIAT_CH0000311"
FT   CDS_pept        323186..325033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000311"
FT                   /product="hypothetical conserved protein"
FT                   /note="yhch00080"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000311"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89305"
FT                   /db_xref="GOA:B3PYF4"
FT                   /db_xref="UniProtKB/TrEMBL:B3PYF4"
FT                   /protein_id="ACE89305.1"
FT                   /translation="MNAVQPITNASSATDITSGGVRGLLMRLWPTVIAYCLILAAVIVV
FT                   TRLHGAIDYVGPDNDDGMRLVEVRDFLAGQGWFDLMQYRLGLNGGTLMHWSRLIDLPIA
FT                   SLIWFLGLFVPRETAEALALGIWPVSLILPAMLAMAVAGRRIGGVAGMHISLGLTALAI
FT                   YTGNRFAPGAIDHHNAQLALVATMTAMLLDPKRRGWSYAVAGIAAAIAIAIGAETTPFV
FT                   AAVCLTVAVLWAWEGKDFAVAAQSFGLALAMTISILFFATVPPRLYSMVTCDNLSLGYY
FT                   SLAAIGGGLLLFCAVFASGLARPLRFAALAVVGAGVLGSAVVIAPQCLSDPLAGLDPML
FT                   VELWLRNVSEAKSIFALARSEPFDIGAFYAAGLFGIAVCIFRIVQRDRVQIHLVLLFLL
FT                   AISWAIALVQVRGSTFSNLISILPLALLIIDIRRISNSDSENIAVALVYVVTVLAGVPA
FT                   AWGLSGGLVSLQMENEAQKKASDPAKEKACASREALAPLAGLPVGLVSAPSEMGVAILR
FT                   FTQNRVLSAPYHRNQGGMLTELHIGMAEPQEAEAFLKGAGVTTLAFCPSDPQTRQLAKL
FT                   KPDGLYAQLGKGNIPAYLEPLPKAADAAVQFFRYRPAAN"
FT   gene            complement(325062..325358)
FT                   /locus_tag="RHECIAT_CH0000312"
FT   CDS_pept        complement(325062..325358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000312"
FT                   /product="hypothetical protein"
FT                   /note="yhch00081"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000312"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89306"
FT                   /db_xref="GOA:B3PYF5"
FT                   /db_xref="UniProtKB/TrEMBL:B3PYF5"
FT                   /protein_id="ACE89306.1"
FT                   /translation="MLGGATYASPRSLREGAEMIILTAAALGITAGQTRSAGAIALIAA
FT                   LIGITFALAAVCSPGPVSLLAFLYAVLGYNGGLILFVLGLYASARFRAPRVSH"
FT   gene            325591..327171
FT                   /gene="xseA"
FT                   /locus_tag="RHECIAT_CH0000313"
FT   CDS_pept        325591..327171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xseA"
FT                   /locus_tag="RHECIAT_CH0000313"
FT                   /product="exodeoxyribonuclease VII protein, large subunit"
FT                   /EC_number="3.1.11.6"
FT                   /note="GO_component: GO:0009318 - exodeoxyribonuclease VII
FT                   complex; GO_function: GO:0008855 - exodeoxyribonuclease VII
FT                   activity; GO_process: GO:0006308 - DNA catabolic process"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000313"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89307"
FT                   /db_xref="GOA:B3PYF6"
FT                   /db_xref="InterPro:IPR003753"
FT                   /db_xref="InterPro:IPR020579"
FT                   /db_xref="InterPro:IPR025824"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3PYF6"
FT                   /protein_id="ACE89307.1"
FT                   /translation="MSNLFDSDSPTNLAEYSVSELSGSIKRTVETAFDQVRVRGEISGY
FT                   RGPHSSGHAYFALKDDRARIDAVIWKGTFSRLKFRPEEGMEVIATGKVTTFPGSSKYQI
FT                   VIETLEPAGAGALMALIEERKRKLGAEGLFDAARKKRLPFMPKVIGVVTSPTGAVIRDI
FT                   LHRISDRFPVHVLVWPVKVQGEGAGDEVANAIRGFNALEPGGAIARPDVLIVARGGGSL
FT                   EDLWSFNDEIVVRAAAESRIPLISAVGHETDWTLIDYAADVRAPTPTGAAEMAVPVKAE
FT                   LEAQATALAARLQGCINRQMDQRRQSVRALMRALPSLDQLLALPRRRFDEAAAGLGRGL
FT                   ELNTINKRRGFERVASHLRPDVLSNRIAERRQLLNDRMARAERTVERLLDRSKSRIDRA
FT                   EAILASLPTRLKTQTDRGRERLGNLTRHADTAIRHQLTRARAELSAQDRVLQSLSYKNV
FT                   LKRGYAVIRDEDDRPVSQAAALSAGMGIAIEFADGRVGAMTTEGGTPPAGAKKRSAKPA
FT                   DPTKQGSLF"
FT   gene            327174..327764
FT                   /locus_tag="RHECIAT_CH0000314"
FT   CDS_pept        327174..327764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000314"
FT                   /product="probable NAD(P)H dehydrogenase (quinone) protein"
FT                   /EC_number="1.6.99.-"
FT                   /note="ypch00118; GO_function: GO:0016491 - oxidoreductase
FT                   activity; GO_function: GO:0050662 - coenzyme binding;
FT                   GO_process: GO:0006118 - electron transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000314"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89308"
FT                   /db_xref="GOA:B3PYF7"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:B3PYF7"
FT                   /protein_id="ACE89308.1"
FT                   /translation="MRILLVLAHPLPDSFAASVARTAREALETSGHVVDLLDLYAEDFD
FT                   PRLSEAERRAYFDVPYDTSAVADAVARLRSADGLILVFPQWWFNFPAILKGFFDRVFAP
FT                   GVAFTHDAAGGRIVPELTNIRLLYALTTTGSPWWVVHLYMGNPVRRLLKRGIANFCSKK
FT                   LAFRMLSLHDMDRATEARRKVHLERVRKALAAV"
FT   gene            complement(327765..328262)
FT                   /locus_tag="RHECIAT_CH0000315"
FT   CDS_pept        complement(327765..328262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000315"
FT                   /product="probable transcriptional regulator protein, MarR
FT                   family"
FT                   /note="ypch00119; GO_component: GO:0005622 - intracellular;
FT                   GO_function: GO:0003700 - transcription factor activity;
FT                   GO_process: GO:0006355 - regulation of transcription,
FT                   DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000315"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89309"
FT                   /db_xref="GOA:B3PYF8"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B3PYF8"
FT                   /protein_id="ACE89309.1"
FT                   /translation="MVEEKQDHVDRILAQWRRERPDLDVEPMGILGRLKRLGTHLGREV
FT                   ETVLMKHGLSTSAFDVLATLRRSGAPYRLSPGELLEMTMVSSGTMTNRIDQLEKSGFVE
FT                   RILNREDRRSVLIALTEKGLATVEEAVGAHVANQHRLTRNLTTEDKAAFDRLLKKLLSD
FT                   FE"
FT   gene            328346..329257
FT                   /locus_tag="RHECIAT_CH0000316"
FT   CDS_pept        328346..329257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000316"
FT                   /product="putative transporter, permease protein"
FT                   /note="ypch00120; GO_component: GO:0016020 - membrane"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000316"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89310"
FT                   /db_xref="GOA:B3PYF9"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B3PYF9"
FT                   /protein_id="ACE89310.1"
FT                   /translation="MKTNSRYLADVLITAVAPAIWGSTYFVTTSFLPHGYPLTSAMLRA
FT                   LPAGLLLLLIVRKLPTGVWWGRAFILGALNFSFFWAMLFVSAYRLPGGVAATVGAVQPL
FT                   IVIALSRLFLGKPIRFLAVIAGLIGMSGVALLVLTPNAALDPVGIAAGLAGAVSMAFGT
FT                   VLTRHWQPPVSSLTFTSWQLTAGGILLVPVAFLLEPALPAPTPANMLGIAYLGLIGAAF
FT                   TYLLWFRGLSRIEPSAAASLGFLSPVVATLLGWLALGQSLSPAQIAGFAMVLASVWLSQ
FT                   RTMMPVRPTRPAASREPASHPA"
FT   gene            complement(329205..330458)
FT                   /locus_tag="RHECIAT_CH0000317"
FT   CDS_pept        complement(329205..330458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000317"
FT                   /product="probable aminopeptidase protein"
FT                   /EC_number="3.4.11.-"
FT                   /note="ypch00121; GO_function: GO:0004177 - aminopeptidase
FT                   activity; GO_process: GO:0006508 - proteolysis"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000317"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89311"
FT                   /db_xref="GOA:B3PYG0"
FT                   /db_xref="InterPro:IPR000787"
FT                   /db_xref="InterPro:IPR035097"
FT                   /db_xref="UniProtKB/TrEMBL:B3PYG0"
FT                   /protein_id="ACE89311.1"
FT                   /translation="MTFMPQSQNTVDPVKLEKLAEVAVKVGLRLQKGQDLVITAPVVAL
FT                   PLVRLITKHAYLAGAGLVSAFYSDEETTLSRYQYGSDESFDRASDWLYEGMAKAYANGA
FT                   ARLAVAGDNPLLLSEQDAGKVGRANRANSTAYKPALEKIANFDINWNIVSYPNPSWARV
FT                   VFSDDPEPIAIAKLAKAIFAASRVDLDDPIAAWAEHNANLSKRSAWLNGERFASLHFKG
FT                   PGTDLTVGLADGHEWHGGASTAKNGITCNPNIPTEEVFTTPHALRVEGHVSSTKPLSHQ
FT                   GTLIDNIQVRFEGGRIVEAKASRGEEVLNKVLDTDEGARRLGEVALVPHSSPISASGIL
FT                   FYNTLFDENASCHIALGQCYSKCFLDGANLSLEQIKAQGGNSSLIHIDWMIGSDKVDID
FT                   GVTPDGSRVPVMRQGEWA"
FT   gene            complement(330589..331272)
FT                   /gene="gstch1"
FT                   /locus_tag="RHECIAT_CH0000318"
FT   CDS_pept        complement(330589..331272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gstch1"
FT                   /locus_tag="RHECIAT_CH0000318"
FT                   /product="glutathione S-transferase protein"
FT                   /EC_number="2.5.1.18"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000318"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89312"
FT                   /db_xref="GOA:B3PYG1"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:B3PYG1"
FT                   /protein_id="ACE89312.1"
FT                   /translation="MSKLTLISHHLCPYVQRAAIALFEKNVPFERITIDLANKPDWFLE
FT                   ISPLGKVPLLRIEQADGSETVLFESSVICEYLEETQAGAALHPADPLTRARHRGWMEFG
FT                   SSVLSDLWGYETAEDRLQLDVKRAALIAKFTTIEGALADGPYFSGSSFSLVDAVFAPVF
FT                   RYFDLFDTLGDSGIFDGLERVRRWRKALAERASAKSAVGEDYPQRLMQFLKTHNSILLR
FT                   PSVAA"
FT   gene            331383..331826
FT                   /locus_tag="RHECIAT_CH0000319"
FT   CDS_pept        331383..331826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000319"
FT                   /product="putative transcriptional regulator protein, MarR
FT                   family"
FT                   /note="ypch00122; GO_component: GO:0005622 - intracellular;
FT                   GO_function: GO:0003700 - transcription factor activity;
FT                   GO_process: GO:0006355 - regulation of transcription,
FT                   DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000319"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89313"
FT                   /db_xref="GOA:B3PYG2"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B3PYG2"
FT                   /protein_id="ACE89313.1"
FT                   /translation="MSEKPPTPSNAVTGAWIHIMRARDRLLAAIESDFKAAKMPPLSWY
FT                   DVLWELARSEDKRLRPYEIEERTLLAQYNLSRLVDRLEREGLVLRETFDEDARGRWVVI
FT                   TDAGLQLRERMWTVYAKSIEANIGCRLSESEANSISALLARFL"
FT   gene            complement(331827..332300)
FT                   /locus_tag="RHECIAT_CH0000320"
FT   CDS_pept        complement(331827..332300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000320"
FT                   /product="hypothetical conserved protein"
FT                   /note="yhch00082"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000320"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89314"
FT                   /db_xref="GOA:B3PYG3"
FT                   /db_xref="InterPro:IPR004369"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:B3PYG3"
FT                   /protein_id="ACE89314.1"
FT                   /translation="MSKTTRATQVLSQAGIAFTIHTYDYDPGAERVGLQAAEALGEAPH
FT                   RVLKTLMAEVDGKPVCVVVPSDREVSMKKLASAFGGKSANMMKPADAERLTGYHVGGIS
FT                   PFGQKKTVPTAIEEAALAEPLVYLNGGQRGLQVRLAPKDALAVLKAVRAPLIA"
FT   gene            complement(332311..332661)
FT                   /locus_tag="RHECIAT_CH0000321"
FT   CDS_pept        complement(332311..332661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000321"
FT                   /product="probable arsenate reductase protein"
FT                   /note="ypch00123; GO_function: GO:0016491 - oxidoreductase
FT                   activity; GO_process: GO:0006118 - electron transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000321"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89315"
FT                   /db_xref="InterPro:IPR006504"
FT                   /db_xref="InterPro:IPR006660"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B3PYG4"
FT                   /protein_id="ACE89315.1"
FT                   /translation="MAVTIYGIKNCDTMKKARSWLEEHEVAYQFHDYKALGIDRARLEA
FT                   WIDQAGLDTVLNRAGTTFRKLPDAERENLTRERAIALMREQPSMIKRPILEAGGKLLIG
FT                   FKPEIYAGTFDG"
FT   gene            complement(332752..333813)
FT                   /locus_tag="RHECIAT_CH0000322"
FT   CDS_pept        complement(332752..333813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000322"
FT                   /product="putative arginine catabolism protein"
FT                   /note="ypch00124; GO_function: GO:0016788 - hydrolase
FT                   activity, acting on ester bonds; GO_process: GO:0008152 -
FT                   metabolic process"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000322"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89316"
FT                   /db_xref="GOA:B3PYG5"
FT                   /db_xref="InterPro:IPR007036"
FT                   /db_xref="UniProtKB/TrEMBL:B3PYG5"
FT                   /protein_id="ACE89316.1"
FT                   /translation="MDVSEIIIPGDTPGTQWRLPVLRFAGRDPKAPNIYIQAALHAGEL
FT                   PGTALLHFLCERLRQAEDQGGILGDITIVPQANPIGAAQSHFGDLQGRFDLGSRTNFNR
FT                   DFPLISIADRMMLIDDLDDYPATDRLKRQLLHMALGADLVLDLHCDDESLQYAYIDEAF
FT                   WPEAADLAAALDMEAVLLSDGESSAFEEAVGFAWKYEIPGERQSRLPGKLSVTVELRGK
FT                   RDVDPVLAKQDAEGLWRFLATRGIVRDEAVTTAAFSGPAVPLDNVEIIRAPEGGAVLFH
FT                   RTIGDRVAEGEFLATIVTRPGQPDGSIDLHAPQDGLVLTRTSDRLVRRRGDLMKIVGAK
FT                   PSKTERKAGTLES"
FT   gene            334184..334747
FT                   /locus_tag="RHECIAT_CH0000323"
FT   CDS_pept        334184..334747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000323"
FT                   /product="probable methylated-DNA-[protein]-cysteine
FT                   S-methyltransferase protein"
FT                   /EC_number="2.1.1.63"
FT                   /note="ypch00125"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000323"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89317"
FT                   /db_xref="GOA:B3PYG6"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:B3PYG6"
FT                   /protein_id="ACE89317.1"
FT                   /translation="MAQTIHHYCIFETAGGFCGIAWSDAGIARFQLPTKTAEATERLLL
FT                   RRLPDGEAGVPTPDVLATVAAVKRYFQGEETDFSGVELDLAGQDGFFREIYAAARRVGW
FT                   GHTTTYGALAKELGAGPEAAREVGQAMAKNPVALIIPCHRVLAAGGKIGGFSAPGGSSS
FT                   KTRMLELEGVNLAPPPPAQQSLGF"
FT   gene            complement(334782..335516)
FT                   /locus_tag="RHECIAT_CH0000324"
FT   CDS_pept        complement(334782..335516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000324"
FT                   /product="putative short-chain dehydrogenase/oxidoreductase
FT                   protein"
FT                   /note="ypch00126; GO_function: GO:0016491 - oxidoreductase
FT                   activity; GO_process: GO:0008152 - metabolic process"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000324"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89318"
FT                   /db_xref="GOA:B3PYG7"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B3PYG7"
FT                   /protein_id="ACE89318.1"
FT                   /translation="MSNIEGKVIAITGASSGIGEAAAKVLAAAGAHIVIGARRTERLER
FT                   LAGEIEARGGTVRLRKLDVTDRSEVEAFAGFARSEFGRLDVIVNNAGVMPLSPLAALKV
FT                   EEWDRMVDVNIKGVLYGIAAALPIMKAQGSGQIINLSSIGGHSVSPTAAVYCATKFAVR
FT                   AISDGLRQETDRIRVTVISPGTTTSELADTITDPTAREAMTAFRAVTISPEAVAHSILY
FT                   AVSQPEDVDVSEIIIRPTASPH"
FT   gene            335540..335719
FT                   /locus_tag="RHECIAT_CH0000325"
FT   CDS_pept        335540..335719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000325"
FT                   /product="hypothetical protein"
FT                   /note="yhch00083"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000325"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89319"
FT                   /db_xref="UniProtKB/TrEMBL:B3PYG8"
FT                   /protein_id="ACE89319.1"
FT                   /translation="MFSGARLSRGNRAERYLRPSVEICPQRSARPRPDDAPVMNQMGVV
FT                   RDMIVILSGRIRPY"
FT   gene            complement(335729..336079)
FT                   /locus_tag="RHECIAT_CH0000326"
FT   CDS_pept        complement(335729..336079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000326"
FT                   /product="hypothetical conserved protein"
FT                   /note="yhch00084"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000326"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89320"
FT                   /db_xref="InterPro:IPR020955"
FT                   /db_xref="InterPro:IPR038646"
FT                   /db_xref="UniProtKB/TrEMBL:B3PYG9"
FT                   /protein_id="ACE89320.1"
FT                   /translation="MVRKSNQAIADWQLNRRHRPHYVQSRQRSVNKQARTRMQDHPYVG
FT                   MWVTDDGEVRHQLLPNGRYDEARGNRESPYRGRYEVTGSHIEYRDDTGFTADGDFVDAN
FT                   TLHHGGMVLRRI"
FT   gene            336079..337047
FT                   /locus_tag="RHECIAT_CH0000327"
FT   CDS_pept        336079..337047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000327"
FT                   /product="probable transcriptional regulator protein, LysR
FT                   family"
FT                   /note="ypch00127"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000327"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89321"
FT                   /db_xref="GOA:B3PYH0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B3PYH0"
FT                   /protein_id="ACE89321.1"
FT                   /translation="MVDDLEGISVFLAVAEARSFRLAGERLGVTRSAVSQALQRLEDRL
FT                   GVALVQRTTRSVSLTEAGEVFFAAVRPSVRQVRDAMQTVRDMQARPSGLLRITVSSIAE
FT                   SFLSGTLLAGFMQACPEIKLDITVTDDEFDIVETGFDAAVRLGEVIEQDMIAVSVSEPQ
FT                   RQCATASTAYLERHGGPRHPGELRNHACIGWRPRPDTAPYRWEFTENNRDFDVAVDPAV
FT                   TTNDMGMMIRLACAGAGITFGMVETFQPYFDRGELVPLLEDFCPPFPGFYLYYPRRERQ
FT                   PLKLRALVEHIKRSGKRSDPSPRRIFTKQIRRLPTGRCAPY"
FT   gene            337098..337949
FT                   /locus_tag="RHECIAT_CH0000328"
FT   CDS_pept        337098..337949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000328"
FT                   /product="probable transcriptional regulator protein, AraC
FT                   family"
FT                   /note="ypch00128; GO_component: GO:0005622 - intracellular;
FT                   GO_function: GO:0003700 - transcription factor activity;
FT                   GO_function: GO:0043565 - sequence-specific DNA binding;
FT                   GO_process: GO:0006355 - regulation of transcription,
FT                   DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000328"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89322"
FT                   /db_xref="GOA:B3PYH1"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:B3PYH1"
FT                   /protein_id="ACE89322.1"
FT                   /translation="MLDDVFRIPTRALIRQGGRACFFRLVNTSPLLIQVQSGTKIVMAD
FT                   DKALRLEAGAYALLPDYRPLTMENIPKAPQKYQTLALPVARQLFEDAYIAMGSIAVPSR
FT                   PLPASASNLPEEAAALFDYCCQPGNLTRLPGAIAKARLMELITWFALCGAVLGQCESPR
FT                   LEDRLRQMIESDTAFDWTLRHAARAFNMSEATLRRKLAAENTGFSEILSDTRMNRALAL
FT                   VQTTTLPMAQVALEVGYDSPSQFSARFKERFGVNPRHVRNGSEHLERIGVEVEHSGADA
FT                   LP"
FT   gene            337991..338536
FT                   /locus_tag="RHECIAT_CH0000329"
FT   CDS_pept        337991..338536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000329"
FT                   /product="putative phosphatidylethanolamine-binding
FT                   protein"
FT                   /note="ypch00129"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000329"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89323"
FT                   /db_xref="InterPro:IPR005247"
FT                   /db_xref="InterPro:IPR008914"
FT                   /db_xref="InterPro:IPR036610"
FT                   /db_xref="UniProtKB/TrEMBL:B3PYH2"
FT                   /protein_id="ACE89323.1"
FT                   /translation="MRLLTAAFLAASVFGATAAQAEMKLTSKDLTSGKTMADAQVFNSF
FT                   GCTGKNISPELTWSGAPQGTKSFAVMVYDPDAPTGSGWWHWSVFNLPADASKIATGASG
FT                   DKKLPAGAVEGRTDFGTSGYGGACPPVGDAPHHYQFTVYALSVDKLPLPETAPGAMVGY
FT                   YVRANTLDKASIEVTYGR"
FT   gene            complement(338622..339092)
FT                   /locus_tag="RHECIAT_CH0000330"
FT   CDS_pept        complement(338622..339092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000330"
FT                   /product="putative acetyltransferase protein"
FT                   /note="ypch00130; GO_function: GO:0008080 -
FT                   N-acetyltransferase activity; GO_process: GO:0008152 -
FT                   metabolic process"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000330"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89324"
FT                   /db_xref="GOA:B3PYH3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B3PYH3"
FT                   /protein_id="ACE89324.1"
FT                   /translation="MIIELTPIDFDALLKGSAPLDLRLVPDSAIAPPEVLEMLSRLAAD
FT                   IGAAFSPSAWMIVEEDEIVGLCSIVRMPRDGNIRIGYGIAPSRQGRGCTTRAIGQLLAW
FT                   GRSDPRVARLSAETGIGNIASQRVLERNGFIRTGERIDAEDGPLICWEAVTG"
FT   gene            complement(339312..339842)
FT                   /locus_tag="RHECIAT_CH0000331"
FT   CDS_pept        complement(339312..339842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000331"
FT                   /product="putative riboflavin biosynthesis reductase
FT                   protein"
FT                   /note="ypch00131; GO_function: GO:0008703 -
FT                   5-amino-6-(5-phosphoribosylamino)uracil reductase activity;
FT                   GO_process: GO:0009231 - riboflavin biosynthetic process"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000331"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89325"
FT                   /db_xref="GOA:B3PYH4"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:B3PYH4"
FT                   /protein_id="ACE89325.1"
FT                   /translation="MAKLVFGMNQSLDGYVDHMAFGPSPTLFRHFVESTRRQAGSVYGR
FT                   QMYEIMRYWDDDHPEWNADERDFAAAWRNQPKWVVSRSLKSVGPNASLVEGDLESAIRK
FT                   LKAEGHGEIEAAGPDLARSLTDLGLIDEYIIYLHPVVLGHGKPYFTGPRPPLRLIANDR
FT                   IDENVIRLVYVPA"
FT   gene            complement(340020..340238)
FT                   /locus_tag="RHECIAT_CH0000332"
FT   CDS_pept        complement(340020..340238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000332"
FT                   /product="hypothetical protein"
FT                   /note="yhch00085"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000332"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89326"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:B3PYH5"
FT                   /protein_id="ACE89326.1"
FT                   /translation="MLQRLARRCMDAAFRDDVDAEYIRLKDKVDLVHAPKLMPWGNRSV
FT                   QFRDPEGTLVALFMPFTDPAKKRFASR"
FT   gene            340265..340564
FT                   /locus_tag="RHECIAT_CH0000333"
FT   CDS_pept        340265..340564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000333"
FT                   /product="hypothetical protein"
FT                   /note="yhch00086"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000333"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89327"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="UniProtKB/TrEMBL:B3PYH6"
FT                   /protein_id="ACE89327.1"
FT                   /translation="MADSNELRRAIREDRKLRLLYRSDTGEETERIVWPIILGYGEATR
FT                   LIVAWCELRQDFRHFRTDRMIEIEVLEATNGLRKGDLRRRWERWREEQRSRSGH"
FT   gene            complement(340619..342181)
FT                   /gene="guaA1"
FT                   /locus_tag="RHECIAT_CH0000334"
FT   CDS_pept        complement(340619..342181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaA1"
FT                   /locus_tag="RHECIAT_CH0000334"
FT                   /product="GMP synthase (glutamine-hydrolyzing) protein"
FT                   /EC_number="6.3.5.2"
FT                   /note="GO_function: GO:0003922 - GMP synthase
FT                   (glutamine-hydrolyzing) activity; GO_function: GO:0005524 -
FT                   ATP binding; GO_process: GO:0006164 - purine nucleotide
FT                   biosynthetic process; GO_process: GO:0006177 - GMP
FT                   biosynthetic process"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000334"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89328"
FT                   /db_xref="GOA:B3PYH7"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR022955"
FT                   /db_xref="InterPro:IPR025777"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3PYH7"
FT                   /protein_id="ACE89328.1"
FT                   /translation="MTHTAHPDSVLIVDFGSQVTQLIARRVREAGVYCEIVPFQSAEEG
FT                   FKRLQPKAVILSGSPASTVDEGSPRAPQIIFDSGLPVFGICYGQQTMCMQLGGKVESGH
FT                   HREFGRAFLDVDKDCQLFEGLWSSGSRHQVWMSHGDRVTALPDGFEVVATSSNAPFAFI
FT                   ADEKRKYYGVQFHPEVVHTPDGAKLIGNFIHNIAGIKGDWSMSAYRQKAVDEIRKQVGD
FT                   KRVICALSGGVDSSVAALLIHEAVGDQLTCILVDHGLMRKDEAANVVAMFREHYNLHLL
FT                   HVDASDRFIGELEGVSDPETKRKIIGRLFIETFEEEAKKLGGADFLGQGTLYPDVIESV
FT                   SFTGGPSVTIKSHHNVGGLPERMKMQLVEPLRELFKDEVRALGRELGLPDSFIGRHPFP
FT                   GPGLAIRCPGGISREKLEILREADAIYLDEIRKAGLYDAIWQAFAVLLPVQTVGVMGDG
FT                   RTYEFVCALRAVTSVDGMTADFYHYDMEFLGRAATRIINEVRGINRVVYDVTSKPPGTI
FT                   EWE"
FT   gene            complement(342297..342935)
FT                   /gene="pfs"
FT                   /locus_tag="RHECIAT_CH0000335"
FT   CDS_pept        complement(342297..342935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pfs"
FT                   /locus_tag="RHECIAT_CH0000335"
FT                   /product="methylthioadenosine
FT                   nucleosidase/adenosylhomocysteine nucleosidase protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000335"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89329"
FT                   /db_xref="GOA:B3PYH8"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010050"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:B3PYH8"
FT                   /protein_id="ACE89329.1"
FT                   /translation="MKFELKSVAGKSMLFVMAAEAEYGPFLRSRIEPLMTGVGPVEAAV
FT                   ALTKTLARLDAADDLPDLVVSLGSAGSAKLEQTEIYQVTSVSYRDMDASPLGFEKGRTP
FT                   FLDLPATLELPLRIPGIAEASLSTGGNVISGAAYGDIDADMVDMETYAVLRACQGYKLP
FT                   LIGLRGISDGAVELQHISGWTEYLHIVDRKLSYGVDGLFTALEDGVFWF"
FT   gene            complement(342932..343441)
FT                   /locus_tag="RHECIAT_CH0000336"
FT   CDS_pept        complement(342932..343441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000336"
FT                   /product="putative phenylacetic acid degradation protein"
FT                   /note="ypch00132; GO_function: GO:0003824 - catalytic
FT                   activity"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000336"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89330"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B3PYH9"
FT                   /protein_id="ACE89330.1"
FT                   /translation="MSSLSNPARHATFPASRGVAMSETDRGDFRARIRRNFARQAAMQT
FT                   IGAELTRVEHGVVEIELPFDLKLTQQHGILHAGIISAALDSACGFAAYSVIDPEASILT
FT                   IEFKVNLMSPGRGERFLFRGEITKPGSTIIVADGRGYAISDGPAKLIASMTGTMMVIRG
FT                   REGITG"
FT   gene            343615..344691
FT                   /locus_tag="RHECIAT_CH0000337"
FT   CDS_pept        343615..344691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000337"
FT                   /product="hypothetical conserved protein"
FT                   /note="yhch00087"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000337"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89331"
FT                   /db_xref="InterPro:IPR018721"
FT                   /db_xref="UniProtKB/TrEMBL:B3PYI0"
FT                   /protein_id="ACE89331.1"
FT                   /translation="MTTISQSVRNFETWLAGELGGDLVKDDLLEKHERMRSDDFVFLRA
FT                   TYWRWCEIILDICPELGRAPEVLAIGDTHLENFGTWRDSEGRLVWGVNDFDDAAVMPYA
FT                   LDLVRLAASASLARGEDGPSVRMIGELILGGYRRGLENPLPVILERDHKWLRKALMLPN
FT                   SERREFWEKYEMLAPGKTKAPAAYIQALADALPSGSGPFTAKPRSAGTGSLGRPRFVAY
FT                   AEWQGGPVLREAKALVSSAWSLHHRALDGTIRAGEIAAGRARAADPHYRVCDRILVRRL
FT                   SPNSRKIEIDKHPEILLSPTMLELMGSEIANCHSNDAAAAAAILQDLQARGPEWLHEAA
FT                   RAAASSVSAEQKAYARAR"
FT   gene            complement(344673..345770)
FT                   /locus_tag="RHECIAT_CH0000338"
FT   CDS_pept        complement(344673..345770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000338"
FT                   /product="hypothetical conserved protein"
FT                   /note="yhch00088"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000338"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89332"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008311"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:B3PYI1"
FT                   /protein_id="ACE89332.1"
FT                   /translation="MMRSALINRRSFVKAAGIGFLASLAPRSLLALERADAVYASGIRT
FT                   ANGSFAIATVTEHGEIIDQVALPARAHGMAFSAATGKTVAFARRPGTYAMIFDPRNKGE
FT                   PIVISSREDRHFYGHGVFSPDGRILYASENDFDGNRGMIGLYDATNRFARIGEYETYGI
FT                   GPHDMTVSDDGRLLIVANGGIETHPDFGRTKLNLGAMQPSLALIDAATGALIEKHVLPA
FT                   EWSQLSTRHVDLDGEGRIWFACQYEGHRKDLPPLVGHFAKGEDLSFVALPEETTRRLAN
FT                   YVGAIAVNRSEGLVGITSPKGGTSVTIDAKTGKVLAESAVPEAAGIAPARDGFAVSSYD
FT                   GDFLATRSDVAWDQHIVRISQRARA"
FT   gene            complement(345775..346875)
FT                   /locus_tag="RHECIAT_CH0000339"
FT   CDS_pept        complement(345775..346875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000339"
FT                   /product="hypothetical conserved protein"
FT                   /note="yhch00089"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000339"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89333"
FT                   /db_xref="InterPro:IPR018976"
FT                   /db_xref="InterPro:IPR034984"
FT                   /db_xref="InterPro:IPR038352"
FT                   /db_xref="UniProtKB/TrEMBL:B3PYI2"
FT                   /protein_id="ACE89333.1"
FT                   /translation="MRLWHPLLCLTLIGLATSAAAQTAASPAGLNEDAVPAVMQRAVDE
FT                   VIRPGYRNMQQSAARLTTAMKDLCEAGTQQTLDKAKSAFDDTIRYWSIIEIVQTGPVIQ
FT                   DNLFEHILFYPDRKGVGLKQVQALIAKADPKDATVDAIAGKSVALQGLTALEYVLYGNG
FT                   SENLVGQKGGFRCLYGAAVAGNIQREAGEVVAAWEKPDGVQASWKHPGPQSNDFMDNKE
FT                   AVTALLGILGHGAENVRDQRLEQFYKGKDNAPRPRMAIYWRSRNTWKSIAANLEGLRTL
FT                   WQKAGMAELLPPDKRSIAASIDEDFKSLLDSVPKLNPDIDAATSDAEKAKLDTLLAESR
FT                   DLITRISDDYGAAIGLSAGFSFSDGD"
FT   gene            complement(346875..348485)
FT                   /locus_tag="RHECIAT_CH0000340"
FT   CDS_pept        complement(346875..348485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000340"
FT                   /product="hypothetical conserved protein"
FT                   /note="yhch00090"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000340"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89334"
FT                   /db_xref="GOA:B3PYI3"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR010538"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:B3PYI3"
FT                   /protein_id="ACE89334.1"
FT                   /translation="MGALDSCDKHRNEGAEREARSSTVEFVARKNRLYLRRAVYAALAV
FT                   APATIAAGFDLPVKRTDLSEADLKRVTEVTRSTKDFSKAEQYEAMQAGGATSIDPVTED
FT                   SFSHISANIPFEEEQNFKLGNALFRKLWVSSPSSTQASDGLGPLFNARSCMSCHVNDGR
FT                   GKPPEGGPSAVSMFLRLSRAARTPEEEKAIAGADILNFPDPVYGHQLQDLAVPGLAAEG
FT                   RMAIRYDEETVTLGDGETVSLRRPHYAATNLAYGPLDASTTISARVAPAMIGLGLIEAI
FT                   PEADILGHADPDDVDGDGISGKAAIVRDHRSGEVALGRFSWKAQNATVRDQNADAFAND
FT                   IGISTPDHPDAHGDCTKAEEKCLEMPTGVQKRLGEEEAPGPILDLVTFYSENLAVPARR
FT                   KASFPETLKGKQIFYETGCISCHVPKFVTRRDSPEKAQSFQLIWPYSDFLLHDMGDGLA
FT                   DGQPVGLASGREWRTPPLWGIGLTRTVSGHSFFLHDGRARDLTEAILWHGGEAEKARNA
FT                   FSALSKDDRAALITFLESL"
FT   gene            complement(348640..349914)
FT                   /locus_tag="RHECIAT_CH0000341"
FT   CDS_pept        complement(348640..349914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000341"
FT                   /product="hypothetical conserved protein"
FT                   /note="yhch00091"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000341"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89335"
FT                   /db_xref="InterPro:IPR018976"
FT                   /db_xref="InterPro:IPR038352"
FT                   /db_xref="UniProtKB/TrEMBL:B3PYI4"
FT                   /protein_id="ACE89335.1"
FT                   /translation="MKLNKFRAAVLAIAPAALLALPAQAATDAAAVVKHYADVAHAKYE
FT                   DSLTTAKALDAAIDAFLKAPTDETLKAARDAWIKARVPYQQTEVYRFGNPVVDEWEGKV
FT                   NAWPLDEGLIDYVDPSYGSESDENSLYVANVIANKTIKIDGKDVDASKLTPEFLSGTLA
FT                   EAGGIEANVATGYHAIEFLLWGQDLNGTGPGAGNRPATDYDLKNCTHGNCDRRAEYLKS
FT                   ASTLLVSDLQEMTDNWKPDGAATKNVEADPKAGLVAILTGMGSLSYGELAGERMKLGLL
FT                   LHDPEEEHDCFSDNTYNSHLNDAIGIAAAYTGNYTRVDGTKLSGPSLHDLVAAKDKALD
FT                   AELEGKLNKTLDAMNSMAKRGETVEKYDQMIAEGNKDGNAVVQAAIDGLIDQTKSIQRV
FT                   IAALDLGTVQLEGSDSLDNPNAVFK"
FT   gene            complement(350219..351508)
FT                   /gene="sun"
FT                   /locus_tag="RHECIAT_CH0000342"
FT   CDS_pept        complement(350219..351508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sun"
FT                   /locus_tag="RHECIAT_CH0000342"
FT                   /product="tRNA and rRNA cytosine-C5-methylase (RNA
FT                   methyltransferase) protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000342"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89336"
FT                   /db_xref="GOA:B3PYI5"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B3PYI5"
FT                   /protein_id="ACE89336.1"
FT                   /translation="MRLGGRLEGAISVLADIDARKRPVADALKDWGLAHRFAGSGDRAA
FT                   IGNIVYDALRMRLSHAWLMDDDSAAAIAHAVMFRQWGFTPDRLAAELADDKFAPPPLSA
FT                   DALAAFAGRSLDDAPPHIRGDIPEWIQPSFEQAFGAGWLAEAQALAARPTLDLRANILK
FT                   SSRDKAVKALERAGAHAAKIARYGIRIAAGEGASRLPNVTAELSFQKGWFEVQDEGSQI
FT                   VADLVLAKDGEQILDYCAGGGGKTLAMAAAMQNKGQVHAYDADRKRLAPIIERLKRAGT
FT                   RNVQVHDDPRGLSALAGRCDKVLVDAPCTGTGTWRRRPDTKWRLTAKNLDERTAQQQDA
FT                   LAQASGFVKPGGELIYVTCSVLPQENEEQVRRFAAGNPDFQIVSALPAWDALFGNDAPR
FT                   PHSSDALTVTLTPASTDTDGFFFCRLQRKG"
FT   gene            complement(351731..352093)
FT                   /locus_tag="RHECIAT_CH0000343"
FT   CDS_pept        complement(351731..352093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000343"
FT                   /product="probable rare lipoprotein A protein"
FT                   /note="ypch00133"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000343"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89337"
FT                   /db_xref="GOA:B3PYI6"
FT                   /db_xref="InterPro:IPR009009"
FT                   /db_xref="InterPro:IPR012997"
FT                   /db_xref="InterPro:IPR034718"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:B3PYI6"
FT                   /protein_id="ACE89337.1"
FT                   /translation="MKKIRRSIIAAVTIAACSSMLPAESFAGNGCGGASWYALRSKTAS
FT                   GERMNPAVLTAAHRSLAFGTKVKVTNRNNGRTVVVRINDRGPFIRGRVLDLSRAAAQNI
FT                   GMVSSGTAKVCYQVIS"
FT   gene            complement(352185..352367)
FT                   /locus_tag="RHECIAT_CH0000344"
FT   CDS_pept        complement(352185..352367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000344"
FT                   /product="hypothetical protein"
FT                   /note="yhch00092"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000344"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89338"
FT                   /db_xref="UniProtKB/TrEMBL:B3PYI7"
FT                   /protein_id="ACE89338.1"
FT                   /translation="MAKPEKNFRDFCERRDGDRNSGKFIRILADFIMFFPYVTAVTDFR
FT                   HDINALTNVTYCNIP"
FT   gene            complement(352492..353361)
FT                   /locus_tag="RHECIAT_CH0000345"
FT   CDS_pept        complement(352492..353361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000345"
FT                   /product="putative nucleoside-diphosphate-sugar epimerase
FT                   protein"
FT                   /note="ypch00134; GO_function: GO:0003824 - catalytic
FT                   activity; GO_function: GO:0050662 - coenzyme binding;
FT                   GO_process: GO:0044237 - cellular metabolic process"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000345"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89339"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B3PYI8"
FT                   /protein_id="ACE89339.1"
FT                   /translation="MHVMIFGCGYSGTAIAKAFAGQDVQVSGTTRSAEKVEALRANGIE
FT                   AFLFDGETMGDRLSRALVDVTHLVQSIAPGKADPLLRLLGEDSARLLPRLEWIGYLSTV
FT                   GVYGDHKGAWVSEETPCLPVSGRSKERLEAEEGWLAIGRERDVPAAILRLSGIYGPGRN
FT                   AFCNLDKGTARRLIKKDQVFNRIRVEDIGAATRFLSEHGLGGIYNVTDDRPGPPQDVIV
FT                   EAARLMGVEPPPEQAFETAELTPMARTFYGENKRVSNAKLKKAGFEFSFPTYPMSLAQL
FT                   WQDGRWRG"
FT   gene            complement(353361..354518)
FT                   /locus_tag="RHECIAT_CH0000346"
FT   CDS_pept        complement(353361..354518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000346"
FT                   /product="putative iron-sulfur cluster binding protein"
FT                   /note="ypch00135"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000346"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89340"
FT                   /db_xref="GOA:B3PYI9"
FT                   /db_xref="InterPro:IPR004453"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR013542"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B3PYI9"
FT                   /protein_id="ACE89340.1"
FT                   /translation="MPEADRDDKERRRRDNLTTFVRAESAAKGFDLCRITRPDAIPEAK
FT                   ERLGQFIDAGRHGTMEWMAETRERRGDPRALWSEVRSVVVFGLNYAPEEDPRGILAKPD
FT                   RAAISVYARNRDYHDIIKGRLKEIATRFAARAGADVKVFVDTAPVMEKPLAAAAGLGWQ
FT                   GKHTNLVSRQHGSWLFLGSMFTTADLAVDAEETDHCGSCRACLDICPTAAFPAPYQIDA
FT                   RRCISYLTIEHKGPIDPDLRPLIGNRIYGCDDCLAACPWNKFAVSAAEMKLKARDDLKE
FT                   PSLAFLLTLDDAAFRTFFSGSPVKRIGRNRFIRNVLIAAGNSGETALIAQCRALAGDAT
FT                   PAVRGMAVWALSRLMQAGEFSAFAAQRTDESDDDVLNEWRLAGVG"
FT   gene            complement(354531..355223)
FT                   /gene="gstch2"
FT                   /locus_tag="RHECIAT_CH0000347"
FT   CDS_pept        complement(354531..355223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gstch2"
FT                   /locus_tag="RHECIAT_CH0000347"
FT                   /product="glutathione S-transferase protein"
FT                   /EC_number="2.5.1.18"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000347"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89341"
FT                   /db_xref="GOA:B3PYJ0"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:B3PYJ0"
FT                   /protein_id="ACE89341.1"
FT                   /translation="MPTLYHHPMSSASRFVRLILAEYGYQADLIEEQTWEKRRDFLALN
FT                   PAGTLPVYVDDSMRALCGATVISEYLDETHGVLKRDRRLLAEDPFQRAEIRRLSEWFMQ
FT                   KMENDVTKPLARERVYKLQMTADQGGGAPDSKILRTARANIRQHMRYLTWLAGSRQWLA
FT                   GERMSYADLAAAASISILDYLGEIEWADAPVVKEWYQRLKSRPSFRPMLTERVRGLTPV
FT                   SHYADLDF"
FT   gene            355458..356255
FT                   /gene="upk"
FT                   /locus_tag="RHECIAT_CH0000348"
FT   CDS_pept        355458..356255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="upk"
FT                   /locus_tag="RHECIAT_CH0000348"
FT                   /product="undecaprenyl-diphosphatase protein"
FT                   /EC_number="3.6.1.27"
FT                   /note="GO_component: GO:0016020 - membrane"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000348"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89342"
FT                   /db_xref="GOA:B3PYJ1"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3PYJ1"
FT                   /protein_id="ACE89342.1"
FT                   /translation="MDYINAALLGVIEGITEFLPISSTGHLIIAEQWLGHRSDMFNIVI
FT                   QAGAILAVTIIYWRRLLDLVLGWREPENRDYAAKLIVAFLITAILGLVVKKLGFELPET
FT                   ATPIAWALIIGGIWMIFAEWAAARKAPHKEITWLVAILVGIAQIVAGVFPGTSRSGATI
FT                   FVAMLAGTGNRAAATEFAFLVGIPTMYAASGYELLKTFKDGGAAGEDWTALAIAFIVST
FT                   IVAFIAVKWLLAYIRSNRFTLFAIYRIILGVLLLGMATSGLIA"
FT   gene            complement(356494..356745)
FT                   /locus_tag="RHECIAT_CH0000349"
FT   CDS_pept        complement(356494..356745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000349"
FT                   /product="hypothetical conserved protein"
FT                   /note="yhch00093"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000349"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89343"
FT                   /db_xref="GOA:B3PYJ2"
FT                   /db_xref="UniProtKB/TrEMBL:B3PYJ2"
FT                   /protein_id="ACE89343.1"
FT                   /translation="MLFAIPLTTKPRASPMDSTPAKACGNHCERQYSMGKSIALLFACA
FT                   ALVILAGSFVASGSVAAVKGGCSPAYGVDPCSTASISH"
FT   gene            complement(356928..357908)
FT                   /locus_tag="RHECIAT_CH0000350"
FT   CDS_pept        complement(356928..357908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000350"
FT                   /product="probable NADH dehydrogenase/NADH dehydrogenase
FT                   (ubiquinone) protein"
FT                   /note="ypch00136; GO_function: GO:0003824 - catalytic
FT                   activity; GO_function: GO:0050662 - coenzyme binding;
FT                   GO_process: GO:0044237 - cellular metabolic process"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000350"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89344"
FT                   /db_xref="GOA:B3PYJ3"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B3PYJ3"
FT                   /protein_id="ACE89344.1"
FT                   /translation="MTLANLPPLVTLFGGSGFVGRHVVRALAKRGYRIRVAVRRPDLAG
FT                   FLQPLGNVGQISLVQANLRYRNSIDRAVDGASHVVNCVGILQETGRNTFDAVQEFGARA
FT                   VAEAARNAGATLAHISAIGANANSDSDYGRTKGRAEAAILSIKPDAVIFRPSIVFGPED
FT                   SFFNKFADMARMSPVLPLVGGGKTKFQPVYVEDVAEAVARAVDGKVPAGKVYELGGPEV
FT                   LSFRECLETMLKVTSRKNRLVSLPFGIASMIGSIASLIPFVTPPITPDQVRLLKRDNVV
FT                   SAEAESEGRTLKGLGIAPTMAASVLESYLVQYRPHGQYTGSGKAA"
FT   gene            complement(358127..358414)
FT                   /locus_tag="RHECIAT_CH0000351"
FT   CDS_pept        complement(358127..358414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000351"
FT                   /product="hypothetical conserved protein"
FT                   /note="yhch00094"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000351"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89345"
FT                   /db_xref="InterPro:IPR010753"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:B3PYJ4"
FT                   /protein_id="ACE89345.1"
FT                   /translation="MAKGYWIARVDVRDAERYKDYVAAAKPAFEKYGANFLARGGALTE
FT                   LEGKARARNVVIEFPSMQHAVDCYNSPEYQIAAKIRQEVADAEMVVVEGV"
FT   gene            complement(358437..359144)
FT                   /gene="pyrF"
FT                   /locus_tag="RHECIAT_CH0000352"
FT   CDS_pept        complement(358437..359144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrF"
FT                   /locus_tag="RHECIAT_CH0000352"
FT                   /product="orotidine 5'-phosphate decarboxylase protein"
FT                   /EC_number="4.1.1.23"
FT                   /note="GO_function: GO:0004590 - orotidine-5'-phosphate
FT                   decarboxylase activity; GO_process: GO:0006207 - 'de novo'
FT                   pyrimidine base biosynthetic process"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000352"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89346"
FT                   /db_xref="GOA:B3PYJ5"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR014732"
FT                   /db_xref="InterPro:IPR018089"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3PYJ5"
FT                   /protein_id="ACE89346.1"
FT                   /translation="MDARERLIVGLDVPTIGEAEKLVSTLGDDILFYKIGYQLVFAGGL
FT                   EFARDLAASGKKIFLDMKLLDIDNTVASGVENIARMGMSMLTLHAYPKAMRAAVEAAAG
FT                   SGLCLLGVTVLTSMDAEDLAEAGYNQDPHSLVLRRAEQARAAGMGGIVCSAAEAAEVRE
FT                   VLGPDMAIVTPGIRPTGSDHGDQKRVMTPFDALKAGATHLVVARPIVKAPDPRHAARAV
FT                   LNEMVAARWPANR"
FT   gene            complement(359151..359732)
FT                   /locus_tag="RHECIAT_CH0000353"
FT   CDS_pept        complement(359151..359732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000353"
FT                   /product="putative phosphoglycerate mutase protein"
FT                   /note="ypch00137"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000353"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89347"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:B3PYJ6"
FT                   /protein_id="ACE89347.1"
FT                   /translation="MFGIYITHPQVKIDANVPVPKWGLSDVGAARARKAAESGWARQLR
FT                   RIVSSDETKAIETAEILAEASGVAVEIVHGMHENDRSATGFLPPPQFEEAANWFFAHPE
FT                   ESFKGWERAADAQARIVEAVNAVLAAHDAAAPIAFVGHGGVGTLLKCHLAGRPISRDRD
FT                   QPGGGGNLYAFGLADRRLSCDWTPIEDWRG"
FT   gene            complement(359734..360333)
FT                   /gene="pmtA1"
FT                   /locus_tag="RHECIAT_CH0000354"
FT   CDS_pept        complement(359734..360333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pmtA1"
FT                   /locus_tag="RHECIAT_CH0000354"
FT                   /product="phospholipid N-methyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000354"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89348"
FT                   /db_xref="GOA:B3PZ54"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B3PZ54"
FT                   /protein_id="ACE89348.1"
FT                   /translation="MRLRVKVREHFGKRFDEEIRFFRGMMQGPKTVGSIVPTSSITAKR
FT                   MASVIDMHSGLPVLELGPGTGAITKAILGRGVKPDNLVAIEYSTDFHQHLLRAYPGVHF
FT                   INGDAFDLKTTLGAFGDQTFDCVISCIPLLNFPMAMRVSLLESLLDRLPPGRPVVQISY
FT                   GAISPIAANPDRYHIQHFDFVMRNIPPAQLWIYRRG"
FT   gene            complement(360429..361337)
FT                   /locus_tag="RHECIAT_CH0000355"
FT   CDS_pept        complement(360429..361337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000355"
FT                   /product="hypothetical conserved protein"
FT                   /note="yhch00095"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000355"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89349"
FT                   /db_xref="InterPro:IPR002763"
FT                   /db_xref="InterPro:IPR036520"
FT                   /db_xref="UniProtKB/TrEMBL:B3PZ55"
FT                   /protein_id="ACE89349.1"
FT                   /translation="MKKTGTVRIGISGWTYAPWRGQFYPKGLPQKHELSYAARHFRSIE
FT                   INGTFYGLQRPESFGRWRDETPEDFVFAVKGSRFITHMKRLQEIETPLANFFASGLLRL
FT                   GPKLGPILWQFPPNMAFDPALFETFLSLLPHDCDAAIALAKRHDGRLKGRAWLKSDADQ
FT                   PIRHAFEIRHDSFRSPAFIEMLRRHNVALVCADTVEWPLLMDITADFIYCRLHGSEQLY
FT                   VSGYEDEALDLWAERIRAWATGGEPEHATRVLAPLPSRKKGRDVYLYFDNTDKKLRAPV
FT                   DADHLGERLADLMPRSDRKAA"
FT   gene            complement(361395..362513)
FT                   /gene="dnaN"
FT                   /locus_tag="RHECIAT_CH0000356"
FT   CDS_pept        complement(361395..362513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="RHECIAT_CH0000356"
FT                   /product="DNA polymerase III, beta chain protein"
FT                   /EC_number="2.7.7.7"
FT                   /note="GO_function: GO:0003677 - DNA binding; GO_function:
FT                   GO:0003887 - DNA-directed DNA polymerase activity;
FT                   GO_function: GO:0008408 - 3'-5' exonuclease activity;
FT                   GO_process: GO:0006260 - DNA replication"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000356"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89350"
FT                   /db_xref="GOA:B3PZ56"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:B3PZ56"
FT                   /protein_id="ACE89350.1"
FT                   /translation="MRITIERSNLLKSLNHVHRVVERRNTIPILSNVLLKADGQNLDMK
FT                   ATDLDLEITEATPASVEQAGATTVPAHLLYDIVRKLSDGSEVLLATSTDGGSMTVQSGR
FT                   SKFSLQCLPESDFPDLTAGTFTHSFKLKATDLKMLIDRTQFAISTEETRYYLNGIFFHT
FT                   IESKGELKLRAVATDGHRLARADVDAPSGSEGMPGIIIPRKTVGELQKLVDNPEAIVTV
FT                   EVSDAKIRMTIGSIVLTSKLIDGTFPDYQRVIPTGNDKEMRVDCTSFAQAVDRVSTISS
FT                   ERGRAVKLALSEGQLMLTVNNPDSGSATEEVAVGYDTDAMEIGFNAKYLLDITAQLSGE
FT                   EAIFLLADAGSPTLIRDTAGDDALYVLMPMRV"
FT   gene            362775..363692
FT                   /locus_tag="RHECIAT_CH0000357"
FT   CDS_pept        362775..363692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000357"
FT                   /product="putative methyltransferase protein"
FT                   /note="ypch00138; GO_function: GO:0008168 -
FT                   methyltransferase activity; GO_process: GO:0008152 -
FT                   metabolic process"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000357"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89351"
FT                   /db_xref="GOA:B3PZ57"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:B3PZ57"
FT                   /protein_id="ACE89351.1"
FT                   /translation="MNEETTAEAATRRSFRLHNMAVPARPLEPALYLVATPIGNLGDIT
FT                   LRALETLAGADVLACEDTRVTRVLLDRYGIQNRPFAYHEHNADEAGPRLLQALEAGRSV
FT                   ALVSDAGTPLVSDPGYRLAQQAIAAGYRVVPIPGASAPLAALVGSGLPNDAFLFAGFLP
FT                   AKDKARRDRLGELAAAPATLIFFESPHRIAATLLAAADVLGGTRPASVCRELTKTYEEF
FT                   RRGTLAELAAHYQEVDNVKGEIVLVVGPPQPVETPDADVEAVLADLAKSMPTAKAATEA
FT                   ARLTGLPRKALYQRLLEMKGADGR"
FT   gene            363682..364050
FT                   /locus_tag="RHECIAT_CH0000358"
FT   CDS_pept        363682..364050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000358"
FT                   /product="hypothetical conserved protein"
FT                   /note="yhch00096"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000358"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89352"
FT                   /db_xref="GOA:B3PZ58"
FT                   /db_xref="InterPro:IPR003509"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3PZ58"
FT                   /protein_id="ACE89352.1"
FT                   /translation="MGDNDRTAIRRKALRRGLVSEYVAAVFLMLKGYRILALRHRTRLG
FT                   EIDIVARKGDLAVFVEVKARHGEAAAVDAVSAAAQKRIRAASDLWLARQADQARLSQRY
FT                   DIVAVTPSRLPRHFPDAF"
FT   gene            364179..364667
FT                   /locus_tag="RHECIAT_CH0000359"
FT   CDS_pept        364179..364667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000359"
FT                   /product="hypothetical conserved protein"
FT                   /note="yhch00097"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000359"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89353"
FT                   /db_xref="InterPro:IPR008579"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B3PZ59"
FT                   /protein_id="ACE89353.1"
FT                   /translation="MLASAVAMAARSVPYAVAKPAGKSFVAHASDLLPLKSTPINPDWI
FT                   INGNPQARTAEHSRGHDEASLTAIWDCTAGEFRWYFGWDETVMILEGEVHITAEDGTER
FT                   TLCAGDVAFFAGGTWASWRVDNYVRKVAFLRKPFPMPLAIAYRLRNLLRNGSNQGIAA"
FT   gene            364756..365703
FT                   /gene="gshB"
FT                   /locus_tag="RHECIAT_CH0000360"
FT   CDS_pept        364756..365703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gshB"
FT                   /locus_tag="RHECIAT_CH0000360"
FT                   /product="glutathione synthetase protein"
FT                   /EC_number="6.3.2.3"
FT                   /note="GO_function: GO:0004363 - glutathione synthase
FT                   activity; GO_function: GO:0005524 - ATP binding;
FT                   GO_process: GO:0006750 - glutathione biosynthetic process"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000360"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89354"
FT                   /db_xref="GOA:B3PZ60"
FT                   /db_xref="InterPro:IPR004215"
FT                   /db_xref="InterPro:IPR004218"
FT                   /db_xref="InterPro:IPR006284"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:B3PZ60"
FT                   /protein_id="ACE89354.1"
FT                   /translation="MAKITNVAVQMDHVAGINIAGDSTFAMSLEAQTRGYKLFHYTPER
FT                   LSFRDGKLFASVEPMLLRDVKGDHFELGAPERVDLSTMDVVLLRQDPPFDMAYITSTHL
FT                   LERIHPKTLVVNDPAWVRNSPEKIFVTEFSDLMPKTLITKDPAEIRRFRDEMGDIILKP
FT                   LYGNGGAGVFHSTRDDRNLSSLLEMFGQLFREPFIAQQYLPDVRKGDKRIILVDGEFAG
FT                   AINRVPAEHDSRSNMHVGGRAEATELTPREKQICERIGPALRERGFLLVGIDVIGDYMT
FT                   EINVTSPTGIREVKKFGGADIAALLWDAIERKRG"
FT   gene            365877..367409
FT                   /locus_tag="RHECIAT_CH0000361"
FT   CDS_pept        365877..367409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000361"
FT                   /product="probable Mg-chelatase protein"
FT                   /note="ypch00139; GO_function: GO:0016851 - magnesium
FT                   chelatase activity; GO_process: GO:0015979 -
FT                   photosynthesis; GO_process: GO:0015995 - chlorophyll
FT                   biosynthetic process"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000361"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89355"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3PZ61"
FT                   /protein_id="ACE89355.1"
FT                   /translation="MVARVGTVAFQGIEGVPVEVQVMIAPGKIGMQIVGLPDKAVAESR
FT                   ERVQAALHASGLALPAKRVTVNLAPADLPKEGSHFDLPIALALMAALGAIPADALSDYV
FT                   VVGELNLDGTIAAIAGALPAAIGANALGKGLICPAESGAEAAWAGAEVNILAPRSLIAL
FT                   ANHFRGTQVLSRPEPSIRANAANLPDLAEIKGQESAKRALEVAAAGGHNLLMVGPPGSG
FT                   KSMLAARLPSILPPLSPAELLEVSMVHSIAGQLTGGKLSDRRPFRTPHHSATMAALVGG
FT                   GLRARPGEASLAHHGVLFLDEFPEFTPQALDALRQPLEGGECVIARANHRVSYPAKFQL
FT                   IAAMNPCRCGMAGEPGHSCARGPRCMSDYQARISGPLMDRIDIRIDVPAVSAADLIRPM
FT                   VAEASADVARRVARARELQQERFEAAGAKGIGTNARCSTAMIEKLAEPDAAGLQLLRDA
FT                   AEKMKFSARGYHRVLKVARTLADLDGKPTVGRLHLAEAISYRIAGERLTAAA"
FT   gene            367524..367724
FT                   /locus_tag="RHECIAT_CH0000362"
FT   CDS_pept        367524..367724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000362"
FT                   /product="hypothetical protein"
FT                   /note="yhch00098"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000362"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89356"
FT                   /db_xref="UniProtKB/TrEMBL:B3PZ62"
FT                   /protein_id="ACE89356.1"
FT                   /translation="MSPSANQPRRDDGSLPWRECCRPRSRCVAYPLAVRASPHFVAIYN
FT                   ISFGWKNFEDDVGPSDMVGRR"
FT   gene            367741..368199
FT                   /locus_tag="RHECIAT_CH0000363"
FT   CDS_pept        367741..368199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000363"
FT                   /product="hypothetical conserved protein"
FT                   /note="yhch00099"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000363"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89357"
FT                   /db_xref="UniProtKB/TrEMBL:B3PZ63"
FT                   /protein_id="ACE89357.1"
FT                   /translation="MPGMPMSNEYPGSNANPLEVLDLANAYSRASELLLRKGQKRVALS
FT                   IAPARMCAIHAIELYLNAFLRHEGVTPEEIRGRLHDLSEATFVDKLKLRKKTAQHLEAM
FT                   TAKREYLISRYAPERAKEHTELTRLAATLAEVMKKVGKHLHSTSSGRH"
FT   gene            complement(368339..369301)
FT                   /gene="cysK1"
FT                   /locus_tag="RHECIAT_CH0000364"
FT   CDS_pept        complement(368339..369301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysK1"
FT                   /locus_tag="RHECIAT_CH0000364"
FT                   /product="cysteine synthase protein"
FT                   /EC_number="2.5.1.47"
FT                   /note="GO_function: GO:0003824 - catalytic activity;
FT                   GO_process: GO:0008152 - metabolic process"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000364"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89358"
FT                   /db_xref="GOA:B3PZ64"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005856"
FT                   /db_xref="InterPro:IPR005859"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:B3PZ64"
FT                   /protein_id="ACE89358.1"
FT                   /translation="MSHKPGRGRIYSSITETIGNTPLVRFDKLAREKGVVANLIGKLEF
FT                   FNPIASVKDRIGVAMIESMEAQGRITPGKSVLIEPTSGNTGIALAFAAAAKGYRLILTM
FT                   PETMSVERRKMLALLGAELVLTEGAKGMKGAIAKAEELAESLPDAIIPQQFENPANPEI
FT                   HRKTTAEEIWNDTDGTVDIVVSGIGTGGTITGVGQVLKSHKPEIQIIAVEPADSPILSG
FT                   GNPGPHKIQGIGAGFAPKILDTGIYDEVVTVTNDEAFEQARLVARLEGVPVGISSGAAL
FT                   TAAIKVGSRPENAGKNIVVIIPSFAERYLSTALFEGLGS"
FT   gene            complement(369445..370062)
FT                   /locus_tag="RHECIAT_CH0000365"
FT   CDS_pept        complement(369445..370062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000365"
FT                   /product="probable amino acid efflux protein, LysE family"
FT                   /note="ypch00140; GO_component: GO:0016020 - membrane;
FT                   GO_function: GO:0005293 - lysine permease activity;
FT                   GO_process: GO:0006865 - amino acid transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000365"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89359"
FT                   /db_xref="GOA:B3PZ65"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:B3PZ65"
FT                   /protein_id="ACE89359.1"
FT                   /translation="MSLAALLAYAGALFIAAAIPGPGITAIVARALGSNFRETFFMGLG
FT                   LVLGDMTYLTAVILGLAFVAQTFTEVFIAIKIAGALYLAYIAWKLWTAGLLPQDIAAKK
FT                   SSNIGLSFLSGLLVTLGNPKTMLFYVALAPTLIDIGNIGLRDYVMLLAVTFVVLIAVLV
FT                   PYMLLASRARTMLKQPRALQALNRVAAGILAGTAAFIATRAA"
FT   gene            complement(370178..371080)
FT                   /locus_tag="RHECIAT_CH0000366"
FT   CDS_pept        complement(370178..371080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000366"
FT                   /product="putative transporter permease protein"
FT                   /note="ypch00141; GO_component: GO:0016020 - membrane"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000366"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89360"
FT                   /db_xref="GOA:B3PZ66"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B3PZ66"
FT                   /protein_id="ACE89360.1"
FT                   /translation="MTGDIKRGTAEMTAAMLISGTIGWFVVMSGQPVSGVVFWRCLFGA
FT                   LTLLVICGALGLLRPGILTLRTFAIAVFGGIAIVVNWLLLFASYSHATISIATTVYNTQ
FT                   PFMLLVLGALFLGEKITAAKLFWLTLAFAGMIAIVQAEPGGSGDTFESYGLGILMALGA
FT                   AFFYALAALAAKWLKGTPPHLIALIQVATGMLMLAPMTDFSQPPQDAGGWAILVSIGVV
FT                   HTGLMYVLLYGAIQRLPTHLTGALSFLYPIAAILVDRLAFGHALQPMQIAGAAIILLAT
FT                   AGMNLGWTPRWLRPRALQG"
FT   gene            371192..371656
FT                   /locus_tag="RHECIAT_CH0000367"
FT   CDS_pept        371192..371656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000367"
FT                   /product="probable transcriptional regulator protein, AsnC
FT                   family"
FT                   /note="ypch00142; GO_component: GO:0005622 - intracellular;
FT                   GO_function: GO:0003700 - transcription factor activity;
FT                   GO_function: GO:0043565 - sequence-specific DNA binding;
FT                   GO_process: GO:0006355 - regulation of transcription,
FT                   DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000367"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89361"
FT                   /db_xref="GOA:B3PZ67"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B3PZ67"
FT                   /protein_id="ACE89361.1"
FT                   /translation="MPNDIQPLDEIDQAILEALAGNARISLKELAQQVGLSSPSAAERL
FT                   RRLEERGVIKAFTIDLDPAAVGYPLQAIVRVRPLPGQLHFVERLIQEIPEIVECDKVTG
FT                   EDCFIARLVIRSMAELDGLLDRVAERAETNTAMIKASPVKRRLPPLSRGK"
FT   gene            complement(371774..372676)
FT                   /locus_tag="RHECIAT_CH0000368"
FT   CDS_pept        complement(371774..372676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000368"
FT                   /product="putative acetyltransferase protein"
FT                   /note="ypch00143"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000368"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89362"
FT                   /db_xref="GOA:B3PZ68"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B3PZ68"
FT                   /protein_id="ACE89362.1"
FT                   /translation="MAKRLDSAGVTFRQDYFGDPAGWAALVRLLQDIFGIDIGPLQQLG
FT                   GPDPTSMPFGWFDADGELAANLSAFALPFVLNGRIVHAAGLQSGAVRPPWRGRGLYRDL
FT                   TVKALDWCERQGFEAVILYTDKPSLYEPYGFRAMPLHRYVGTAPTPAIDGATAARPLLP
FT                   ANADDLALLQLLLKARSPVSTTLSVTTNAAMFLINTQLDPDVRISFLEDCQAVIAWKMD
FT                   GTGRFSLLDVVAAEIPSLAAILGGLDIASATVEVLFRPDKLDWTGAPQPFESGTTLMLR
FT                   GLGDAAPHFPAMLSPMADF"
FT   gene            complement(372778..373248)
FT                   /gene="dut"
FT                   /locus_tag="RHECIAT_CH0000369"
FT   CDS_pept        complement(372778..373248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dut"
FT                   /locus_tag="RHECIAT_CH0000369"
FT                   /product="deoxyuridine 5'triphosphate nucleotidohydrolase
FT                   protein"
FT                   /EC_number="3.6.1.23"
FT                   /note="GO_process: GO:0046080 - dUTP metabolic process"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000369"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89363"
FT                   /db_xref="GOA:B3PZ69"
FT                   /db_xref="InterPro:IPR008181"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3PZ69"
FT                   /protein_id="ACE89363.1"
FT                   /translation="MTIHHETRPTLNLIRLANGEGLELPAYESQGAAGMDLRAAVDGDA
FT                   PLTLPPGKRALVPTGFIFEIPEGFEGQVRPRSGLAFKHGITCLNSPGTVDSDYRGEVKV
FT                   LLANLGEEAFVIERGMRIAQMVIAPVTQARVAEITAASETARGAGGFGSTGV"
FT   gene            373339..374922
FT                   /gene="prfC"
FT                   /locus_tag="RHECIAT_CH0000370"
FT   CDS_pept        373339..374922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prfC"
FT                   /locus_tag="RHECIAT_CH0000370"
FT                   /product="peptide chain release factor 3 protein"
FT                   /note="GO_function: GO:0003924 - GTPase activity;
FT                   GO_function: GO:0005525 - GTP binding"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000370"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89364"
FT                   /db_xref="GOA:B3PZ70"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004548"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR032090"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR038467"
FT                   /db_xref="UniProtKB/TrEMBL:B3PZ70"
FT                   /protein_id="ACE89364.1"
FT                   /translation="MAESLAEAVSRRRTFAIIAHPDAGKTTLTEKLLLFGGAIQLAGEV
FT                   KAKKDRMQTRSDWMKIERERGISVVTSVMTFEYNDNVFNILDTPGHEDFADDTYRTLTA
FT                   VDAAVMVIDAAKGIEPRTLKLFEVCRMRDIPIITFINKMDRESRDPFEILDEVEEKLAL
FT                   DTAPITWPIGRSKTFCGSYHLANSTARGSDTEVETTPVNGPQAVAGRLPENERQAFIDE
FT                   TELAIEACRPFDRDSFLEGHMTPVFFGSALRNFGVRDLINALGEFAPPPRDQVADTRTV
FT                   HATDDKMTAFVFKIQANMDPNHRDRIAFARICSGKLERGMKARLARTGKQLGLTAPQFF
FT                   FASQRQLADTAYAGDVVGIPNHGTLRIGDTLTEGESLVFQGVPNFSPEILRRVRLEDAM
FT                   KAKKLKEALQQMAEEGVVQLFSPEDGSPAIVGVVGALQLDVLKERLMAEYGLPVSFEMS
FT                   RFSVCRWISADQPADLEKFLTVKRGDIARDLDGDPVFLAQDAFSLRYEAERYPAIKMVA
FT                   IKEYHAAKAA"
FT   gene            complement(374947..376167)
FT                   /locus_tag="RHECIAT_CH0000371"
FT   CDS_pept        complement(374947..376167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000371"
FT                   /product="probable protein secretion protein, HlyD family"
FT                   /note="ypch00144; GO_component: GO:0016020 - membrane;
FT                   GO_function: GO:0008565 - protein transporter activity;
FT                   GO_process: GO:0009306 - protein secretion"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000371"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89365"
FT                   /db_xref="GOA:B3PZ71"
FT                   /db_xref="InterPro:IPR003997"
FT                   /db_xref="InterPro:IPR010129"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:B3PZ71"
FT                   /protein_id="ACE89365.1"
FT                   /translation="MAGGWATLAPLDSAAVAPGVIKVAGDRKLIQHLEGGIIADLNAAN
FT                   GDIVKAGKVLIQLDSTQARTKLDLVQNRIATREALAARLRAERDDKAEIEFDPALLANS
FT                   SKSAKDAVAAQRDVFAAKHHNLQDEREILSQRRRQTQEEITGLQELIVTEDKQIEVFED
FT                   ETKDLESLLKRGLVTRERGLLLTRQQREVEGDRATNVAAIARAKSAMAEIDMQILNLST
FT                   LRLNEAVEELSKVEAELVDLRQEERSAKDVLARTDIIAPVDGIVMDLKVHTAGGVVKPG
FT                   ETLMTVVPLGQQLVVEAMVRPEDVETIAPGQRARVSFPAFARYNLPPLEGVVGIVSADR
FT                   MVEERSGAPYFAATVLIDKSELAKLEGRKLMPGMSSEAMIRTGARTVLSYLAEPITQNF
FT                   RRAMREK"
FT   gene            complement(376278..378023)
FT                   /locus_tag="RHECIAT_CH0000372"
FT   CDS_pept        complement(376278..378023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000372"
FT                   /product="putative protein transport protein"
FT                   /note="ypch00145; GO_function: GO:0005524 - ATP binding;
FT                   GO_function: GO:0016887 - ATPase activity"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000372"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89366"
FT                   /db_xref="GOA:B3PZ72"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010128"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:B3PZ72"
FT                   /protein_id="ACE89366.1"
FT                   /translation="MKNKQPPPALQVVMKEARRAIRPLIWFSGAINVLTLTGALYMLQV
FT                   YHRVLSSHSLETLLMLSLMAAGALAAMAGLEVVRGRLLATVGSWMNARLAPVLLTASVE
FT                   YAAAKPGQANARPLRDLDQVRNFFTSPSIFPILDAPWAPLFFAAIFFMHPWLGWLALSG
FT                   GAVLFALALLNEWLTRKPLAEATSAQSRAYTQAEAAIRNAEVVQAMGMLKPLLEGWKVQ
FT                   QDEATKGQVVAANRGGIISAIARCHRQALQMGILGLGAYLVLRNEASGGIMVSASILMG
FT                   RALSPVEQAIGTWKATVGARAAYRRLTAVAGEHPEATPVPVMPRPTGRFEADNIVLARQ
FT                   GGEHILKGINFRLEPGESMALIGQSGAGKTSLARILAGAWRPSGGRALLDGMDVAQWAA
FT                   EDRGHHVGYLPQDIELFAGNVCENICRFATVSPVVFDKAVKAARLAGVHDLIKGLPKGY
FT                   LTEIGESGAVLSGGQRQRIGLARALYGDPALIILDEPNSNLDREGEEALIATLGTVKAA
FT                   GTTVILIAHRPNIMETVDKILVLNRGQQDLFGPRDHVFNELAARVRKVAQMPTIVAKSQ
FT                   GTKQP"
FT   gene            complement(378105..381713)
FT                   /locus_tag="RHECIAT_CH0000373"
FT   CDS_pept        complement(378105..381713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000373"
FT                   /product="hypothetical conserved protein"
FT                   /note="yhch00100"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000373"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89367"
FT                   /db_xref="UniProtKB/TrEMBL:B3PZ73"
FT                   /protein_id="ACE89367.1"
FT                   /translation="MALDITTQDLVIDETSGLQDDDINPSTSPHNANTTLLYMLSRDGA
FT                   GGLSSPEVAYQSDFVVASASAGETITTVVLTQSASGTPYSTTVGVNSNIRTVDGNYVWL
FT                   FQDPTHANVVIGVIGTSDANAAPAATGALAFSLGLIGTSATNADLYTVQYVPLFHPNAT
FT                   NPDDRIDLTNKVFASVTGTTDISFTGDNAHPGSNQFNLLSSPDDASKQLLVTGLVRSSQ
FT                   LDPNSALVNSECNVSEQGFGVDNQSIDPDTDGQNQPLGREVLQVDFVTGGTPSAGAGAD
FT                   IAYGSHLDNILHAGFIINQITPSTPTERVDIKISAFDVTGNEQGSDFFNGSPTTPVDIT
FT                   SLTLTGASALATITADGTYATPSGNITVTGLSGTGNVVTITGLDNITTVDFTTSGQMDR
FT                   LHVEAIDATQGLDITEVHYAQQTTNAYNEEVGSFINFDDDGPAITAVGTAPQVTVDETD
FT                   LTTNATGNFATAFTPTPGADGATITYALGINALNNVSGLTDTATGQSVLLFLESGSVVG
FT                   RAGAGGPVVFTVSVSTAGVVTLDQQRAIIHANTSNPDDSRTLAAADLVTLTATITDRDG
FT                   DPASAVRNIGQNLNFEDDGPAITAAGTAPQVTVDETDLVANATGNFVTAFTPTPGADGA
FT                   TVTYALGINALNNVSGLTDTETGASVLLFKEGNNVVGRAGAGGPVVFTVSVSAGVVTLD
FT                   QARAVIHANTSNPDDSRTLAAADLVTLTATITDGDGDQATATRNIGQNLNFEDDGPTIT
FT                   KPFDGNPALPDVQHETLANTLNAQATGDFGYNIGADIHPAAYYAGGGSDFVDQNSVADK
FT                   VQIGLTGTIIGGGGGNLVSSNVTLASESLTSATFNFTFTYDKDPAAGTQTGTAGGTLVF
FT                   DKVADTYTINLTDPMEGFSFDVLHTSELLSKQPTSNTGHPQIVVEKLQADDPSTTTTNE
FT                   AFYVQFTGNLVNKANPFSLTSNGEGSSGLSLFTPDGQLMVSNNNETWVSATQSTNGVAG
FT                   DTIQKDELLTLRFFNTDVGIANEATTPTATAGAMAIKFDGIGSSEDLMLILNLIDKDGA
FT                   DNIAGNGDDNHVITRAMYVSNDDIYKMGQVPAPYSSEFKLDNNDGLVIVEQNDYNASGE
FT                   DYVLQGAQIMQSGNGITGNNTAINLIRETGGGGGSNATGALVNFDATDNDVLKITDIGF
FT                   TSTVSQTPDANLDFAFQVVDADGDQTAMQHILVDVT"
FT   gene            complement(382342..382743)
FT                   /locus_tag="RHECIAT_CH0000374"
FT   CDS_pept        complement(382342..382743)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000374"
FT                   /product="putative glutathione-dependent
FT                   formaldehyde-activating protein"
FT                   /note="ypch00146; GO_function: GO:0016846 - carbon-sulfur
FT                   lyase activity; GO_process: GO:0008152 - metabolic process"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000374"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89368"
FT                   /db_xref="GOA:B3PZ74"
FT                   /db_xref="InterPro:IPR006913"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniProtKB/TrEMBL:B3PZ74"
FT                   /protein_id="ACE89368.1"
FT                   /translation="MQISGGCHCGAIRYEAQIDPDWVSICHCTDCQRLTGSAYRVTAPA
FT                   RPGSFTLISGEPRDYSKYGDSGGLSRQFFCPTCGSPLYRTDEEGGAIGIRLGSIDQRRD
FT                   LTPKKQIWCRSALSWVENIGRLPRFDGED"
FT   gene            complement(382753..384282)
FT                   /locus_tag="RHECIAT_CH0000375"
FT   CDS_pept        complement(382753..384282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000375"
FT                   /product="putative carboxypeptidase-related protein"
FT                   /EC_number="3.4.16.-"
FT                   /note="ypch00147; GO_function: GO:0004185 - serine
FT                   carboxypeptidase activity; GO_process: GO:0006508 -
FT                   proteolysis"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000375"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89369"
FT                   /db_xref="GOA:B3PZ75"
FT                   /db_xref="InterPro:IPR001563"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B3PZ75"
FT                   /protein_id="ACE89369.1"
FT                   /translation="MRRRFLFLLAALAASLAPALSPAQESAHSRANAESGVRDGVLKLL
FT                   PADSVTEHELTIGGRKIAYTATAGTLDLFGQDGAQTGAIFYTAYVAKDAGADRPLTFAF
FT                   NGGPGAASAFLHLGLVGPKVLDFGPQGRDGANAKLVDNAHSWLDFTDLVLIDPIGTGWS
FT                   RTVKADDASNYYNVNSDAQSIAKAIALYVAHNNRSNSPKYLLGESYGGFRAAKVASVLQ
FT                   ESQGIVIAGAVMLSPLLEGQLMFNADQFALGAALELPSLAAAELERHNTFDEQKQREAE
FT                   TFALGDYLTTLAGPPPTGASAAAFYGRIAGLTGIPEDIVARNRGFLGNSFVKHSDGGNG
FT                   AVMSPYDASFAAPDPYPESDYDRGDDAILDGFTRAYGGAFTDYARNTLGFRTEMTYSLL
FT                   DSDISRRWEWGGGRGGSRSQASASDDLRQLLASNSAFHLLIAHGYSDLVTPYGVSRYVV
FT                   DHLPPSLAGGRVGLKLYRGGHMFYTNADQRAAFTADAKAFYTTRPASPPAD"
FT   gene            complement(384396..385688)
FT                   /locus_tag="RHECIAT_CH0000376"
FT   CDS_pept        complement(384396..385688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000376"
FT                   /product="probable cyanate transporter protein"
FT                   /note="ypch00148"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000376"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89370"
FT                   /db_xref="GOA:B3PZ76"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B3PZ76"
FT                   /protein_id="ACE89370.1"
FT                   /translation="MSAPSNDLAATLDPADELLIDAEAGRRPPPRATPVQGAADRVLLG
FT                   ASLVLIAFNLRPVFSSASALLPEIRSELGLTALGASLLTTLPVVCLGAFSPLAPRLAQR
FT                   FGSERTLLGVVLLLALGTALRGLSSVPLLFIGTALAGACIAVGNVLLPGLVKRDFATRT
FT                   ALMTGFYTMALCAGAASAAGLTLPVEHALGGSLDGALAIWALPALAVGLIWLPQVLRSS
FT                   GQARRNGFHVKGLWRDRLAWQVTLFMGLQSALAYCVFGWLVPILRERGLDGVTAGAIVS
FT                   LSVMVQAASCLIVPHIAVRGKDQRLINASLCGVAVTALLGLLFAPLSTVWLWAVLQGIG
FT                   QGGLIAAAMTTIVLRSRDPDVAAHLSGMAQCVGYLLAAVGPLIVGLIRGWTGSFSWCAL
FT                   LFVALGLGAAINGWEAGRSVDVNVRAVAKTG"
FT   gene            complement(385685..386362)
FT                   /locus_tag="RHECIAT_CH0000377"
FT   CDS_pept        complement(385685..386362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000377"
FT                   /product="probable transcriptional regulator protein, GntR
FT                   family"
FT                   /note="ypch00149"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000377"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89371"
FT                   /db_xref="GOA:B3PZ77"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B3PZ77"
FT                   /protein_id="ACE89371.1"
FT                   /translation="MRAISRTNLAEEAIEAIRSDILGKRWAVGDKLPNEAALSAMLSVS
FT                   RGTVREAVRVLVSQGYLETRQGSGTYVRSTSDAGRPLTMARRASLRDQFEARLALDVEA
FT                   ARLTAIRKTPETVTELRRLLSERGTYDGGDKAGFIERDLAFHKAVIAASGNRAMVEIYD
FT                   FFSASIADTIAATLGQDIPEPDMRAHADIVDAIETGNPDRADAAVRRFMAPVLAALDRM
FT                   ILS"
FT   gene            386869..387681
FT                   /locus_tag="RHECIAT_CH0000378"
FT   CDS_pept        386869..387681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000378"
FT                   /product="putative glutamine amidotransferase protein"
FT                   /note="ypch00150; GO_process: GO:0008152 - metabolic
FT                   process"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000378"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89372"
FT                   /db_xref="GOA:B3PZ78"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR026869"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:B3PZ78"
FT                   /protein_id="ACE89372.1"
FT                   /translation="MCRWAAYRGNPLYLEELVSSPAHSLIEQSHCATRAKTATNGDGFG
FT                   IAWYGDRPEPGRYRDILPAWSDCNLKSLARQIRSPLFLAHVRAATGGGTRRDNCHPFTH
FT                   DTWSFMHNGQISGFERLRRPMEAMLDDELFNARSGTTDSELMFLLALQFGLREAPVAAM
FT                   AAMVGFVEDLAENIIGSILLRFTAAFSDGNTLYAIRYATDRKAPTLYASPVGAGYCLVS
FT                   EPLNDDVDAWAEIPDGSAVTVGKNGIDVADFRPENRSVAKLQPLAASA"
FT   gene            complement(387787..388998)
FT                   /gene="dfp"
FT                   /locus_tag="RHECIAT_CH0000379"
FT   CDS_pept        complement(387787..388998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dfp"
FT                   /locus_tag="RHECIAT_CH0000379"
FT                   /product="phosphopantothenate-cysteine
FT                   ligase/phosphopantothenoylcysteine decarboxylase protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000379"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89373"
FT                   /db_xref="GOA:B3PZ79"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR005252"
FT                   /db_xref="InterPro:IPR007085"
FT                   /db_xref="InterPro:IPR035929"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:B3PZ79"
FT                   /protein_id="ACE89373.1"
FT                   /translation="MALSGKRILLIISGGIAAYKSLDLIRRLRERGASVRPIMTKGAQE
FT                   FVTPLAVGALAADHVFVDLFSRQDEQDVGHIRLARDCDLVLIAPASADLMAKMANGLAD
FT                   DLASTVLLATARPVLAAPAMNPRMWAHPATRRNAARLREDGIRFVGPMAGEMAESHEAG
FT                   LGRMAEPLDIVAAAETMLEDGEKLLKGRKAIVTSGPTHEPIDPVRYIANRSSGRQGHAI
FT                   AAALAKLGAEVTLVSGPVTIADPVGVHTVHVERAEEMRDAVLAALPADIAVMVAAVADW
FT                   RVASAADQKLKKHPGESIPTLALTENPDILKTVGHHTMRPKLVIGFAAETQDVESNARA
FT                   KLERKGADMIVANDVSPATGIMGGSRNSVKLIRHDGVEQWPDLAKEEVAERLAALIAEH
FT                   FHAW"
FT   gene            complement(389269..390033)
FT                   /locus_tag="RHECIAT_CH0000380"
FT   CDS_pept        complement(389269..390033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000380"
FT                   /product="probable oxidoreductase protein"
FT                   /note="ypch00151; GO_function: GO:0016491 - oxidoreductase
FT                   activity; GO_process: GO:0008152 - metabolic process"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000380"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89374"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B3PZ80"
FT                   /protein_id="ACE89374.1"
FT                   /translation="MNRLNNKVAIVTGASSGIGRVTAKLFAAEGAKVIVGARRQAELDS
FT                   LVAEIRAEGGDAVAVAGDVRSEDYHKALVAAAVTHYGKLDIAFNNAGIIGEAGPSTGVS
FT                   EADFSEALAVNLTASFLAAKHQIGAMAENGGGSVIFTSTFVGYSFAFPGVAAYAASKSG
FT                   LIGLTQALAAEFGPQGVRVNAVLPGAVDTDMYRDMNDTADKQAAVTAMHALKRVATPDE
FT                   VARSVLYLASDDASFVTGTASLVDGGISITRS"
FT   gene            390158..391063
FT                   /locus_tag="RHECIAT_CH0000381"
FT   CDS_pept        390158..391063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000381"
FT                   /product="probable transcriptional regulator protein, LysR
FT                   family"
FT                   /note="ypch00152"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000381"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89375"
FT                   /db_xref="GOA:B3PZ81"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B3PZ81"
FT                   /protein_id="ACE89375.1"
FT                   /translation="MIRVEGIAAFVAVVEAGSVSEAARRLRLSKSVVSERLAELEKALG
FT                   GTLLHRTTRKLSLTEDGAVFLERAGRIVREIEEAAADMAERRGTLSGPIRIAAPVTFGR
FT                   MHLGPALYPFLAEHPEIHLTLDIDDRRVDAASDGYDAIIRNGPLADSRLVAWKLAPSRR
FT                   LLCASPDYLARQGMPSSLADLNSHRGIFYTNRGVADWRFQTPEGAILVRAKPALGINNG
FT                   DMLRDAAIAGLGIALLPAFIAGPAIREGLLAEIDVGHRPEAEFIYMAHPAGRNPSAKLR
FT                   AIADHLKKSFGDPPYWDIAD"
FT   gene            391097..392335
FT                   /locus_tag="RHECIAT_CH0000382"
FT   CDS_pept        391097..392335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000382"
FT                   /product="putative transporter permease protein"
FT                   /note="ypch00153"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000382"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89376"
FT                   /db_xref="GOA:B3PZ82"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B3PZ82"
FT                   /protein_id="ACE89376.1"
FT                   /translation="MPPPVHAVKTVLTGEKHYLTRGTGAYRRASLALFLSGFSTFSLLY
FT                   CVQPLLPIFSQEFSVSPAESSLSLSLSTGFLALAIVCAAAVSEGLGRRSLMSISLLGAA
FT                   LLTIATAFAPNWHLLLVIHALQGLVLGGVPAVAMAYLAEEIDPRGLGATMGLYVGGTAF
FT                   GGMSGRVLTGIFAEYLGWRPALFLVGAIGLAAALGFIALLPPSRNFVRRPGFDPRFHAR
FT                   TWLGHLKNPALPFIFAIAFLAMGSFVTIYNYAGFRLVAPPYGLNQTELGLIFSVYLFGI
FT                   GAASIGGLIGDRIGHFRVLLFGLALTAAGSVLTLFVPLPSIILGIVVLTAGFFMSHSIA
FT                   SGLVGRLAHGTKGHASSLYMLAYYVGSSLMGSAGGWFFAIDGWAAVVAFTLVMLALAFI
FT                   SACVAQRLAREKA"
FT   gene            392332..392718
FT                   /locus_tag="RHECIAT_CH0000383"
FT   CDS_pept        392332..392718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000383"
FT                   /product="putative biphenyl-2,3-diol 1,2-dioxygenase
FT                   protein"
FT                   /note="ypch00154"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000383"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89377"
FT                   /db_xref="GOA:B3PZ83"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B3PZ83"
FT                   /protein_id="ACE89377.1"
FT                   /translation="MIRIDRLDHLVLTVADITATCDFYSRILGMSVETFAEGRKALKFG
FT                   HQKINLHQAGQEFEPKARNPIPGSGDLCFIAETPIADVITHLQASAIVIEEGPVERTGA
FT                   TGGLRSVYFRDPDGNLIEVSNLID"
FT   gene            complement(392749..394410)
FT                   /gene="hutUch"
FT                   /locus_tag="RHECIAT_CH0000384"
FT   CDS_pept        complement(392749..394410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hutUch"
FT                   /locus_tag="RHECIAT_CH0000384"
FT                   /product="urocanate hydratase protein"
FT                   /EC_number="4.2.1.49"
FT                   /note="GO_function: GO:0016153 - urocanate hydratase
FT                   activity; GO_process: GO:0006548 - histidine catabolic
FT                   process"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000384"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89378"
FT                   /db_xref="GOA:B3PZ84"
FT                   /db_xref="InterPro:IPR023637"
FT                   /db_xref="InterPro:IPR035085"
FT                   /db_xref="InterPro:IPR035400"
FT                   /db_xref="InterPro:IPR035401"
FT                   /db_xref="InterPro:IPR036190"
FT                   /db_xref="InterPro:IPR038364"
FT                   /db_xref="UniProtKB/TrEMBL:B3PZ84"
FT                   /protein_id="ACE89378.1"
FT                   /translation="MPKANPRHPKFPIPGGPELRAKGWRQEALLRLLENVLSVGEDPDN
FT                   LVVYAALGKAARNWAAHKGIVKALTEMEEDQTLLIQSGKPIGLVKTHAKAPLVIMANCN
FT                   IVGQWAKAEVFYELQRKGLICWGGLTAGAWQYIGSQGVIQGTYEIFMRIAERRFGGDLA
FT                   GRFVLTAGLGGMGGAQPLAGRMAGAAILCVDIDPERARKRQQIGYLQEIAPDLDTALEM
FT                   IDAAVKDRRAVSVGFVGNAAEVYPEIARRGIVPDIVTDQTSAHDLVYGYVPKGMSLDQV
FT                   RELRDDGQGQLMAASRASIVEHVMAMLDFQKRGAEVFDNGNLIRTQAKEGGVANAFDIP
FT                   IFTEAYLRPLFARAIGPFRWMALSGDESDIGRIDDLLLELFPDNKIITNWIRLAREHVP
FT                   FEGLPARIAWLGHGERTMLARRVNALVAGGKLKGPVAFSRDHLDAGAMAHPNIMTERMK
FT                   DGSDAIADWPLIDAMMLCSSMADLVVVHSGGGGYAGYMTSCGVTVIADGSEAADERLDH
FT                   ALTNDTALGVMRYADAGYEEALDEVVKKDVPYIRLD"
FT   gene            394387..394674
FT                   /locus_tag="RHECIAT_CH0000385"
FT   CDS_pept        394387..394674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000385"
FT                   /product="hypothetical protein"
FT                   /note="yhch00101"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000385"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89379"
FT                   /db_xref="UniProtKB/TrEMBL:B3PZ85"
FT                   /protein_id="ACE89379.1"
FT                   /translation="MTRIGLRHGCSSLGSLFFLYPLWGSEGRVETCGSTPVGGPKGRMR
FT                   GHTAQHSWPFACAQGIRGFAAHPLICPSDIFSRWGEGGKRSRHLPGSDST"
FT   gene            complement(394647..394976)
FT                   /locus_tag="RHECIAT_CH0000386"
FT   CDS_pept        complement(394647..394976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000386"
FT                   /product="hypothetical conserved protein"
FT                   /note="yhch00102"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000386"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89380"
FT                   /db_xref="InterPro:IPR007076"
FT                   /db_xref="UniProtKB/TrEMBL:B3PZ86"
FT                   /protein_id="ACE89380.1"
FT                   /translation="MTRDPGLEELLRDELGDRPGLSETSMFGGRAFLLNGNLLCGARHD
FT                   GMLIRLGRGNDGWALALPGVIQMSMGERVMHGWVRANAEAYGDDALRWRLLDAALAYVE
FT                   SLPGK"
FT   gene            complement(394980..396077)
FT                   /locus_tag="RHECIAT_CH0000387"
FT   CDS_pept        complement(394980..396077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000387"
FT                   /product="hypothetical conserved protein"
FT                   /note="yhch00103"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000387"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89381"
FT                   /db_xref="InterPro:IPR010318"
FT                   /db_xref="InterPro:IPR027479"
FT                   /db_xref="UniProtKB/TrEMBL:B3PZ87"
FT                   /protein_id="ACE89381.1"
FT                   /translation="MGRILVEKDVEAAVKGGSVYAAGGGGWADHGRMLGLAAVNVGKPE
FT                   LVSIEELKDDDWVATAAAIGAPASTTPWEMQGIDYVKAVQLLQEALGEKLSGLIIGQNG
FT                   KSSTLNGWLPSAILGTKVVDAVGDIRAHPTGDMGSIGMAASPEPMIQTAVGGNRAENRY
FT                   IELVVKGATAKISPVLRAAADQSGGFIASCRNPLRASYVRSHAALGGISMALALGEAII
FT                   AAEKRGGAAVIDAICKTTGGHILAEGVISRKDVVYTREAFDIGTVIVGSDAKSVTLHVM
FT                   NEYMAVDDAGGGRLATFPAVITTLSPEGEPLSVGQLREGMQVFILHVPKDIIPLSASVL
FT                   DPTVYPVVERAMGIEIARYALETKA"
FT   gene            complement(396058..397338)
FT                   /locus_tag="RHECIAT_CH0000388"
FT   CDS_pept        complement(396058..397338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000388"
FT                   /product="probable N-carbamoyl-L-amino acid hydrolase
FT                   protein"
FT                   /EC_number="3.5.1.87"
FT                   /note="ypch00155; GO_function: GO:0008237 -
FT                   metallopeptidase activity; GO_process: GO:0006508 -
FT                   proteolysis"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000388"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89382"
FT                   /db_xref="GOA:B3PZ88"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010158"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:B3PZ88"
FT                   /protein_id="ACE89382.1"
FT                   /translation="MSRNLAVNASRIAEDIVALAEITEPGHPWTRRAFSPLFLEGRTYL
FT                   EARMKAAGLETRIDAAGNLIGRRTGRKPWLGTIMLGSHSDTVPDGGRFDGIVGVIAALE
FT                   VARALSDQSIELEHDLEIVDFLAEEVSIFGVSCIGSRGMTGQLPEAWLSRVNGDLDLAG
FT                   GIAQVGGEPGVLQQQKRPDIAAFLELHIEQGPVLEAERKDIGIVTAIAGITRIEITVEG
FT                   RADHAGTTPMDRRADALVAASQLVLDIRNAAAELAKMPGHFAATVGEFRIEPNAANVVP
FT                   SKVVLLIDGRAEIRADMEAFCRWLDGHVEKLATAYGVTIATPKRVSDNQPTPGDAGLLS
FT                   ALEAACERVGAKHRRMASGAGHDTAWIAKVAPAAMIFVPCRGGRSHCADEWADNDDIAL
FT                   GAAVLFEAVREMDKDLKREKVDGTHTG"
FT   gene            complement(397335..398714)
FT                   /gene="pucH"
FT                   /locus_tag="RHECIAT_CH0000389"
FT   CDS_pept        complement(397335..398714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pucH"
FT                   /locus_tag="RHECIAT_CH0000389"
FT                   /product="allantoinase protein"
FT                   /EC_number="3.5.2.5"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000389"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89383"
FT                   /db_xref="GOA:B3PZ89"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B3PZ89"
FT                   /protein_id="ACE89383.1"
FT                   /translation="MDFDLVLQGSVVLPDRILDEGYVAARDGKIAEVGLGVPPSARERH
FT                   LLGKALILPGAIDAQVHSLSQKDQEDFIWSTRSAAAGGVTTIVDMPYDEGDLVCSAAAV
FT                   KRKIDHAGQQARVDFALYGTVDPEEGPARIGEMVEAGVAAFKFSTFGTDPKRFPRIPPA
FT                   LLDACFAAIAPTGLTAGVHNEDDEAVRSYMEQVKASGITDWRAHGLSRPAITELLAMHT
FT                   IFETGAATGCPAHVVHCSLGRGYDIARAYRRDGFAATVECCIHYLTLDEENDVKRLGGK
FT                   AKINPPLRPRAEVEKLWRKVAEGDVWLVSTDHVSWSENRKTNPDMLANASGVPGLEVMV
FT                   PLFVNGAIDRGIPLTWAARLMAENPAKHFRLDHIKGALTPGKDADITVLEPRESVYDAS
FT                   ASGNNVVGWSPYNGIRLPWTVTATYLRGEKIAEGGKVLAEPGTGRFVRPPPRHIIAGAG
FT                   A"
FT   gene            complement(398846..400423)
FT                   /gene="hutHch"
FT                   /locus_tag="RHECIAT_CH0000390"
FT   CDS_pept        complement(398846..400423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hutHch"
FT                   /locus_tag="RHECIAT_CH0000390"
FT                   /product="histidine ammonia-lyase protein"
FT                   /EC_number="4.3.1.3"
FT                   /note="GO_function: GO:0016211 - ammonia ligase activity;
FT                   GO_process: GO:0009058 - biosynthetic process"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000390"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89384"
FT                   /db_xref="GOA:B3PZ90"
FT                   /db_xref="InterPro:IPR001106"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:B3PZ90"
FT                   /protein_id="ACE89384.1"
FT                   /translation="MQHERPGIELSGRPLGFAEMVTIGAGKATVSASATGMARIAIARE
FT                   IVEDAIASGMPVYGSTTGVGAMKDVEWSADELDTFNLGLVRAHHFGTGTPFSCNVVRNA
FT                   MAIRVNTALTGQVGCTPELIEAYIRMLEADVIPVVRRTGSIGCADIGLMGQIGAVLTGV
FT                   GEAVYRGKRMQAADAFRAAGLEPVRMAPRDSLASLSINAVSFAAAAETTRNAAASIRIL
FT                   LATAMMAAGALGASRDPWKAVRHVGTAREALIGAWLCNASEDWNWPVATHVQDPLSLRM
FT                   IAQVFGAVIENLLSTGHKILAATGRSDDNPVVVEGRVMTSGGSLPLDVTILLESAALCM
FT                   AHAARNAFNRCVILGNGQRRDLPVNLVPPGRIATGFGPIIKLAGEIFSRVLSMSGPVSA
FT                   QSLVVAAGLEDEAAFLPLVIERFERQMQALKRLAALEALLSAQAIDILGDEPKGVAGML
FT                   YQVVRKHAAFYTVDRPLSAEVEAIEEELGSDEFLAKLIEQVPIASFDDFFALGSPEPIE
FT                   ERLASRTG"
FT   gene            complement(400514..402088)
FT                   /gene="ubiB"
FT                   /locus_tag="RHECIAT_CH0000391"
FT   CDS_pept        complement(400514..402088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiB"
FT                   /locus_tag="RHECIAT_CH0000391"
FT                   /product="ubiquinone biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000391"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89385"
FT                   /db_xref="GOA:B3PZ91"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR010232"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:B3PZ91"
FT                   /protein_id="ACE89385.1"
FT                   /translation="MSTFGAYFRLWRVGWVLVREGVVSALPSEGLPPSVALAKSFVTIF
FT                   ERSKAKHQKRSDRLAQAVERLGPSYVKIGQFLATRPDVVGVEFANDLSQLQDRMAFFSS
FT                   AAAKANIEGSLGRPIGELYASFGEPIAAASIAQVHPAEVETSQGRKKVAVKIVRPGVRQ
FT                   RFAHDIEAMYLVAHMQERFMPSSRRLRPVEVTKTLEQTTKVEMDLRLEAAALSEIAENT
FT                   DSDPGFRVPKVDWERTGRDVITMEWIDGTRMSDVEGLRAAGHDLNLLADTLIQSFLRHT
FT                   LRDGFFHADMHPGNLFVDADGMIVAVDMGIVGRLGKKERRFLAEILYGFITRDYIRVAE
FT                   VHFEAGYVPGHHNVESFAQAIRAIGEPIHGQPAETISMGKLLTLLFEVTELFDMATRPE
FT                   LVMLQKTMVVVEGVSRMLNPRFNMWKASEPVVGDWIRNNLGPKRIATDLKDGLKAAVKL
FT                   AEAVPEIAAKTEKFHHQLLHISEHGLRFDEETAEAIGKAEARHNRSGKLALWIIALTLL
FT                   YIAWMLS"
FT   gene            complement(402137..402913)
FT                   /gene="ubiE"
FT                   /locus_tag="RHECIAT_CH0000392"
FT   CDS_pept        complement(402137..402913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiE"
FT                   /locus_tag="RHECIAT_CH0000392"
FT                   /product="ubiquinone/menaquinone biosynthesis
FT                   methyltransferase protein"
FT                   /EC_number="2.1.1.-"
FT                   /note="GO_function: GO:0008168 - methyltransferase
FT                   activity"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000392"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89386"
FT                   /db_xref="GOA:B3PZ92"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR023576"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3PZ92"
FT                   /protein_id="ACE89386.1"
FT                   /translation="MSESRTSADGGMETSYGFREVPGGEKQGLVNQVFHKVAKRYDIMN
FT                   DVMSMGMHRVWKDAMIAALNPRKEPGYKVLDVAGGTGDIAFRIVEASGRQAHATVLDIN
FT                   GSMLGVGAERAEKKKLSANLTFVEANAEELPFEAASFDAYTIAFGIRNVPRIDVALAEA
FT                   YRVLKRGGRLLVLEFSEVDMPLLDKIYDAWSFNAIPQFGKAITGDAEPYQYLVESIRKF
FT                   PNQENFAAMIRQAGFSRVSHTNYTGGIAALHSGWKL"
FT   gene            403064..403954
FT                   /gene="fpg"
FT                   /locus_tag="RHECIAT_CH0000393"
FT   CDS_pept        403064..403954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fpg"
FT                   /locus_tag="RHECIAT_CH0000393"
FT                   /product="formamidopyrimidine-DNA glycosylase protein"
FT                   /note="GO_process: GO:0006281 - DNA repair"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000393"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89387"
FT                   /db_xref="GOA:B3PZ93"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR015887"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3PZ93"
FT                   /protein_id="ACE89387.1"
FT                   /translation="MPELPEVETVKRGLAPAMEGARVARLELRRQDLRFPFPEALADRV
FT                   SGRTIVGLGRRAKYLLVDLDDGNTLVSHLGMSGSFRIEEGAASAMPGEFHHARTKDEKH
FT                   DHVVFHLEGQGGPRRVVYNDPRRFGFMDMVRRADLAAHPFFRDLGPEPTGNDLGAAYLA
FT                   ERFRDKAQPLKSALLDQKNIAGLGNIYVCEALWRSHLSPIRAAGTLVTPGGKPKEKLGL
FT                   LVASIRDVIADAIAAGGSSLRDHIQTDGSLGYFQHSFSVYDREGQACGTPGCGGTVARI
FT                   VQAGRSTFYCAACQK"
FT   gene            403974..404747
FT                   /gene="fadB1"
FT                   /locus_tag="RHECIAT_CH0000394"
FT   CDS_pept        403974..404747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadB1"
FT                   /locus_tag="RHECIAT_CH0000394"
FT                   /product="enoyl-CoA hydratase protein"
FT                   /EC_number="4.2.1.17"
FT                   /note="GO_function: GO:0003824 - catalytic activity;
FT                   GO_process: GO:0008152 - metabolic process"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000394"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89388"
FT                   /db_xref="GOA:B3PZ94"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:B3PZ94"
FT                   /protein_id="ACE89388.1"
FT                   /translation="MAYETLIVETRGNVGLVTLNRPQALNALNSTVLKELKVAYAAFHD
FT                   DEAIGAIVITGSERAFAAGADIKEMQSLQFADMYKSDFISGWDDIAKARKPVIAAVSGF
FT                   ALGGGCELAMMCDFIIAAETAKFGQPEITLGVIPGMGGSQRLTRAVGKAKAMDLVLTGR
FT                   MMDAAEAERSGLVSRVVAPERLLDEALAAAEKIASLSQPSVMMAKEAVNRAFETTLEEG
FT                   LRFERRLFHSLFATDDQKEGMAAFVEKRKPAFKHR"
FT   gene            404940..405218
FT                   /gene="rpsT"
FT                   /locus_tag="RHECIAT_CH0000395"
FT   CDS_pept        404940..405218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsT"
FT                   /locus_tag="RHECIAT_CH0000395"
FT                   /product="30S ribosomal protein S20"
FT                   /note="GO_component: GO:0005622 - intracellular;
FT                   GO_component: GO:0005840 - ribosome; GO_function:
FT                   GO:0003723 - RNA binding; GO_function: GO:0003735 -
FT                   structural constituent of ribosome; GO_process: GO:0006412
FT                   - translation"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000395"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89389"
FT                   /db_xref="GOA:B3PZ95"
FT                   /db_xref="InterPro:IPR002583"
FT                   /db_xref="InterPro:IPR036510"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3PZ95"
FT                   /protein_id="ACE89389.1"
FT                   /translation="MANTTSAKKATRKIARRTDVNKARRSRVRTFVRQVEEAIASGDAD
FT                   KAKAAFLAAQPELARAASKGVLHSNTASRKVSRLAARVKALSVSATA"
FT   gene            complement(405697..406107)
FT                   /locus_tag="RHECIAT_CH0000396"
FT   CDS_pept        complement(405697..406107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000396"
FT                   /product="hypothetical protein"
FT                   /note="yhch00104"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000396"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89390"
FT                   /db_xref="UniProtKB/TrEMBL:B3PZ96"
FT                   /protein_id="ACE89390.1"
FT                   /translation="MPACRHRIHLHSAAFQFHRAASAKQPPEHSPPLTGWRHPHEAARL
FT                   PVHSNTAPEGTGAELRCRYRVHAAPSSAFRARLAVDPRFRPTSPNAILLSPIPQPHVKR
FT                   VIAIGTKHPCPVTATLRLKSVKCLKKRKRKAP"
FT   gene            406075..407625
FT                   /gene="dnaA"
FT                   /locus_tag="RHECIAT_CH0000397"
FT   CDS_pept        406075..407625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="RHECIAT_CH0000397"
FT                   /product="chromosomal replication initiator protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000397"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89391"
FT                   /db_xref="GOA:B3PZ97"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:B3PZ97"
FT                   /protein_id="ACE89391.1"
FT                   /translation="MQMNTMTAGGHDNGDAAPQAFGSIRLEMGEAKAEMKQSILFERVS
FT                   ARLKAQVGPDVYASWFARLKLHSVSKSVVRLSVPTTFLKSWINNRYLDLITGLFQAEDP
FT                   EILKIEILVRTATRSGMKAADEVVQPEPAAPAQMRRPASAQPASQAVQQAVSAVAAARP
FT                   ASFGAPLFGSPLDSRFTFDTFVEGSSNRVALAAAKTIAEAGSGAVRFNPLFVHSTVGLG
FT                   KTHLLQAIANAAVQNPRALRVVYLTAEYFMWRFATAIRDNDALTLKDSLRNIDLLIIDD
FT                   MQFLQGKMIQHEFCHLLNMLLDSAKQVVVAADRAPWELESLDPRVRSRLQGGVAIELDA
FT                   PDYEMRLEILKRRLAAARQEDPSLEIPADLLQHVARNITASGRELEGAFNQLIFRRSFE
FT                   PNLSIERVDELLAHLVGSGEPRRVRIEDIQRIVARHYNVSRQELVSNRRTRVIVKPRQI
FT                   AMYLSKTLTPRSFPEIGRRFGGRDHTTVLHAVRKIEELISGDTKLSHEIELLKRLINE"
FT   gene            407789..408871
FT                   /locus_tag="RHECIAT_CH0000398"
FT   CDS_pept        407789..408871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000398"
FT                   /product="probable saccharopine dehydrogenase protein
FT                   (NAD(+), L-lysine-forming)"
FT                   /EC_number="1.5.1.7"
FT                   /note="ypch00156"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000398"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89392"
FT                   /db_xref="GOA:B3PZ98"
FT                   /db_xref="InterPro:IPR005097"
FT                   /db_xref="InterPro:IPR032095"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B3PZ98"
FT                   /protein_id="ACE89392.1"
FT                   /translation="MSFKKIAVLGLGKVGRLAATLLHEGGFEVIGVDAQLPLGDLPFRC
FT                   RTGDISDAQVIGELLSTVEAVLSCLPYHLNIELARAAHLAGIHYFDLTEDVPTTNFIIE
FT                   LSKTARGLMGPQCGLAPGFVGIVGASLADGFDRCRSIRMRVGALPQHPTGLLGYAFNWS
FT                   PEGVVNEYLNDCEVIEGGVRKLVSPMEWHETVYVGGVKLEAFTTSGGLGTMCDTMLGKI
FT                   DNLDYKTMRYPGHMELMNFFFHELLMRDKRALAGEILTNAKPPVEDDVVYVHVAAEGTE
FT                   NGSLRRKEFVRAYYPIEIAGARRTAIAWTTSASVVAVIEMVRDGLLPATGFLHQEHIPL
FT                   EMFLKTPTGSLFKAGATNHG"
FT   gene            complement(408932..410134)
FT                   /gene="hemNch"
FT                   /locus_tag="RHECIAT_CH0000399"
FT   CDS_pept        complement(408932..410134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemNch"
FT                   /locus_tag="RHECIAT_CH0000399"
FT                   /product="oxygen-independent coprophorphyrinogen III
FT                   oxidase protein"
FT                   /EC_number="1.3.99.22"
FT                   /note="GO_function: GO:0003824 - catalytic activity;
FT                   GO_function: GO:0051536 - iron-sulfur cluster binding"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000399"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89393"
FT                   /db_xref="GOA:B3PZ99"
FT                   /db_xref="InterPro:IPR004559"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010723"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:B3PZ99"
FT                   /protein_id="ACE89393.1"
FT                   /translation="MDNFDTPGSPRDAALLPDTGEPGFGVYVHWPFCAAKCPYCDFNSH
FT                   VRHQPVDQERFAAAFLKETAAVRAMSGPKTVTSIFLGGGTPSLMKPETVAAILDGIARH
FT                   WHVPDGIEITMEANPSSVEAERFRGYRAAGVNRVSLGVQALNDRDLKFLGRLHDVADAL
FT                   KAIRLAREIFPRMSFDLIYARPDQTVEEWESELKQAISYAVDHLSLYQLTIEEGTPFYG
FT                   LHKAGKLIVPDGEQSAVLYEATQEITAREGMPAYEVSNHARPGAESRHNLTYWRYGDYA
FT                   GIGPGAHGRLTRGREKIATATERKPEAWLDMVERDGHGILDEERLGHEEQSDELLLMGL
FT                   RLREGVDLARWQQLSGRELDPKREEFLLEHKFIERIGNSRLRCTPSGMLILDSVVADLA
FT                   C"
FT   gene            complement(410144..410788)
FT                   /locus_tag="RHECIAT_CH0000400"
FT   CDS_pept        complement(410144..410788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000400"
FT                   /product="probable nucleoside-triphosphatase protein,
FT                   HAM1-like protein"
FT                   /EC_number="3.6.1.15"
FT                   /note="ypch00157; GO_function: GO:0016787 - hydrolase
FT                   activity"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000400"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89394"
FT                   /db_xref="GOA:B3PZA0"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:B3PZA0"
FT                   /protein_id="ACE89394.1"
FT                   /translation="MRKLETKTIVVASHNAGKIREIQELIGPLGFTAKSAAELNFVEPD
FT                   ETGTSFEENATIKAVASAHAAGMPALSDDSGLVVDALGGDPGVYTANWAEKADGTRDFD
FT                   MAMAKVEKALQDAGATAPEQRTARFVSVLCLAWPDGHTELFRGEVEGNVVWPPRGTQGF
FT                   GYDPVFQPEGYGVTFGEMSGEEKHGWNIGKPQALSHRARAFKLFVETCLEA"
FT   gene            complement(410789..411214)
FT                   /locus_tag="RHECIAT_CH0000401"
FT   CDS_pept        complement(410789..411214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000401"
FT                   /product="putative glyoxalase (lactoylglutathione lyase)
FT                   protein"
FT                   /note="ypch00158"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000401"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89395"
FT                   /db_xref="GOA:B3PZA1"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B3PZA1"
FT                   /protein_id="ACE89395.1"
FT                   /translation="MNPMLEGMLETALYARDLDKAEVFYEDVLGLEKISRAGNRHVFFR
FT                   CGPGVLLIFNPEETVKPPAPNALQVPPHGTSGEGHACFRVSGRNIDAMAERLKAAGVSI
FT                   ESEVHWPNGGRSIYFRDPEGNSLECAEAKIWGIEQDI"
FT   gene            complement(411211..411930)
FT                   /gene="rph"
FT                   /locus_tag="RHECIAT_CH0000402"
FT   CDS_pept        complement(411211..411930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rph"
FT                   /locus_tag="RHECIAT_CH0000402"
FT                   /product="ribonuclease PH protein"
FT                   /EC_number="2.7.7.56"
FT                   /note="GO_function: GO:0000175 - 3'-5'-exoribonuclease
FT                   activity; GO_function: GO:0003723 - RNA binding;
FT                   GO_process: GO:0006396 - RNA processing"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000402"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89396"
FT                   /db_xref="GOA:B3PZA2"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR002381"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR018336"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3PZA2"
FT                   /protein_id="ACE89396.1"
FT                   /translation="MRPSGRKTDQMRKVSFERNFSKHAEGSCLVKFGDTHVLCTASLED
FT                   KTPPWLRNTGKGWVTAEYGMLPRATGERMKREAAAGKQGGRTQEIQRLIGRSLRAVVDL
FT                   QALGERQITLDCDVIQADGGTRTASITGGWIALYDCLKWMESRNMIKVDRVLKDHVAAI
FT                   SCGVFASQAVIDLDYLEDSSAETDANFVMTGAGGIVEIQGTAEGTPFTEEEFTSLMGLA
FT                   KNGIGELVALQKQAIAG"
FT   gene            412058..413146
FT                   /gene="hrcA"
FT                   /locus_tag="RHECIAT_CH0000403"
FT   CDS_pept        412058..413146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hrcA"
FT                   /locus_tag="RHECIAT_CH0000403"
FT                   /product="heat-inducible transcriptional regulator
FT                   (repressor) protein"
FT                   /note="GO_process: GO:0006355 - regulation of
FT                   transcription, DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000403"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89397"
FT                   /db_xref="GOA:B3PZA3"
FT                   /db_xref="InterPro:IPR002571"
FT                   /db_xref="InterPro:IPR021153"
FT                   /db_xref="InterPro:IPR023120"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3PZA3"
FT                   /protein_id="ACE89397.1"
FT                   /translation="MGTRSTSVSDAVAVLDERSREIFRRIVEGYLESGEPLGSRNLSRL
FT                   LPMSLSPASVRNVMSDLEELGLIYSPHISAGRLPTQIGLRFFVDAFMQVGDLSAEDRAN
FT                   IDRQVRAESGGNPVESMMNEASRMLSGISRGAGLVITSKSDPVLKHVEFIRLEPTKALA
FT                   VLVGDHDQVENRIIELPAGVTSSQLTEAANFLNAHMSGQTLPELRKQLSQLKDDVRHEL
FT                   DALSRDLVERGIAVWAGSPDEGKPAQLIIRGRANLLEGLGGAEDLDRLRMLFDDLEKKD
FT                   SLIEILSLAESGSGVRIFIGSENKLFSLSGSSLIVAPYRDDDDRIVGAVGVIGPTRLNY
FT                   SRIVPMVDYTAQLVSRLSRNPL"
FT   gene            413323..413955
FT                   /gene="grpE"
FT                   /locus_tag="RHECIAT_CH0000404"
FT   CDS_pept        413323..413955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="grpE"
FT                   /locus_tag="RHECIAT_CH0000404"
FT                   /product="molecular chaperone heat shock protein"
FT                   /note="GO_function: GO:0000774 - adenyl-nucleotide exchange
FT                   factor activity; GO_function: GO:0042803 - protein
FT                   homodimerization activity; GO_function: GO:0051087 -
FT                   chaperone binding; GO_process: GO:0006457 - protein
FT                   folding"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000404"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89398"
FT                   /db_xref="GOA:B3PZA4"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3PZA4"
FT                   /protein_id="ACE89398.1"
FT                   /translation="MTDETTKNGPDATAADAAADAAAYVENDTVQEETAQPDPLELLKA
FT                   ENSELRDRYLRLAAEMDNLRRRTEREVKDAKSYSVAGFARDMLAVSDNLRRALDAISPE
FT                   AKATADAGLTSLIEGVEMTERAMLSALERHGVRKLEPVGQKFDPNFHQAMFEVPNSEVP
FT                   NNTVVQVVQAGFTIGERVLRPAMVGVAKGGPKPAEAETNSVFDEKDA"
FT   gene            complement(413997..414941)
FT                   /gene="iunH1"
FT                   /locus_tag="RHECIAT_CH0000405"
FT   CDS_pept        complement(413997..414941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iunH1"
FT                   /locus_tag="RHECIAT_CH0000405"
FT                   /product="inosine-adenosine-guanosine preferring nucleoside
FT                   hydrolase protein"
FT                   /EC_number="3.2.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000405"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89399"
FT                   /db_xref="GOA:B3PZA5"
FT                   /db_xref="InterPro:IPR001910"
FT                   /db_xref="InterPro:IPR023186"
FT                   /db_xref="InterPro:IPR036452"
FT                   /db_xref="UniProtKB/TrEMBL:B3PZA5"
FT                   /protein_id="ACE89399.1"
FT                   /translation="MASARKIIIDTDPGQDDAAAIMLAFGSPDELEVLGITTVAGNVPL
FT                   SLTSRNARIVCELCGRPETKVFAGADRPIARKLVTAEHVHGKTGLDGPELAEPTMALQP
FT                   GHSVDFIIETLRREPAGTVTLCTLGPLTNIGMAFQKAPDIIARIRELVMMGGGFFEGGN
FT                   ITPAAEFNIYVDPEAADIVFRSGVPIVMMPLDVTHQLLTRKDRVKRMAEIGTAPAKAMV
FT                   EMLEFFERFDIEKYGSDGGPLHDPTVIAYLLKPALFQGRDCNVEIEVRSELTVGMTVVD
FT                   WWHVTERKRNAKVMRHVDADGFFDLLIERFARI"
FT   gene            415238..415663
FT                   /gene="hsp"
FT                   /locus_tag="RHECIAT_CH0000406"
FT   CDS_pept        415238..415663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hsp"
FT                   /locus_tag="RHECIAT_CH0000406"
FT                   /product="molecular chaperone small heat shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000406"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89400"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR031107"
FT                   /db_xref="InterPro:IPR037913"
FT                   /db_xref="UniProtKB/TrEMBL:B3PZA6"
FT                   /protein_id="ACE89400.1"
FT                   /translation="MSRITPFASPLLLGFDAMEKTLERISKASDGYPPYNIERIAADSG
FT                   APERLRITLAVAGFSEEELDVSTEENQLVIRGRQVEHGERDFLYRGIAARQFQRTFVLA
FT                   DGMQVLGAGLKNGLLSVDLIRPEPARMVKKINISVSQ"
FT   gene            415711..415968
FT                   /locus_tag="RHECIAT_CH0000407"
FT   CDS_pept        415711..415968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000407"
FT                   /product="hypothetical conserved protein"
FT                   /note="yhch00105"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000407"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89401"
FT                   /db_xref="InterPro:IPR009531"
FT                   /db_xref="UniProtKB/TrEMBL:B3PZA7"
FT                   /protein_id="ACE89401.1"
FT                   /translation="MLMKEATSHLTKSELAHIGNGEVAYIRKMRTEEVAKCFPEAPDID
FT                   PNVDLWALFGADGTPILLTDNRSSTFFKAAEDELKTVSLH"
FT   gene            complement(416130..416564)
FT                   /locus_tag="RHECIAT_CH0000408"
FT   CDS_pept        complement(416130..416564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000408"
FT                   /product="hypothetical protein"
FT                   /note="yhch00106"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000408"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89402"
FT                   /db_xref="InterPro:IPR028957"
FT                   /db_xref="UniProtKB/TrEMBL:B3PZA8"
FT                   /protein_id="ACE89402.1"
FT                   /translation="MVYTDVPGGEKLLAWFGKVPTFHDAEIISLSLSRTGTSELKIHGW
FT                   IMTDAVDPNGYFVLDKHAVVTFSLDGVRDLQLDGFSHQNVIAGLILQRATDRGRSGYYA
FT                   EPDDAQDIEIELLPCYGLDGFIRAQKVRISFVPGRPGDAK"
FT   gene            complement(416808..417500)
FT                   /locus_tag="RHECIAT_CH0000409"
FT   CDS_pept        complement(416808..417500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000409"
FT                   /product="probable tRNA (guanine-N(7)-)-methyltransferase
FT                   protein"
FT                   /EC_number="2.1.1.33"
FT                   /note="ypch00159"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000409"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89403"
FT                   /db_xref="GOA:B3PZA9"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B3PZA9"
FT                   /protein_id="ACE89403.1"
FT                   /translation="MERRGRATEAFFGRRKGKALREQQAETLNSLLPAFLVDLSAAPPE
FT                   PLTSLFPVPVETLRLEIGFGGGEHLMHRALERPSTGFIGVEPFVNSMQKLLSRIGETGA
FT                   RNIRVYNDDATQLLDWLPDASLDQIDLLYPDPWPKRKHWKRRFVSKTNLDRFHRVLKPG
FT                   GLFCFASDIDTYVNWTLLKCRDHSGFDWIADNAADWLTPYEGWPSTRYEAKARREGRSS
FT                   AYLTFRKI"
FT   gene            complement(417506..418759)
FT                   /gene="metK"
FT                   /locus_tag="RHECIAT_CH0000410"
FT   CDS_pept        complement(417506..418759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metK"
FT                   /locus_tag="RHECIAT_CH0000410"
FT                   /product="S-adenosylmethionine synthetase protein"
FT                   /EC_number="2.5.1.6"
FT                   /note="GO_function: GO:0004478 - methionine
FT                   adenosyltransferase activity; GO_function: GO:0005524 - ATP
FT                   binding; GO_process: GO:0006730 - one-carbon compound
FT                   metabolic process"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000410"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89404"
FT                   /db_xref="GOA:B3PZB0"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/TrEMBL:B3PZB0"
FT                   /protein_id="ACE89404.1"
FT                   /translation="MRANYLFTSESVAEGHPDKVCDRISDEIVDLVYREAAKTGVNPWG
FT                   VRIACETLATTNRVVIAGEVRLPPSLMKKDKDGNDVINPSKFKAAARRAIKDIGYEQDG
FT                   FHWKKAKIDVLLHSQSADIAQGVDSAADQQGDEGAGDQGIMFGYACKETPDLMPAPIYY
FT                   SHKILQLLATARKKGDGEVAKLGPDAKSQVTVRYVDGKPSEATSIVLSTQHLDDSWDSN
FT                   KVRAVVEPYIREALGELKIADDCKWYINPTGKFVIGGPDGDAGLTGRKIIVDTYGGAAP
FT                   HGGGAFSGKDTTKVDRSAAYAARYLAKNVVAASLADRCTIQLSYAIGVAQPLSIYVDLH
FT                   GTGKGVSEDQVEAAIRENMDLSPSGIRRHLDLNKPIYAKTSAYGHFGRKAGRDGSFSWE
FT                   RTDLVKALKEAVKTKAAA"
FT   gene            complement(418939..419358)
FT                   /locus_tag="RHECIAT_CH0000411"
FT   CDS_pept        complement(418939..419358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000411"
FT                   /product="probable transcriptional regulator protein"
FT                   /note="ypch00160; GO_function: GO:0043565 -
FT                   sequence-specific DNA binding"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000411"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89405"
FT                   /db_xref="GOA:B3PZB1"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B3PZB1"
FT                   /protein_id="ACE89405.1"
FT                   /translation="MIENKKKPNPIDIHVGSRIRLRRTMLGMSQEKLGESLGITFQQIQ
FT                   KYEKGTNRVGASRLQNISSILNVPVSFFFEDAPGEHSGAIGGMAEASSSNYVVDFLSSS
FT                   EGLQLNRAFVKISDPKVRRKVVELVKALAAEADAD"
FT   gene            complement(419510..421114)
FT                   /gene="lnt"
FT                   /locus_tag="RHECIAT_CH0000412"
FT   CDS_pept        complement(419510..421114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lnt"
FT                   /locus_tag="RHECIAT_CH0000412"
FT                   /product="apolipoprotein N-acyltransferase protein"
FT                   /EC_number="2.3.1.-"
FT                   /note="GO_function: GO:0016810 - hydrolase activity, acting
FT                   on carbon-nitrogen (but not peptide) bonds; GO_process:
FT                   GO:0006807 - nitrogen compound metabolic process"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000412"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89406"
FT                   /db_xref="GOA:B3PZB2"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR004563"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3PZB2"
FT                   /protein_id="ACE89406.1"
FT                   /translation="MERLADRVILVWGFKRSLLAIGAGAFAVLALPPFGFFAAMFLSFT
FT                   LLVWLIDGAAASPESGLIGRLWPAFAVGWLFGFGYFVAGLWWLGHALLVDSEEFAWALP
FT                   LAILGLPACLAIFYGLAVALARIFWSDGMGRIAALAAGFGLMEWLRSVILTGFPWNAIG
FT                   YGLMPVPLMMQSAHVIGAMGVTALAVFVFSAPALFGTRQGARTGVALAVLLFAAHLGYG
FT                   AYALYLAPRPAPLPEDKRPVVRLVQPDIDQAAKMDNDADRNAIFETHLKLSAEAPRNGG
FT                   RKPNIIVWPETSIPFILTDNQDALTRIADTLDDDQILIAGAVRAEEMGPGTPVRYYNSI
FT                   YVIDGRGQIIAASDKVHLVPFGEYLPLEELLTELGIQNVVEVPGGFSAAASRHLLALPG
FT                   GLNLYPLICYEIIFPDEMTGDIKDANALLNLTNDAWFGMTPGPYQHFLQARVRAVETGL
FT                   PLIRDANSGISALVNAHGEIIAGLDLGETGFIDATVDSLSEGFGSTYPRQTYFWLTEAL
FT                   LILIALISREGFIFGLN"
FT   gene            complement(421245..422390)
FT                   /locus_tag="RHECIAT_CH0000413"
FT   CDS_pept        complement(421245..422390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000413"
FT                   /product="putative hemolysin protein"
FT                   /note="ypch00161"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000413"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89407"
FT                   /db_xref="GOA:B3PZB3"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:B3PZB3"
FT                   /protein_id="ACE89407.1"
FT                   /translation="MSDFTTKPAADAKDSEPSSSSDEAGSSSRPSGRSQSFWSRAARIL
FT                   RPQQGSRLREDLADALMTDAAGDDAFSPDERAMLHNILRFREVRVADVMVPRADIEAVD
FT                   QNITIGELMILFEESGRSRMPVYADTLDDPRGMVHIRDLLSYVAKQARNKRRGPAKPAV
FT                   AVPAIDVAPENIQKPTRSAKPNFDLARVDLQKTLAEAGIIRKILFVPPSMLASDLLRRM
FT                   QVNRTQMALVIDEYGGTDGLASHEDIVEMVVGDIDDEHDDEEVMFKRVAEDIFVADARV
FT                   ELEEIAEAIGPDFDISEQVDEVDTLGGLIFSALGRIPVRGEVVQALPNFEFHILDADPR
FT                   RIKRLRITRKRHAIRRRAKEAGDITPGSETGDDRPTESTAN"
FT   gene            complement(422387..422902)
FT                   /locus_tag="RHECIAT_CH0000414"
FT   CDS_pept        complement(422387..422902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000414"
FT                   /product="hypothetical conserved protein"
FT                   /note="yhch00107"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000414"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89408"
FT                   /db_xref="GOA:B3PZB4"
FT                   /db_xref="InterPro:IPR002036"
FT                   /db_xref="InterPro:IPR020549"
FT                   /db_xref="InterPro:IPR023091"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3PZB4"
FT                   /protein_id="ACE89408.1"
FT                   /translation="MAELDIQISIENIGWPEEETLLAFCGRVLGAAAVYLRDSEKQPFP
FT                   TMPPEVSLVFTDDASIQDINAEWRGKDKATNVLSFPAFPVQPGKMPGPMLGDIIIARET
FT                   VEREAHELEKSFDDHLTHLLVHGFLHLLGYDHMNSAEAEIMEGLETRILAQLGLSDPYE
FT                   GQDLKMEP"
FT   gene            complement(422902..423954)
FT                   /gene="phoH"
FT                   /locus_tag="RHECIAT_CH0000415"
FT   CDS_pept        complement(422902..423954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoH"
FT                   /locus_tag="RHECIAT_CH0000415"
FT                   /product="phosphate starvation inducible protein"
FT                   /note="GO_function: GO:0005524 - ATP binding; GO_process:
FT                   GO:0016036 - cellular response to phosphate starvation"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000415"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89409"
FT                   /db_xref="GOA:B3PZB5"
FT                   /db_xref="InterPro:IPR003714"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3PZB5"
FT                   /protein_id="ACE89409.1"
FT                   /translation="MNGQELVSSSPRHPRTPSDTNHFVLTFENNRFASELFGQFDQNLK
FT                   LLEERLNIDARARGNSVVISGDVVTTNQARRTLDYLYEKLQKGGSVERSDVEGAIRMAV
FT                   AADDQLSLPTMERKAKLTMAQVSTRKKTIIARTPTQDAYIRALERSELVFGVGPAGTGK
FT                   TYLAVAHAAQLLERGAVEKIILSRPAVEAGERLGFLPGDMKEKVDPYLRPLYDALYDMI
FT                   PADKVDRAITAGVIEIAPLAFMRGRTLANAAIILDEAQNTTSMQMKMFLTRLGENARMI
FT                   VTGDPSQIDLPRGVKSGLVEALQLLNGVEGISIVRFKDTDVVRHPLVGRIVRAYDSTYA
FT                   VDAEDVSRQD"
FT   gene            complement(423973..425382)
FT                   /locus_tag="RHECIAT_CH0000416"
FT   CDS_pept        complement(423973..425382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000416"
FT                   /product="putative 2-methylthioadenine synthetase
FT                   (miaB-like) protein"
FT                   /note="ypch00162"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000416"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89410"
FT                   /db_xref="GOA:B3PZB6"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006463"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3PZB6"
FT                   /protein_id="ACE89410.1"
FT                   /translation="MTQDSALLQAPEPMLRDGSNSRKVFIKTYGCQMNVYDSTRMSDAL
FT                   ARDGYEPTEDMEEADLVLLNTCHIREKAAEKVYSALGRLREMKKKKAADGREMMIGVTG
FT                   CVAQAEGEEILRRAPAVDVVIGPQTYHRLPEALRRAQQGQRVVDTEYAIEDKFEHLPIA
FT                   ESRKIRARGVTAFLTVQEGCDKFCTFCVVPYTRGSEVSRPVSQIVEEAEKLVEAGVREI
FT                   TLLGQNVNAWHGAGPRGEAWSLGDLLYRLAEIPGLARLRYTTSHPRDMDDRLIEAHRDL
FT                   RALMPYLHLPVQSGSDRILKAMNRRHTAAEYLSLIERIRTVRPDIALSGDFITGFPGET
FT                   DADFEDTLRLVEEVRYAQAFSFKYSTRPGTPGAELKDQVPEEIKAERLERLQALLLKQQ
FT                   QEFAESCIGKEIDLLLEKPGRMPGQLIGRSPWLQSVNVDAKASQIGDIIKVRITGTGTN
FT                   SLFAERAEAAV"
FT   gene            complement(425531..426328)
FT                   /gene="olsA"
FT                   /locus_tag="RHECIAT_CH0000417"
FT   CDS_pept        complement(425531..426328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="olsA"
FT                   /locus_tag="RHECIAT_CH0000417"
FT                   /product="1-acyl-sn-glycerol-3-phosphate acyltransferase
FT                   (phospholipid/glycerol acyltransferase) protein"
FT                   /note="GO_function: GO:0008415 - acyltransferase activity;
FT                   GO_process: GO:0008152 - metabolic process"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000417"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89411"
FT                   /db_xref="GOA:B3PZB7"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:B3PZB7"
FT                   /protein_id="ACE89411.1"
FT                   /translation="MIVWLRIVLAAAVILAVSIVLIPLQLLALRFDWRLRRRLPRLWHR
FT                   IICYCLGIRVRVTGRLEDRRPLMLCSNHSSWMDIMVMSAVADVAFIAKIEVADWPIFGM
FT                   LAKLQKSVFVVREERRKTGHQANEIAGRMADGEIIVLFPEGTTSDGNRLLEVKSSLFGA
FT                   AAMAVPASPTGTVVVQPVAIAYTRVHGIPMGRYHRPLAAWPGDIELLPHLIDIVRCGAL
FT                   DAEVSFGEAVEYRADTNRKEVSATIASRIRNLLNSRLRGREIS"
FT   gene            complement(426356..426784)
FT                   /gene="fur"
FT                   /locus_tag="RHECIAT_CH0000418"
FT   CDS_pept        complement(426356..426784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fur"
FT                   /locus_tag="RHECIAT_CH0000418"
FT                   /product="ferric uptake regulation protein"
FT                   /note="GO_function: GO:0003700 - transcription factor
FT                   activity; GO_process: GO:0006355 - regulation of
FT                   transcription, DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000418"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89412"
FT                   /db_xref="GOA:B3PZB8"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B3PZB8"
FT                   /protein_id="ACE89412.1"
FT                   /translation="MSDVAKTLEELCAERGMRMTEQRRVIARILEDSADHPDVEELYRR
FT                   SVKVDAKISISTVYRTVKLFEDAGIIARHDFRDGRSRYETVPEEHHDHLIDLKTGTVIE
FT                   FRSPEIEALQERIAREHGFQLVDHRLELYGIPLKKDDL"
FT   gene            complement(426863..427363)
FT                   /gene="rimI"
FT                   /locus_tag="RHECIAT_CH0000419"
FT   CDS_pept        complement(426863..427363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rimI"
FT                   /locus_tag="RHECIAT_CH0000419"
FT                   /product="ribosomal-protein-alanine N-acetyltransferase
FT                   protein"
FT                   /EC_number="2.3.1.128"
FT                   /note="GO_function: GO:0008080 - N-acetyltransferase
FT                   activity; GO_process: GO:0008152 - metabolic process"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000419"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89413"
FT                   /db_xref="GOA:B3PZB9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B3PZB9"
FT                   /protein_id="ACE89413.1"
FT                   /translation="MTMLEAYLTLKPEFEIIAMEREDCRDVAVLHGERFARPWGDGEFH
FT                   SLLSQETVFGFVARQTNAILKKPLPGFILARQVAGEAEILTIAVQAKAARAGLGWRLMQ
FT                   AAMREARARGGESMFLEVDNGNTAALGLYRKLGFEKVGERQGYYKQENGALSTALVMKR
FT                   VLR"
FT   gene            complement(427360..428022)
FT                   /locus_tag="RHECIAT_CH0000420"
FT   CDS_pept        complement(427360..428022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000420"
FT                   /product="probable O-sialoglycoprotein endopeptidase
FT                   protein"
FT                   /EC_number="3.4.24.57"
FT                   /note="ypch00163; GO_function: GO:0008450 -
FT                   O-sialoglycoprotein endopeptidase activity; GO_process:
FT                   GO:0006508 - proteolysis"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000420"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89414"
FT                   /db_xref="GOA:B3PZC0"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:B3PZC0"
FT                   /protein_id="ACE89414.1"
FT                   /translation="MIVLALDTAGVDCSAAVYDSGRNTVLGEASDMIGKGHAEHLIGIV
FT                   DRALGQADMTLSEVDRLAVTVGPGSFTGIRVGVAAARGFALSLQIPVVGVTTLEVMAAA
FT                   ERERTPGRAVLAAMDAKRDEIYLQSFAADGSPLDAPRAASVADAQAFAAGFDGEITGSA
FT                   TPLLKAGAGGDHANVFPISVVARLGAAAPADAGKPKPLYLRGPDAKPQAGYAIARRV"
FT   gene            complement(428111..428677)
FT                   /gene="nifUch1"
FT                   /locus_tag="RHECIAT_CH0000421"
FT   CDS_pept        complement(428111..428677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nifUch1"
FT                   /locus_tag="RHECIAT_CH0000421"
FT                   /product="nitrogen fixation protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000421"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89415"
FT                   /db_xref="GOA:B3PZC1"
FT                   /db_xref="InterPro:IPR001075"
FT                   /db_xref="InterPro:IPR014824"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="InterPro:IPR035433"
FT                   /db_xref="InterPro:IPR036498"
FT                   /db_xref="UniProtKB/TrEMBL:B3PZC1"
FT                   /protein_id="ACE89415.1"
FT                   /translation="MFIQTEATPNPATQKFLPGKVVMENGTAEFRSAAEAEASPLAARL
FT                   FEIPGVTGVYFGYDFISVSKDNAEWQHLKPAILGSIMEHFMSGKPVMGDASILSEDADA
FT                   GDEFFDEGDESIVLTIKELLETRVRPAVAQDGGDITFRGFKDGKVYLNMKGSCSGCPSS
FT                   TATLKHGVQNLLRHFVPEVQEVIAA"
FT   gene            complement(428787..429278)
FT                   /locus_tag="RHECIAT_CH0000422"
FT   CDS_pept        complement(428787..429278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000422"
FT                   /product="putative universal stress protein"
FT                   /note="ypch00164; GO_process: GO:0006950 - response to
FT                   stress"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000422"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89416"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:B3PZC2"
FT                   /protein_id="ACE89416.1"
FT                   /translation="MVSKRLSRLEGHRRKFMAVIDGTPECQRAVHYAGRRAKNSNGGLV
FT                   LLYVIPNGDFQQWLGVEEIMRAEAREEAEATVAKIAQIVRETIGIEPEIVIREGSAAEQ
FT                   INAVIEEDRDVAILVLAAGSAKEGPGPLVSSVAGRAAAFPIPVTVLPDTLTNEEIDALC
FT                   "
FT   gene            complement(429386..430450)
FT                   /gene="trpS"
FT                   /locus_tag="RHECIAT_CH0000423"
FT   CDS_pept        complement(429386..430450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpS"
FT                   /locus_tag="RHECIAT_CH0000423"
FT                   /product="tryptophanyl-tRNA synthetase protein"
FT                   /EC_number="6.1.1.2"
FT                   /note="GO_function: GO:0004812 - aminoacyl-tRNA ligase
FT                   activity; GO_function: GO:0005524 - ATP binding;
FT                   GO_process: GO:0006418 - tRNA aminoacylation for protein
FT                   translation"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000423"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89417"
FT                   /db_xref="GOA:B3PZC3"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024109"
FT                   /db_xref="UniProtKB/TrEMBL:B3PZC3"
FT                   /protein_id="ACE89417.1"
FT                   /translation="MSEFKKLVFSGVQPTGNLHLGNYLGAIRRFVALQEGNDCIYCVVD
FT                   MHALTAQLVHEDMPSQTRSIAAAFIAAGIDPEKHIVFNQSAVPQHAELAWIFNCVARIG
FT                   WMNRMTQFKDKAGKDREQASLGLYAYPSLMAADILVYRATHVPVGEDQKQHLELARDIA
FT                   MKFNLDYAQHIARTGYGIDITVGDEPVHAYFPMVEPLIGGPAPRVMSLRDGTKKMSKSD
FT                   PSDLSRINLMDDEDAISKKIRKAKTDPDGLPSEIDGLQGRPEADNLVAIYAALADKSKS
FT                   EVLAEFGGQQFSVFKPALVDLAIHVLAPITGEMRRLMDDTSHIDAILRKGGERARARAE
FT                   VTMNQLRDVIGFLY"
FT   gene            complement(430547..430945)
FT                   /locus_tag="RHECIAT_CH0000424"
FT   CDS_pept        complement(430547..430945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000424"
FT                   /product="putative glyoxalase protein"
FT                   /note="ypch00165"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000424"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89418"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B3PZC4"
FT                   /protein_id="ACE89418.1"
FT                   /translation="MTINSLFLVTLVVDDYDRAKAFYCDVLGFDCLQDEPQPQGKRWVV
FT                   VKPRGGDGAAFLLAQAVNVEQRAAIGNQTGGRVGFFLKTDDFARDHAAMVAAGLRFLEE
FT                   PRHEVYGTVAVFADPYGNSFDLIQHAAD"
FT   gene            431133..431561
FT                   /locus_tag="RHECIAT_CH0000425"
FT   CDS_pept        431133..431561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000425"
FT                   /product="hypothetical conserved protein"
FT                   /note="yhch00108"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000425"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89419"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="InterPro:IPR010275"
FT                   /db_xref="UniProtKB/TrEMBL:B3PZC5"
FT                   /protein_id="ACE89419.1"
FT                   /translation="MQNPALLAMAGLFALQSATSAVGQDSKRPAIHLPKHEARLAYTVQ
FT                   TVSVRAGCFPTRLQAILSHIAAKTGRRPIITSGLRPHPSRHGSLHGKCLAADFRMPGLS
FT                   ERTIIAAARSAPGIGGIGSYCNGIIHVDVGPQRRWVDC"
FT   gene            complement(431565..433145)
FT                   /gene="mviN"
FT                   /locus_tag="RHECIAT_CH0000426"
FT   CDS_pept        complement(431565..433145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mviN"
FT                   /locus_tag="RHECIAT_CH0000426"
FT                   /product="virulence factor transmembrane protein"
FT                   /note="GO_component: GO:0016021 - integral to membrane;
FT                   GO_process: GO:0009405 - pathogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000426"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89420"
FT                   /db_xref="GOA:B3PZC6"
FT                   /db_xref="InterPro:IPR004268"
FT                   /db_xref="UniProtKB/TrEMBL:B3PZC6"
FT                   /protein_id="ACE89420.1"
FT                   /translation="MSLVKKFATVGGATLGSRIFGFARETLMAAALGTGPMADVFYAAF
FT                   RFPNLFRRLFAEGAFNAAFVPLFAKEIEANGTDGAKRFSEEVFGVLFSVLLLITIVMEL
FT                   AMPLLVRFVIAPGFADDPEKFSITIRMAAVMFPYLMCMSLTAMMSGMLNSLHHFFAAAI
FT                   APVFLNVVMIGALFYALYTGADPLATAWYLSWGVLVAGLLQLAVVYVGVLAAGMSIGLR
FT                   FPKMTPNVKRLLILAVPAAVTGGITQINQLIGQAIASSRDGAIAALQYADRIYQLPLGV
FT                   VGVAVGVVLLPELARALKAGHLREAGNLQNRSIEFVLFLTIPAAFALWILSDEIIRVLY
FT                   ERGAFHQENTLVVGSILAIYGIGLPAFVLIKALQPGFYAREDTKTPMRFSAIAVATNCA
FT                   TALTLFPYMGAPGIAVAEATAGWISTVLLFTTLLRRGHLTWEWALAKRAALLIVAAAVM
FT                   GAAIVVLKQYFAPWLASGAPLLTKIGTLGLLIAISMLVYFAAAFLIGGANLGMIRRNLN
FT                   RKPAAAEDA"
FT   gene            complement(433156..436062)
FT                   /gene="glnD"
FT                   /locus_tag="RHECIAT_CH0000427"
FT   CDS_pept        complement(433156..436062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnD"
FT                   /locus_tag="RHECIAT_CH0000427"
FT                   /product="[protein-PII] uridylyltransferase protein"
FT                   /EC_number="2.7.7.59"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000427"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89421"
FT                   /db_xref="GOA:B3PZC7"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR010043"
FT                   /db_xref="InterPro:IPR013546"
FT                   /db_xref="UniProtKB/TrEMBL:B3PZC7"
FT                   /protein_id="ACE89421.1"
FT                   /translation="MQTKPAAGREPAARHEQDATPAKAMRDLDFSTILDTELLQNQCDA
FT                   VAEANRNRPDVMRSDLLAVLKKASTEGRQKARAALAADGSGLNCAHRISWLQDQIITVL
FT                   HNFATAHIFPQQKDKFAVTAVGGYGRDTLAPGSDIDLLFLFLPRPAEETHKAVEFMLYV
FT                   LWDMGFKVGHATRTVEECIALSKSDMTIRTAILEMRFICGLQRLETELETRFDKEIVTG
FT                   TGPEFIAAKLAERDERHRKAGDTRYLVEPNVKEGKGGLRDLHTLFWISKYYYHVRDQAE
FT                   LVKLGVLSKHEYRLLEKADDFLWAVRCHMHFLTGKAEERLSFDIQREIAEAFGYHTRPG
FT                   LSAVERFMKHYFLVAKDVGDLTRILCAALEDQQAKSIPGLTGVISRFTHRTRKIAGSVE
FT                   FVEDRGRIALADADVFKRDPVSILRLFHVADINGLEFHPDALKRVTRSLALIDNSLREN
FT                   DESNRLFMSILTSKRDPALILRRMNEAGVLGRFIPDFGKIVAMMQFNMYHHYTVDEHLI
FT                   RTVDVLSEIDKSRSEDLHPLANKLIANIEDREALYVAVLLHDIAKGRLEDHSIAGARVA
FT                   RKLCARFGLSQKQTEIVVWLIEEHLTMSMVAQTRDLTDRKTITDFADRVQSLDRLKMLL
FT                   ILTICDIRAVGPGVWNGWKGQLLRTLYYETELLLAGGFSEVSRKERANAAAEALRAALS
FT                   DWSQKDRNTYTKLHYQPYLLSVPLEDQLRHAHFIRQADKAGQALATMVRTDSFHAITEI
FT                   TVLSPDHPRLLAVIAGACAAAGANIVDAQIFTTSDGRALDTIHVSREFADDADELRRAG
FT                   TIGRMIEDVLSGRKRLPEVIATRTRNRKKSKAFVIPPSVNITNSLSNKFTVIEVECLDR
FT                   PGLLSEITAVLSDLSLDIQSARITTFGEKVIDTFYVTDLVGQKISGDSKRANITARMKA
FT                   VMAEEEDELRERMPSGIIAPAATARTSPPAEKKADSPA"
FT   gene            complement(436198..436473)
FT                   /locus_tag="RHECIAT_CH0000428"
FT   CDS_pept        complement(436198..436473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000428"
FT                   /product="hypothetical protein"
FT                   /note="yhch00109"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000428"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89422"
FT                   /db_xref="UniProtKB/TrEMBL:B3PZC8"
FT                   /protein_id="ACE89422.1"
FT                   /translation="MFMEKLVRETERLSLICSLLDTMRRADRDRNARGWTSPIGLLKMT
FT                   RSCATISELATSIAKAGYRECDRQTLEEILSETRQVLYSLQAEFAS"
FT   gene            complement(436485..439211)
FT                   /gene="mutS"
FT                   /locus_tag="RHECIAT_CH0000429"
FT   CDS_pept        complement(436485..439211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutS"
FT                   /locus_tag="RHECIAT_CH0000429"
FT                   /product="DNA mismatch repair protein"
FT                   /note="GO_function: GO:0005524 - ATP binding; GO_function:
FT                   GO:0030983 - mismatched DNA binding; GO_process: GO:0006298
FT                   - mismatch repair"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000429"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89423"
FT                   /db_xref="GOA:B3PZC9"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR005748"
FT                   /db_xref="InterPro:IPR007695"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR007860"
FT                   /db_xref="InterPro:IPR007861"
FT                   /db_xref="InterPro:IPR016151"
FT                   /db_xref="InterPro:IPR017261"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="InterPro:IPR036678"
FT                   /db_xref="UniProtKB/TrEMBL:B3PZC9"
FT                   /protein_id="ACE89423.1"
FT                   /translation="MNARIDTENEAFSAAELATAESRASATPMMEQYIEIKANNPGSLL
FT                   FYRMGDFYELFFEDALEASRALGITLTKRGQHMGQDIPMCGVPVHAADDYLQKLISLGF
FT                   RVAVCEQVEDPAEAKKRGGKSVVKRDVVRLVTPGTITEEKLLSPSESNYLMALARIRGG
FT                   AEPVLALAWIDISTGVFRLAETESSRLLADILRIDPRELILPDTIFHDPELKPVFDVLG
FT                   RTAVPQPAVLFDSASAEGRIARYFGVSTLDGFGSFSRAELAAAAAAVAYVEKTQIAERP
FT                   PLGQPERESAASTLFIDPATRANLELARTLSGDRNGSLLKAIDRTVTGGGARLLAERLM
FT                   SPLTDPARINARLDSIGFLIDEPSLCGRLRDTLKHVPDMPRALSRLALDRGGPRDLAAI
FT                   RQGLQAASGLADLLATAMLPEELGETLSGLRALPAELETLLAETLADELPLLKRDGGFL
FT                   RDGASGELDEVRALRDQSRRVIAGLQLQYAEETGIRSLKIKHNNILGYFIEVTAGNAGP
FT                   MTDTAEAKARFIHRQTMASAMRFTTTELADLESRIANAADRALSIELEAFDKMTAAVVA
FT                   EAEAIKSGARALAVIDVAAGLALLAEEQAYCRPQVDGSKMFAIEGGRHPVVEQALRRQA
FT                   GGPFVANRCDLSPKDGAKDGAIWLLTGPNMGGKSTFLRQNALIAILAQMGSFVPATSAH
FT                   IGIVDRLFSRVGASDDLARGRSTFMVEMVETAAILNQASDRSLVILDEIGRGTATFDGL
FT                   SIAWAAVEHLHEANRCRGLFATHFHELTVLSEKLGRLSNATMRVKEWDGDVIFLHEVGP
FT                   GAADRSYGIQVARLAGLPASVVARARDVLTRLEDADRKNPASQLIDDLPLFQVAVRRED
FT                   AARGPSNVEEALKAMSLDDMTPREAMDALYNLKKKLK"
FT   gene            439325..441610
FT                   /gene="maeB"
FT                   /locus_tag="RHECIAT_CH0000430"
FT   CDS_pept        439325..441610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="maeB"
FT                   /locus_tag="RHECIAT_CH0000430"
FT                   /product="malate dehydrogenase
FT                   (oxaloacetate-decarboxylating) (NADP(+)) protein"
FT                   /EC_number="1.1.1.40"
FT                   /note="GO_function: GO:0008415 - acyltransferase activity;
FT                   GO_process: GO:0008152 - metabolic process"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000430"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89424"
FT                   /db_xref="GOA:B3PZD0"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR012188"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR015884"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="UniProtKB/TrEMBL:B3PZD0"
FT                   /protein_id="ACE89424.1"
FT                   /translation="MPDIDKKDRPTTSVTDQEALDFHAMGRPGKLEVVPTKPMATQRDL
FT                   SLAYSPGVAVPVKAIAADPQTAYDYTARGNMVAVISNGTAILGLGNLGALASKPVMEGK
FT                   SVLFKRFADVDSIDLEIDTENVDEFINCVRFLGPSFGGINLEDIKAPDCFVIESRLREL
FT                   MDIPVFHDDQHGTAIIAAAGLINALELTGRDLKTTKLVCNGAGAAAIACVELIKAMGFA
FT                   PENIILCDTKGVIYQGRTEGMNQWKSAHAAKTDARTLEEAMKGADVIFGLSQKGAFSAK
FT                   MIRSMADRPIIFAMANPDPEITPEEVARIRDDAIMATGRSDYPNQVNNVLGFPYIFRGA
FT                   LDVRASTINDAMKIAAVNALANLAREDVPDDVVAAYQGNRPRFGAQYIIPVPFDPRLIS
FT                   AIPVAVAQAAIETGVARKVITDMAGYARELSARRDPIASTLASLYERVRRRPKRIVFAE
FT                   AEEEQVLRAALSYANQQLGTALLLGREDLIRATAERAGIDLNRPGLEIVNARISTRVEA
FT                   YIDYLYARLQRHGYLHRDAQRLIHNDRNHFAATMVALGDADGMVTGITRNYSTALEDVR
FT                   RCIDEKPGHRVIGVSLALCRGRTVFVADTAVHDMPTAEQLADIAEEAAGLARRMGYPPR
FT                   VAMLAYSTFGHPSGERSERVREAVKILDKRRVDFEYDGEMAADVALNRKVMEQYPFCRL
FT                   SGPANVLVMPAFHSASISTKMLQELGGSTVIGPILVGLDKAVQITSMGAKDSDIVNMAA
FT                   IAAYGAGS"
FT   gene            441791..442780
FT                   /locus_tag="RHECIAT_CH0000431"
FT   CDS_pept        441791..442780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000431"
FT                   /product="putative transcriptional regulator protein"
FT                   /note="ypch00166; GO_component: GO:0005622 - intracellular;
FT                   GO_function: GO:0003700 - transcription factor activity;
FT                   GO_function: GO:0043565 - sequence-specific DNA binding;
FT                   GO_process: GO:0006355 - regulation of transcription,
FT                   DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000431"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89425"
FT                   /db_xref="GOA:B3PZD1"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR035418"
FT                   /db_xref="UniProtKB/TrEMBL:B3PZD1"
FT                   /protein_id="ACE89425.1"
FT                   /translation="MSENASPNFTARFQGTTFDDMVEALTKGFGSFDAWRNGRDKPLDW
FT                   KVGFWGDERLSLVSNQDSGGWGARTADGTPETLAIIVPRTGALDVAFGRTMAEATPGRL
FT                   LMANNLEPERVSVRAAPHRSDTLSLSWAIIAQTVAAVLETPLTGALDLAPVVDRSTAAG
FT                   QLIFSLAQTMIIGMRNGGPLLHSPIAISNLTQAFADLVVRLVPHRLSHLLDKKIHLIAP
FT                   RHVRRAIEFMHANIAQPLTMQNVADAAGISIRALEVGFRAFKATTPSAYLRTIRLQAVR
FT                   EDLRDPSNRQPLRDICLKWGFFHFGRFAAIYRAAYGENPSDTRRRSDL"
FT   gene            complement(442847..443725)
FT                   /locus_tag="RHECIAT_CH0000432"
FT   CDS_pept        complement(442847..443725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000432"
FT                   /product="hypothetical conserved protein"
FT                   /note="yhch00110"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000432"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89426"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B3PZD2"
FT                   /protein_id="ACE89426.1"
FT                   /translation="MSSIDILNRDVTAEAARPSTAAAQKDGDILGRIGNLETRLARSAR
FT                   EIDAAQAVRYRVFVDEMKAQLPLDAMRRQRDVDAYDAFCDHLLVLDRAIEGDPEDQIVG
FT                   TYRLLRQDVAMANGGFYSASEFEIEGLLAKHPEKRFMELGRSCVLPEYRTKRTVELLWQ
FT                   GNWAYALKHGMSAMFGCASFPGVYLESHALALSFLYHNVLAKDEWAVGALPHLARNMDL
FT                   MPVEAVNPKRALMALPPLIKGYLRLGAMVGSSAVIDHAFNTTDVLIVLPISSISDRYLN
FT                   YYGADAGRFAS"
FT   gene            complement(443834..446113)
FT                   /locus_tag="RHECIAT_CH0000433"
FT   CDS_pept        complement(443834..446113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000433"
FT                   /product="putative two-component sensor histidine
FT                   kinase/response regulator hybrid protein"
FT                   /note="ypch00167; GO_function: GO:0005524 - ATP binding"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000433"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89427"
FT                   /db_xref="GOA:B3PZD3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B3PZD3"
FT                   /protein_id="ACE89427.1"
FT                   /translation="MHNLGQLQERLSAALGGPAAKPHQERMGQPSPRPRAAAPEQTNQR
FT                   QMPAPTRRLLFYWLSGAGLLAATTLMLLAYAGDPLLLAGGLVVLGLAAVGGYLVLTIRR
FT                   RGANKPGRQSLLERNEGAKLFADVHDVLGDITVSRTMDRRIISANDTFRRLTGRLHPEG
FT                   RSCEEIGLAFRPGPIPHCYDVEISTPEGQRIFVWRDVVTRDPADGRLLLHSVARDVTEE
FT                   RLLAQGREQARQKAEYNSAAKSRLLATVSHEVRTPLSGILGMTHLLAETRLTQEQQNYL
FT                   ANIRQSGHALTQLVEDLLDFSTIEVGRFELHPRSESLRKLLESVVEMLAHRAHEKGIEI
FT                   GATVSSDVPQNMSFDPARLRQVLFNVIGNAVKFTQVGGVFIRVSLDAGNLLITVADSGP
FT                   GMTAEEQARVFGEFEQGGTVADKSAGTGLGLAISARIMREFGGALTVASEKGLGSEFTI
FT                   RFPVDVGSERPERRNTLLAGNSVVLLAPAGAARTAIAETITTLGGICHLVGDGETAREK
FT                   LLGMASYGGRPTDIIVDHRMSAEFSAHLADRAEIAALGLRKVLLVNPEERSAHPLDLFD
FT                   AWLIRPLREQSLIDVLRGRMRGMEKRDALNDNQPGFGLSVAETRVAASGLSILLGEDDP
FT                   INAMLVRVVLEKGGHKVRHVEDFETLLDCALGEADARPDIIISDLSMPGGNGIDMLGRL
FT                   RGHERRLDLAPVPVIVLTADKSDESRRQVLLNGANRVMVKPVDPLRLLTEVQAVAALSA
FT                   RRAEAR"
FT   gene            complement(446169..446672)
FT                   /gene="lpsA"
FT                   /locus_tag="RHECIAT_CH0000434"
FT   CDS_pept        complement(446169..446672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpsA"
FT                   /locus_tag="RHECIAT_CH0000434"
FT                   /product="lipoprotein signal peptidase protein"
FT                   /EC_number="3.4.23.36"
FT                   /note="GO_component: GO:0016020 - membrane; GO_function:
FT                   GO:0004190 - aspartic-type endopeptidase activity;
FT                   GO_process: GO:0006508 - proteolysis"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000434"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89428"
FT                   /db_xref="GOA:B3PZD4"
FT                   /db_xref="InterPro:IPR001872"
FT                   /db_xref="UniProtKB/TrEMBL:B3PZD4"
FT                   /protein_id="ACE89428.1"
FT                   /translation="MTEPTHARPALFARPAPILFFIAAAVLIDQIVKIAVDHYLPLQEA
FT                   VPVIPMLALYRTYNLGVAFSMLSGMDGWFIVGMRLVIVAFVVWLWYRTAKDRWLAHLGY
FT                   ALIIAGAIGNLVDRFAYGHVIDYILFYTASWSFAVFNLADSFITIGAACVILDELLLPK
FT                   KAGR"
FT   gene            complement(446669..447529)
FT                   /gene="spoU"
FT                   /locus_tag="RHECIAT_CH0000435"
FT   CDS_pept        complement(446669..447529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoU"
FT                   /locus_tag="RHECIAT_CH0000435"
FT                   /product="rRNA methylase protein"
FT                   /note="GO_function: GO:0003723 - RNA binding; GO_function:
FT                   GO:0008173 - RNA methyltransferase activity; GO_process:
FT                   GO:0006396 - RNA processing"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000435"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89429"
FT                   /db_xref="GOA:B3PZD5"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:B3PZD5"
FT                   /protein_id="ACE89429.1"
FT                   /translation="MSKDFHDQGPRRVGQVKEVTSLANPIIKDIKALTNKKSREESGTF
FT                   LAEGLKLVIDAIELGWTIRTLVYAKAAKGKPLVEQMAAKTVASGGLVLEVSEKVIGSIT
FT                   RRENPQMVVGIFDQRWKPLKDIRPREGETWVALDRVRDPGNLGTIIRTADAAGASGVIL
FT                   VGEATDPFSLETVRATMGSVFAVPVARATPEEFLAWRKSAGVSVVATHLAGAVDYRTID
FT                   YRKKPVVLLMGNEQSGLPEQLAKEADALARIPQQGRADSLNLAVATAVMLFEARRHLLS
FT                   LAEGK"
FT   gene            complement(447526..448623)
FT                   /locus_tag="RHECIAT_CH0000436"
FT   CDS_pept        complement(447526..448623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000436"
FT                   /product="probable SAM-dependent methyltransferase protein"
FT                   /note="ypch00168"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000436"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89430"
FT                   /db_xref="GOA:B3PZD6"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR019614"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B3PZD6"
FT                   /protein_id="ACE89430.1"
FT                   /translation="MKQRERRPGQKKTSGPPGESRRDDRAGRSPKPPARPAAARETARE
FT                   SAAPVTVSRPLMTRTGERPAERVPVILESLGAGDFHLIDSGDGQKLEQYGPYRIIRPEA
FT                   QALWRPSLAPHIWEKVDAVFTGDTDEEGTGRWRFPKAALGETWPLNLLGVDFLGRFTSF
FT                   RHVGVFPEQIVHWSWMKEQVEKAGRPLKVLNLFGYTGVASLVAAAAGAEVTHVDASKKA
FT                   IGWARENQALGRMEKLPIRWICEDAMKFILREERRGSQYDIILTDPPKFGRGPNGEVWH
FT                   LFEHLPLMLDVCREILSPQAAGLVLTAYSIRASFYSIHELMRETMRSAGGAVESGELVI
FT                   REAGLDGKTPGRALSTSLFSRWVPK"
FT   gene            complement(448744..449334)
FT                   /locus_tag="RHECIAT_CH0000437"
FT   CDS_pept        complement(448744..449334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000437"
FT                   /product="putative hydrolase protein, MutT/nudix family"
FT                   /EC_number="3.6.1.-"
FT                   /note="ypch00169; GO_function: GO:0016787 - hydrolase
FT                   activity"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000437"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89431"
FT                   /db_xref="GOA:B3PZD7"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:B3PZD7"
FT                   /protein_id="ACE89431.1"
FT                   /translation="MSDELKPWSVTASRITYEDRWIRLRSDDCLTADGTVVAPFHVLDY
FT                   PDWINVIPLLPDGRVLLTREYRHGRGEIVLGLVAGGVEPSDMRAEDAAMAAARRELREE
FT                   TGYEASTLIKLLTSYPNAANHSNMVTSWLALGLNRAGEPSFDPGEKVDILFADLGAILA
FT                   ELQSGAVIMQSMHVAALYSAEGWLRTQASKGLK"
FT   gene            449441..449896
FT                   /locus_tag="RHECIAT_CH0000438"
FT   CDS_pept        449441..449896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000438"
FT                   /product="hypothetical conserved protein"
FT                   /note="yhch00111"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000438"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89432"
FT                   /db_xref="InterPro:IPR010419"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:B3PZD8"
FT                   /protein_id="ACE89432.1"
FT                   /translation="MDFTGEERIAAPRDMVWAALNDPEIMRGCIPGCQNIERLSPDSFE
FT                   ATIRVKFSLLSATFHGLLTLANVDAPKSYTLSAEGKGGLAGFARGTADVVLEERGAETI
FT                   LHYRGRAELGGKLAQLGVRLLDSTSQRLAEGFFSDFNAAVVAKMAAE"
FT   gene            449950..450384
FT                   /locus_tag="RHECIAT_CH0000439"
FT   CDS_pept        449950..450384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000439"
FT                   /product="putative acetyltransferase protein"
FT                   /EC_number="2.3.1.-"
FT                   /note="ypch00170; GO_function: GO:0008080 -
FT                   N-acetyltransferase activity; GO_process: GO:0008152 -
FT                   metabolic process"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000439"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89433"
FT                   /db_xref="GOA:B3PZD9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B3PZD9"
FT                   /protein_id="ACE89433.1"
FT                   /translation="MTWTIRPPRAEDQEALADIYLSVRRETFVWVDPGKFHREDFAAHT
FT                   NGETIFVCEHADGRLAGFLSLWPEDDFIHMLYISSEFQGVGAGTALLRSLPQWPQHKYR
FT                   LKCLVNNRRAKAFYLSHGFQVTGNGASPEGDYEELSFFPV"
FT   gene            complement(450402..450731)
FT                   /locus_tag="RHECIAT_CH0000440"
FT   CDS_pept        complement(450402..450731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000440"
FT                   /product="hypothetical conserved protein"
FT                   /note="yhch00112"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000440"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89434"
FT                   /db_xref="GOA:B3PZE0"
FT                   /db_xref="UniProtKB/TrEMBL:B3PZE0"
FT                   /protein_id="ACE89434.1"
FT                   /translation="MAKKIINLLILLPLGVILIVFCVANRQSVTLAFNPFRPDDQVLAV
FT                   SAPFFVFLFIALISGMLIGSAATWFSQGKHRKRARTEAKEAIRWQGEADRRTRAEDIAA
FT                   QLPAR"
FT   gene            complement(450893..451192)
FT                   /gene="ihfB"
FT                   /locus_tag="RHECIAT_CH0000441"
FT   CDS_pept        complement(450893..451192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ihfB"
FT                   /locus_tag="RHECIAT_CH0000441"
FT                   /product="integration host factor beta-subunit protein"
FT                   /note="GO_function: GO:0003677 - DNA binding"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000441"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89435"
FT                   /db_xref="GOA:B3PZE1"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR005685"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3PZE1"
FT                   /protein_id="ACE89435.1"
FT                   /translation="MIKSELVQIVAARNPHLYHRDVENIVNAVLDEITDALAAGNRVEL
FT                   RGFGAFSVKNRPSRSGRNPRTGDTVFVEEKWVPFFKTGKELRERLNPGQADEED"
FT   gene            complement(451222..452172)
FT                   /gene="sppA"
FT                   /locus_tag="RHECIAT_CH0000442"
FT   CDS_pept        complement(451222..452172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sppA"
FT                   /locus_tag="RHECIAT_CH0000442"
FT                   /product="proteinase IV protein"
FT                   /EC_number="3.4.21.-"
FT                   /note="GO_function: GO:0008233 - peptidase activity;
FT                   GO_process: GO:0006508 - proteolysis"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000442"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89436"
FT                   /db_xref="GOA:B3PZE2"
FT                   /db_xref="InterPro:IPR002142"
FT                   /db_xref="InterPro:IPR004635"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:B3PZE2"
FT                   /protein_id="ACE89436.1"
FT                   /translation="MDSSIIADRRRLRRKLGFWRIVAVALVVALGLAFYGFAFGGAGTE
FT                   RPHIAHVTISGLIVDDDELLERLKKVETSDQVKAAVISISSPGGTTFGGEKIFKAIRAI
FT                   SAKKPVVSDVRTLAASAGYMIATAGDTIIAGDSSITGSIGVIFQYPQIQPLLDKIGVSL
FT                   QEIKSSPLKAEPSPFHEASEEAKAMIRNMVVDSYNWFVDLVADRRKLPRDEVLKLADGT
FT                   IYTGRQALKMKLIDTIGGEPEIRAYLKSRGVDTDLPMVDWDKKSNTPFLLAGAVSRLIT
FT                   IFGYDDLVKGQDINGILPPKLLLDGLLSVWQVGHD"
FT   gene            452396..453061
FT                   /locus_tag="RHECIAT_CH0000443"
FT   CDS_pept        452396..453061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000443"
FT                   /product="hypothetical conserved protein"
FT                   /note="yhch00113"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000443"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89437"
FT                   /db_xref="GOA:B3PZE3"
FT                   /db_xref="InterPro:IPR010664"
FT                   /db_xref="UniProtKB/TrEMBL:B3PZE3"
FT                   /protein_id="ACE89437.1"
FT                   /translation="MLDTLKNNGNAAYVGSGRSAYGDALFHSARVRRLKILLPVAALIV
FT                   AAGLTAVALVSIYLPENVKFEGAKIENGKVVMEKPAIAGRNSDGINYSMLAERALQDIR
FT                   NPDLITLETIKAAVPMNDGLIARVVASTADYNRATDNLHMTAPFTLVLSSGLNAQFQSA
FT                   RLDIKGGNMRSDDPVTITKDNASIVAKTLEITDKGRVITFEGNVRMNVDPSTIHKQGT"
FT   gene            453077..453715
FT                   /locus_tag="RHECIAT_CH0000444"
FT   CDS_pept        453077..453715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000444"
FT                   /product="hypothetical conserved protein"
FT                   /note="yhch00114"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000444"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89438"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="UniProtKB/TrEMBL:B3PZE4"
FT                   /protein_id="ACE89438.1"
FT                   /translation="MTKDCRISACKTGVAFIAGAFALILTVSGAAAQQATTMSGMKLSN
FT                   DQPIQIESDKLEIHDQEHTALFTGKVKVVQGTTTMQSGKMTVYYKDKAAKPAADGAQPA
FT                   AQPEKSASLASGSADIDKILVTDKVLLTSGTQTATADDGKFDMASQTFTLTADQGNKVI
FT                   LSDGPNVFTGCKLTVHMQTGQAELESCGGRVQIQLDPKSQPNAQQQKQN"
FT   gene            453757..454533
FT                   /locus_tag="RHECIAT_CH0000445"
FT   CDS_pept        453757..454533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000445"
FT                   /product="probable amino acid ABC transporter, ATP-binding
FT                   protein"
FT                   /note="ypch00171; GO_function: GO:0005524 - ATP binding;
FT                   GO_function: GO:0016887 - ATPase activity"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000445"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89439"
FT                   /db_xref="GOA:B3PZE5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030921"
FT                   /db_xref="UniProtKB/TrEMBL:B3PZE5"
FT                   /protein_id="ACE89439.1"
FT                   /translation="MFGQPEPQAAGAADKSRYQGTLIARGLTKTYATRRVVNGVSLVVR
FT                   RGEAVGLLGPNGAGKTTCFYMITGLVPVDEGTIEIDGNDVTTMPMYRRSRLGVGYLPQE
FT                   ASIFRGLTVEENIRAVLEVHVKDKAEREQKLNELLEEFHIQKLRKSAAVALSGGERRRL
FT                   EIARALATDPTFMLLDEPFAGVDPISVADIQNLVHHLTARGIGVLITDHNVRETLGLID
FT                   RAYIIHAGEVLTHGRANDIVNNPEVRRLYLGDNFSL"
FT   gene            454738..456297
FT                   /gene="rpoNch"
FT                   /locus_tag="RHECIAT_CH0000446"
FT   CDS_pept        454738..456297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoNch"
FT                   /locus_tag="RHECIAT_CH0000446"
FT                   /product="RNA polymerase sigma factor protein (sigma-54)"
FT                   /note="GO_function: GO:0003677 - DNA binding; GO_process:
FT                   GO:0006352 - transcription initiation"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000446"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89440"
FT                   /db_xref="GOA:B3PZE6"
FT                   /db_xref="InterPro:IPR000394"
FT                   /db_xref="InterPro:IPR007046"
FT                   /db_xref="InterPro:IPR007634"
FT                   /db_xref="InterPro:IPR038709"
FT                   /db_xref="UniProtKB/TrEMBL:B3PZE6"
FT                   /protein_id="ACE89440.1"
FT                   /translation="MALSANLFLRQSQSLVMTPQLMQSIQLLQMTHFELNQFIAQEVEK
FT                   NPLLEFPSNDGEAGDERGAGEDEPFGQPSEDAGSDDGADSRAEALSSDWYDNGGSESTG
FT                   RLNDELDANYTNVFPDDGGPQRLDAPELVGQWKSMPGSAEGADYDLDDFVAGQLSLRDH
FT                   LAQQIPFVLPDMTDRLIAQNFVDQLDDAGYLQTDLVETGERLGTSLEQVEHVLAALQTL
FT                   DPPGVFARSLAECLAIQLRQKDRYDPAMQALVANLELLARRDFATLKRLCGVDEEDLLD
FT                   MLGEIRQLNPKPGSGFEAGVSEAIMPDVVVRPSADGGWLVELNPDTLPRVLVNQSYFAR
FT                   VRGNGEDHAFLSECLQSANWLTRSLDQRAKTIMKVASEIVRQQDAFLLNGVDHLRPLNL
FT                   KTVAEAIKMHESTVSRVTSNKYMLTPRGLFELKYFFTVSISAVEGGDSHSAEAVRHKIR
FT                   ALIMQESPDAVLSDDDIVDMLKKGGIDLARRTVAKYREAMNIASSVQRRREKRALAKVA
FT                   GF"
FT   gene            456385..457299
FT                   /locus_tag="RHECIAT_CH0000447"
FT   CDS_pept        456385..457299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000447"
FT                   /product="putative permease protein"
FT                   /note="ypch00172; GO_component: GO:0016020 - membrane"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000447"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89441"
FT                   /db_xref="GOA:B3PZE7"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B3PZE7"
FT                   /protein_id="ACE89441.1"
FT                   /translation="MMTPQNPKPARELVLLLVLATLWGSSYTFIKIGVETIPPVTLIAA
FT                   RTLIAGAILLAVLRHRRVRLPRDPAIWRRFFVQACLNSVIPFTLIAWAEQSVDAGLAVI
FT                   LNSATPIFTFLLTVVMTRHEPATLRKLFGVVAGLAGICLVIGVEALGGLGESLIAQLAI
FT                   ILATICYAGAAIFSKNFKGLDPAVPAAGSLISGAVILMPVSLLVDRPWTLDPSAESMLA
FT                   LLALSAFSTALAFAIYFRLVQTLGSVGTTSQAYLRVPIGVAIGIVFLGERLSPTAWIGL
FT                   ICVILGVIAMTIPARRTTQARSA"
FT   gene            457529..458167
FT                   /locus_tag="RHECIAT_CH0000448"
FT   CDS_pept        457529..458167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000448"
FT                   /product="probable sigma 54 modulation protein"
FT                   /note="ypch00173"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000448"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89442"
FT                   /db_xref="GOA:B3PZE8"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR032528"
FT                   /db_xref="InterPro:IPR034694"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="InterPro:IPR038416"
FT                   /db_xref="UniProtKB/TrEMBL:B3PZE8"
FT                   /protein_id="ACE89442.1"
FT                   /translation="MDEPEAWRKLIPANDHKKGNSMSVRVSGKHMEIGESFRQKIEDQI
FT                   GMAITKYFDGGYSGQVTVVKASSRFSADCKLHLDSGVVLHAAGEATDPQLAFDAASERI
FT                   EKRLRRYKRKLKDHHAGNHLNGFAEVSYTVMDSVPDHEDEIPDDFAPAIVAESTKQLKT
FT                   MSVATAVMALDMTDEPLLLFRSPGKEHLNIVYRRHDGNIGWIDSANIKG"
FT   gene            458242..458706
FT                   /gene="ptsN"
FT                   /locus_tag="RHECIAT_CH0000449"
FT   CDS_pept        458242..458706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptsN"
FT                   /locus_tag="RHECIAT_CH0000449"
FT                   /product="protein-N(pi)-phosphohistidine-sugar
FT                   phosphotransferase protein (enzyme II of the
FT                   phosphotransferase system)"
FT                   /EC_number="2.7.1.69"
FT                   /note="GO_function: GO:0005351 - sugar porter activity;
FT                   GO_process: GO:0006810 - transport; GO_process: GO:0009401
FT                   - phosphoenolpyruvate-dependent sugar phosphotransferase
FT                   system"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000449"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89443"
FT                   /db_xref="GOA:B3PZE9"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR006320"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:B3PZE9"
FT                   /protein_id="ACE89443.1"
FT                   /translation="MALADLLHQDAIIPALRVNSKKQLLQELAARAARITGLSEREIFD
FT                   VILQRERLGSTGVGNGIAIPHGKLVNIHSIVGIFARLEQPVDFEALDDQPVDLVFLLLA
FT                   PEGAGADHLKALSRIARVLRDHDLVAKLRATDSASAIYAFLNEEQTSNAA"
FT   gene            complement(458780..461119)
FT                   /locus_tag="RHECIAT_CH0000450"
FT   CDS_pept        complement(458780..461119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000450"
FT                   /product="probable methyl-accepting chemotaxis protein"
FT                   /note="ypch00174; GO_component: GO:0016020 - membrane;
FT                   GO_function: GO:0004871 - signal transducer activity;
FT                   GO_process: GO:0006935 - chemotaxis; GO_process: GO:0007165
FT                   - signal transduction"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000450"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89444"
FT                   /db_xref="GOA:B3PZF0"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:B3PZF0"
FT                   /protein_id="ACE89444.1"
FT                   /translation="MFIFRMKSLAAKLLVITGIAIALVLIVSNFFLIGQTRDRVQTLTM
FT                   DQANLEAKSIANEIAANVGELASAARTMSGVIGRGHEGKSLDRKGMINVLKANLEQNAF
FT                   AFGSWFCEQLGALDGKTTEIANNNDEGTNKNGAFTPYWSKTKDGGVQYSTFDNDYTAEW
FT                   WKLAADSGRGAITTPYLAEGTDVPTLLTSIAYPVTAGGKMIGLAGVDISLKSLTDKLQA
FT                   LHPFGSGRVTLLSQAGNWIVAPIPDLMTKQYDGEGADVVKAALSNKEPGLVRNLTYDGL
FT                   DPFDRVVYPFAVPGVNATWVVLVDVPHTAINAPVKDQTYMMIINGLIVLGAVMLALYFA
FT                   VRSLVQRPLGGLVASVKALSDGHYEQPVAAQDRSDEVGSVAKALEGFRFALADTRRLED
FT                   EAARERQAAEAERGRSESERQESVSLQRRIVSIVGAGLSELSRGNLGHRIIDDFPGEYG
FT                   KLKQDFNAALASLEETINTMTLSVANIGSGTGEISNSASDLAKRTEQQAASLEETAAAL
FT                   NELTAQVDSSADNARTAADNVSLACQDAERSGEVVQKAIASMQGIEQSSTEVSRIIGVI
FT                   DEIAFQTNLLALNAGVEAARAGEAGKGFAVVAQEVRELAQRSANAAKEIKTLINTSAVQ
FT                   VKEGVDLVGRAGGTLHKIAEQVMGINDLIRQISASASEQAVGLKEINQAMNQMDQVTQQ
FT                   NAAMVEEATAASVALNDEAQTLKALATRFRVSGSGNAAQLNAVAQQMRAPAASAASPRI
FT                   AAPAARRPAASSHGSAAVAQDSWEEF"
FT   gene            complement(461413..462312)
FT                   /gene="rbsK1"
FT                   /locus_tag="RHECIAT_CH0000451"
FT   CDS_pept        complement(461413..462312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbsK1"
FT                   /locus_tag="RHECIAT_CH0000451"
FT                   /product="ribokinase protein"
FT                   /EC_number="2.7.1.15"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000451"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89445"
FT                   /db_xref="GOA:B3PZF1"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011877"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:B3PZF1"
FT                   /protein_id="ACE89445.1"
FT                   /translation="MITVFGSINMDLIATTDRLPKPGETVAGNGFTTAAGGKGANQALA
FT                   ARRAGRYVHMAGAVGKDGFAADALALLDDAGTDLSLVKHVDGPTGTALILVGGDGENMI
FT                   AVVPGANGLVTAADAETAVGKMSEGDILMLQLEVPVDAVECALSEARVRGVTSILNLAP
FT                   LTPDAPRLGRLADIVIANETEFERLAGQDGMDAEAREAALHRLHQETGQTLIVTLGGDG
FT                   VTAIRDGVISRAQGLKIEPVDTVGAGDTFCGYFTASLDEGLDFASALRRAAVAGSLACL
FT                   KAGAQPSIPLSQDVADRI"
FT   gene            complement(462398..463621)
FT                   /locus_tag="RHECIAT_CH0000452"
FT   CDS_pept        complement(462398..463621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000452"
FT                   /product="putative DNA recombination protein"
FT                   /note="ypch00175"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000452"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89446"
FT                   /db_xref="GOA:B3PZF2"
FT                   /db_xref="InterPro:IPR003798"
FT                   /db_xref="UniProtKB/TrEMBL:B3PZF2"
FT                   /protein_id="ACE89446.1"
FT                   /translation="MTVASESLSASVASISPAMLALAGGVLAALILLVIVLFLRAAGLR
FT                   REQAEEADLRARESAMRMAELLKIQAEMQGRITAMAEVFGARQSELNQAINQRLDGMSQ
FT                   RMSSTISEQTKSTHENLQRLQERLAVIDAAQNNIQTLAKDVVGLQAILSNKQTRGAFGQ
FT                   SRMETIVADGLPMGAYAFQQTLSNGSRPDCTIRMPNGAPPLVIDAKFPLEAWNAIRDAG
FT                   SPEAAKLAGQQFRRDMEIHIRDIAEKYLIQGETQDIAFLFVPSESIFAELHENFEPVVQ
FT                   KAHRARIVIVSPSLLMLSIQVIQAVLKDQRMRAQAHLIQGEVALLMDDLGRLDERVRKL
FT                   QGHFAMAQKDIDMVVTSADKLTRRGAKIEALEFEAGGDVRPVRDEETPAKSVESRTGLL
FT                   KLRVVDEE"
FT   gene            463825..465321
FT                   /locus_tag="RHECIAT_CH0000453"
FT   CDS_pept        463825..465321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000453"
FT                   /product="probable methyl-accepting chemotaxis protein"
FT                   /note="ypch00176; GO_component: GO:0016020 - membrane;
FT                   GO_function: GO:0004871 - signal transducer activity;
FT                   GO_process: GO:0006935 - chemotaxis; GO_process: GO:0007165
FT                   - signal transduction"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000453"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89447"
FT                   /db_xref="GOA:B3PZF3"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="InterPro:IPR039379"
FT                   /db_xref="UniProtKB/TrEMBL:B3PZF3"
FT                   /protein_id="ACE89447.1"
FT                   /translation="MTSQQTDSALKQRLDFIELDEAARKSMRDLRPVISELVGGALDKF
FT                   YAKIARTPAVSSFFTDKSQVAHAKKRQQDHWANLAGGSFDESYVDGVTAVGRTHARIGL
FT                   EPRWYIGGYALVMSELVKGIMEKQWPSVFARQQGRQLAEKLSAVIKSAMLDMDYSISVY
FT                   LETLEAKRRALEEERAKAQSDQAIALEQLRRGLEALSNGDLEATLPCDLPGDFRQMAEH
FT                   YNRAVSALRQSFASVRDTSGQIMSGADVISNATNDLALRTAQQAAGVEESSAALQQLSV
FT                   SVGQTAANAEKASDAVRETQQKAKNSGELVTSAVSAMAGIEKSSTEISKIIGVIDEIAF
FT                   QTNLLALNAGVEAARAGDAGKGFAVVAQEVRQLAQRTAEAAKEIKNLISQSSTQVNEGV
FT                   GIVSSTGEALNDMISRIDIINRFVADIAAAARDQATGVNEVSVAIRSMGEITQQNSGMV
FT                   EHTSAETRRLKDEVEKLIELLRRFRARPEGRSVAATRRAA"
FT   gene            465421..465936
FT                   /gene="def1"
FT                   /locus_tag="RHECIAT_CH0000454"
FT   CDS_pept        465421..465936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="def1"
FT                   /locus_tag="RHECIAT_CH0000454"
FT                   /product="peptide deformylase protein"
FT                   /EC_number="3.5.1.88"
FT                   /note="GO_function: GO:0005506 - iron ion binding;
FT                   GO_function: GO:0042586 - peptide deformylase activity;
FT                   GO_process: GO:0006412 - translation"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000454"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89448"
FT                   /db_xref="GOA:B3PZF4"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:B3PZF4"
FT                   /protein_id="ACE89448.1"
FT                   /translation="MTIKPLIILPDPLLRQLSKPIERVDADLQRLADDMLETMYDAPGI
FT                   GLAAIQIGVPRRMLVIDVSREGEEKQPQVFINPEIVKSSDERSVYEEGCLSIPDYYAEV
FT                   ERPAVVSVKYLDRNGKEQTVEADGLLATCLQHEIDHLNGVLFIDHISRLKREMVIKKFT
FT                   KAAKSKAL"
FT   gene            466000..466260
FT                   /locus_tag="RHECIAT_CH0000455"
FT   CDS_pept        466000..466260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000455"
FT                   /product="probable plasmid stabilization protein"
FT                   /note="ypch00177"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000455"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89449"
FT                   /db_xref="GOA:B3PZF5"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:B3PZF5"
FT                   /protein_id="ACE89449.1"
FT                   /translation="MGDLLIRDVPDAMKRQLQESAQRNGRSLSEEAIEIIRRQVAVGRS
FT                   GASAGQRLRSLMSDEKLTDEEVESIAASRHEPDREPPRFDT"
FT   gene            466257..466676
FT                   /gene="stdB"
FT                   /locus_tag="RHECIAT_CH0000456"
FT   CDS_pept        466257..466676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="stdB"
FT                   /locus_tag="RHECIAT_CH0000456"
FT                   /product="plasmid stabilization protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000456"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89450"
FT                   /db_xref="GOA:B3PZF6"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:B3PZF6"
FT                   /protein_id="ACE89450.1"
FT                   /translation="MIVLDTNVISELQGRTRSERILNWLDGYDVEMLFLTTIAVAEMRY
FT                   GLELLDDGRRKATLISDFNRIESEFAGRILGFSLVAANRYGLLAAQRRKMGRPMETKDA
FT                   IIAAICLANGATLATRNTRDFEGLDLKLVNPFEDG"
FT   gene            466697..467632
FT                   /gene="fmt"
FT                   /locus_tag="RHECIAT_CH0000457"
FT   CDS_pept        466697..467632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fmt"
FT                   /locus_tag="RHECIAT_CH0000457"
FT                   /product="methionyl-tRNA formyltransferase protein"
FT                   /EC_number="2.1.2.9"
FT                   /note="GO_function: GO:0016742 - hydroxymethyl-, formyl-
FT                   and related transferase activity; GO_process: GO:0009058 -
FT                   biosynthetic process"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000457"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89451"
FT                   /db_xref="GOA:B3PZF7"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3PZF7"
FT                   /protein_id="ACE89451.1"
FT                   /translation="MSLSIIFMGTPEFSVPTLRLLVDAGHRIVAVYTQPPRPGGRRGLD
FT                   LQKSPVHQAAELLGLPVFTPVNFKDAGERERFAAFKADVAVVVAYGLLLPEAILNGTRD
FT                   GCYNGHASLLPRWRGAAPIQRAIMAGDDKTGMMVMKMDKGLDTGAVALSREVEIGPNMT
FT                   AGELHDRLMQVGAKAMAEAMVKLEMNDLPLTPQRQDGVLYAAKIDKAETRIDFARPARD
FT                   VHNHIRGLAPFPGAWFELEIGGKPERVKVLGSELAEGQGVAGQLLTDDLVVACASGAVR
FT                   LTRLQKAGGKPLAASDFLRGTPLAAGTRLS"
FT   gene            467632..468432
FT                   /gene="truA"
FT                   /locus_tag="RHECIAT_CH0000458"
FT   CDS_pept        467632..468432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="truA"
FT                   /locus_tag="RHECIAT_CH0000458"
FT                   /product="tRNA-pseudouridine synthase I protein"
FT                   /EC_number="5.4.99.12"
FT                   /note="GO_function: GO:0004730 - pseudouridylate synthase
FT                   activity; GO_process: GO:0008033 - tRNA processing"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000458"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89452"
FT                   /db_xref="GOA:B3PZF8"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:B3PZF8"
FT                   /protein_id="ACE89452.1"
FT                   /translation="MPRYRMTVEYDGGPYVGWQRQENGPSVQGAIEAAVLSLTGETVSV
FT                   RGAGRTDSGVHAMGQVIHADLSKQWSPYQLQNAMNAHLRLAGERVSILDVEAVPEFFDA
FT                   RFSALRRHYLYRIVSRRAPLALEAGKAWWVPKTLDHEVMHAAAQRLVGRHDFSTFRSAH
FT                   CQANSPVRTLDRLDVTRSGALIEIRATAQSFLHNQIRSFAGTLKLAGEGKWTPDDVEAA
FT                   LEARDRKACGPVAPPDGLYFLQVDYPEVITDRRRPADESDDDLS"
FT   gene            complement(468465..469061)
FT                   /locus_tag="RHECIAT_CH0000459"
FT   CDS_pept        complement(468465..469061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000459"
FT                   /product="hypothetical conserved protein"
FT                   /note="yhch00115"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000459"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89453"
FT                   /db_xref="GOA:B3PZF9"
FT                   /db_xref="UniProtKB/TrEMBL:B3PZF9"
FT                   /protein_id="ACE89453.1"
FT                   /translation="MPGLREVQYYLAGLWLLIRMDPRGFRFLDLSERGVNRSFWAMVWC
FT                   LPPMGISWLWWRQAFLRSMPPEADVTLAFFIRLGLVEIANWIVPLVFAGLLLLAFRMGE
FT                   RFAPVVVSVNWLGVPLSYINGLLLALVFFLPGAVGLVSLLLLAFMLAQVFVLARILRMI
FT                   CHDHALMVGALTLVLLVPSMILSEYLQHFLGIYPA"
FT   gene            complement(469048..470277)
FT                   /gene="dapE2"
FT                   /locus_tag="RHECIAT_CH0000460"
FT   CDS_pept        complement(469048..470277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapE2"
FT                   /locus_tag="RHECIAT_CH0000460"
FT                   /product="succinyl-diaminopimelate desuccinylase protein"
FT                   /EC_number="3.5.1.18"
FT                   /note="GO_function: GO:0008237 - metallopeptidase activity;
FT                   GO_process: GO:0006508 - proteolysis"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000460"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89454"
FT                   /db_xref="GOA:B3PZG0"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR005941"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:B3PZG0"
FT                   /protein_id="ACE89454.1"
FT                   /translation="MSLPFPPDSSTAMTATDPVANLQTLIRCPSVTPAEGGALTALDAM
FT                   LTPLGFTVDKVTAREEGTADIENLYARLGRDGPHLMFAGHTDVVPVGDEAAWTHPPFAA
FT                   EIAKGELFGRGAVDMKGGIACFVAAVARHIEKNGPPAGSISLLITGDEEGPAINGTVKL
FT                   LQWATERGERWDACLVGEPTNPDRLGDMIKIGRRGSLSGRITVHGVQGHAAYPHLADNP
FT                   VRGIVQLTQALMDPPFDGGTDDFQPSNLEVTTVDVGNPATNVIPAKASASFNIRFNDSW
FT                   TVDTLRAEILRRLDAAAGNGQLRPGREPVKYDIVWADRPSHVFLTRNNALIASLSSAIE
FT                   SVAGRSPALSTTGGTSDARFIKDYCPVVEFGLVGQTMHMVDERVAVADLETLTAIYETF
FT                   IDRWFAHAGS"
FT   gene            complement(470344..471204)
FT                   /gene="dapD"
FT                   /locus_tag="RHECIAT_CH0000461"
FT   CDS_pept        complement(470344..471204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapD"
FT                   /locus_tag="RHECIAT_CH0000461"
FT                   /product="2,3,4,5-tetrahydropyridine-2-carboxylate
FT                   N-succinyltransferase protein"
FT                   /EC_number="2.3.1.117"
FT                   /note="GO_function: GO:0008415 - acyltransferase activity"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000461"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89455"
FT                   /db_xref="GOA:B3PZG1"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005664"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR023180"
FT                   /db_xref="InterPro:IPR037133"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3PZG1"
FT                   /protein_id="ACE89455.1"
FT                   /translation="MSATDLASLEKTIEAAFDNRDNVNMSTKGEVRDAVEAALNLLDEG
FT                   KARVAERGADGVWTVNQWLKKAVLLSFRLNDMEVVKGGSGNSTWWDKVPSKFENWGENQ
FT                   FRAAGFRAVPNCVVRRSAYIAANAILMPSFVNLGAYVGEGTMVDTWATVGSCAQIGKHV
FT                   HLSGGVGIGGVLEPMQAGPTIIEDNCFIGARSEVVEGCIIREGSVLGMGVYIGKSTKIV
FT                   DRATGEVMYGEVPPYSVVVAGSMASANATMANGLPAPHLYCAVIVKRVDEQTRSKTGIN
FT                   ELLRD"
FT   gene            471233..472258
FT                   /locus_tag="RHECIAT_CH0000462"
FT   CDS_pept        471233..472258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000462"
FT                   /product="hypothetical conserved protein"
FT                   /note="yhch00116"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000462"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89456"
FT                   /db_xref="InterPro:IPR031100"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q024"
FT                   /protein_id="ACE89456.1"
FT                   /translation="METAQSPELRLAGLRPALQHAPVEWNYFSGRIDLVSRRYRDISGT
FT                   KAGSTERHFDMAKGRNGGSRRKDGVWDPLKSSSTDRQRAQAVPKTPQTTSPAYRLAYVD
FT                   EDFLCREELRPIRLQLELLKTEMMLTERGIRSTVVMFGGARIPAPGQSAWAARNDIQRA
FT                   NLEAASVYYDEARKFARLCSKYSASFDFQEYVIVTGGGPGVMEAGNRGAADEGAPSIGL
FT                   NIVLPHEQAPNAYVTPELSFNFHYFAIRKMHFMVRAKAIAVFPGGFGTLDEFFECLTLI
FT                   QTGRMERLPLILFGEAFWRRIINFEALAEFGTIAPDDVKLISFVDTADAAWKIVQDFYE
FT                   H"
FT   gene            complement(472332..472949)
FT                   /locus_tag="RHECIAT_CH0000463"
FT   CDS_pept        complement(472332..472949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000463"
FT                   /product="hypothetical conserved protein"
FT                   /note="yhch00117; GO_function: GO:0005509 - calcium ion
FT                   binding"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000463"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89457"
FT                   /db_xref="GOA:B3Q025"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q025"
FT                   /protein_id="ACE89457.1"
FT                   /translation="MYRNKLILAALSSVLVFGAAAGTSFAAPGNGPRPHHAGMDGPGRD
FT                   AFLEITYVRMLKEFDANKDGKVSKEEATSGLDKVFAAIDTNKDGSLTPGEIRQYRQTQL
FT                   QAMKDQHKQEAGDDKDANAAPDMPDDEAGRAARDEHDGHHWMRHGGSFMRASMMMRRVD
FT                   TDENGQISKQEAVAAFDKLFTRMDRNKDGVISIDDMPDRPLL"
FT   gene            complement(473066..473782)
FT                   /locus_tag="RHECIAT_CH0000464"
FT   CDS_pept        complement(473066..473782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000464"
FT                   /product="putative hydrolase protein"
FT                   /note="ypch00178; GO_function: GO:0003824 - catalytic
FT                   activity; GO_process: GO:0008152 - metabolic process"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000464"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89458"
FT                   /db_xref="GOA:B3Q026"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR010237"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q026"
FT                   /protein_id="ACE89458.1"
FT                   /translation="MTKIDRTPEKADFDHVTDWVFDLDNTLYPHHVNLFAQIDRNMTSY
FT                   VAALLQMEREEARKLQKQYYLEHGTTLQGLMIHHGIDPNDFLEKAHAIDYSALMPQPEL
FT                   GQAIKALPGRKFIFTNGSVKHAEMTAGALGILEHFDDIFDIVAADYVPKPAQATYDKFA
FT                   ALKRVDTGKAAMFEDLPRNLTVPKALGMQTVLLVPRNLEETVVEWWEKTSGEEDHIDFV
FT                   TDDLVAFLGKVTGSGG"
FT   gene            473969..475498
FT                   /gene="bchE"
FT                   /locus_tag="RHECIAT_CH0000465"
FT   CDS_pept        473969..475498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bchE"
FT                   /locus_tag="RHECIAT_CH0000465"
FT                   /product="Mg-protoporphyrin IX monomethyl ester oxidative
FT                   cyclase subunit protein"
FT                   /note="GO_function: GO:0031419 - cobalamin binding;
FT                   GO_function: GO:0046872 - metal ion binding"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000465"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89459"
FT                   /db_xref="GOA:B3Q027"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034466"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q027"
FT                   /protein_id="ACE89459.1"
FT                   /translation="MKIVLINPPHTAIGSRIPDDHLPPLGLLSVAGPLIDGGHDVSLID
FT                   AEFGPMTIVDIVNRITANGPDLVLIGHSGSTSAHPTARAIAEAVKRSDPAIRIVYGGVF
FT                   PTYHWREVLAETEAFDILVRGEGEETMRRLAEALAANRPLDAVAGIAYRDGDGEIQATR
FT                   PAQAIADLDGYRIGWELIDHARYSYWGGKRAVVMQFSRGCPHLCNYCGQRGFWTRWRHR
FT                   SPELFAREIARLYREQGVELINLADENPTSSRKAWLAFLEAMIAENVPVQIVGSTRADD
FT                   IVRDADILHLYRKAGVVRWLLGMENTDEATLALIKKGGAKTTDREAIRLLRQHDILSMA
FT                   TWVVGFEEEKLSDLWRGFRQLLSYDPDQIQALYVTPHRWTSFFRIARDRQVIETDIRKW
FT                   DYKHQVLKMRYLHPLALVACVKLIEVAVQARPKALMRVLFHRDREQRHSMRWYTEMGRR
FT                   VWFHEVFEFLFRRRHLKNGPTLENFWGAPQDAEEESMLRPQRHLKSLDAAE"
FT   gene            475554..476627
FT                   /gene="ada"
FT                   /locus_tag="RHECIAT_CH0000466"
FT   CDS_pept        475554..476627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ada"
FT                   /locus_tag="RHECIAT_CH0000466"
FT                   /product="methylated-DNA-[protein]-cysteine
FT                   S-methyltransferase protein"
FT                   /EC_number="2.1.1.63"
FT                   /note="GO_function: GO:0003677 - DNA binding; GO_function:
FT                   GO:0008168 - methyltransferase activity; GO_function:
FT                   GO:0008270 - zinc ion binding; GO_process: GO:0006281 - DNA
FT                   repair; GO_process: GO:0006355 - regulation of
FT                   transcription, DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000466"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89460"
FT                   /db_xref="GOA:B3Q028"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR004026"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR016221"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR035451"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q028"
FT                   /protein_id="ACE89460.1"
FT                   /translation="MLFERPDDDTLYDALIARSADYEGQAYVCVKTTGVFCRLTCPARK
FT                   PKRENTLFFETIAACMHSGFRPCRRCRPLEQPGREPIVDALLARLEEEPEVRWSEDELV
FT                   RRGHDPSTVRRAFKRALGMTFHDIVCYIRLGEAARQLAAGARVIDAQIEAGYESPSGFR
FT                   TAFQRLVGKAPALSQNRELLFADWFDTPLGPMIAVADKTHLHLLEFHDRKALPAELKAL
FT                   QKRVRSSVAIRRTPVIDQIEAEIRDYFEGRLGVFRTPLALGGTPFEKHVWAKLMEIPVG
FT                   QTRAYGDLAREMERPEVVRAVGRANGANQLAIIVPCHRVLGADGSLTGYGGGLWRKQWL
FT                   LRHEEKISTETKMEETA"
FT   gene            476624..477394
FT                   /locus_tag="RHECIAT_CH0000467"
FT   CDS_pept        476624..477394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000467"
FT                   /product="putative PEP phosphonomutase protein"
FT                   /EC_number="4.1.3.30"
FT                   /note="ypch00179"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000467"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89461"
FT                   /db_xref="GOA:B3Q029"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR039556"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q029"
FT                   /protein_id="ACE89461.1"
FT                   /translation="MNQTEKARAFHALHQKGNPIVLYNIWDAGTAKAVAEAGAKALATG
FT                   SWSVAAAHGFADGEKLPMSVLVETAKSIADFVDLPLSVDFEGAYSAEPERAAANVARLI
FT                   EFGAVGINFEDRVVAGEGLYPIESQAARIRAIRAMADGRDMPFFINARTDLFLAESDLA
FT                   KHAGLVDEAIERGRAYAAAGGNGFFVPGLIDPGLIEKICAASSLPVNIMMRAGAPDVKT
FT                   LAKLGVGRISYGPGPYRSMMEKLKQEAAAIYSLL"
FT   gene            complement(477575..478723)
FT                   /gene="lldD1"
FT                   /locus_tag="RHECIAT_CH0000468"
FT   CDS_pept        complement(477575..478723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lldD1"
FT                   /locus_tag="RHECIAT_CH0000468"
FT                   /product="L-lactate dehydrogenase (cytochrome) protein"
FT                   /EC_number="1.1.2.3"
FT                   /note="GO_function: GO:0016491 - oxidoreductase activity;
FT                   GO_process: GO:0006118 - electron transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000468"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89462"
FT                   /db_xref="GOA:B3Q030"
FT                   /db_xref="InterPro:IPR000262"
FT                   /db_xref="InterPro:IPR008259"
FT                   /db_xref="InterPro:IPR012133"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR037396"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q030"
FT                   /protein_id="ACE89462.1"
FT                   /translation="MRLTDCYNFHDFRRMAKRRLPGPIFDYIDGAADDEVTYRRNTAAF
FT                   EACDLVPNVLRGVAEVDMSVTVMGQKLAMPVYCSPTALQRLFHHQGERAVAAAAAKHGT
FT                   MFGVSSLGTISLEEARQISDGPQVYQFYFHKDRGLNHEMMARAKNAGVQAMMLTVDSIT
FT                   GGNRERDKRTGFAIPFKLNLAGVTQFAIKPSWAIGWLTHERFALPQLENHVKMDGGALS
FT                   ISRYFTEMLDPSMSWDDVAEMVRAWGGHFCLKGIMSVEDAKRAVDIGCTGIVLSNHGGR
FT                   QLDGSRSAFDQLAEIVDAVGDRIDVMMDGGVQRGTHVLKALSLGAKAVGLGRYYLFPLA
FT                   AAGQPGVERALETIRTEIERDMKLMGCTSIDQLTRGNLRFHS"
FT   gene            complement(479099..479986)
FT                   /gene="argB"
FT                   /locus_tag="RHECIAT_CH0000469"
FT   CDS_pept        complement(479099..479986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argB"
FT                   /locus_tag="RHECIAT_CH0000469"
FT                   /product="acetylglutamate kinase protein"
FT                   /EC_number="2.7.2.8"
FT                   /note="GO_process: GO:0008652 - amino acid biosynthetic
FT                   process"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000469"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89463"
FT                   /db_xref="GOA:B3Q031"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037528"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3Q031"
FT                   /protein_id="ACE89463.1"
FT                   /translation="MNESESEIQARLLAQALPFMQRYENKTIVVKYGGHAMGNPELGKA
FT                   FASDIALLKQSGVNPIVVHGGGPQIGAMLNKMGIESKFEGGLRVTDQKTVEIVEMVLAG
FT                   SINKEIVALINQTGEWAIGLCGKDGNMVFAEKARKTIKDPDSNIERVLDLGFVGEVVEV
FT                   DRTLLDLLARSEMIPVIAPVAPGRDGATYNINADTFAGAIAGALNATRLLFLTDVPGVL
FT                   DKNGQLIKELSVAEAHALIADGTISGGMIPKVETCIDAIKAGVQGVVILNGKTAHSVLL
FT                   EIFTEHGIGTLIVP"
FT   gene            480133..480672
FT                   /gene="sigK"
FT                   /locus_tag="RHECIAT_CH0000470"
FT   CDS_pept        480133..480672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sigK"
FT                   /locus_tag="RHECIAT_CH0000470"
FT                   /product="RNA polymerase sigma-70 factor protein, ECF
FT                   family"
FT                   /note="GO_function: GO:0003677 - DNA binding; GO_function:
FT                   GO:0003700 - transcription factor activity; GO_function:
FT                   GO:0016987 - sigma factor activity; GO_process: GO:0006352
FT                   - transcription initiation; GO_process: GO:0006355 -
FT                   regulation of transcription, DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000470"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89464"
FT                   /db_xref="GOA:B3Q032"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q032"
FT                   /protein_id="ACE89464.1"
FT                   /translation="MQGDEIKQLIGRVALGDRTAFVALYNQTAPKLLAICLRILKDRGE
FT                   AEEALQEVYISIWQRARSFQAASGSSSAWLSAIARNRSIDLLRARKPVADELDSAYDLA
FT                   DAAPDPERQTVTKDEGRRIDTCMEELEADRAVAVKRAYVEGLSYQELADQFGVPLNTMR
FT                   TWLRRSLLKLRECMER"
FT   gene            480669..481388
FT                   /locus_tag="RHECIAT_CH0000471"
FT   CDS_pept        480669..481388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000471"
FT                   /product="hypothetical conserved protein"
FT                   /note="yhch00118"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000471"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89465"
FT                   /db_xref="GOA:B3Q033"
FT                   /db_xref="InterPro:IPR018764"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q033"
FT                   /protein_id="ACE89465.1"
FT                   /translation="MTSPDKSKGDRSRDEVLAGEYVLGVLSLQDRRVVEERMRHDRPFA
FT                   AIVSRWEANLSAFNDEYDGVAPNRETFKQIESRLFGDAGKPASFSQGLWNSAVFWRSLA
FT                   FACIVVAVSAVIFASGVVPQPEGPTPLVAELSGENNAINLRASYELQSGRLKIVPVAAG
FT                   KPEEKSLELWLVPGSGLPKSLGVFQPGESGELVIPAELRSHVTDGATLAVSLEPFGGSP
FT                   TGQATGPIVASGTVRRP"
FT   gene            481491..482069
FT                   /locus_tag="RHECIAT_CH0000472"
FT   CDS_pept        481491..482069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000472"
FT                   /product="putative transforming growth factor-induced
FT                   protein (and secreted protein MPB70)"
FT                   /note="ypch00180; GO_process: GO:0007155 - cell adhesion"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000472"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89466"
FT                   /db_xref="InterPro:IPR000782"
FT                   /db_xref="InterPro:IPR036378"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q034"
FT                   /protein_id="ACE89466.1"
FT                   /translation="MVSGEEKIMIKSLLRGFALATVLSAAAFAAAKNPIVGGAAMFDSK
FT                   NIIENAMNSKDHTTLVAAVKAAGLVGTLEGKGPFTVFAPTNEAFAALPKGTVETLLKPE
FT                   NKATLTKVLTCHVVAADAMAKTVAKMIKADGGEHDIKTVGGCVIRARQDMGKITLTDEN
FT                   GDVAHVTIADVKQSNGVIHVVDKVLLPKM"
FT   gene            complement(482174..483250)
FT                   /locus_tag="RHECIAT_CH0000473"
FT   CDS_pept        complement(482174..483250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000473"
FT                   /product="probable two-component sensor histidine kinase
FT                   protein"
FT                   /note="ypch00181"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000473"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89467"
FT                   /db_xref="GOA:B3Q035"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011102"
FT                   /db_xref="InterPro:IPR011495"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q035"
FT                   /protein_id="ACE89467.1"
FT                   /translation="MTDSKDEVLSPQGVGNLPHLAEALDDDRFRHFLDHVPFAVAVSEL
FT                   GTFEKLVYVNLEFERLTALTAGQVEGKRWTDIEVNCTAVSSEATLTAAVTTAEEYIGAF
FT                   SLVAEPEGNLIIDVWSNTIVNDDDVPLFRLVAFAARNEVTGGQSFSELLAEKDVLLREL
FT                   QHRVKNNLQMITALIRMEARNAQKNEESERFARLAGRIEALALLYRALSDEEKGATIDL
FT                   GSYVSQIAASVMAAHAVEGIRLDMKVDTWPVSVNVAMPAGLVINELLTNTFKHAFVGRD
FT                   GGEITLRCVVSDTGCRITVADNGVGLPENVPWPNPGKLSAMIIQSLKQNAHAEVEVSSS
FT                   PGTGMSVSLVFPRIEAAQ"
FT   gene            complement(483481..483756)
FT                   /locus_tag="RHECIAT_CH0000474"
FT   CDS_pept        complement(483481..483756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000474"
FT                   /product="hypothetical conserved protein"
FT                   /note="yhch00119"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000474"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89468"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q036"
FT                   /protein_id="ACE89468.1"
FT                   /translation="MAEDTKELQSINTAWQIAIQEILRMVIRDMYRGGGEASFKSHIKR
FT                   IEEAAVDSIYTDLRLRGTDEWTEVLVKERASNFVTTLLTSFTYDRA"
FT   gene            complement(483949..484173)
FT                   /locus_tag="RHECIAT_CH0000475"
FT   CDS_pept        complement(483949..484173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000475"
FT                   /product="hypothetical conserved protein"
FT                   /note="yhch00120"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000475"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89469"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q037"
FT                   /protein_id="ACE89469.1"
FT                   /translation="MAETYSKSRQRAEIAFGNISPSFFAKNKAMEELESHAQSQQAKTL
FT                   RLREARLAKQRDDRASAMSALLAKRAKAC"
FT   gene            complement(484304..484528)
FT                   /locus_tag="RHECIAT_CH0000476"
FT   CDS_pept        complement(484304..484528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000476"
FT                   /product="probable cold shock protein"
FT                   /note="ypch00182; GO_function: GO:0003677 - DNA binding;
FT                   GO_process: GO:0006355 - regulation of transcription,
FT                   DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000476"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89470"
FT                   /db_xref="GOA:B3Q038"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q038"
FT                   /protein_id="ACE89470.1"
FT                   /translation="MKGFIMTTGTVKWFNSTKGFGFIQPDNGGADAFVHISAVERAGMR
FT                   ELVEGQKIGFDLERDHKSGKMSACNLQKA"
FT   gene            complement(484751..485404)
FT                   /gene="engB"
FT                   /locus_tag="RHECIAT_CH0000477"
FT   CDS_pept        complement(484751..485404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="engB"
FT                   /locus_tag="RHECIAT_CH0000477"
FT                   /product="GTP-binding protein"
FT                   /note="GO_component: GO:0005622 - intracellular;
FT                   GO_function: GO:0005525 - GTP binding"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000477"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89471"
FT                   /db_xref="GOA:B3Q039"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019987"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030393"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3Q039"
FT                   /protein_id="ACE89471.1"
FT                   /translation="MPETEKPLFGHPWIFIRGVPSLTFLPPEGPSEVAFAGRSNVGKSS
FT                   LINALVGQKGLARTSNTPGRTQELNYFVPDGYSGEGGDLPPMAIVDMPGYGYAQAPKEQ
FT                   VDKWTKLVFDYLRGRATLKRVYVLIDSRHGIKKNDEDVLTLLDKAAVSYQLVLTKTDKI
FT                   KAPAVPKLLAETADKIRKRPAAYPAVLSTSSEKGDGLDDLRQAIAQTVGIANWE"
FT   gene            complement(485546..487342)
FT                   /gene="oxaA"
FT                   /locus_tag="RHECIAT_CH0000478"
FT   CDS_pept        complement(485546..487342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oxaA"
FT                   /locus_tag="RHECIAT_CH0000478"
FT                   /product="inner membrane transmembrane protein"
FT                   /note="GO_component: GO:0016021 - integral to membrane;
FT                   GO_process: GO:0051205 - protein insertion into membrane"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000478"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89472"
FT                   /db_xref="GOA:B3Q040"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="InterPro:IPR019998"
FT                   /db_xref="InterPro:IPR028053"
FT                   /db_xref="InterPro:IPR028055"
FT                   /db_xref="InterPro:IPR038210"
FT                   /db_xref="InterPro:IPR038221"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3Q040"
FT                   /protein_id="ACE89472.1"
FT                   /translation="MMENNRNYFIAIALSVLIVLGWQFLYMNPRIEAQRKAQEAQKAQQ
FT                   QTEQVQQPAAGGATPAPASGTAPSGQAVATATLEQALAKTPRVAIDTPALSGSINLAGA
FT                   RLDDLKLKGYHETVDDSSPIITLFSPAETKDGYFTELGYIGSDATGSVPGASTLWTAPE
FT                   GAKLTEKTPVTLSYTNDKGLTFTRTISVDERYMFTIADKVANTGQAPVSLSSYGRVTRY
FT                   NKPTTPSAYVLHEGFIGVIGDDGLIESKYTAVEKEAVMPAKSTGGWLGITDKYWAATIV
FT                   PPQASAYEARFSHFSDGQPRYQADYKDDAFTVAPGQSVELKNLVFAGAKEVPVIDGYEA
FT                   SYSIPRFDRLIDWGWFYFITKPMFKLMDFFFRFFGNFGVAILCTTIVVKALFFPLASKQ
FT                   YASMANMKRMQPKMEELKAKFGDDRMGLQQATMQLYKEEKINPIAGCWPVALQIPIFFS
FT                   LYKVIYITIEMRHAPFFGWIQDLSAPDPTTIVNLFGLLPFTAPTFLHLGVWPLIMGVTM
FT                   FLQMRMNPTPPDPTQAMIFNWMPLVFMFMLASFPAGLVIYWAWNNTLSVIQQSVIMKRH
FT                   GVKIELFDNLKGLFRRKTAPSK"
FT   gene            complement(487339..487740)
FT                   /gene="rnpA"
FT                   /locus_tag="RHECIAT_CH0000479"
FT   CDS_pept        complement(487339..487740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnpA"
FT                   /locus_tag="RHECIAT_CH0000479"
FT                   /product="ribonuclease P protein"
FT                   /EC_number="3.1.26.5"
FT                   /note="GO_function: GO:0004526 - ribonuclease P activity;
FT                   GO_process: GO:0008033 - tRNA processing"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000479"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89473"
FT                   /db_xref="GOA:B3Q041"
FT                   /db_xref="InterPro:IPR000100"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q041"
FT                   /protein_id="ACE89473.1"
FT                   /translation="MAGELTTSEKKYAVGRLKSRPQFLAVREGEKRRGGLFLLEVLDRK
FT                   EPDSQARVGFTVTKKHGNAVERNRMRRRLKEAVRLHAGFAMQPGHDYVVVARRDVLDAS
FT                   FQELAAELKLRVETRPKHRRSGDGRPRNV"
FT   gene            complement(487762..487896)
FT                   /gene="rpmH"
FT                   /locus_tag="RHECIAT_CH0000480"
FT   CDS_pept        complement(487762..487896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmH"
FT                   /locus_tag="RHECIAT_CH0000480"
FT                   /product="50S ribosomal protein L34"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000480"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89474"
FT                   /db_xref="GOA:B3Q042"
FT                   /db_xref="InterPro:IPR000271"
FT                   /db_xref="InterPro:IPR020939"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3Q042"
FT                   /protein_id="ACE89474.1"
FT                   /translation="MKRTYQPSKLVRKRRHGFRARMSTKGGRKVIAARRAQGRKRLSA"
FT   gene            488315..490315
FT                   /gene="mcpT"
FT                   /locus_tag="RHECIAT_CH0000481"
FT   CDS_pept        488315..490315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mcpT"
FT                   /locus_tag="RHECIAT_CH0000481"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /note="GO_component: GO:0016020 - membrane; GO_function:
FT                   GO:0004871 - signal transducer activity; GO_process:
FT                   GO:0006935 - chemotaxis; GO_process: GO:0007165 - signal
FT                   transduction"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000481"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89475"
FT                   /db_xref="GOA:B3Q043"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q043"
FT                   /protein_id="ACE89475.1"
FT                   /translation="MKIRGKINLLVCVMGAVALLIGATALSAMAEYGRNLTAYEHAAAR
FT                   AYAGERLNRFVTAVVMESRGIYAAKSIKDTPNFAKGLMAGLDEIDKVIAGWAPLVPEAE
FT                   KDNFAKLVARAAEFRTFRTETARLGTEVGPEAASAQGNNDANRANRKAFQAEIDAVVAT
FT                   DKAALQAVNDEIESFRSWVLMLVLGITGIGIAVGIGMGFYIGTSHLSRPIKRVTHAIKE
FT                   VADGNFEAEVPFAGRKDEIGEMAAAVAVFKENGLAVKRLNAQEAAMRAKSDDLQSSMSV
FT                   VVAAAAAGDFSHRIDKDYQDENLNQFAGNINTLLSSVDAGIGETRRVIASLAEGDLTQT
FT                   MNGNFQGAFAELQQNVNNSFVTLQATMREVRETTEAMNGNTAELRNASDDLSKRTEQQA
FT                   AALEQTSAALDQITAVVQNSTERAHEATVMVSEAKENAGRSGVVVRNAVEAMGRIEQAS
FT                   REISQIINVIDEIAFQTNLLALNAGVEAARAGEAGKGFAVVAQEVRELAQRSATAAKDI
FT                   KALITKSGDEVQVGVKLVQATGEALSEIGTRVIAINDHIHSIATAAVEQSTGLKEVNTA
FT                   VNQMDQVTQQNAAMVEETSAATHRLSAEANGLVHLIARFKLSDGPAPVALVRNEPHRQP
FT                   VASPARRAIAKVARAFGGGNTAAAEQSWEEF"
FT   gene            490475..491995
FT                   /gene="regM"
FT                   /locus_tag="RHECIAT_CH0000482"
FT   CDS_pept        490475..491995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="regM"
FT                   /locus_tag="RHECIAT_CH0000482"
FT                   /product="two-component sensor histidine kinase protein"
FT                   /EC_number="2.7.3.-"
FT                   /note="GO_function: GO:0005524 - ATP binding"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000482"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89476"
FT                   /db_xref="GOA:B3Q044"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q044"
FT                   /protein_id="ACE89476.1"
FT                   /translation="MPVRNQGNDPSAEIPAAGEAAKGRCPSAGMFGGLSGKLLWLTVVF
FT                   IMLAEILIFFPSVASMRLRWLQERLNTAAAAAIVIDGLQPIELPRALQKETLEATGTKA
FT                   IVLRKEGTSRLLATTDMPTSVDESYDLTDVPPATAIRDALDTLIFGGGRMIRVYGPVGD
FT                   TKVGVEVVMKDRPLRTAMFAYSRNVLLLSVLISLFTATLIFFAINRLLIGPIRRLTGSM
FT                   QQFSSDPENPAHVYIGDGGRDELAVAGRNLTSMQMELQKTLKQQKNLAALGLAVSKINH
FT                   DMRNILASAQLMSDRLVDVDDPMVKSFAPKLLRTIDRAVGYTTEVLSYGKASESAPRRR
FT                   HVRLLELTQDVRDMLAIDPQSGIEFIEQFAADLEVDADGEQLFRVIHNLTRNALQALTA
FT                   PGEGGPGAVRRITVSAQRVGSVVSITVDDTGPGMPLKARQNLFAAFRGSARSGGTGLGL
FT                   TIARELVLAHGGTIALVEKPTVGTQFRIEIPDRPVSLDDYRNRTHSEN"
FT   gene            492119..492195
FT                   /locus_tag="RHECIAT_CH0000483"
FT   tRNA            492119..492195
FT                   /locus_tag="RHECIAT_CH0000483"
FT                   /product="tRNA-Arg"
FT                   /inference="ab initio prediction:tRNAscan-SE:1.23"
FT   gene            492219..493046
FT                   /locus_tag="RHECIAT_CH0000484"
FT   CDS_pept        492219..493046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000484"
FT                   /product="hypothetical protein"
FT                   /note="yhch00121"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000484"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89477"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q045"
FT                   /protein_id="ACE89477.1"
FT                   /translation="MADDQEMSGGTLGASEWLTTHHTYSESELSKIREFWTPSDQWRGE
FT                   IESLLSLDKLDALDESRSEFEKIKADRLSGKSNFEELATTFLRRSSSAVGKASGTMQKA
FT                   YIQRVQELATDLSALLQEPSIRGTPADLFALARRNMDPNFVFKVEMELLTDLAMISMLA
FT                   NIRLRNRTLPDEEVVHAIVDKTTYDRFRFASGAINFYERSTGKTATGWVDGSKQSEAIG
FT                   FLMAIMNPVLQSVGQPQISAESARKEIQEVKKAFGAGVNPNEIGFGTGRLPGT"
FT   gene            493134..493340
FT                   /locus_tag="RHECIAT_CH0000485"
FT   CDS_pept        493134..493340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000485"
FT                   /product="hypothetical protein"
FT                   /note="yhch00122"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000485"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89478"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010260"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q046"
FT                   /protein_id="ACE89478.1"
FT                   /translation="MHYMASKILPIEEVIDRTGLSRRTLYQEISEGRFPRPVQLTSRRV
FT                   GWPENDVDTWIDHKIAARDGLAA"
FT   gene            493337..493525
FT                   /locus_tag="RHECIAT_CH0000486"
FT   CDS_pept        493337..493525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000486"
FT                   /product="hypothetical protein"
FT                   /note="yhch00123"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000486"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89479"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q047"
FT                   /protein_id="ACE89479.1"
FT                   /translation="MTGTDHEHSESVVQAAMWLAEQNPAPQPIIPELRKRFPLTALQAC
FT                   EAAALSNRYRFLRKAHG"
FT   gene            493522..494049
FT                   /locus_tag="RHECIAT_CH0000487"
FT   CDS_pept        493522..494049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000487"
FT                   /product="hypothetical protein"
FT                   /note="yhch00124"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000487"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89480"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q048"
FT                   /protein_id="ACE89480.1"
FT                   /translation="MSQHKRRSRKQAGERFFQMHHWVVTSAAWKAASVYERCLYMELKQ
FT                   RYNGQNNGDIALSHREAMDALNCSNKPVAEAFRGLVDKGFIKVQQMGSFHWKSKAPGGR
FT                   STRWILTELAVDQPERSLVPTKDFMQWRPGQEEKQRYAHGTRMVVGDTTAQERMVVSGH
FT                   TIKAKVYAHGTR"
FT   gene            494142..494450
FT                   /locus_tag="RHECIAT_CH0000488"
FT   CDS_pept        494142..494450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000488"
FT                   /product="hypothetical protein"
FT                   /note="yhch00125"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000488"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89481"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q049"
FT                   /protein_id="ACE89481.1"
FT                   /translation="MHDHDLPLFAWRPACQLILFPMTARVGKVRDVARKLASKTTARHA
FT                   DYYCSQVTEALRLHLEKVGLGEAQQDEQIGAFWSKVDQEMVRLTYRGTGSHDPRGAA"
FT   gene            494447..494626
FT                   /locus_tag="RHECIAT_CH0000489"
FT   CDS_pept        494447..494626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000489"
FT                   /product="hypothetical protein"
FT                   /note="yhch00126"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000489"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89482"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q050"
FT                   /protein_id="ACE89482.1"
FT                   /translation="MREKHRAAVGWAIQHAPTREAYRRSTGEDLGPALDRYRLWVEENV
FT                   IGRPGDVTDDAEAA"
FT   gene            494623..494823
FT                   /locus_tag="RHECIAT_CH0000490"
FT   CDS_pept        494623..494823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000490"
FT                   /product="hypothetical protein"
FT                   /note="yhch00127"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000490"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89483"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q051"
FT                   /protein_id="ACE89483.1"
FT                   /translation="MTETEVLTGHKAIARFLGLTPRQVSWHDEQGNMPTFRIGRTVCAR
FT                   KAKLLQWLDELEEQARAKAKR"
FT   misc_feature    494979..495623
FT                   /note="yich00005; insertion sequence:Resolvase, N-terminal"
FT   gene            495733..496122
FT                   /locus_tag="RHECIAT_CH0000491"
FT   CDS_pept        495733..496122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000491"
FT                   /product="hypothetical protein"
FT                   /note="yhch00128"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000491"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89484"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q052"
FT                   /protein_id="ACE89484.1"
FT                   /translation="MSTHRNQIDSNSTRNRSAISNGSWLLDGVDNRSALGRRYRDLCMS
FT                   FADDLGGAASLNEPQRALVRQVAAVTVESEKLQAAIVKGEPVDAENLVRLNNLQARLMK
FT                   QLDIKPRGTKPKRSLQDLLAGGAAA"
FT   gene            496119..497516
FT                   /locus_tag="RHECIAT_CH0000492"
FT   CDS_pept        496119..497516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000492"
FT                   /product="hypothetical conserved protein"
FT                   /note="yhch00129"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000492"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89485"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q053"
FT                   /protein_id="ACE89485.1"
FT                   /translation="MNILEACAHPEIFKPWFRKPETYRAWFAFLAALFGLQMDGEQLEL
FT                   YQKHTGRTEAPTEAQREGWLVIGRRGGKSFTMALIAVFLACFFDYRQYLAPGERATVLV
FT                   IATDRRQARVILRYVRAMLDNIPLLQAMVERDTADSFDLDNSTTIEVGTASFRSTRGYT
FT                   YAAVLCDELAFWRTDDAAEPDYAILDAIRPGMASIPNSMLLCASSPHARRGALWDAFKR
FT                   FWGKDDAPLVWRAATREMNPTISQSVVDRALERDHASAMAEYGAEFRSDIEQFVNIEVV
FT                   EDCVSRGVYERAPLPNIRYRAFVDPSGGSNDSMTLAIGHKEGERNILDCVRERKPPFSP
FT                   ESVVAEFADTLAKYRVREVEGDRYAGEWPREQFRKKGITYKIAEKPRSDLYRDMLPLLN
FT                   SGVADLLDSDRLVTQIVGLERRVSRGGKESIDHAPGGHDDLANAVAGVLNASAKQQHVV
FT                   ISEELRI"
FT   gene            497696..498544
FT                   /locus_tag="RHECIAT_CH0000493"
FT   CDS_pept        497696..498544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000493"
FT                   /product="hypothetical protein"
FT                   /note="yhch00130"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000493"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89486"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q054"
FT                   /protein_id="ACE89486.1"
FT                   /translation="MINKDSKFPGKDRSDKGKWIGPWMPRWRDSGDNGPFTTLEKLYAE
FT                   IQSAPERIRAKRAELEKTGKYTPAGIKDMLKQIALSETVPDIRRAAAQQVSKFRREIDS
FT                   RRAAFKPFEHDPNDLVGEMRRQEVRAWLRTMTPDERTKAVSHASDPFIVEAAISVPVEL
FT                   TGLLPSTRDRLSQLLVEQRYGDEIAGLNELDEAVKTVERAVDGARDDVREIIGMFPHDF
FT                   DAEFKPIEQQIDKDAEKAFVAPIPIDVDAIAAQIKTLKFDERHLLIDLALDLQTAAVKA
FT                   A"
FT   gene            498641..498937
FT                   /locus_tag="RHECIAT_CH0000494"
FT   CDS_pept        498641..498937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000494"
FT                   /product="hypothetical protein"
FT                   /note="yhch00131"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000494"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89487"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q055"
FT                   /protein_id="ACE89487.1"
FT                   /translation="MDAFAAAATFKDSIEAFGDAAIDELTAEAGYRRARTNIANLHQSR
FT                   KTEIETMLEAYSRRPWPADHHQGVRECAENALAVLDLLYRDFQRNLAILHKRG"
FT   gene            498942..499331
FT                   /locus_tag="RHECIAT_CH0000495"
FT   CDS_pept        498942..499331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000495"
FT                   /product="hypothetical conserved protein"
FT                   /note="yhch00132"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000495"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89488"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q056"
FT                   /protein_id="ACE89488.1"
FT                   /translation="MADAFSFALDLRKFADSIPEELVKPVVQKFAMHALSSVVMRSPVD
FT                   TGRFRGNWNVAVNAVDYTVTEATDKSGGSTIAKGVATIEAAAPEQAIFISNNVPYAVAL
FT                   ENGHSKQAPAGVVALTFAELESMTL"
FT   gene            499339..502134
FT                   /locus_tag="RHECIAT_CH0000496"
FT   CDS_pept        499339..502134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000496"
FT                   /product="hypothetical protein"
FT                   /note="yhch00133"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000496"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89489"
FT                   /db_xref="InterPro:IPR009628"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q057"
FT                   /protein_id="ACE89489.1"
FT                   /translation="MNSTKTLSIVIDPSGTETGGRVVRREFQEIGQAAMNAQRMTETLS
FT                   KAQQQMAKSAQLSAQSLFQQQDALRAKFNPTYAVLQRYKVTQDEIRQAHRLGALSVNEM
FT                   TTALSRERQAALSAIAAIKGYNSAVTVASSTRQTASKGIRSFETANLAAQFQDIAVTAA
FT                   MGMSPLQIALQQGTQLSAVLGPMGAGGAVKGLGAAFLSLLNPVSLVTMGLVAGTAALLQ
FT                   YVGSAVSGTKTVDELLSRHADNIRGIKAAYGEAAAGLKAYVSESKATLAANAGETLEAT
FT                   KAIVAKSARNELSEALGLPASDFAGNINVIDRFKEAINQLKKSTEAGKPDLLAYRDALS
FT                   QIATSADAAPAQKKLANRLRVIDEDELKAAMALPGMLKAVQVAAEQSAGGLDRLKAIDL
FT                   SQTTQGATALGTSLQTVSQTAKGTAATVIDVAQQAANSRRQTLTSLEQSSTQLRSMKTE
FT                   LSDLQKAIAEAAKTPVSEVFGDGVAGQAAADAIARAASSVQKVFQALDGGQTTALQAHE
FT                   SLELIRQSLYQIGGDPRIIDGFINALMNGNGRVRDLQASVDALSKSILSIPDKTVNIGI
FT                   RQYTVPSAGGGSANVNVYGGGNDMTLQQYSIGGRTHNVYGGISTFATHEQYATLTPAAR
FT                   ERIYRGQSDFMQELSPTTSGGLISQNDFQAMYETLGYRAAGGPVSAGGTYLVGEKGPEI
FT                   LTMTSAGSVTNANSTASILSGGRDTLSLIEDHASNALQELRIHTNYFETYESDLGEMLA
FT                   SLKEVKSGIASVAVAARASVMSSYGSLGGSYSRRGGGFAGSGGSGSSSAIVDYSSPFMG
FT                   PGITFTNGTGAIGYATYNITPGITGIQHNPGLKGFATGGQIMPGEDQKVEFFKRNKERV
FT                   LIVDDSKVSDQRSGGRQSSSKAERPVNLHVNFNGGAALDQRSRQTQADDFRRVVQQVLR
FT                   S"
FT   gene            502141..502581
FT                   /locus_tag="RHECIAT_CH0000497"
FT   CDS_pept        502141..502581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000497"
FT                   /product="hypothetical protein"
FT                   /note="yhch00134"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000497"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89490"
FT                   /db_xref="InterPro:IPR021451"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q058"
FT                   /protein_id="ACE89490.1"
FT                   /translation="MTEIEVEGVGVMRLVNNFQLARIKNIANREDREIAFAAFGLGMTV
FT                   KQFKALPEEQRRAAWDAHSRLCSPAALAPERGAQPDRPRLPRPFERVSEEKMIQIGREL
FT                   IRIKDQLPHGHFGPWVREQSGLSVSQAQRFMRAAIATQGPAA"
FT   gene            502578..502823
FT                   /locus_tag="RHECIAT_CH0000498"
FT   CDS_pept        502578..502823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000498"
FT                   /product="hypothetical protein"
FT                   /note="yhch00135"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000498"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89491"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q059"
FT                   /protein_id="ACE89491.1"
FT                   /translation="MTVYRAKCLRSYLISAHEAAAFLKVTLFRFRQLVQEGYIRQADRK
FT                   GFFRLGAVLDGYTAWVRDHTVDRLAENAGVGEQEAA"
FT   gene            complement(502837..503619)
FT                   /locus_tag="RHECIAT_CH0000499"
FT   CDS_pept        complement(502837..503619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000499"
FT                   /product="hypothetical protein"
FT                   /note="yhch00136"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000499"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89492"
FT                   /db_xref="InterPro:IPR025285"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q060"
FT                   /protein_id="ACE89492.1"
FT                   /translation="MAVESLIGSKLKAYCSNCRGDRNCEIKGHHQENDDGDYGFWWRRD
FT                   WYLLVCCGCDHVFAQSVAIDSESYHQEYDSSGDVITVPDETVRSWPARSKRDRPEWFQH
FT                   SSIETKAAVGDLSASLVELYGALDHDLNVLAAIGIRTSFDIAAEILGVDPSKNFQRKLD
FT                   EMVSKNLIRQSEREHLDVLINAGNASAHRGWTPSFSDLSTLMDTLESFLNDVFIVPAKK
FT                   EAAAAKMAKIKAKVPVKKAKSKAPGTDPKGNGPAKPQP"
FT   gene            complement(503685..503885)
FT                   /locus_tag="RHECIAT_CH0000500"
FT   CDS_pept        complement(503685..503885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000500"
FT                   /product="hypothetical protein"
FT                   /note="yhch00137"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000500"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89493"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q061"
FT                   /protein_id="ACE89493.1"
FT                   /translation="MDWEAKAEAARRRYNELYPDRPIKQIGDTTDVYYFLFGFRDWENG
FT                   QPLSEQEIRAVEMITQAGCFS"
FT   gene            complement(503908..504198)
FT                   /locus_tag="RHECIAT_CH0000501"
FT   CDS_pept        complement(503908..504198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000501"
FT                   /product="hypothetical protein"
FT                   /note="yhch00138"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000501"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89494"
FT                   /db_xref="GOA:B3Q062"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q062"
FT                   /protein_id="ACE89494.1"
FT                   /translation="MTKRFEISGSQYFSSIGLLGVSMFIFSPIVDAACYWWLTSELLDT
FT                   YDRNLWPPLIGLLVCSVAFLSGLVLIIIGREQTYTVREIDPSNTVKGLWSS"
FT   gene            complement(504313..504612)
FT                   /locus_tag="RHECIAT_CH0000502"
FT   CDS_pept        complement(504313..504612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000502"
FT                   /product="hypothetical protein"
FT                   /note="yhch00139"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000502"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89495"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q063"
FT                   /protein_id="ACE89495.1"
FT                   /translation="MRAVKLALKASLVLIVAGFAGLALLLLVFGWSSSRAQQENGECSM
FT                   LVLEKKIEPITNATEYHRACMASKGYGMQPSCYIDNFTGASCFIPRWMFWINKV"
FT   gene            complement(504643..505164)
FT                   /locus_tag="RHECIAT_CH0000503"
FT   CDS_pept        complement(504643..505164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000503"
FT                   /product="hypothetical protein"
FT                   /note="yhch00140"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000503"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89496"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q064"
FT                   /protein_id="ACE89496.1"
FT                   /translation="MMQTLAALLTPTIAAIAIVIAFMQWRTAHQKVMLDLFERRLKIYD
FT                   QVHEVVAYFWTNEGNLVGFNAGRKLAAAHADARFMFGEEVAIAIEGLKSMVHQLSSLKN
FT                   KLEKIETDGPEREKLVSQILDIEAEFERWPESFSKICLPYMRMDQKLMRTPAEWFRDKN
FT                   RKRLSYGDQP"
FT   gene            complement(505348..505563)
FT                   /locus_tag="RHECIAT_CH0000504"
FT   CDS_pept        complement(505348..505563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000504"
FT                   /product="hypothetical protein"
FT                   /note="yhch00141"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000504"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89497"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q065"
FT                   /protein_id="ACE89497.1"
FT                   /translation="MLPVSGEVDVLEDECRNQTDDGDCKSGEHDRFPSWVMGFYVHINY
FT                   HNYFCNSYANNYCSKNRSPLFCRQKE"
FT   gene            505585..505992
FT                   /locus_tag="RHECIAT_CH0000505"
FT   CDS_pept        505585..505992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000505"
FT                   /product="hypothetical protein"
FT                   /note="yhch00142"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000505"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89498"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q066"
FT                   /protein_id="ACE89498.1"
FT                   /translation="MLERSVQAAGEAMLTRRQLIAASAAVAVGVTAVAPIAAHAAAADP
FT                   LLDAVAAFRSGMADYNANAPQDDAGANAYSLISWMPPHAVLANWTAPAATRAGAMAALR
FT                   LAVDEEETGDSPLVGPMMRAALAYLEQEGAL"
FT   gene            506046..506372
FT                   /locus_tag="RHECIAT_CH0000506"
FT   CDS_pept        506046..506372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000506"
FT                   /product="hypothetical protein"
FT                   /note="yhch00143"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000506"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89499"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q067"
FT                   /protein_id="ACE89499.1"
FT                   /translation="MALPAAAAGLDDVAIVRLLIDAHKAATARWDALAVVWPDEESVAL
FT                   WERLSAEKDAAAAAVCFYRPTTIEGVHVKAEYIFGCEDFVDQEANDDWTRAELISGFLP
FT                   PAVE"
FT   misc_feature    complement(506375..507676)
FT                   /note="yich00006; insertion sequence:Integrase, catalytic
FT                   core, phage"
FT   gene            507675..507941
FT                   /locus_tag="RHECIAT_CH0000507"
FT   CDS_pept        507675..507941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000507"
FT                   /product="hypothetical protein"
FT                   /note="yhch00144"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000507"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89500"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q068"
FT                   /protein_id="ACE89500.1"
FT                   /translation="MGINPRGHVGGTKDLRLSAVHCTLLHNWQRRNTMFCSACGEFGND
FT                   TALPCTKETPDYESGGQEFESLRVRHFLFHHLKFRMAPNGKVI"
FT   gene            507996..508688
FT                   /locus_tag="RHECIAT_CH0000508"
FT   CDS_pept        507996..508688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000508"
FT                   /product="putative DNA methylase protein"
FT                   /note="ypch00183; GO_function: GO:0003677 - DNA binding;
FT                   GO_function: GO:0008170 - N-methyltransferase activity;
FT                   GO_process: GO:0006306 - DNA methylation"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000508"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89501"
FT                   /db_xref="GOA:B3Q069"
FT                   /db_xref="InterPro:IPR001091"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR017985"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q069"
FT                   /protein_id="ACE89501.1"
FT                   /translation="MPGDRSGRRELAVAISDLLTVSNRHQFPLPDFQNGDEIRFPGALV
FT                   SALLDRFTKPGDVVFDPFVGLGTTFFVCEQRGRLPYGIEADRQRYEWVRERITAKHHLI
FT                   CGDSAELTAFDLPEMDFCITSPPYMPHWHKWNPLYNGDPDYDGYDVYLKRMQEIYGRIC
FT                   KRMKTDAYLVVQADNLTSEQFSPLVWDLGRALSEVMTLEGEIMVNWSDALENGNPFTQC
FT                   LVFRNTGA"
FT   gene            complement(508747..509172)
FT                   /locus_tag="RHECIAT_CH0000509"
FT   CDS_pept        complement(508747..509172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000509"
FT                   /product="hypothetical conserved protein"
FT                   /note="yhch00145"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000509"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89502"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q070"
FT                   /protein_id="ACE89502.1"
FT                   /translation="MRTFGMRKKGAMIYGQRLLALVSILLGSAAQTFACDQPVVISNWS
FT                   FCATGNVSAEGGAADWKVVPAWTREKAISAYFGNDPRLLANHGLCNAKFHRVVLCQPGW
FT                   QTGNPDECSYLVCSGYYSSLFGKEEREAYERDFPAEQ"
FT   gene            509437..510024
FT                   /locus_tag="RHECIAT_CH0000510"
FT   CDS_pept        509437..510024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000510"
FT                   /product="hypothetical conserved protein"
FT                   /note="yhch00146"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000510"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89503"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q071"
FT                   /protein_id="ACE89503.1"
FT                   /translation="MAEFNPRDKSRTSAGKTRSLVRKHTAPPSGGDDGSLRWQWSTVEL
FT                   LESPAFTSLSANAGRAFFRIIIEHTAHAALANGRLVVTHPQFVSYGVTGEYVADALDEL
FT                   AYKGLIKVRRGRAGSGVAHPNLFTLTFVGDHEGAPPTNDWRRCTAERCRKWSEIDRKLA
FT                   ADKRGRVGRKKKTPLRDPEIPPLRDPEIRRAS"
FT   gene            510247..510567
FT                   /locus_tag="RHECIAT_CH0000511"
FT   CDS_pept        510247..510567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000511"
FT                   /product="hypothetical conserved protein"
FT                   /note="yhch00147"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000511"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89504"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q072"
FT                   /protein_id="ACE89504.1"
FT                   /translation="MAMGIFRAVGAVALMAALVGCIDHANEPVLLAVGVPVNPPAVAHS
FT                   LCMTDGNAMYDEAKRQYELRAQLTGYAQADALEAETIARAAAHRQYVACLSGQGYRTLY
FT                   AN"
FT   gene            510759..511142
FT                   /locus_tag="RHECIAT_CH0000512"
FT   CDS_pept        510759..511142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000512"
FT                   /product="hypothetical conserved protein"
FT                   /note="yhch00148"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000512"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89505"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q073"
FT                   /protein_id="ACE89505.1"
FT                   /translation="MKIVSLAPLTAALGTLVALAAIAPAAAAPIPTLRPPIVSPSLSDA
FT                   KTVQYKAHAGTWHGYRGFATERPGTRRHSDGYWYPLAAFGVEPGTTGSIIRQPVNRPAA
FT                   PPMCNPTFSGSIGSGSMPCDNGY"
FT   gene            511299..511598
FT                   /locus_tag="RHECIAT_CH0000513"
FT   CDS_pept        511299..511598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000513"
FT                   /product="hypothetical conserved protein"
FT                   /note="yhch00149"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000513"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89506"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q074"
FT                   /protein_id="ACE89506.1"
FT                   /translation="MITTFKSGLAAAVIGAMLGLSSFSAEAAPLQSSATQQGAVKQPVA
FT                   QQETQMQHDRRTTGSIGERGPDTMASPYMMNPKKPLNMDCKLGFNPTSSSGCNY"
FT   gene            511817..512485
FT                   /gene="pmtA2"
FT                   /locus_tag="RHECIAT_CH0000514"
FT   CDS_pept        511817..512485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pmtA2"
FT                   /locus_tag="RHECIAT_CH0000514"
FT                   /product="phospholipid N-methyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000514"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89507"
FT                   /db_xref="GOA:B3Q075"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q075"
FT                   /protein_id="ACE89507.1"
FT                   /translation="MTAKAACSDFLHFFRSWISNPLRVAAIAPSGDSLARIMTSEIAAL
FT                   DGPIIELGPGTGVFTRALLARGVSEADLTLIEYGPEFIDALQARFPAARVLQMDAAHLA
FT                   QADIFDDEPVGAVISGLPLLSMSPRKIASILAGVFTYMRPGGAVYQFTYGPRCPVPRPI
FT                   LDRLGLKAVRIGGTVRNLPPASVYRISRRKPLELSRERVRYRDSDADIDVAAFSGETGG
FT                   "
FT   gene            512732..513613
FT                   /locus_tag="RHECIAT_CH0000515"
FT   CDS_pept        512732..513613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000515"
FT                   /product="probable oxidoreductase protein"
FT                   /note="ypch00184; GO_function: GO:0016491 - oxidoreductase
FT                   activity"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000515"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89508"
FT                   /db_xref="GOA:B3Q076"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q076"
FT                   /protein_id="ACE89508.1"
FT                   /translation="MASHNAAKSGTFRIGGEIEVNRLGFGAMRVTGKGIWGEPEDHAES
FT                   IRTLKRLPELGVNFIDTADSYGPDVSEWLIKEALHPYGGKSVVATKGGLTRHGPDIWLP
FT                   VGRPEYLIQQAHKSLRNLGVEQIDLWQLHRIDAKVPAREQFDAIKSLLDAGLIRHAGLS
FT                   EVSVAEIEAAAKHFKVATVQNRYNLVDRTSEDVLDYCAKHNIGFIPWYPLAAGDLAKSG
FT                   SLLDTIAKKHNAAPSQIALAWVLKRSPVMLPIPGTSKVKHLEENVAAVDIALSDDEFSA
FT                   LDAEGRKLFKAA"
FT   gene            513699..514148
FT                   /locus_tag="RHECIAT_CH0000516"
FT   CDS_pept        513699..514148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000516"
FT                   /product="hypothetical protein"
FT                   /note="yhch00150"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000516"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89509"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q077"
FT                   /protein_id="ACE89509.1"
FT                   /translation="MRDVGRGRKDRAVSPSPRERGPKDGSRPVARPRRWLQPDEGLAIG
FT                   DQRGLIFQQNLTNRSKMPQNEAASCCFEGKHCAGCIAALRYFRYSRSNEWAIYISVSSA
FT                   LLLPALLHRTDNTPPPSCQSGSRAWRTSSRARLFSFSQQVLHHAV"
FT   gene            514221..515498
FT                   /locus_tag="RHECIAT_CH0000517"
FT   CDS_pept        514221..515498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000517"
FT                   /product="hypothetical conserved protein"
FT                   /note="yhch00151"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000517"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89510"
FT                   /db_xref="InterPro:IPR010297"
FT                   /db_xref="InterPro:IPR014586"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q078"
FT                   /protein_id="ACE89510.1"
FT                   /translation="MIGKWRAPHAALTGLLVATLVLAGCGGRPVGVMQAAGTVPPGTSK
FT                   VDLLVATTRAADDNPAVLFSGERGTGLTVNAVDVSIPPDANRKVGQVQWPKRLPADPLR
FT                   DFVTVSVDPLEGERAGERWLKGHMPKSRRVLVFVHGFNNRYEDAVYRFAQIVHDSHADV
FT                   APVVFTWPSRASIFDYNYDKESTNYSRDALEELLTRTAANPAVGDITIMAHSMGTWLTV
FT                   EALRQMAIRNGQVAGKINNVILASPDLDVDVFGRQFASLGKDKPHFTIFVSQDDRALAL
FT                   SRRISGNIDRLGQIDPSAEPYRSKLEAAGITVLDLTKLKGGDRLNHGKFAESPEVVKLI
FT                   GDRLIAGQTITDSNVGLGEAVGAVAMGAAQTAGSAVGVAVSTPIAIFDPRTRRNYDAQL
FT                   KRLGQSVDNTVGSVGDSVGAGLPETQ"
FT   gene            515583..516833
FT                   /locus_tag="RHECIAT_CH0000518"
FT   CDS_pept        515583..516833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000518"
FT                   /product="probable D-amino acid dehydrogenase protein"
FT                   /EC_number="1.4.99.1"
FT                   /note="ypch00185; GO_function: GO:0016491 - oxidoreductase
FT                   activity; GO_process: GO:0006118 - electron transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000518"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89511"
FT                   /db_xref="GOA:B3Q079"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q079"
FT                   /protein_id="ACE89511.1"
FT                   /translation="MAEETKKRVVVVGAGVIGASTAFDLQRRGHQVTLVDKGEPGRGTS
FT                   FGNMASIALDFAAGSGPSTWKKMPRWLLDPEGPVWLRPSYAAKMLPWFLRFLAAGRPSR
FT                   LRQIEDAGMSLSERALGDFRQMLQAIAASELMTEEGCLAIYETEAEFAADRGHLAMMQR
FT                   YGLEFEVLSNGAIQYYEPALSPAIAKAVLLPDNKSIRDPYRLVVKLAEAAKAAGTAFVS
FT                   GAVRNIERKGDGAVVVLLEDGGRLEADSVVLAAGVHTRFLAEKLGEPIPLETERGYHTQ
FT                   IMKPGISMRYSMIWPARAFMVTPTAGGIRVGGNVELAGLDAAPDFRRPRVLVRHAQRAL
FT                   PGLKLEEATDWMGHRPALPDTIPIISPSSKMPGVFYATGHGHLGLTYAPTTARLIGDMV
FT                   SGIKPPVDMRPFRIDRY"
FT   gene            516869..517906
FT                   /locus_tag="RHECIAT_CH0000519"
FT   CDS_pept        516869..517906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000519"
FT                   /product="probable proline racemase protein"
FT                   /EC_number="5.1.1.4"
FT                   /note="ypch00186"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000519"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89512"
FT                   /db_xref="GOA:B3Q080"
FT                   /db_xref="InterPro:IPR008794"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q080"
FT                   /protein_id="ACE89512.1"
FT                   /translation="MRWKRTIQLLDVHAEGEIGRVAIGGVPKIPGDTIAAQLHWLNTDP
FT                   KGDELRRFLCLEPRGAPIGSVNLLLPARHPEADAAFIILQPDQAHASSGSNSICVTTAL
FT                   LEAGIVEMQEPETIVTLETAAGLVKATATCRDGRCEKVRLTMVPSFVHELDVTIDTPHW
FT                   GKIKADLCYGGIFYALVDVGQIGLTIEKANAAGLVQAGMILKELINRDIKVVHPEIPAI
FT                   SGVAYVMFRDTEADGTVRTCTTMWPGRADRSPCGTGNSANLAALHARGRAKIGDIFTSK
FT                   SIIGSQFEVGLQAVTEVAGRPAVIPTITGRGFTFGLTQVALDPFDPHPGGFALTDVWGP
FT                   SAGEI"
FT   gene            517950..518321
FT                   /locus_tag="RHECIAT_CH0000520"
FT   CDS_pept        517950..518321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000520"
FT                   /product="hypothetical protein"
FT                   /note="yhch00152"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000520"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89513"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q081"
FT                   /protein_id="ACE89513.1"
FT                   /translation="MVESIVLGNWCKRLAASLVAIPLCGCDPIIQHFADVEVSGDYKAI
FT                   ASCAAKYLSGQYWLREDHDDTKQVRFLQGSQDKFQTIIEVVGSGAGRTHVSVSEWSIGG
FT                   GSADLYESYFTYCASVTAK"
FT   gene            complement(518403..518675)
FT                   /locus_tag="RHECIAT_CH0000521"
FT   CDS_pept        complement(518403..518675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000521"
FT                   /product="hypothetical conserved protein"
FT                   /note="yhch00153"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000521"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89514"
FT                   /db_xref="InterPro:IPR007076"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q082"
FT                   /protein_id="ACE89514.1"
FT                   /translation="MKGILYLRVDAAMRAEFEAEGSEPFSYRAAGREVRVRRYYAVPAL
FT                   VIDDPSLLRRCSERAFEATLLPGRKRSNTILAVTSRKRLEMADDR"
FT   gene            complement(518800..519162)
FT                   /locus_tag="RHECIAT_CH0000522"
FT   CDS_pept        complement(518800..519162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000522"
FT                   /product="hypothetical conserved protein"
FT                   /note="yhch00154"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000522"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89515"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q083"
FT                   /protein_id="ACE89515.1"
FT                   /translation="MTPETLWNRYAAIWSLDADAREPEMLACLADDVTYCDPNGAIAGR
FT                   AGLSAYMADFKESVPAGRFIISSVLHHNERSLARWELRHEDDTVLQTGTSFAAMSDGRL
FT                   SAITGFFDPLTGQHHG"
FT   gene            complement(519159..519740)
FT                   /locus_tag="RHECIAT_CH0000523"
FT   CDS_pept        complement(519159..519740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000523"
FT                   /product="probable transcriptional regulator protein, TetR
FT                   family"
FT                   /note="ypch00187; GO_function: GO:0003700 - transcription
FT                   factor activity; GO_process: GO:0006355 - regulation of
FT                   transcription, DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000523"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89516"
FT                   /db_xref="GOA:B3Q084"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039419"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q084"
FT                   /protein_id="ACE89516.1"
FT                   /translation="MGRTREFDEEAVLKGAMHVFRKHGYQGASIRDLEEATGLKGGSIY
FT                   HAFGDKAGLFDAAFRHYNRAVLEGRLERFAPPGSGLKGLRELFLSLLHEPDNGSLGCLI
FT                   TNMAVEFGGDVKTHPRVEAALGLLRSTFRSRLSEPPSLARDTDRTKADRTAVRLLAFYQ
FT                   GLLVLIRGGEDKASLRQAIEDEFNQLETLL"
FT   gene            complement(519968..521500)
FT                   /locus_tag="RHECIAT_CH0000524"
FT   CDS_pept        complement(519968..521500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000524"
FT                   /product="probable two-component response regulator
FT                   protein"
FT                   /note="ypch00188; GO_function: GO:0000156 - two-component
FT                   response regulator activity; GO_function: GO:0003677 - DNA
FT                   binding; GO_process: GO:0000160 - two-component signal
FT                   transduction system (phosphorelay; GO_process: GO:0006355 -
FT                   regulation of transcription, DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000524"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89517"
FT                   /db_xref="GOA:B3Q085"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q085"
FT                   /protein_id="ACE89517.1"
FT                   /translation="MNTPHLAFGHFEFIAENGCLLRDDRPVAVGARGASLLAVLLAAQG
FT                   GVVAKSALIDAVWPGLAIEESNLSVQIAALRKLLGPAPDGGEWIITVPRVGYRFSGRVE
FT                   SASEGTDSGWHAQAGSKLGIAVLPFDNLGGDAEKQYLADGIADDLITALTRFRWLRVAS
FT                   RGASFKDRAGSRDPRAVGLELGVNFLVDGAIRYTGDRIRISVHLAEAGKGATVWSEHYD
FT                   LQLAEIFAVQDAIAERIAAAVEPELLLRHGLAVAPHTGNITAWDLVRQGTFNFHKVSRP
FT                   THLLARRFFREAAELDPMLPEAQIWRARVNAGLIAYGWTDDPAADGQEGLTAALRAIYL
FT                   DARNPYSHYALAIVSAYTGRADQAILAAERSIELGSSFALGHLVLGMARLFSGDATGAR
FT                   KPLSRGLELNPHDPQNGVWFSLLMLAQYFSGDVEGALDVGRAALKARPDWPALLRIHAC
FT                   CHTALGHIEQARRFAAAASSLPEAAGDALGPFREGNTEWATRLEQLLREAEL"
FT   gene            521619..522053
FT                   /locus_tag="RHECIAT_CH0000525"
FT   CDS_pept        521619..522053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000525"
FT                   /product="hypothetical conserved protein"
FT                   /note="yhch00155"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000525"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89518"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q086"
FT                   /protein_id="ACE89518.1"
FT                   /translation="MTNQATQPKNPYAGTAKVVSGSGSHVAQQGSVYRSGVSAQSVGST
FT                   MLWLGTISLPAGRRTSAHRHEGHETALLMTSGQEIEIWSGAKLERCELVRPGDYLFIPA
FT                   GVPHVAVNRSPEDAEFLGARNDPAANESVVLMQELDEIVP"
FT   gene            522119..522619
FT                   /locus_tag="RHECIAT_CH0000526"
FT   CDS_pept        522119..522619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000526"
FT                   /product="hypothetical conserved protein"
FT                   /note="yhch00156"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000526"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89519"
FT                   /db_xref="InterPro:IPR013813"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q087"
FT                   /protein_id="ACE89519.1"
FT                   /translation="MAIIEQRLAEMGLQLPEPLKVRDGLKLPFAWVRVRGTRAYISGHV
FT                   ACNPDGTLAKPLGKVGAEVSPEQGYASARLVALAHLASLKRALGDLDRVTAWLRVFAMV
FT                   NVAPGFNETPLVTNGYSDLILELYGPDVGAHARSSIGMAIPLNAPVNCEAEVEIDGKSP
FT                   GAG"
FT   gene            complement(522742..524289)
FT                   /locus_tag="RHECIAT_CH0000527"
FT   CDS_pept        complement(522742..524289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000527"
FT                   /product="putative sensory box/GGDEF family protein"
FT                   /note="ypch00189"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000527"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89520"
FT                   /db_xref="GOA:B3Q088"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q088"
FT                   /protein_id="ACE89520.1"
FT                   /translation="MPRIRPTRPQMEILGWLAIFLLLFCLSWRFQWHEELDEFIERHHR
FT                   YPLDHALLALNISGFLGLIYSALRIRDLSREVARRLQAEKNVDWIACHDTLTELPNRRF
FT                   LESVCARAMNERTAEEAYAVFSIDLDGFKKVNDLLGHDHGDAVLKTVAQRLSSLFPRDH
FT                   VFRLGGDEFVILARRVGNADLVALGNRIVSAIGKPFTFNGAAVDLGASVGFALYPENGD
FT                   ELGQVIRHSDCAMYVAKKQGRNLVKPFVPSMQDELAKRIRTEGDLRAAIRKAEIVPYYQ
FT                   PLVDLKANKIIGFEALARWKTASGEFIPPSEFIPVAEEAGLIVELTDQLLRRACTDALS
FT                   WPSELVLSFNLSPIQLSDRLLGLRILKILGDVGLPAHRVELEVTESAIIQDAVTARIVL
FT                   DDLVNAGVRIALDDFGTGFSSLSQLSSYRFDKIKIDRSFVASFETNDKQDKVIKAIIAL
FT                   GAGLGVAITAEGIEEESQLQRLQDLGCDIGQGYLLGRPAPIEEIAADQAGGRILQRR"
FT   gene            complement(524318..524653)
FT                   /locus_tag="RHECIAT_CH0000528"
FT   CDS_pept        complement(524318..524653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000528"
FT                   /product="hypothetical protein"
FT                   /note="yhch00157"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000528"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89521"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q089"
FT                   /protein_id="ACE89521.1"
FT                   /translation="MDLKWQKTTLVPPIFNDVYHHKCLMIFIIKVVKQIFLKPAPHANC
FT                   GNLSVARSETHAPSARQPTINLRGSKICLEVPVRLVDAGEPTSQLRPNELWRFDHRRGR
FT                   CGSASRP"
FT   gene            524718..525722
FT                   /locus_tag="RHECIAT_CH0000529"
FT   CDS_pept        524718..525722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000529"
FT                   /product="probable zinc-binding oxidoreductase protein"
FT                   /note="ypch00190"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000529"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89522"
FT                   /db_xref="GOA:B3Q090"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q090"
FT                   /protein_id="ACE89522.1"
FT                   /translation="MKAFVVDKYKKKGALRLASLPEPELQDNDVLVRIKATAVNQLDSK
FT                   VRDGEFKLILPYRPPFVLGHDLAGTVVKVGSRVRRFKVGDEVYARPRDHRVGTFAEFIA
FT                   IDEADAALKPSNLSMSEAASVPLVGLTAWQALVEVGKIKPGQKVFIQAGSGGVGTFAIQ
FT                   LAKHLGAAVATTTSAENAELARSLGADVVIDYKTQDFEKILSGYDLVLNSQDPKTLEKS
FT                   LGVLKPGGRLISISGPPDPAFARELGLNLFLKLVLWLLSRGVRRKAKRLGVAYSFLFMR
FT                   AEGRQLGEIARLIEQGLIRPVVDKVFPFEKTEDALAYVETGRAKGKVVIAVAN"
FT   gene            complement(525751..526332)
FT                   /locus_tag="RHECIAT_CH0000530"
FT   CDS_pept        complement(525751..526332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000530"
FT                   /product="putative transcriptional regulator protein, TetR
FT                   family"
FT                   /note="ypch00191; GO_function: GO:0003700 - transcription
FT                   factor activity; GO_process: GO:0006355 - regulation of
FT                   transcription, DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000530"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89523"
FT                   /db_xref="GOA:B3Q091"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039419"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q091"
FT                   /protein_id="ACE89523.1"
FT                   /translation="MRITKEQKQENYDRIIATASELFRERGFDGVGVAELMERAGLTHG
FT                   GFYNHFRSKEELIAESTENGLDETLQRYAGYDVLDVMELYLARDHRDGRGQGCTAAALS
FT                   CDAARQPETTKAVFAAGIDKLVRAVEGGIAQRHASGAGGRAQAIAILAQAVGAIVLSRA
FT                   CPDDSPLADELLDACRTDCRDAIENRMRQR"
FT   gene            526322..526513
FT                   /locus_tag="RHECIAT_CH0000531"
FT   CDS_pept        526322..526513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000531"
FT                   /product="hypothetical protein"
FT                   /note="yhch00158"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000531"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89524"
FT                   /db_xref="GOA:B3Q092"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q092"
FT                   /protein_id="ACE89524.1"
FT                   /translation="MIRTSRSFQRPFPAMIAVVIIAYILMMCIINMGGQQRRSVVTATH
FT                   FMQMAPRVFYARCHLQQL"
FT   gene            complement(526598..527875)
FT                   /locus_tag="RHECIAT_CH0000532"
FT   CDS_pept        complement(526598..527875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000532"
FT                   /product="putative catalase protein"
FT                   /EC_number="1.11.1.6"
FT                   /note="ypch00192"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000532"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89525"
FT                   /db_xref="GOA:B3Q093"
FT                   /db_xref="InterPro:IPR007760"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR010287"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR039377"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q093"
FT                   /protein_id="ACE89525.1"
FT                   /translation="MYHHVKKLMYTVRVDEPDPKFGNMLLEQFGGANGELAAAMQYSIQ
FT                   GLNCEDPGRKDLLMDIGTEELSHLEIVGTLARMHLKPLKSVREEAEADPLIAIAGGGGV
FT                   NLFNSMGNPWTADYLKITGELDVDLRSNIAAEARAKIVYERLIDFCRDPGTKDALQFLM
FT                   TREITHMRAFALALESMGKPPLSVGRIAPTAGLVDQFFNDSTGQGDLGEVDTRGPWNEG
FT                   EPWEFVEAPAFQDLPGAENGGRAIRAQSAPPEGAEAIQEVLVDELRDLLHAEKQLLKAL
FT                   PKMQKAARTQQLQTLLRNHLAETEAQVERLNECLRILGTSARAKPCKGMAGLVEEGEEV
FT                   MAEGKKKEDAPADLALIGAALRVEHYEIAAYTTARNMALQLGQPAVAQLLTLSLGEEQN
FT                   AGQLLDQVAQPLMSAARMPSSVLLTV"
FT   gene            527895..528170
FT                   /locus_tag="RHECIAT_CH0000533"
FT   CDS_pept        527895..528170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000533"
FT                   /product="hypothetical protein"
FT                   /note="yhch00159"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000533"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89526"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q094"
FT                   /protein_id="ACE89526.1"
FT                   /translation="MATNRPIAGMFPICGCCRRIGLRPHQPTPVGAASEAGIACADVPH
FT                   DKEPHHMLASSTGSSILAQQIGRGNADSRGWPDRQLRIFGVAQPGL"
FT   gene            complement(528233..528706)
FT                   /gene="fucU1"
FT                   /locus_tag="RHECIAT_CH0000534"
FT   CDS_pept        complement(528233..528706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fucU1"
FT                   /locus_tag="RHECIAT_CH0000534"
FT                   /product="fucose dissimilation pathway protein"
FT                   /note="GO_process: GO:0008643 - carbohydrate transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000534"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89527"
FT                   /db_xref="GOA:B3Q095"
FT                   /db_xref="InterPro:IPR007721"
FT                   /db_xref="InterPro:IPR023750"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q095"
FT                   /protein_id="ACE89527.1"
FT                   /translation="MLKGLDPLLSPELLFTLRAMGHGDEIAIVDGNYPGVEHARRLIRL
FT                   DGHRLIPVLNAVLSVLPIDDFVPEAIFRSTVKAERDKLDPVHEEMIDCCAVHEPHRQVV
FT                   PLVGQDFYGRVKAAHAVIQTSEPRLYANMILRKGVIYPKEPGTQAAEVDPFVY"
FT   gene            complement(528690..529937)
FT                   /gene="frcR"
FT                   /locus_tag="RHECIAT_CH0000535"
FT   CDS_pept        complement(528690..529937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frcR"
FT                   /locus_tag="RHECIAT_CH0000535"
FT                   /product="sugar transcriptional regulator protein, ROK
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000535"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89528"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q096"
FT                   /protein_id="ACE89528.1"
FT                   /translation="MSSLDGPEHTPVPPPILNPAGGANQVRVRAYNERLVLSLVRLYGA
FT                   LSKADIARRSGLSAQTVSVIMRVLEKEGLLSRGAPVRGRVGQPSIPMHLNPDAVYSFGL
FT                   KMGRRSADLVLMDFVGRIRMQLHQTYAYPLPDEILAFVTSGIAEIESRLDDKQRSRIAG
FT                   LGIAAPFELWNWAEEVGAPPGAMEVWRDVDLQADIAARVSHPVFLQNDATSACGAELVF
FT                   GVGPSYPDFVYFFIGSFIGGGIVLNSAIFSGRTGTAGAIGPLPVRDRNGETKQLLEIAS
FT                   IFVLENMLRERGIDPEPLWYSADDWVDFGAPMEIWIQDSAKALAQAIVAAASIVDFSAA
FT                   VIDGGFPHWVRSRVVQATIDEAAKLDLQGVVMPEIIEGAVGAQARAIGGASLPIFSRYL
FT                   TDQNVLFKEIDHAEGT"
FT   gene            530267..531286
FT                   /gene="frcB"
FT                   /locus_tag="RHECIAT_CH0000536"
FT   CDS_pept        530267..531286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frcB"
FT                   /locus_tag="RHECIAT_CH0000536"
FT                   /product="fructose ABC transporter, substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000536"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89529"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q097"
FT                   /protein_id="ACE89529.1"
FT                   /translation="MKKSVLAFGALALGVAFSAPVMAADVSACLITKTDTNPFFVKMKE
FT                   GATAKAKELGVSLKSYAGKVDGDSESQVAAIESCIADGAKGILLTASDTKGIVSSVKKA
FT                   RDAGVLVIALDTPLEPADAADATFATDNLLAGKLIGQWAKETLGDKAKDAKVGFLDLTP
FT                   SQPTVDVLRDQGFMMGFGIDPKNPDKIGDEDDKRIVGHDVTNGNEEGGRKAMENLLQKD
FT                   PGINVIHTINEPAAVGAYQALKAVGMEKNVLIVSVDGGCPGVKSVKEGVIGATSQQYPL
FT                   LMASLGIEAIKKFADSGEKPKPTEGKSFFDTGVSLVTDKPVSGVKSIDTKEGTAKCWG"
FT   gene            531439..532503
FT                   /gene="frcC"
FT                   /locus_tag="RHECIAT_CH0000537"
FT   CDS_pept        531439..532503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frcC"
FT                   /locus_tag="RHECIAT_CH0000537"
FT                   /product="fructose ABC transporter, permease protein"
FT                   /note="GO_component: GO:0016020 - membrane; GO_function:
FT                   GO:0005215 - transporter activity; GO_process: GO:0006810 -
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000537"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89530"
FT                   /db_xref="GOA:B3Q098"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q098"
FT                   /protein_id="ACE89530.1"
FT                   /translation="MTGAQEFERVLDGSDKNVASFEHQGVPLIKRAQHFLHSTPAAVPL
FT                   IVLVLAIIIFGIALGGRFFSSYTLTLILQQIAIVGVLGAAQTLVILTAGIDLSIGVIMV
FT                   ISAVIMGNVAITYGIPTPVAVIAGLLVGGLCGLLNGFLVAFMKLPPFIVTLGTWNIVMA
FT                   TNFIYSANETIRDADVDAQAPLLHLFAASFRLGTAVLTLGVIAMVLLVLLLWYVLNHTA
FT                   WGRHVYAVGDDPEAAKLSGIQTKKVLLTVYTISGVIAAFAAWVSIGRNGSISPSSAVTD
FT                   YNLQAITATVIGGISLFGGRGSILGTLFGAMIVGVVSMGLNMLGADPQWKVLLTGVLII
FT                   AAVAIDQWIRKVSV"
FT   gene            532506..533288
FT                   /gene="frcA"
FT                   /locus_tag="RHECIAT_CH0000538"
FT   CDS_pept        532506..533288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frcA"
FT                   /locus_tag="RHECIAT_CH0000538"
FT                   /product="fructose ABC transporter, ATP-binding protein"
FT                   /note="GO_function: GO:0005524 - ATP binding; GO_function:
FT                   GO:0016887 - ATPase activity"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000538"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89531"
FT                   /db_xref="GOA:B3Q099"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q099"
FT                   /protein_id="ACE89531.1"
FT                   /translation="MAREPLLTARGLVKRYGRVTALDNADFDLYPGEILAVIGDNGAGK
FT                   SSLIKAISGAVTPDEGVITLEGKPVQFRSPMEAREAGIETVYQNLALSPALSIADNMFL
FT                   GREIRKPGPLGSLFRMLDRPAMEKLARNKLSELGLMTIQNINQAVETLSGGQRQGVAVA
FT                   RAAAFGSKVIIMDEPTAALGVKESRRVLELILDVRARGLPIVLISHNMPHVFEVADRIH
FT                   IHRLGRRLTVIDPKEYTMSDAVAFMTGAKAVPTEPVAA"
FT   gene            533285..533917
FT                   /gene="frcK"
FT                   /locus_tag="RHECIAT_CH0000539"
FT   CDS_pept        533285..533917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frcK"
FT                   /locus_tag="RHECIAT_CH0000539"
FT                   /product="pantothenate kinase protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000539"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89532"
FT                   /db_xref="GOA:B3Q0A0"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q0A0"
FT                   /protein_id="ACE89532.1"
FT                   /translation="MTAGVDEIAGEVLNRAGDAKRFLIAIAGPPGAGKSTMADNLADAL
FT                   KAKGESVAVLPMDGFHMDNAVLIERGLLARKGIPETFDVRGFLDIVRAVRPADQEVLVP
FT                   VFDRSRELAIASARPIDPKDRFIIVEGNYLLFTQGKWAELDGIFDYTIMLAPPIEVLEE
FT                   RLWDRWRGYRLTEEEASAKVYGNDLPNGRLILENRRPADVTLEIALA"
FT   gene            533990..535036
FT                   /gene="pyrC"
FT                   /locus_tag="RHECIAT_CH0000540"
FT   CDS_pept        533990..535036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrC"
FT                   /locus_tag="RHECIAT_CH0000540"
FT                   /product="dihydroorotase protein"
FT                   /EC_number="3.5.2.3"
FT                   /note="GO_function: GO:0016787 - hydrolase activity"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000540"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89533"
FT                   /db_xref="GOA:B3Q0A1"
FT                   /db_xref="InterPro:IPR002195"
FT                   /db_xref="InterPro:IPR004721"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3Q0A1"
FT                   /protein_id="ACE89533.1"
FT                   /translation="MQSITIRRPDDWHLHLRDGAMLEGVIADTSRTFARAIIMPNLVPP
FT                   VVTTSDATAYRDRILKALPAGHHFQPLMTLYLTEHTSPDDVEAGAKSGLITAVKLYPAG
FT                   ATTNSHGGVRDLEKAMPVLERMARIGLPLCVHGEVTTPEVDIFDREAVFIDTVLDPLRK
FT                   RLPELKVTMEHVTTADGIDYIKAAQSNLAGSITTHHLIINRNAILVGGIRPHYYCLPVA
FT                   KRENHRLALRAAAVSGDARFFLGTDSAPHVDPLKECACGCAGIYTSINTMSCLAHVFEE
FT                   EGALDKLEAFASLNGPAWYGLSPNEERITLSRQAEPVVFPAKIETGAGPVTVFDPMFPL
FT                   HWQVMPQA"
FT   gene            535213..536391
FT                   /locus_tag="RHECIAT_CH0000541"
FT   CDS_pept        535213..536391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000541"
FT                   /product="putative sensory box/GGDEF family protein"
FT                   /note="ypch00193"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000541"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89534"
FT                   /db_xref="GOA:B3Q0A2"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q0A2"
FT                   /protein_id="ACE89534.1"
FT                   /translation="MTLDYNSLLLALGVSAACLAVTLMGSWLVRRAETVLLTATIGLVL
FT                   VVSGIFVYSAYVNRPEAAFAIGSFVLFHAGFATIWGAGKQFLTGCLSIPAIAMRALAAM
FT                   IFSVAPMLAGYDGLAFIADNLAIALLLFATARQYWLARAEAPAPILGIAALYTATAISF
FT                   VLCAAVLIADGKLVLGAAPSNWAEDLSLAVCIAGMTGIGALSLALHQWRLAARHRLEAI
FT                   TDPLTGLLNRRAVFDQHGTRPMGTTTAIIVFDIDHFKSVNDRFGHAAGDRVITVFAEEL
FT                   RANCSAGDTAARLGGEEFALVLKEIMPGRAELTAERIRRAFEAREIDIDGQMLKCTVSV
FT                   GVAPGRSQMPDFDTMLSAADKALYAAKRGGRNRVELAAHLRAVPAEVSRTAS"
FT   gene            536621..537130
FT                   /locus_tag="RHECIAT_CH0000542"
FT   CDS_pept        536621..537130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000542"
FT                   /product="putative glyoxalase protein"
FT                   /note="ypch00194"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000542"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89535"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q0A3"
FT                   /protein_id="ACE89535.1"
FT                   /translation="MAKTLRQALADRDISLTHSETLEIVARQFGLDQWNILSAKIEAAG
FT                   ASRSAVGIEPPTPIFRIFSVEKAMEFYCGFLGFHLDWEHRFDENSPLYCQVSRDGMALH
FT                   LSEHSGDASPGAKAFVRVANVRAYHAELAGKDYRYMKPGVEEAPWGLEMTVIDPFSNRI
FT                   AFCEQR"
FT   gene            complement(537522..538004)
FT                   /locus_tag="RHECIAT_CH0000543"
FT   CDS_pept        complement(537522..538004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000543"
FT                   /product="hypothetical conserved membrane protein"
FT                   /note="yhch00160"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000543"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89536"
FT                   /db_xref="GOA:B3Q0A4"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q0A4"
FT                   /protein_id="ACE89536.1"
FT                   /translation="MQIVLILSLVAAALGSGLVAGIFFAFSTFIMTAFSRIPAEQGIAA
FT                   MNSINVTIVRSPFMALFVPTAILCLVITVLAVINWRGGASALMLAGAALYVVASFLSTI
FT                   IFNVPMNDALEKVSGNGPEAVALWSTYLEDWTWWNHVRTVASLLASVAFVRALMIV"
FT   gene            538100..538753
FT                   /locus_tag="RHECIAT_CH0000544"
FT   CDS_pept        538100..538753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000544"
FT                   /product="putative transcriptional regulator protein, TetR
FT                   family"
FT                   /note="ypch00195; GO_function: GO:0003700 - transcription
FT                   factor activity; GO_process: GO:0006355 - regulation of
FT                   transcription, DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000544"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89537"
FT                   /db_xref="GOA:B3Q0A5"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR039419"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q0A5"
FT                   /protein_id="ACE89537.1"
FT                   /translation="MSEQAGASRRRQQQHTGQPRRIPSQQRGRERFEKILAVAAELIES
FT                   KGSDGLKMSEIVEKAGISFGALYQYFPDKSAIIRTLAERFNDEGRRCVAAELAKVADAA
FT                   ALQGALANIVDEYYAFFRREPVMRDLWHATHTDKLLQQIDAEDMEFHAQAFLAVLVRLW
FT                   PDRDHGELLAIARLTMQLLAAAVRYAVSLDAEEGARAIALFKTMQLVDFSRLLR"
FT   gene            538829..539518
FT                   /gene="pyrE"
FT                   /locus_tag="RHECIAT_CH0000545"
FT   CDS_pept        538829..539518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrE"
FT                   /locus_tag="RHECIAT_CH0000545"
FT                   /product="orotate phosphoribosyltransferase protein"
FT                   /EC_number="2.4.2.10"
FT                   /note="GO_process: GO:0009116 - nucleoside metabolic
FT                   process"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000545"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89538"
FT                   /db_xref="GOA:B3Q0A6"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3Q0A6"
FT                   /protein_id="ACE89538.1"
FT                   /translation="MIQTTFPDRAVMAELVAKMLWEIKAVHFNAGEPYKLSSGMASPVY
FT                   IDCRKLLSYPRIRSTVMDFAASTLMRDAGFEQFDCIAGGETAGIPFAALLADRLGLPMI
FT                   YVRKQPKGHGRNAQIEGNMPEGSRVLVIEDLTTAGGSMFKFIDAVRAAGGIVDHGIALF
FT                   FYDIFGQQRFTDGKVRLHHIATWRNVLAVAKAQQLFDDKTLAEVEAFLDAPLAWSGRNG
FT                   GVCELSL"
FT   gene            539581..540507
FT                   /gene="frk"
FT                   /locus_tag="RHECIAT_CH0000546"
FT   CDS_pept        539581..540507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frk"
FT                   /locus_tag="RHECIAT_CH0000546"
FT                   /product="fructokinase protein"
FT                   /EC_number="2.7.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000546"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89539"
FT                   /db_xref="GOA:B3Q0A7"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q0A7"
FT                   /protein_id="ACE89539.1"
FT                   /translation="MILCCGEALIDMLPRDTTLGEKGFAPYAGGAIFNTAIALGRLGIP
FT                   TAFFTGIADDMMGEILLATLKAANVDYSPCAITQRPSTIAFVKLVNGQATYAFYDEGTA
FT                   GRMITEADLPVLGDDCEALHFGAISLIPSPCGETYEALLDREAEKRVISLDPNIRPGFI
FT                   KDKPAHMARIKRMAAKADIVKFSDEDLDWFGLEGDHDALAAHWLAHGAKLVVITKGAEG
FT                   ASGYTQERKVTVPSERVTVVDTVGAGDTFDAGVLASLKRDGLLTKAQVASLDEQAVRNA
FT                   LTLGAKAAAVTVSRAGANPPWAHEIGL"
FT   gene            complement(540792..542198)
FT                   /gene="otsA"
FT                   /locus_tag="RHECIAT_CH0000547"
FT   CDS_pept        complement(540792..542198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="otsA"
FT                   /locus_tag="RHECIAT_CH0000547"
FT                   /product="trehalose-6-phosphate synthase protein"
FT                   /EC_number="2.4.1.15"
FT                   /note="GO_function: GO:0003824 - catalytic activity;
FT                   GO_process: GO:0005992 - trehalose biosynthetic process"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000547"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89540"
FT                   /db_xref="GOA:B3Q0A8"
FT                   /db_xref="InterPro:IPR001830"
FT                   /db_xref="InterPro:IPR012766"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q0A8"
FT                   /protein_id="ACE89540.1"
FT                   /translation="MSRLIVVSNRVPVPSKDGGAAAGGLAVALQAALQERGGIWMGWSG
FT                   ESSGDREPGALSLRQKGNITYALTDLTDTDVEEYYRGFANRVLWPICHYRLDLAEYGRK
FT                   EMAGYFRVNRFFAHRLAPLIEPDDIIWVHDYHLIPLAAELRQMGLKNRIGFFLHIPWPP
FT                   ADILVTMPVHEEIMRGLSHYDLVGFQTDYDLQNFAGYLRREGIGDDLGNGLFDSHGRIF
FT                   KAGAYPIGIETAAFAEFAEKAANNVMVQKTRRSIEGRDMIIGVDRLDYSKGIIQRLEAF
FT                   ERFITCNPAYQNKVTFLQITPKSRSEVPEYEQMQKMVAEQAGRVNGAIGTVDWVPIRYV
FT                   NRSISRNVLAGLFRLATIGLVTPLRDGMNLVAKEYVAAQDPDRPGVLVLSRFAGAAREL
FT                   KGALLVNPYDVEGTGNAIARGLAMSIEERRDRWRMMMEHLLSHDVSLWCKEFLRDLVTA
FT                   PSSDRSEAEG"
FT   gene            complement(542767..544392)
FT                   /gene="pgi"
FT                   /locus_tag="RHECIAT_CH0000548"
FT   CDS_pept        complement(542767..544392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgi"
FT                   /locus_tag="RHECIAT_CH0000548"
FT                   /product="glucose-6-phosphate isomerase protein"
FT                   /EC_number="5.3.1.9"
FT                   /note="GO_function: GO:0004347 - glucose-6-phosphate
FT                   isomerase activity; GO_process: GO:0006094 -
FT                   gluconeogenesis; GO_process: GO:0006096 - glycolysis"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000548"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89541"
FT                   /db_xref="GOA:B3Q0A9"
FT                   /db_xref="InterPro:IPR001672"
FT                   /db_xref="InterPro:IPR018189"
FT                   /db_xref="InterPro:IPR023096"
FT                   /db_xref="InterPro:IPR035476"
FT                   /db_xref="InterPro:IPR035482"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3Q0A9"
FT                   /protein_id="ACE89541.1"
FT                   /translation="MNAIVEQLKSTAAATKATDLRAAFAADAQRFSRFSVALDDLLMDF
FT                   SKTAVNDDILKLLVKLAEDGGVEKKREEMFSGKAINFTEDRAVLHTALRNRSNTPVLVD
FT                   GKDVMPDVNAVLAAMGKFADEIRSGALKGATGKAITDVINIGIGGSDLGPVMATLALAP
FT                   FHDGPRAHFVSNIDGAHIADILKLVQPETTLFIVASKTFTTVETMTNAQTARNFIAKAL
FT                   GEAAVQHHFAAVSTALDKVAAFGIDSARVFGFWDWVGGRYSIWSAIGLPLMIAIGPENF
FT                   GKFLDGAHAVDNHFRKAPITENLPMLLGLIGFYHRNVLGYPTRAILPYDQRLSRFPAYL
FT                   QQLDMESNGKGVTIDGTPVEGNSGPVVWGEPGTNGQHAFYQLIHQGTSIIPAEFMIAAN
FT                   AFEPELRHQHQLLISNVLAQSEALMKGRTFAEAKKQLTDKGMDDKKADFIAPHRVFTGN
FT                   RPSITFVYDKLTPYALGRLIALYEHRVFVEGVLFRINSFDQWGVELGKELATGLLPVVE
FT                   GKESAEGHDSSTQGLVAALAKLAK"
FT   gene            complement(544533..546233)
FT                   /gene="fadD"
FT                   /locus_tag="RHECIAT_CH0000549"
FT   CDS_pept        complement(544533..546233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadD"
FT                   /locus_tag="RHECIAT_CH0000549"
FT                   /product="long-chain-fatty-acid-CoA ligase protein"
FT                   /EC_number="6.2.1.3"
FT                   /note="GO_function: GO:0003824 - catalytic activity;
FT                   GO_process: GO:0008152 - metabolic process"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000549"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89542"
FT                   /db_xref="GOA:B3Q0B0"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q0B0"
FT                   /protein_id="ACE89542.1"
FT                   /translation="MSSISVHPNGAKADKPWLATYPEMVPAELPPLEHASLAELLEKSC
FT                   ARYADRTVFSSMGKAMSYRELEDQTRKVAAWLQSIGLEKGDRVAVMMPNVLQNPVATYA
FT                   ILRAGFVVVNVNPLYTPRELEHQLRDSGAKAIFVLENFARTVEQVLNKTDLRHVVVTSL
FT                   GEMLGPKGLIVNLVVRKVKKLVPSWSIPQHKSFSQVLREGAKKSLQPVTLAGGDVAFLQ
FT                   YTGGTTGVAKGAVLTHQNLLANKLQLSLWLRSAFERKKQPEVLNFLCALPLYHIFALTV
FT                   NSLMGMSLGAHNILIANPRDIPGLVKEFEKSDVHIFPGLNTLFNALMNNAEFAELDFSS
FT                   LIMSLGGGMAVQRPVAERWLKMTGTAITEGYGLSETSPVATANRFDSIEFTGSIGLPLP
FT                   STELDIRDEEGRPLPLGEIGEICIRGPQVMAGYWQKPEETARVMTADGYFRSGDMGFMD
FT                   ERGYTKIVDRKKDMILVSGFNVYPNEIEEVAAMHAGILEAAAIGVPDGHSGEAVKLFVV
FT                   RKDPNLTEAEVKAHCIANLTNYKRPRFIEFRTELPKSPVGKILRKDLRG"
FT   gene            546494..546886
FT                   /locus_tag="RHECIAT_CH0000550"
FT   CDS_pept        546494..546886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000550"
FT                   /product="hypothetical conserved protein"
FT                   /note="yhch00161"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000550"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89543"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q0B1"
FT                   /protein_id="ACE89543.1"
FT                   /translation="MLNQDTDASRRDPDTKETHSLIASDRVEGTRVYGSDGRHIGSIER
FT                   LIIGKRDGRVAYAVLSFGGFLGIGHDHYPLPWEKLNYDTQLDGYRIDLTKEQIEGAPSY
FT                   SDDDDTWYNDNGRRVYDYYGVPPYWM"
FT   gene            complement(547042..549495)
FT                   /gene="manB1"
FT                   /locus_tag="RHECIAT_CH0000551"
FT   CDS_pept        complement(547042..549495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="manB1"
FT                   /locus_tag="RHECIAT_CH0000551"
FT                   /product="beta-mannosidase protein"
FT                   /EC_number="3.2.1.25"
FT                   /note="GO_function: GO:0004553 - hydrolase activity,
FT                   hydrolyzing O-glycosyl compounds; GO_process: GO:0005975 -
FT                   carbohydrate metabolic process"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000551"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89544"
FT                   /db_xref="GOA:B3Q0B2"
FT                   /db_xref="InterPro:IPR006102"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR036156"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q0B2"
FT                   /protein_id="ACE89544.1"
FT                   /translation="MIEKTVLNSGWTLSCNDTARPGLPETIAATVPGCVHLDLIASRLI
FT                   PDPYIDVNEITNDWIGKTDWTYRCSFEAAPDDDRVWEFVFDGLDTVAVIALNGEEIGRS
FT                   FNMHRTYRFDVSGLLKTGANELTVSFRSAYAYGAEMETHYGYRPNNYPGPGNLMRKMAC
FT                   NFGWDWGPTLVTAGLWKPVRLESWDRARLAEIRVSATLAGGDGLVKIHSRLARHGDRAP
FT                   CRLVATIGGITKTVAIGAGQDEFAFELRLPSPQLWWPHHLGAQPLYALTLELLDDAGGV
FT                   LDSYERELGFRSLRLDTSADAHGSAFTFIINDVPLFIAGANWIPDDCFPSRVTAERYAA
FT                   RIEEAKAANIHMLRVWGGGIFEHDEFYAACDRMGMLVWQDFLFACAAYPEEEPLKSEVE
FT                   AEVRDNVVRLMSHASLILWNGNNENIWGFDEWGWRPIIKQGESWGLGYYLDLLPRLCSE
FT                   LDPDRPYYPGSPYSGSMEIEPNADGHGCKHIWDVWNDVGYEVYRDYIPRFCSEFGWQAP
FT                   PAWATIEESVHDQPLTPQSNGVFHHQKATLGNDKLIRGLAGHLPEPKTMDDWHFATQLN
FT                   QARAIRFAIEHLRSHREICRGAVVWQFNDCWPVTSWAALDSAGRRKPLWYALQAAYDPR
FT                   LLTIQPRGRGLAAVAVNERTLFWRAKISGRRLKLDGTVLAEFEFWRLLCDRFEAKEFPL
FT                   PENIVRPDLPKDEVIVVEMLDRRALHYFVEDIELALPVPRLAVDVTGTEGGYAVKVTAE
FT                   NFLKDLCLMADRLDPDAVVDTMLVTLLPGESHVFAVKTAKVISANDLVVGTVLRSANDL
FT                   VAGRQ"
FT   gene            complement(549563..549937)
FT                   /gene="lguL"
FT                   /locus_tag="RHECIAT_CH0000552"
FT   CDS_pept        complement(549563..549937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lguL"
FT                   /locus_tag="RHECIAT_CH0000552"
FT                   /product="lactoylglutathione lyase protein"
FT                   /EC_number="4.4.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000552"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89545"
FT                   /db_xref="GOA:B3Q0B3"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q0B3"
FT                   /protein_id="ACE89545.1"
FT                   /translation="MIRVLDEARSVDFYRKAFGLEVADRVDFETFTLIYLSNAETGFEL
FT                   ELTVNKGRTEPYNLGNAYGHLAISVEEVAVERERMLKLGLKTGELVELNRDGRLFGLFF
FT                   FVSDPDGYKIEVLQRHGRFL"
FT   gene            complement(550003..550752)
FT                   /locus_tag="RHECIAT_CH0000553"
FT   CDS_pept        complement(550003..550752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000553"
FT                   /product="probable proline/glycine betaine ABC transporter,
FT                   permease protein"
FT                   /note="ypch00196; GO_component: GO:0016020 - membrane;
FT                   GO_function: GO:0005215 - transporter activity; GO_process:
FT                   GO:0006810 - transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000553"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89546"
FT                   /db_xref="GOA:B3Q0B4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q0B4"
FT                   /protein_id="ACE89546.1"
FT                   /translation="MKLVVANLFRLAALALLLILLFRTEWLSFLLTPLTSNNAPAVYTQ
FT                   NSLASLAAGHLQLVVGSIACSAVLAVLGGIFVTRESGADFLPLSRAIANAGQTFPPVAV
FT                   LALAVPATGFGAMPTLIALFLYGLLPIFENTVAGLKQVSPQVLDAADGMGMSATQRLLR
FT                   VELPLALPLILEGLKVATVINIGTATIGSTVAAKGLGEVIIAGLISDNTAFILQGGLIV
FT                   GLMAVLIYDAMGLVEGAITRRIGLRAA"
FT   gene            complement(550749..551693)
FT                   /locus_tag="RHECIAT_CH0000554"
FT   CDS_pept        complement(550749..551693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000554"
FT                   /product="probable proline/glycine betaine ABC transporter,
FT                   ATP-binding protein"
FT                   /note="ypch00197; GO_function: GO:0005524 - ATP binding;
FT                   GO_function: GO:0016887 - ATPase activity"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000554"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89547"
FT                   /db_xref="GOA:B3Q0B5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q0B5"
FT                   /protein_id="ACE89547.1"
FT                   /translation="MSMIEIRNVTKRYGAATVVDDVSMQVEKGSITVVVGTSGSGKSTL
FT                   MRMINRLVPITEGEIFVGGQNVMDVEVTELRRRIGYAIQGHGLFPHRTVAQNIATVPQL
FT                   LEWDSARIAARVEELLGLFNLDPATFADKYPHQLSGGQQQRVGVARALAAEPELLLMDE
FT                   PFGALDPVIRGKAQDDLLAIQKQFGTTIILVTHDMDEAFHLGNQIAVMSQGRLLQCSTP
FT                   ERILTEPADPFVQQLTGTSDRALKLMSLLPLEESMEPAKSGLAYALPQSLSLRDALAEM
FT                   IWQGVDEAAVQDGEKAPVGSISMTRLLELGRKA"
FT   gene            complement(551690..552856)
FT                   /locus_tag="RHECIAT_CH0000555"
FT   CDS_pept        complement(551690..552856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000555"
FT                   /product="probable proline/glycine betaine ABC transporter,
FT                   permease protein"
FT                   /note="ypch00198; GO_component: GO:0016020 - membrane;
FT                   GO_function: GO:0005215 - transporter activity; GO_process:
FT                   GO:0006810 - transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000555"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89548"
FT                   /db_xref="GOA:B3Q0B6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q0B6"
FT                   /protein_id="ACE89548.1"
FT                   /translation="MDETSAVRRLDRLGVVLVAGGIAATALMPFIYVKANRIAAGKPML
FT                   LTQLFPQPSVVVLTALLILTALATLFLRSAVARLVIATLCLVALVVAIGLVSSAATPPG
FT                   STVARMTPGGGFWVLFAVIGLIISDALVKIRLAPWMRVVALAAYTALLFISLASGLLDS
FT                   LSIMKEFATRAPQFETEAISHLLLALGSLAIAIILGLPLGILCFWVPRLRAVVLQGLSL
FT                   IQTIPSLALFGLLMLPLGYLATHVPLASAIGIRGIGTAPALIALVLYSLLPIVANTVVG
FT                   LQGVDPSVRDAAAGMGLTRRQILVGIDMPLAFPVILTGIRIVLVQAIGMVTIAALIGGG
FT                   GFGIFIFQGLGQTAMDLVLLGAVPTVFFAFSSAVILDAVIDSIRGPAA"
FT   gene            complement(552915..553823)
FT                   /locus_tag="RHECIAT_CH0000556"
FT   CDS_pept        complement(552915..553823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000556"
FT                   /product="probable glycine betaine ABC transporter,
FT                   substrate-binding protein"
FT                   /note="ypch00199; GO_function: GO:0005215 - transporter
FT                   activity; GO_function: GO:0005488 - binding; GO_process:
FT                   GO:0006810 - transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000556"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89549"
FT                   /db_xref="GOA:B3Q0B7"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q0B7"
FT                   /protein_id="ACE89549.1"
FT                   /translation="MLKKLALAVSLSAFAAGAVQAADVVVSSKIDTEGTLLGNVIALAL
FT                   EANGIKTQDRIALGATPVVRKAITAGEIDIYPEYTGNAGFFFNKADDAAWKNNDQGYEL
FT                   AKKLDYDANKIVWLTPSPANNTWALAVRNDVASPNKLKTMSDFGKWVAGGGTAKLAASS
FT                   EFVNSAGALPAFQTTYGFQLKPDQMVVLSGGDTAATIKAAADQTNGVNTAMVYGTDGAI
FT                   EAAELTVLEDDKGVQQVYAPTPIIREAVLKANPKIEEILSPIFKSLNADELRKLNAKIQ
FT                   VDGEPAKSVAEAYLKEKGFLK"
FT   gene            complement(553817..554206)
FT                   /locus_tag="RHECIAT_CH0000557"
FT   CDS_pept        complement(553817..554206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000557"
FT                   /product="hypothetical protein"
FT                   /note="yhch00162"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000557"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89550"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q0B8"
FT                   /protein_id="ACE89550.1"
FT                   /translation="MMCSRKKISLPRQSRAIVAVIIIRAAATRARAPEPSRKHAREQKQ
FT                   IAPDLEKGMPFRAPGRVRRHNHRRERKYWRGPASIFRVCTLFPRRTQFRHDGGLVAFAG
FT                   GFPAQTPPAGGLRHVNGVKTGDIPC"
FT   gene            554244..555473
FT                   /locus_tag="RHECIAT_CH0000558"
FT   CDS_pept        554244..555473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000558"
FT                   /product="probable transcriptional regulator protein, LysR
FT                   family"
FT                   /note="ypch00200; GO_function: GO:0003700 - transcription
FT                   factor activity; GO_process: GO:0006355 - regulation of
FT                   transcription, DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000558"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89551"
FT                   /db_xref="GOA:B3Q0B9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q0B9"
FT                   /protein_id="ACE89551.1"
FT                   /translation="MHLGALFIIRHVLTSASVRETARRFQLSPSTVSAAIRNAETELAM
FT                   KLTERASGELVTLIASGGVLEGLEPITAAIGELCLFAGHAGAEGIDEVWAARIPVKIGA
FT                   MERFLEVADQGSINRAARRLHLGQPQLSLQLANLEKFLGRRLFERQAQGSVLTEEGRRA
FT                   HQIFMAIIQAWNDLKSAADERYRRTARSLRIGSIIPTGSESWVARCLGLLVSEWNARRS
FT                   NNAISLVSMTADDLREALKSGRIDVAILDSVFGLDDFRHRELLQTDMVVIAPPQSTETT
FT                   VADLVAGHAICMPSPRTGLGHAAMALSHERAPDRRLRSRDITAADSLPVIVDLVANHGY
FT                   VSFLGRVSAMPIADKVRIVDLDEALPMSYHVAFNHRKAAADASAVIIAAAARITSETVA
FT                   KTDAVRESAA"
FT   gene            555470..556195
FT                   /gene="cutC"
FT                   /locus_tag="RHECIAT_CH0000559"
FT   CDS_pept        555470..556195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cutC"
FT                   /locus_tag="RHECIAT_CH0000559"
FT                   /product="copper homeostasis protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000559"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89552"
FT                   /db_xref="GOA:B3Q0C0"
FT                   /db_xref="InterPro:IPR005627"
FT                   /db_xref="InterPro:IPR023648"
FT                   /db_xref="InterPro:IPR036822"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q0C0"
FT                   /protein_id="ACE89552.1"
FT                   /translation="MTILLEVCVDSAEGLAAAIEGGAGRIELCSALELGGLTPLPSLMR
FT                   IAARAPIPVYAMIRPHAGPFIFGSADEEAMLLDIDAVRAAGLAGVVIGANRPDGRLDMP
FT                   LIHRLKAHASGLGSTLHRAFDLVPDADQALEQAVELRCERVLTSGCALKAADGTETLKR
FT                   LSAKAAGRISIMPGSGIRPANVGAILQATGAREVHGSCSSPVESVDPRAVAFGFEAKSS
FT                   NRTDVDVVRDMRRAIAAAG"
FT   gene            complement(556423..557442)
FT                   /locus_tag="RHECIAT_CH0000560"
FT   CDS_pept        complement(556423..557442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000560"
FT                   /product="probable Zn-dependent alcohol dehydrogenase
FT                   protein"
FT                   /EC_number="1.1.1.-"
FT                   /note="ypch00201"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000560"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89553"
FT                   /db_xref="GOA:B3Q0C1"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q0C1"
FT                   /protein_id="ACE89553.1"
FT                   /translation="MKAVVCREPGVLEIVERPSPAAPAPGWVRLAVSHVGICGTDYHIF
FT                   EGKHPFLEYPRVMGHEISATVIEAGDGVTLAAGTPVIVNPYLSCGQCVACIKGKPNCCT
FT                   NIKVLGVHTDGAFCEEISVPAGNLYPARGLSLEAAATTEFLAIGAHAVRRSLAGAGQRA
FT                   LVIGAGPIGLGAAIFSRIAGHEVTLLDTSAERLQMASERFGFTSGIVADAKTADAVREK
FT                   TDGDGFDVVFDATGYGPSMEKAFSFVAHGGALVLVSVVKDDIRFSDPEFHKREMMLIGS
FT                   RNATRADFEHVADSIAKGLVPVDKLITHRTTLADAPRDLARWAHEKSGLIKAVIRVGG"
FT   gene            complement(557506..558480)
FT                   /locus_tag="RHECIAT_CH0000561"
FT   CDS_pept        complement(557506..558480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000561"
FT                   /product="probable sugar ABC transporter, permease protein"
FT                   /note="ypch00202; GO_component: GO:0016020 - membrane;
FT                   GO_function: GO:0005215 - transporter activity; GO_process:
FT                   GO:0006810 - transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000561"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89554"
FT                   /db_xref="GOA:B3Q0C2"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q0C2"
FT                   /protein_id="ACE89554.1"
FT                   /translation="MTATPTEIVAPPPRRKMNILFGLTLIGLLIFLWIVLGFVTESFWT
FT                   PLNISNLLRQGAMTAILALGQTFVIITAGIDLSVGAIVGFCTVIIAWLLQAGVPLWGAI
FT                   VLTLAIGVAIGAFHGFGIVHMGLPPFIITLATLTSLRGIGLLITNGSTISITDESFSNF
FT                   ARADFLGIPSLFWMVILVAVPSFVFLHLSRWGRYLFAVGSNAEAARLSGVNVKGMIYLA
FT                   YILSAGFAAFVGVLLASRIAIGNATQADGWELQAIASSVIGGTSLFGAVGSVHGPLIGA
FT                   FILATINNGANLLNVNSFWQRIITGLLIIVIVFFDQLRRRKSN"
FT   gene            complement(558508..560061)
FT                   /locus_tag="RHECIAT_CH0000562"
FT   CDS_pept        complement(558508..560061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000562"
FT                   /product="probable sugar ABC transporter, ATP-binding
FT                   protein"
FT                   /EC_number="3.6.3.17"
FT                   /note="ypch00203; GO_function: GO:0005524 - ATP binding;
FT                   GO_function: GO:0016887 - ATPase activity"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000562"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89555"
FT                   /db_xref="GOA:B3Q0C3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q0C3"
FT                   /protein_id="ACE89555.1"
FT                   /translation="MTGLEEVSHRHDDSATLKEANRIPAGSPILELKGLQKNYGHVQAL
FT                   KPATLTFLAGEIHAIVGENGAGKSTLIKLLTGVITRTAGEVLWCGHPVGLSTPNEAIAR
FT                   GINAVHQEVVLCRHLTVAANLFLGDEVNRYGLMRKKQMEKMAQAVLDDLGFGLPAGALL
FT                   SSLTIGQQQLVATARAAMRGTQFLIFDEPTAYLTRQESAQLFKLIRRLQGEGVTIVYIS
FT                   HRMEEVFELADRVSVLRDGTHVGTRLIGETNDAELIALMINRSIEQIYHKEEIAIGQTI
FT                   VEAKGLSGPGFEDVSLSVKSGQIVGLYGLIGAGRSEFALGLYGRQPISAGEIEWMGKPV
FT                   DIRNERTAMELGIALAPESRRDQGLCLNLPIGLNINLPVFGRLSHGPVINHARESANAD
FT                   RQIRDLSIKTPSRRVPASSMSGGNQQKIVIGKWLSHGARLFIFDEPTVGVDVGTKAEIY
FT                   RLFAKLLKEGAGIILISSYLPEVYELADRLHVFRGGRLVASHDFHAATHEQVLSEAIGV
FT                   "
FT   gene            complement(560181..561170)
FT                   /locus_tag="RHECIAT_CH0000563"
FT   CDS_pept        complement(560181..561170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000563"
FT                   /product="probable sugar ABC transporter, substrate-binding
FT                   protein"
FT                   /note="ypch00204"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000563"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89556"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q0C4"
FT                   /protein_id="ACE89556.1"
FT                   /translation="MSIVKSLLSRRAFTALAGAAVIATAMPVTSFAAEVTIPIIVKDTT
FT                   SFYWQIVLAGARKAGQDLGVKVPELGAQAESDINGQISILENAVAGKPAAIVISPTEFK
FT                   ALGKPIDEAAKSVPIIGIDSGADSKAFKSFLTTDNVQGGRIAADGLAAAIKEMTGKEEG
FT                   DIVILTNLPGVGSLEQRREGFLDQIKTKHPGLKVIADKYGDGQATTGLNMMTDLITANP
FT                   KLVGVFASNLILAQGVGQAIAENKLGDKIKVIGFDSDDKTVGFLKDGAIAGLVVQDPYR
FT                   MGYDGIKTALAVSKGEKVPENVDTGANLVTKANMADPKIDALLNPKIK"
FT   gene            complement(561377..561826)
FT                   /gene="fucU2"
FT                   /locus_tag="RHECIAT_CH0000564"
FT   CDS_pept        complement(561377..561826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fucU2"
FT                   /locus_tag="RHECIAT_CH0000564"
FT                   /product="fucose dissimilation pathway protein"
FT                   /note="GO_process: GO:0008643 - carbohydrate transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000564"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89557"
FT                   /db_xref="GOA:B3Q0C5"
FT                   /db_xref="InterPro:IPR007721"
FT                   /db_xref="InterPro:IPR023750"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q0C5"
FT                   /protein_id="ACE89557.1"
FT                   /translation="MLRGIHPLLGPDLLHALKTMGHGDDIVISDANFPSGSMGPPVIRA
FT                   DGVSATAMAEAILTHMPLDTFVPETAWRMEVVGDPQAVPEVCAEFQEIVSRRAGDFVIV
FT                   PVERFAFYAMARKAAYIVATTEFRLYGNLILKKGVVHPHEVEFGR"
FT   gene            complement(561837..562856)
FT                   /locus_tag="RHECIAT_CH0000565"
FT   CDS_pept        complement(561837..562856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000565"
FT                   /product="putative L-fucose dehydrogenase protein"
FT                   /EC_number="1.1.1.122"
FT                   /note="ypch00205; GO_function: GO:0016491 - oxidoreductase
FT                   activity"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000565"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89558"
FT                   /db_xref="GOA:B3Q0C6"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q0C6"
FT                   /protein_id="ACE89558.1"
FT                   /translation="MKTRRIGKTRLEVTEISFGAAALGGLYRACPREQAMETLQAAWNS
FT                   GIRYFDVAPWYGLGLAERRVGDFLRDQPDGSYVLSTKVGRLLRPVPTGTVPDYSYVDPL
FT                   SFDADYDYSYDGIMRSVEFSYARLGLNRIDILYVHDIGGYTHGAAKNAVYQKQLLDSGV
FT                   KALEELKSSGAISAFGLGVNEVPVCLEVMRHADLDCILLAGRYTLLDRSAVAELLPLCR
FT                   QKGTSLVVGGVFNSGILATGPVPGSHFDYMPATEEVLAKVGAMEAIAKRHGVPLAAPAM
FT                   QFPLREPIVASVLIGTAKASSVTRNMEIVEPQLPDSIYGEFEPYTLVAPPLGAEAVRV"
FT   gene            complement(562895..564397)
FT                   /locus_tag="RHECIAT_CH0000566"
FT   CDS_pept        complement(562895..564397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000566"
FT                   /product="probable altronate dehydratase protein"
FT                   /EC_number="4.2.1.7"
FT                   /note="ypch00206; GO_function: GO:0016836 - hydro-lyase
FT                   activity"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000566"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89559"
FT                   /db_xref="GOA:B3Q0C7"
FT                   /db_xref="InterPro:IPR007392"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q0C7"
FT                   /protein_id="ACE89559.1"
FT                   /translation="MDKQPWIILSAGDNVAVATAAIAPGSTVAGIEARQKIDPGHKVAI
FT                   ADIPLGSPVVKYGQAIGRTTAEVKAGDHVHSHNLHFENDRLVATANSAPETATPEDKAR
FT                   TFMGYRRADGRAATRNYIGIIASVNCSTTVCRAIADEANRTILPHYDGIDGFVPIVHDQ
FT                   GCGMSSTGDGMNVLHRTLAGYTRHVNFGGVLMIGLGCEVNQLTLYGQSGAGASKRHFNI
FT                   QDAGGSRRAVERAMGMLREIAADVGREKRVPILIGEIIIGLQCGGSDGFSGITANPALG
FT                   VAADLLAAAGGTAILSETSEIYGAEHLLRSRAVSDDVAKKLDEKIAWWEEYVALHGASL
FT                   DNNPSPGNKRGGLTTILEKSLGAVAKGGRSPLTAVYGYAERVTAPGLVFMDTPGYDPVS
FT                   ATGQVAGGANMIAFTTGRGSCFGCRPAPSLKLSSNSALYAAMEEDMDIDCGTIATGDAT
FT                   ISGKGREIFELIIDTASGKRTKSELFGYGDNEFVPWHLGATL"
FT   gene            564660..565559
FT                   /locus_tag="RHECIAT_CH0000567"
FT   CDS_pept        564660..565559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000567"
FT                   /product="probable transcriptional regulator protein"
FT                   /note="ypch00207"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000567"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89560"
FT                   /db_xref="GOA:B3Q0C8"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q0C8"
FT                   /protein_id="ACE89560.1"
FT                   /translation="MARQNTVFKEAYNRYAAALRTDTALPSEPEIAAQLGVSRSTARAI
FT                   LTRLSEEGIIRWNKRQKIVLRQPTDRDLFPSEETDSLHDIIERSFMQRILADDAAPGMQ
FT                   INELELAREIGTGTTSVREFLIRFSRFGLIEKRPNSHWTLKGFTREFALELADVREMFE
FT                   LHSAAEFGRLPRDHQAWTDLAAIRDEHHAMLADINQRFKDFSVLDERFHLLIHRASKNR
FT                   FIADFYDAIAIVFHYHYQWNKTAARERNERAIHEHLDYIAALESGDQAAIEKACRIHLR
FT                   SARQTLLQSLPQMATESA"
FT   gene            complement(565631..566284)
FT                   /locus_tag="RHECIAT_CH0000568"
FT   CDS_pept        complement(565631..566284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000568"
FT                   /product="hypothetical protein"
FT                   /note="yhch00163"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000568"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89561"
FT                   /db_xref="UniProtKB/TrEMBL:B3PNJ8"
FT                   /protein_id="ACE89561.1"
FT                   /translation="MSSDFSAYATGDLLRMINDGEDHGENFAYDALWGAVFKRWRKGID
FT                   LEPLIELLQSEKSGQRERGAWYLDEADPPADRTADVIIKLADDPVGHCRWRFVAYVTNS
FT                   KLYSDAIADRLAACLLDCDLYVRARTVFWAVVADCKTFAHFSEAVLSGAGTKPYKFRDP
FT                   ETTAFWRESERKRATRGIEIAQRLRAGESVASIRESMPEEDSYSFDQLAFLIRQ"
FT   gene            566504..567661
FT                   /locus_tag="RHECIAT_CH0000569"
FT   CDS_pept        566504..567661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000569"
FT                   /product="hypothetical protein"
FT                   /note="yhch00164"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000569"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89562"
FT                   /db_xref="GOA:B3PNJ9"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B3PNJ9"
FT                   /protein_id="ACE89562.1"
FT                   /translation="MVINGEQVSPMANTSAPASNGEWTLADFLSTYRYWAVFLSSLLIA
FT                   VGGHGLSTVFPVIAQMAGSSAQTIGIFYFGSTLGWVVGAFLAFIVAGRHGRSALISPIL
FT                   VCAVVAVAVLPAPDLWGSPSFLPFFGLVLGAVRAVFPLASAIFLVGGRPGKIDFGCALT
FT                   LMSTTILISAFAPVAASWLYELDLGAVPVVSAFLACLVLAVIVLVPAGNLAFDDAPRPR
FT                   HKPLAPRQRSPLLVAVILIIPPILLLLAAVGFRLFQANDVGVGDSPIALLSVLLVFAIA
FT                   LAAFIYLAYWVYRIHGELAGAAPSQHLLTPLAAMLIAILVPLGLPVLLMTLGDLLNERA
FT                   RDRGEANAVSIAWLGIWSFILPPVAIAMIQNAANDSYVIGADKAS"
FT   gene            567750..569699
FT                   /locus_tag="RHECIAT_CH0000570"
FT   CDS_pept        567750..569699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000570"
FT                   /product="probable ABC transporter, ATP-binding protein"
FT                   /note="ypch00208; GO_function: GO:0005524 - ATP binding;
FT                   GO_function: GO:0016887 - ATPase activity"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000570"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89563"
FT                   /db_xref="GOA:B3PNK0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:B3PNK0"
FT                   /protein_id="ACE89563.1"
FT                   /translation="MTDATLKPKSVDGTEEHGAEKSRPEKASTVEAAAPPDAIEPNPDL
FT                   TPEEAEQARKRYLLRRFWISARRYWGSSGDRLAWPCSIGLLAMICMNVGFQYGINRWNR
FT                   GIFDAIERHDAGTVYYLSAVFVPLVLGSVALVTAQVYVRMMIQRRWRSWLTAAVIARWL
FT                   ANGRYYQLNLIGGDHKNPEARISEDLRIATEAPVDFIAGVISAFLSASTFIVVLWTIGG
FT                   ALTLPVAGMTITIPGFLVVTAVLYAVITSTVIAIIGRHFVQVSEVKNQVEAELRYTLTR
FT                   VRENGESIALLGGEEEERNDLDKTFSNVLKQWALLARQHMRTTFVSHGSMLIAPVVPLL
FT                   LCAPKFLAGGMTLGEVMQAASAFAIVQTAFGWLVDNYPRLADWNACARRIASLMTSLDG
FT                   LERAEQSDALRRIKHGETQGNAILNLNDLSVSLDDGTAVVKETQVEIAPGERVLVAGES
FT                   GSGKSTLVRAIAGLWPWGHGSVDFHADRRLFMLPQRPYIPSGTLRRAVAYPRAADSWTP
FT                   EEVKSALAKVGLEYLNEKIEEDAPWDQILSGGEKQRLAFARLLLHHPDIIVLDEATSAL
FT                   DEKSQDRMMETLIEEMPTVTIISVAHRAELEAFHSRKITLERRKGGAKLVSDIDLGPRK
FT                   TRRSLIMRVLDNRR"
FT   gene            complement(569820..571310)
FT                   /locus_tag="RHECIAT_CH0000571"
FT   CDS_pept        complement(569820..571310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000571"
FT                   /product="putative multidrug transport protein"
FT                   /note="ypch00209"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000571"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89564"
FT                   /db_xref="GOA:B3PNK1"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B3PNK1"
FT                   /protein_id="ACE89564.1"
FT                   /translation="MSNAAHRSNRVLVVATIMVATFMVAIEATIVATAMPRIVGQLGGF
FT                   SYYSWVFSAFLLAQSTTTVIYGKLSDIFGRKPVLIAGIVIFLAGSALCGFAWSMMSLVL
FT                   FRLLQGLGAGAIQPVTMTIIGDLFKLEERGRVQGAMATVWATSAVVGPLAGGIIVDNIS
FT                   WAWIFWINLPIGIVSIIAFMIFLKEDVAHKQARIDYLGSVLFSISIVALLVMLTETDAG
FT                   GSILLALFAVFVVAGLLFLAQEKRAPEPIISIALWSRRLIATSNAATLLAGMALIGLST
FT                   ILPIYVQGVLGRSPIVAGFTLTMLIVGWPLAVMLSGRFYKAFGIRRTLRVGSLMFPFGA
FT                   CFLLFLTPESSPVLAGTGSFFMGFGMGLISLTSIVLVQDSVEWSMRGSATASIIFARSL
FT                   GNTLGATVLGAILNAGIGHYASGEMAAALHKALNQPTGLSALAADPDIRGIFDAALHWS
FT                   FWGVVVVAVLTFFTTWLIPVGHVRKREEPAAASEAASH"
FT   gene            complement(571507..571974)
FT                   /locus_tag="RHECIAT_CH0000572"
FT   CDS_pept        complement(571507..571974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000572"
FT                   /product="hypothetical protein"
FT                   /note="yhch00165"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000572"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89565"
FT                   /db_xref="UniProtKB/TrEMBL:B3PNK2"
FT                   /protein_id="ACE89565.1"
FT                   /translation="MAALLQRYVRIGFKAVLILFVFSLGPAAGLAPCPPANELLAKAKV
FT                   VVEARVKSLSIGESGFLLEENFPTRMIRADLQITRVIKGEYPGNEAIVYGTVFPPGPFK
FT                   ELTQMALFAEFEGRDTFEWELSRHELAAGAAFFSMNDCIYYKFPDYAAGAR"
FT   gene            572328..572693
FT                   /locus_tag="RHECIAT_CH0000573"
FT   CDS_pept        572328..572693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000573"
FT                   /product="hypothetical protein"
FT                   /note="yhch00166"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000573"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89566"
FT                   /db_xref="UniProtKB/TrEMBL:B3PNK3"
FT                   /protein_id="ACE89566.1"
FT                   /translation="MRWYRCHEGCREAGGDRNDQGRYDRYVIVGQAGADTTRVVQMPGS
FT                   YTTTGTATLYGNTGYYSGNTVYNPGPTYVSGGHNQDLAVRMFKEGEPGSDTALSARERL
FT                   GPKWALIVRDGINTCAD"
FT   gene            complement(572885..573265)
FT                   /locus_tag="RHECIAT_CH0000574"
FT   CDS_pept        complement(572885..573265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000574"
FT                   /product="hypothetical conserved protein"
FT                   /note="yhch00167"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000574"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89567"
FT                   /db_xref="UniProtKB/TrEMBL:B3PNK4"
FT                   /protein_id="ACE89567.1"
FT                   /translation="MEQTMSCKLIAISLLSIGLAGSALAQTTGGANSNGRLSVAPVIGG
FT                   SGSSGTGSAGTGSAGTGSGSTGSVGTDPGTTGSTTDSTTGAGGVDLNSGRSTINRGGVN
FT                   PDLQQVPGCTAGTGSLSEACQQ"
FT   gene            complement(573418..573750)
FT                   /locus_tag="RHECIAT_CH0000575"
FT   CDS_pept        complement(573418..573750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000575"
FT                   /product="hypothetical protein"
FT                   /note="yhch00168"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000575"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89568"
FT                   /db_xref="UniProtKB/TrEMBL:B3PNK5"
FT                   /protein_id="ACE89568.1"
FT                   /translation="MEGNVNQANFQEYCERDPGYETVAHGGKLTVEQCVALYMKEDGED
FT                   TYRSTADCRKGTLSFFPSAGEPVRVTFPLPEDADISCASGMPPLIRQFTMLCPQAARKF
FT                   KMLDDE"
FT   gene            573749..574033
FT                   /locus_tag="RHECIAT_CH0000576"
FT   CDS_pept        573749..574033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000576"
FT                   /product="hypothetical protein"
FT                   /note="yhch00169"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000576"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89569"
FT                   /db_xref="UniProtKB/TrEMBL:B3PNK6"
FT                   /protein_id="ACE89569.1"
FT                   /translation="MTAFLESVPVLLISVPSHPAHEARGKSSECALEMVKVKSTTLESN
FT                   IRINPPTERPAPARSTSVAHAQPKGQVDCFDDVAQHPFGDFARRAATAD"
FT   gene            complement(574096..574171)
FT                   /locus_tag="RHECIAT_CH0000577"
FT   tRNA            complement(574096..574171)
FT                   /locus_tag="RHECIAT_CH0000577"
FT                   /product="tRNA-Thr"
FT                   /inference="ab initio prediction:tRNAscan-SE:1.23"
FT   gene            complement(574294..575253)
FT                   /locus_tag="RHECIAT_CH0000578"
FT   CDS_pept        complement(574294..575253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000578"
FT                   /product="probable dioxygenase protein"
FT                   /note="ypch00210; GO_function: GO:0016491 - oxidoreductase
FT                   activity; GO_process: GO:0006118 - electron transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000578"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89570"
FT                   /db_xref="GOA:B3PNK7"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B3PNK7"
FT                   /protein_id="ACE89570.1"
FT                   /translation="MALPPILKDKLRLPVIGSPLFIISHPALTLAQCKAGIVGAFPALN
FT                   ARPESQLDEWLAEITEELARHDANHPQRPAAPFAVNQIVHMSNKRLEHDLSLCVKYKVP
FT                   IVISSLGAVPEVNAAVHSYGGIVLHDIINNRHAHSAIRKGADGLIAVASGAGGHAGTLS
FT                   PFALVQEIREWFDGPLLLAGAISTGGAILAAEAMGADMAYIGSPFIATQEARAADAYKQ
FT                   AIVEGAAADIVYSNYFTGVHGNYLKPSIVAAGMDPDNLPVADPSKMDFEQATGGAKAWK
FT                   DIWGSGQGIGAVKAIEPVAKLVDRLEAEYKAARARLSL"
FT   gene            complement(575276..575464)
FT                   /locus_tag="RHECIAT_CH0000579"
FT   CDS_pept        complement(575276..575464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000579"
FT                   /product="hypothetical protein"
FT                   /note="yhch00170"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000579"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89571"
FT                   /db_xref="UniProtKB/TrEMBL:B3PNK8"
FT                   /protein_id="ACE89571.1"
FT                   /translation="MRQTASLAGPPAVDLRRYSPAFTDTGLTLSVMRGLYIGLKSTKAW
FT                   QPLFYRLFFSVMRLTFS"
FT   gene            575539..576738
FT                   /locus_tag="RHECIAT_CH0000580"
FT   CDS_pept        575539..576738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000580"
FT                   /product="putative transcriptional regulator protein"
FT                   /note="ypch00211"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000580"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89572"
FT                   /db_xref="GOA:B3PNK9"
FT                   /db_xref="UniProtKB/TrEMBL:B3PNK9"
FT                   /protein_id="ACE89572.1"
FT                   /translation="MSGLETAIRTALENADRDNPEVRARIYQSARQALEAGLRKQDITD
FT                   ADAVAHHRHRLESTIHAIEGEERDRLHPRQRPPEVPVPPVVEMPAPPVHRGDVTDIDSL
FT                   IDSPVAAGEARSPEVVMHRSDESSLGNVHAGDADHLSAAPAGEERLTRGERATSMDFRP
FT                   ERAAGRRKPRKFFSRLLVWCVLFAFIGIGAWWAYTSGLLLTAAERDTSVANPPASTQPE
FT                   DFTGNDDSAGDAATHTDQPVTIDPQNSFSADWIPVFKPDEADKIKSGPRARTENITEND
FT                   GPAVRLISESGAADGNISVSVPSSVLQQLAGKSSTIALTLQSTTDEPTQVTVECDFQSL
FT                   GNCARHRFNVTREKSDALLQVKFDRSLAPNSPGTLTINSDLDGKARGINLFAIRILPGQ
FT                   "
FT   gene            complement(576810..577691)
FT                   /locus_tag="RHECIAT_CH0000581"
FT   CDS_pept        complement(576810..577691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000581"
FT                   /product="putative polyphosphate kinase protein"
FT                   /note="ypch00212"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000581"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89573"
FT                   /db_xref="GOA:B3PNL0"
FT                   /db_xref="InterPro:IPR016898"
FT                   /db_xref="InterPro:IPR022486"
FT                   /db_xref="InterPro:IPR022488"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3PNL0"
FT                   /protein_id="ACE89573.1"
FT                   /translation="MGEDVESRAVELDIRGKKRIFDVDDPVLPDWVEEQALESGAFPYK
FT                   KKLNEEDYLAQLEKLQVELVKVQFWLQASGKRVMALFEGRDAAGKGGAISASSAHMNPR
FT                   LARVVALAKPTEREQGQWYFQRYVAQFPTSGEFVLFDRSWYNRAGVEPVMGFCTPQQYE
FT                   GFLKQAPQLEKIIAHEGIFLFKFYLDIGREMQLKRFHDRRHDPLKVWKLSSMDIAALTK
FT                   WGDYSEKRDRMLKETHTDFAPWTVIRANDKRRARLQLIRHMLNRMDYDGKDKTALGEVD
FT                   EEIIGSGPGFLK"
FT   gene            578046..579155
FT                   /gene="phoR"
FT                   /locus_tag="RHECIAT_CH0000582"
FT   CDS_pept        578046..579155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoR"
FT                   /locus_tag="RHECIAT_CH0000582"
FT                   /product="phosphate regulon, two-component sensor histidine
FT                   kinase protein"
FT                   /EC_number="2.7.13.3"
FT                   /note="GO_function: GO:0005524 - ATP binding"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000582"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89574"
FT                   /db_xref="GOA:B3PNL1"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR014310"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B3PNL1"
FT                   /protein_id="ACE89574.1"
FT                   /translation="MSLTALFNEAPVLKAEPAEPEETGPETSPSRLPDVSATLAGLDIP
FT                   VMVLSDDASVLFQNRAAEKAFGEVALGAHISARLRSPGVLDMVRETIATNAPNQIEHAE
FT                   RLPSERVYIVRSAPVEFQADGQRERFFILSFRDISEVRRIDRMRSDFVANASHELRTPL
FT                   ASLRGFIETIQGPAKNDQKAQAQFLGIMFDQTTRMSRLVDDLLSLSRLELKSHIAPDEK
FT                   VDLVPLLGHVRDSLVPLARDVGVEINLHLPDGKVEVLGDRDELVQVFENLMENACKYGQ
FT                   EGKVVDVRLKNGADGPVEVSIIDKGPGIPAEHVPRLTERFYRVSIEDSRSKKGTGLGLA
FT                   IVKHILTRHRARLIVKSEVGKGTDFTVRF"
FT   gene            complement(579293..579694)
FT                   /locus_tag="RHECIAT_CH0000583"
FT   CDS_pept        complement(579293..579694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000583"
FT                   /product="hypothetical conserved protein"
FT                   /note="yhch00171"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000583"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89575"
FT                   /db_xref="InterPro:IPR007569"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:B3PNL2"
FT                   /protein_id="ACE89575.1"
FT                   /translation="MRGPKPKTTARARPLRQSDNDAEGKLWNELRDRRLNGHKFVRQLP
FT                   IGPYFADFACRELRLVVEIDGSQHADDRRDAIRDIFMIGNGWSVVRFWNVDVLRELPSV
FT                   LDTILAICDGRLTERVEATDLRFFPAACD"
FT   gene            580038..581072
FT                   /gene="pstS"
FT                   /locus_tag="RHECIAT_CH0000584"
FT   CDS_pept        580038..581072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstS"
FT                   /locus_tag="RHECIAT_CH0000584"
FT                   /product="phosphate ABC transporter, substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000584"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89576"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:B3PNL3"
FT                   /protein_id="ACE89576.1"
FT                   /translation="MNTFKLTVAALAATAAFAGAAVARDQIQVAGSSTVLPYAKIVAES
FT                   FGETFTNFKTPVVESGGTGAGLKEFCKGVGEDTIDIANASRPINKNEADACKAAGVTDI
FT                   QEVKIGYDGIVFATDSSNPDVAYVPADIYKALAAQVVVDGKLVANPYKKWSEVNPKLPA
FT                   VDIAAYIPGEKHGTREVFEQNVLAAGCKASGALDVIAKEISDKAAQGKACVAVRKDGAA
FT                   VDIDGDYPETLARIAANKTGVGVFGLSFYENNADKLKVASVNGIVPSTETIANGTYPVS
FT                   RPLFFYVKKAHLGAVPGLKEYVNFFVSDQMIGPDGPLAEYGLVAAPDAERDAIRKDVEA
FT                   GKSM"
FT   gene            581240..582721
FT                   /gene="pstC"
FT                   /locus_tag="RHECIAT_CH0000585"
FT   CDS_pept        581240..582721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstC"
FT                   /locus_tag="RHECIAT_CH0000585"
FT                   /product="phosphate ABC transporter, permease protein"
FT                   /note="GO_component: GO:0016020 - membrane; GO_function:
FT                   GO:0005215 - transporter activity; GO_process: GO:0006810 -
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000585"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89577"
FT                   /db_xref="GOA:B3PNL4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011864"
FT                   /db_xref="InterPro:IPR022182"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B3PNL4"
FT                   /protein_id="ACE89577.1"
FT                   /translation="MSTSIILLCLVVIGAAAYLVARSRATALAGGRSSALHSRPAYYGA
FT                   YAAIWAVLPALIVLCVWLSVSPGIIQSSVRGAFPADVKAQAAVEQDLSYSMVATVARGL
FT                   TMLTSDEAAAVANDPAALQAKLSEKGVPLAGQPQPYMVEAAKTLNAMSLTSRMAMTAVV
FT                   FLLAVAGAFYALRAIAPRFRARNRVERVMLWGLLLASSIAILTTVGIVLSMLSEATRFF
FT                   AVVPAGEFFFGTVWDPRFAGAGSSSFGQFGLIPLLLGTLYIGLVAMLVAVPVGLFAAIY
FT                   MAEYASPKLRGIAKPLLEVLAGIPTIVYGFFALVTVGPFLRDFSAQISGLLSGSYTNFI
FT                   QAQSVLTAGIVMGIMLIPYVSSLSDDIITAVPRALRDCSLGLGATRSETIKKVVLPAAL
FT                   PGIVGALLMTASRAIGETMIVVLAAGVAARIQINPFEPMTTVTVKIVNQLTGDLEFTSP
FT                   QTLVAFALGITLFCITLCLNIYALYIVRKYREQYE"
FT   gene            582718..584040
FT                   /gene="pstA"
FT                   /locus_tag="RHECIAT_CH0000586"
FT   CDS_pept        582718..584040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstA"
FT                   /locus_tag="RHECIAT_CH0000586"
FT                   /product="phosphate ABC transporter, permease protein"
FT                   /note="GO_component: GO:0016020 - membrane; GO_function:
FT                   GO:0005215 - transporter activity; GO_process: GO:0006810 -
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000586"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89578"
FT                   /db_xref="GOA:B3PNL5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005672"
FT                   /db_xref="InterPro:IPR024573"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B3PNL5"
FT                   /protein_id="ACE89578.1"
FT                   /translation="MTDIVSPTQGVAVSKAPARRDIGIKRRYAAERRFQAYGIAAIIFG
FT                   LVFLFILLWTVIGKGYTAFQQTAITLPIEFSEKTIDPSNKRATDPSVLIAANYPVLLRD
FT                   AIVKQLNINASSKPDVRDASAMLSKSAPIQLRDMVVADPSLIGKTVNVSLLADANIDSA
FT                   NKGQIDLSVDEKNRKVNDKQVTWMNQLKASGALQKQFNTGLFVNGNSSRPEAAGLGVAL
FT                   IGSLYLMLIVLALSLPIGVAASIYLEEFAPKNKLTDLIEVNINNLAAVPSIVYGLLGLS
FT                   VFINFIGLPRSASLVGGLVLTLMTLPTIIIATRAALRAVPPSIRAAALGLGASKMQMVF
FT                   HHVLPLAMPGILTGTIIGLAHALGETAPLLLIGMVAFVANAPATPLEPSTALPVQVYMW
FT                   ANEAERAFVERTSGAIIVLLLFLIVMNMGAILLRRRFERRW"
FT   gene            584056..584871
FT                   /gene="pstB"
FT                   /locus_tag="RHECIAT_CH0000587"
FT   CDS_pept        584056..584871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstB"
FT                   /locus_tag="RHECIAT_CH0000587"
FT                   /product="phosphate ABC transporter, ATP-binding protein"
FT                   /EC_number="3.6.3.27"
FT                   /note="GO_function: GO:0005524 - ATP binding; GO_function:
FT                   GO:0016887 - ATPase activity"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000587"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89579"
FT                   /db_xref="GOA:B3PNL6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR015850"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3PNL6"
FT                   /protein_id="ACE89579.1"
FT                   /translation="MNMLTEAAVEKALDQKMSNVPYKMIGQDVSVYYGEKRALFDVNLN
FT                   IRENTVTALIGPSGCGKSTFLRSLNRMNDTIEGCRVAGKITLDGDDIYDPDIDVVELRA
FT                   RVGMVFQKPNPFPKSIYENVSYGPRIHGLAKSKADLDQIVETSLQRAGLWNEVKDRVHE
FT                   SGTGLSGGQQQRLCIARAVAVSPEVILMDEPCSALDPIATAKVEELIHELRENYTIVIV
FT                   THSMQQAARVSQRTAMFHLGNLVEENDTDKMFTNPDDPRTQDYIMGRFG"
FT   gene            584916..585629
FT                   /gene="phoU"
FT                   /locus_tag="RHECIAT_CH0000588"
FT   CDS_pept        584916..585629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoU"
FT                   /locus_tag="RHECIAT_CH0000588"
FT                   /product="phosphate uptake transcriptional regulator
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000588"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89580"
FT                   /db_xref="GOA:B3PNL7"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR028366"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:B3PNL7"
FT                   /protein_id="ACE89580.1"
FT                   /translation="MASTHIYSAYDDDLKFLSRRISEMGGLAEQMVAESVRALVNGDTA
FT                   LAQKVISDDVILDHTEREIGDKAIVTIARRQPMAADLREIMGSIRIAADLERVGDLGKN
FT                   TAKRVIAVQSTGVPRKLARGLEHLSELALVQLKEVLDVYTTRAADKATAIRERDNEIDA
FT                   MYTSLFRELLTYMMEDPRNITSCTHLLFCAKNIERIGDHATNIAETIYYMATGAQPEGD
FT                   RPKDDSANTVGAATE"
FT   gene            585764..586447
FT                   /gene="phoB"
FT                   /locus_tag="RHECIAT_CH0000589"
FT   CDS_pept        585764..586447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoB"
FT                   /locus_tag="RHECIAT_CH0000589"
FT                   /product="phosphate regulon, two-component response
FT                   regulator protein"
FT                   /note="GO_function: GO:0000156 - two-component response
FT                   regulator activity; GO_process: GO:0000160 - two-component
FT                   signal transduction system (phosphorelay; GO_process:
FT                   GO:0006355 - regulation of transcription, DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000589"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89581"
FT                   /db_xref="GOA:B3PNL8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011879"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B3PNL8"
FT                   /protein_id="ACE89581.1"
FT                   /translation="MIPRVAVVEDEEALSVLLRYNLEAEGFEVDTILRGDEAEIRLQER
FT                   TPDLLILDWMLPGVSGIELCRRLRMRPETERLPIIMLTARGEESERVRGLSTGADDYVV
FT                   KPFSTPELVARVKAMLRRARPEVLSSVLKCGDIELDRETHRVHRKSREVRLGPTEFRLL
FT                   EFLMSSPGRVFSRSQLLDGVWGHDIYVDERTVDVHVGRLRKALNFSNMQDVIRTVRGAG
FT                   YSMEA"
FT   gene            complement(586704..587237)
FT                   /locus_tag="RHECIAT_CH0000590"
FT   CDS_pept        complement(586704..587237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000590"
FT                   /product="hypothetical conserved protein"
FT                   /note="yhch00172"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000590"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89582"
FT                   /db_xref="InterPro:IPR011681"
FT                   /db_xref="UniProtKB/TrEMBL:B3PNL9"
FT                   /protein_id="ACE89582.1"
FT                   /translation="MNWTDERVEKLKKLWSEGLSASQIAAQLGGVSRNAVIGKVHRLNL
FT                   PGRAKAGGTATAARTPKRQTSAPRAPNYASRITTRTVTRQQGATMLKEEIEIETVEEME
FT                   YVPKGNVVVPISRRLGLTELTERTCKWPVGDPLKDDFHFCGCESPDNSPYCSYHQKLAY
FT                   QPINERRRAAARVS"
FT   gene            587663..588862
FT                   /gene="argD"
FT                   /locus_tag="RHECIAT_CH0000591"
FT   CDS_pept        587663..588862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argD"
FT                   /locus_tag="RHECIAT_CH0000591"
FT                   /product="acetylornithine transaminase protein
FT                   (diaminobutyrate--pyruvate aminotransferase)"
FT                   /EC_number="2.6.1.11"
FT                   /note="GO_function: GO:0008483 - transaminase activity;
FT                   GO_function: GO:0030170 - pyridoxal phosphate binding"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000591"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89583"
FT                   /db_xref="GOA:B3PNM0"
FT                   /db_xref="InterPro:IPR004636"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B3PNM0"
FT                   /protein_id="ACE89583.1"
FT                   /translation="MAEAAPLYDTYSRAPLRFERGEGVWLITEGGERYLDFGAGVAVTS
FT                   VGHSNPHVVAALKEQADKVWHLSNIYEIPGQERLAKRLTDATFADKVFFTNSGAEALEC
FT                   AIKTARRYQFSKGHPERFHIITFEGAFHGRTLATIAAGGQEKYLEGFGPKAPGFDQVAF
FT                   GDIAAVRAAITDATAAILIEPVQGEGGVRPATPEFMKALRQICDENGLLLILDEVQTGV
FT                   GRTGKLFAHEWSGIAPDIMAVAKGIGGGFPLGACLATAEAASGMKAGTHGSTYGGNPLA
FT                   MAVGSAVLDVILADGFLQQVRDVALVFRQGLASLKDRYPDVIEDIRGEGLLLGVKGAVP
FT                   SAELLQAIRAAHLLGVPAGDNVIRLLPPLVVTAEEAREGLARLERAAESIRAAKVKKTA
FT                   "
FT   gene            588900..589814
FT                   /gene="argF"
FT                   /locus_tag="RHECIAT_CH0000592"
FT   CDS_pept        588900..589814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argF"
FT                   /locus_tag="RHECIAT_CH0000592"
FT                   /product="ornithine carbamoyltransferase protein"
FT                   /EC_number="2.1.3.3"
FT                   /note="GO_function: GO:0016743 - carboxyl- and
FT                   carbamoyltransferase activity; GO_process: GO:0006520 -
FT                   amino acid metabolic process"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000592"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89584"
FT                   /db_xref="GOA:B3PNM1"
FT                   /db_xref="InterPro:IPR002292"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR024904"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/TrEMBL:B3PNM1"
FT                   /protein_id="ACE89584.1"
FT                   /translation="MAPKHFLDLSAVTSADLRTIMNDALVRKQAFKAGQGDKPLAGKML
FT                   AMIFEKPSTRTRVSFDVGMRQLGGETLFLSGTEMQLGRAETIGDTAKVLSRYVDAIMIR
FT                   TTEHSRLLELAEHATVPVINALTDDTHPCQIMADIMTFEEHRGSIKGKTIAWTGDGNNV
FT                   LHSLVEGAARFGYRMNMAVPLGSEPKDHYLNWARNEGAEIMLCHDADRAVEGVDCVVTD
FT                   TWVSMNQEHRARGHNVFQPYQVNAALMAKAGSDALFMHCLPAHRGEEVTDEVIDGPQSV
FT                   VFDEAENRLHAQKSILAWCLGAI"
FT   gene            589904..590896
FT                   /gene="hsp33"
FT                   /locus_tag="RHECIAT_CH0000593"
FT   CDS_pept        589904..590896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hsp33"
FT                   /locus_tag="RHECIAT_CH0000593"
FT                   /product="33K chaperonin (heat shock protein 33) protein"
FT                   /note="GO_component: GO:0005737 - cytoplasm; GO_function:
FT                   GO:0051082 - unfolded protein binding; GO_process:
FT                   GO:0006457 - protein folding"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000593"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89585"
FT                   /db_xref="GOA:B3PNM2"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="InterPro:IPR016153"
FT                   /db_xref="InterPro:IPR016154"
FT                   /db_xref="InterPro:IPR023212"
FT                   /db_xref="UniProtKB/TrEMBL:B3PNM2"
FT                   /protein_id="ACE89585.1"
FT                   /translation="MAEAAAALGQFDFAGDDHVVPFQVEGLDVRGRAVQLGPMLDAILE
FT                   RHHYPTPVARLLAEVVVLTVLLGTSLKFDGKFTVQTKGDGPVDLLVADFSTPENVRAYA
FT                   RFDQALLAKAVEAGETEPEQLLGKGVLAFTIDQGKFAQPYQGIVALDGTSLEEIAGVYF
FT                   RQSEQIPTRVRLAAAELFDRDDAGKPRHRWRAGGLVAQFLPEAPERMRHPDLHGGDGDN
FT                   GDRPHGEDDAWVEARSLVETIDADELTDPLVGTERLLFRLFHERGVRVYEPRAVFDRCS
FT                   CSRDKIKGVLKGFSAEEIEESQENGEIAVTCEFCSTTYRFEPTELQPAE"
FT   gene            591052..591600
FT                   /locus_tag="RHECIAT_CH0000594"
FT   CDS_pept        591052..591600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000594"
FT                   /product="hypothetical conserved protein"
FT                   /note="yhch00173"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000594"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89586"
FT                   /db_xref="UniProtKB/TrEMBL:B3PNM3"
FT                   /protein_id="ACE89586.1"
FT                   /translation="MPQIGLADDKAIQWKEVGGWTVAVDPTLDDGCFVLTSFDDDTIFR
FT                   LGFNFRKKDKPLYILLGNPNWKSLEKGKHYPIELSLDQTQWTADARGLDLDGLKSLWID
FT                   TDDTDLIEEFSGKLSFRARFNGKEIVALGLKDSERAADELLACQKAVNDAVMKQPAPPQ
FT                   SKDPFEAKPGTQASDPFDL"
FT   gene            complement(591758..592150)
FT                   /gene="apaG"
FT                   /locus_tag="RHECIAT_CH0000595"
FT   CDS_pept        complement(591758..592150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="apaG"
FT                   /locus_tag="RHECIAT_CH0000595"
FT                   /product="protein affecting Mg2+/Co2+ transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000595"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89587"
FT                   /db_xref="InterPro:IPR007474"
FT                   /db_xref="InterPro:IPR023065"
FT                   /db_xref="InterPro:IPR036767"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3PNM4"
FT                   /protein_id="ACE89587.1"
FT                   /translation="MYRALTRDIEVVVEPFYLEEQSDPEDDRYVWGYRIVISNNSGVAV
FT                   RLVNRYWNITDQNGVVDEVTGPGVVGEQPRLSPGDTYEYSSGCPLDTPSGLMFGHYQME
FT                   TDEGELFDVDIPAFSLDSPGLLRVLN"
FT   gene            complement(592366..593550)
FT                   /gene="metZ"
FT                   /locus_tag="RHECIAT_CH0000596"
FT   CDS_pept        complement(592366..593550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metZ"
FT                   /locus_tag="RHECIAT_CH0000596"
FT                   /product="O-succinylhomoserine (thiol)-lyase protein"
FT                   /EC_number="2.5.1.48"
FT                   /note="GO_process: GO:0006520 - amino acid metabolic
FT                   process"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000596"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89588"
FT                   /db_xref="GOA:B3PNM5"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006234"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B3PNM5"
FT                   /protein_id="ACE89588.1"
FT                   /translation="MSKTWRPATQLVHGGTLRSQYGETSEAIYLTQGFVYDTSEAAEAR
FT                   FKGETDGYIYARYGSPTNDMFEKRMCMLEGAEDARATASGMAAVSAAILCQVKAGDHIV
FT                   AARALFGSCRWVVETLAPKYGIECTLVDGRDLKNWEEAIRPNTKVFFLESPTNPTLEVV
FT                   DISGVARLANQVGAKVVVDNVFATPLFQKPLELGAHIVVYSATKHIDGQGRCLGGVVLA
FT                   DKAWIDENLHDYFRHTGPAMSPFNAWTLLKGIETLPLRVKQQTQNAAKIADFLAEQNKV
FT                   AKVIYPGRADHPQADIIAKQMKGGSTLVAFELKGGKEAAFALQNALDIVRISNNLGDSK
FT                   SLITHPATTTHKNLSEEARAELGISPGTVRLSAGIEDTDDLIEDFAKALAKVSA"
FT   gene            593748..594839
FT                   /gene="dcd"
FT                   /locus_tag="RHECIAT_CH0000597"
FT   CDS_pept        593748..594839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dcd"
FT                   /locus_tag="RHECIAT_CH0000597"
FT                   /product="deoxycytidine triphosphate deaminase protein"
FT                   /EC_number="3.5.4.13"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000597"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89589"
FT                   /db_xref="GOA:B3PNM6"
FT                   /db_xref="InterPro:IPR010550"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/TrEMBL:B3PNM6"
FT                   /protein_id="ACE89589.1"
FT                   /translation="MARDTGILADRAISALFETGRLNSERELDRDQIQPASLDLRLGSK
FT                   AFRVRASFMPGPSHLVSDKLDRLSLHVIDLSQGAVLETGCVYIVPLMESLALPADMSAS
FT                   ANPKSSTGRLDIFTRVITDYAQEFDKIPPGYSGPLYLEISPRTFPIVVRRGSRLSQIRF
FT                   RVGQSLLGEPELLKLHESETLVASKQPNVSGGGIALSIDLSGDKDGLIGYRGKHHTAVV
FT                   DVDEKDQHDIFDFWEPLYSRGRNELILDPDEFYILVSREAVHVPPDYAAEMTPFDPLVG
FT                   EFRVHYAGFFDPGFGHAPAGGRGSRAVLEVRSHEVPFILEDGQIVGRLVYEHMQEKPAS
FT                   LYGSGLGSNYQAQGLKLSKHFRI"
FT   gene            594898..594971
FT                   /locus_tag="RHECIAT_CH0000598"
FT   tRNA            594898..594971
FT                   /locus_tag="RHECIAT_CH0000598"
FT                   /product="tRNA-Gly"
FT                   /inference="ab initio prediction:tRNAscan-SE:1.23"
FT   gene            complement(594995..595282)
FT                   /locus_tag="RHECIAT_CH0000599"
FT   CDS_pept        complement(594995..595282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000599"
FT                   /product="hypothetical conserved protein"
FT                   /note="yhch00174"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000599"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89590"
FT                   /db_xref="UniProtKB/TrEMBL:B3PNM7"
FT                   /protein_id="ACE89590.1"
FT                   /translation="MDMKPALLGLIGTLILAGCNSVSYYGGPGLEPIPGSITYNGQPRS
FT                   KLTKSPPGSSFPHDFIDQYGQQVEETYIIQPDRSLIIAHRRYKPIRFFGD"
FT   gene            595638..596018
FT                   /locus_tag="RHECIAT_CH0000600"
FT   CDS_pept        595638..596018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000600"
FT                   /product="putative glyoxalase/bleomycin resistance
FT                   protein/dioxygenase protein"
FT                   /note="ypch00213"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000600"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89591"
FT                   /db_xref="GOA:B3PNM8"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B3PNM8"
FT                   /protein_id="ACE89591.1"
FT                   /translation="MRLNHLDFHVPDIAETADFFIRHFGLKLKDMRGNNGLAILEDAVG
FT                   LEIVLSHAIAKFGTADQVEIGRQTYHIGFILPERGDVDTVHAGLVAAGAVLSGPPAAMR
FT                   GGWLFYCTAPGNILVEVGWRPG"
FT   gene            complement(596175..598184)
FT                   /gene="mcpAch1"
FT                   /locus_tag="RHECIAT_CH0000601"
FT   CDS_pept        complement(596175..598184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mcpAch1"
FT                   /locus_tag="RHECIAT_CH0000601"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /note="GO_component: GO:0016020 - membrane; GO_function:
FT                   GO:0004871 - signal transducer activity; GO_process:
FT                   GO:0006935 - chemotaxis; GO_process: GO:0007165 - signal
FT                   transduction"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000601"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89592"
FT                   /db_xref="GOA:B3PNM9"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:B3PNM9"
FT                   /protein_id="ACE89592.1"
FT                   /translation="MLKHLKIRTKILSVVALMGLITMAGLIYIIADFRRADTAYSAFID
FT                   HEALASMQSARASASVVASVLQVTLLADMKPDTPAFETALATPSKLPQARDRLKQALAL
FT                   VPSRKAAIDEIQAGIDDIEALANKIIEQSKAKDSAGALANVALMNAKLNALTPKMIANN
FT                   DAMMALLNDGGDALSASVNGRISFCFLLIGIAVLAAIGISIAVAQSGIAGPMARLRLRM
FT                   TRLAEGDTDSEIGGLDRGDEIGQMAKAVSIFRDNAIERRQIEARAEADRSVSDGERRER
FT                   EAQRTREASELDRAVTALGDGLRRLAAGDLAAQLDEPFVAHLDALRQDFNHSVEKLNET
FT                   LQAVGANARAIGAGANEIRSSADELSRRTEQQSASVEETAAALEEITTTVRDAAKRAEE
FT                   ASQLVTRTRLGAEKSGEIVRKAVSAMRQIEQSSVEIGNIIGVIDDIAFQTNLLALNAGV
FT                   EAARAGEAGKGFAVVAQEVRELAQRSARAAKEIKDLITNSGTHVQTGVTLVGDTGKALD
FT                   AIVSEVQEINQHVHAIAEASREQSIGLQEINTAVNTMDQGTQQNAAMVEQSTAASHSLA
FT                   TEATALNNLLGQFRLTGTGSFAAAAPIASTRPPAAAPRAPARPVAKAPAIRVAWEGTAR
FT                   PTASPARALGQTLANAFGGGSTPSKSQEADWTEF"
FT   gene            complement(598405..598773)
FT                   /locus_tag="RHECIAT_CH0000602"
FT   CDS_pept        complement(598405..598773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000602"
FT                   /product="hypothetical protein"
FT                   /note="yhch00175"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000602"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89593"
FT                   /db_xref="UniProtKB/TrEMBL:B3PNN0"
FT                   /protein_id="ACE89593.1"
FT                   /translation="MPLRRDLSESWLAGNMRVSDAGTPAPSFEAPVFGAPILLLAPNNC
FT                   QWPTSPFEAPAGHLRMRSEKAWQPPLRIILSAAISKAPHPEVRRPEAGASKDAPQRCSL
FT                   HAPNAGTPASPLRHLQGT"
FT   gene            598807..599670
FT                   /locus_tag="RHECIAT_CH0000603"
FT   CDS_pept        598807..599670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000603"
FT                   /product="probable amino acid ABC transporter,
FT                   substrate-binding protein"
FT                   /note="ypch00214; GO_component: GO:0030288 - outer
FT                   membrane-bounded periplasmic space; GO_function: GO:0005215
FT                   - transporter activity; GO_process: GO:0006810 - transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000603"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89594"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:B3PNN1"
FT                   /protein_id="ACE89594.1"
FT                   /translation="MQSKLASLTLKGFLAFGLLLFSSLAASAQQAAPSLPLLFDARERL
FT                   ARPDLSSLVRLRFLTSVDFPPFNFTDQNGKLSGFNVDLAREICGELEISDKCQIQAIPF
FT                   ADLKDALAASQGDAVIAGLAVTPELRRRFVFSRPYLMLPARFVRNLAAPVEGKTAAALA
FT                   GRPVGVVKGTVHEAMLAAFFPALKAEPFDTKEALLAALKERKVDAAFADALQLSFWVSS
FT                   PASDKCCALFDGPYLSEHFLGEGMTIMLRQKDSVLTSAIDHALAALSRSGRLQELYLRY
FT                   FPYGLY"
FT   gene            complement(599747..600160)
FT                   /locus_tag="RHECIAT_CH0000604"
FT   CDS_pept        complement(599747..600160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000604"
FT                   /product="hypothetical conserved protein"
FT                   /note="yhch00176"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000604"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89595"
FT                   /db_xref="InterPro:IPR029024"
FT                   /db_xref="UniProtKB/TrEMBL:B3PNN2"
FT                   /protein_id="ACE89595.1"
FT                   /translation="MNKPLSAHDALIYVMVMASAVDSTMNDREMERIGQLIGFLPVFRD
FT                   FDEDTLISVARDCASLLAGPEGLDVVLETVRDTLPAKLYDTAYALAVEVASADLSVKAE
FT                   ELRLLSLLRDRLGLDKLTCAAIERSAIARFRKG"
FT   gene            complement(600249..600962)
FT                   /locus_tag="RHECIAT_CH0000605"
FT   CDS_pept        complement(600249..600962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000605"
FT                   /product="hypothetical conserved protein"
FT                   /note="yhch00177"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000605"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89596"
FT                   /db_xref="InterPro:IPR035437"
FT                   /db_xref="UniProtKB/TrEMBL:B3PNN3"
FT                   /protein_id="ACE89596.1"
FT                   /translation="MRPAAVFTGLAGMAVVAGLLISAEARLRGGTGGEDMITAEAPATD
FT                   TAAQTAPEAAGLSTPISDADAEIIARGAQPAAPSPAPAERVAATPADPPPPSETPGGQA
FT                   AGPAAKKPIELARPVAENAGVLSFGERRLQLAGIVPTPADRICGPAGRQWPCGMLAKTA
FT                   LRQLLRNRNLTCDLDMAEWKGTVTAACRLGAQDLGTWLAENGWTEAEAGSPLGAVADKA
FT                   KQAQKGIYGGDPRRK"
FT   gene            complement(600974..601660)
FT                   /locus_tag="RHECIAT_CH0000606"
FT   CDS_pept        complement(600974..601660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000606"
FT                   /product="putative phage-related transcriptional regulator
FT                   protein"
FT                   /note="ypch00215; GO_function: GO:0008236 - serine-type
FT                   peptidase activity; GO_process: GO:0006508 - proteolysis"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000606"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89597"
FT                   /db_xref="GOA:B3PNN4"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/TrEMBL:B3PNN4"
FT                   /protein_id="ACE89597.1"
FT                   /translation="MLSHEQIWEAIDRLAERHDLTPSGLARRAGLDPTSFNKSKRLSAD
FT                   GRLRWPSTESIAKVLDATGASMEQFLALLPPGGTAAERTGERAQRLDSRFQPQGGAIPL
FT                   LGFAQAGAGGFFDDGGFPAGQGWDVVEFPAAPSQKSGVYALEVQGESMMPLYRDGDVLI
FT                   VEPGAQVRRNDRVVVRTREGEVMAKVLLRQSPRSIELMSLNPEHPNRTLDLSDVEWIAR
FT                   IIWASQ"
FT   gene            complement(601783..602430)
FT                   /locus_tag="RHECIAT_CH0000607"
FT   CDS_pept        complement(601783..602430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000607"
FT                   /product="probable two-component response regulator
FT                   protein"
FT                   /note="ypch00216; GO_function: GO:0000156 - two-component
FT                   response regulator activity; GO_process: GO:0000160 -
FT                   two-component signal transduction system (phosphorelay;
FT                   GO_process: GO:0006355 - regulation of transcription,
FT                   DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000607"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89598"
FT                   /db_xref="GOA:B3PNN5"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B3PNN5"
FT                   /protein_id="ACE89598.1"
FT                   /translation="MQEQTIIIADDHPLFRDALRQAVIGMEGRQSIVEAGDFAAARTAA
FT                   GAHPDADLMLLDLAMPGVSGFSGLMALRAEFASLPIIIVSASDDATTIRRALELGASGF
FT                   ISKSSGIEDIRRSIQTVLAGDIATPENYRDGQEQDPDVADLIHRLHTLTPQQSRVLTML
FT                   AEGLLNKQIAYELGVSEATIKAHVSAILLKLDVDSRTQAVIQLGKINMAMVA"
FT   gene            complement(602521..602919)
FT                   /locus_tag="RHECIAT_CH0000608"
FT   CDS_pept        complement(602521..602919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000608"
FT                   /product="hypothetical conserved protein"
FT                   /note="yhch00178"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000608"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89599"
FT                   /db_xref="UniProtKB/TrEMBL:B3PNN6"
FT                   /protein_id="ACE89599.1"
FT                   /translation="MKILALTLGAVLLPLAAVAAEADAGRFQLEKSGDHFVRLDRQTGA
FT                   MSICQDKDGALVCRMAADERAAYEDELDRLSQRVTKLEQQGLVQRALPSDAEIDRSISI
FT                   MEKMMKSFMGMVREFQAEEKANPLPQKT"
FT   gene            603037..603390
FT                   /locus_tag="RHECIAT_CH0000609"
FT   CDS_pept        603037..603390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000609"
FT                   /product="hypothetical conserved protein"
FT                   /note="yhch00179"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000609"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89600"
FT                   /db_xref="InterPro:IPR009297"
FT                   /db_xref="UniProtKB/TrEMBL:B3PNN7"
FT                   /protein_id="ACE89600.1"
FT                   /translation="MTLTPTLYKIVTETLWQQARQSGVFHGAGIDLKDGFIHFSTADQV
FT                   KQTAALHFAGQSGLMLVAVDGGRLGDKLIFESSRGGDLFPHLYADLPLAAVLWEVPLPL
FT                   DETGAHIFPELQP"
FT   gene            603387..604475
FT                   /gene="pyrD"
FT                   /locus_tag="RHECIAT_CH0000610"
FT   CDS_pept        603387..604475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrD"
FT                   /locus_tag="RHECIAT_CH0000610"
FT                   /product="dihydroorotate dehydrogenase protein"
FT                   /EC_number="1.3.98.1"
FT                   /note="GO_function: GO:0004152 - dihydroorotate
FT                   dehydrogenase activity; GO_process: GO:0006207 - 'de novo'
FT                   pyrimidine base biosynthetic process"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000610"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89601"
FT                   /db_xref="GOA:B3PNN8"
FT                   /db_xref="InterPro:IPR001295"
FT                   /db_xref="InterPro:IPR005719"
FT                   /db_xref="InterPro:IPR005720"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3PNN8"
FT                   /protein_id="ACE89601.1"
FT                   /translation="MIDPFKRLARKGLFLFDPETAHGMSIAALKSGLVPACQITPDPRL
FT                   RQTVAGLTFENPLGMAAGYDKNAEVPEALLRLGFGFTEIGTVTPRPQSGNPRPRIFRLV
FT                   EDEAVINRLGFNNEGHEAAFERLSALTGKGVVGVNIGANKDSEDRITDYVAGIRCFYSV
FT                   ARYFTANISSPNTPGLRDLQARESLAALLSAVLAARDEMAERSGRKIPVFLKIAPDLTE
FT                   EGMDDIAAEALAHPLDGLIVSNTTLSREGLKDQRQAKETGGLSGVPLFEKSTAVLARMR
FT                   KRVGAALPIIGVGGVSSAETALEKIRAGADLVQLYSCMVYEGPGLPGNIVRGLSGLLDR
FT                   EKAGSIRELRDSRLDYWAARKV"
FT   gene            complement(604451..605797)
FT                   /gene="dinF"
FT                   /locus_tag="RHECIAT_CH0000611"
FT   CDS_pept        complement(604451..605797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dinF"
FT                   /locus_tag="RHECIAT_CH0000611"
FT                   /product="DNA-damage-inducible F protein (Na+ driven
FT                   multidrug efflux pump)"
FT                   /note="GO_component: GO:0016020 - membrane; GO_function:
FT                   GO:0015238 - drug transporter activity; GO_function:
FT                   GO:0015297 - antiporter activity; GO_process: GO:0006855 -
FT                   multidrug transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000611"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89602"
FT                   /db_xref="GOA:B3PNN9"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:B3PNN9"
FT                   /protein_id="ACE89602.1"
FT                   /translation="MDTRSNSHSLAFEVTHRLVLSIAIPMTLGFLTTPLLGLTSTAVVG
FT                   HMGDPEALAGLAIGAMLFDLILGSFNFLRASTTGLTAQAYGRRDQHEQQAVFARALISA
FT                   LGCGLALLCLSPLLRAAGLRLMGAEGAIAEATATYFSIRILAAPAALANYAILGFVLGR
FT                   GQGGVGLLLQALINGINILLSIYLGLSLGWGVAGVAWGTLAGEVAGALAGLFIVLSGFA
FT                   RAERPAWPEILSRHRLAELFALNRDILIRTFVLIGAFAIMTRIGTGFGAVTLAANAVLM
FT                   NFFLLSGYYLDGLANAAEQITGRAVGAHYRPAFDRGLKLTTLWSFGLAAIVSAFFLLAG
FT                   PWLISVLTTSPEVRQAAGAYLPWAAVTGLTGALAFLMDGVFIGATWSVDMRNRMLMSFA
FT                   GYLAMLGVFVPLFGNHGLWLAMNAFLLFRGFFLAMLVKPRADQTFRAAQ"
FT   gene            complement(605826..606323)
FT                   /locus_tag="RHECIAT_CH0000612"
FT   CDS_pept        complement(605826..606323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000612"
FT                   /product="hypothetical conserved protein"
FT                   /note="yhch00180"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000612"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89603"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR014044"
FT                   /db_xref="InterPro:IPR035940"
FT                   /db_xref="UniProtKB/TrEMBL:B3PNP0"
FT                   /protein_id="ACE89603.1"
FT                   /translation="MTSIDLSRRGLLRLSGLALAAGIAGCTTTPRLAGTPSNGEDETAS
FT                   VLPLVNQLRAKNGLPPLSPDPAAQTAALFQAKRMASAGKMAHLMGMTDSFGDRVKASGV
FT                   QLPAAENIASGQQSVDAVVTAWINSPHHLENMLGRYDGLGVAVAHNSSSRNLPYWAMVL
FT                   SS"
FT   gene            complement(606325..606642)
FT                   /locus_tag="RHECIAT_CH0000613"
FT   CDS_pept        complement(606325..606642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000613"
FT                   /product="hypothetical conserved protein"
FT                   /note="yhch00181"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000613"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89604"
FT                   /db_xref="GOA:B3PNP1"
FT                   /db_xref="UniProtKB/TrEMBL:B3PNP1"
FT                   /protein_id="ACE89604.1"
FT                   /translation="MRAARRNLIPRATRRWRMSDQVNRFLGDSLGRTLIKLIVVSLIVG
FT                   FVMTVFGLTPWNIIYGFRDFILEIWHRGFSALGRVGDYLLLGATIVIPLFLILRLFSYH
FT                   R"
FT   gene            606786..607718
FT                   /locus_tag="RHECIAT_CH0000614"
FT   CDS_pept        606786..607718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000614"
FT                   /product="probable methyltransferase protein"
FT                   /note="ypch00217"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000614"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89605"
FT                   /db_xref="GOA:B3PNP2"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B3PNP2"
FT                   /protein_id="ACE89605.1"
FT                   /translation="MQPHQLSSGDVIADRRADYARMLEEGGEPEAAAELMEQALELAPA
FT                   WAAGWYRLATYREKAGKAEAAIEAYRKTLALDPEDIFGSALKLALLGDTATPDRPPSRY
FT                   VERLFDDYADRFETALIEKLDYSVPQKLAALVSATGRHYACAVDLGCGTGLLGPEIHGR
FT                   VGRLEGFDLSQNMLAKAAEKVVYDHLAQADLSLASGLSGLFADRPRGRADLVTAADVLM
FT                   YLGNLESVFEIIDELAAAGADLAFSVEDAGEGESFHLAPSLRYAHSEAYVRMLLARHGF
FT                   EILDIVKTVIRKDGGKPVAGILFLTRKPA"
FT   gene            607928..608563
FT                   /locus_tag="RHECIAT_CH0000615"
FT   CDS_pept        607928..608563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000615"
FT                   /product="hypothetical conserved protein"
FT                   /note="yhch00182"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000615"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89606"
FT                   /db_xref="GOA:B3PNP3"
FT                   /db_xref="InterPro:IPR003740"
FT                   /db_xref="UniProtKB/TrEMBL:B3PNP3"
FT                   /protein_id="ACE89606.1"
FT                   /translation="MTQLINALGVWNTSATRHSPIEDVQGIFSGSLVAALGLYVLASAG
FT                   LLTGSTAGVAFLLHYAFGVNFGLAFFLLNLPFFYLSWKRLGMAFTMKTFIAIGLTSAIA
FT                   DLQSRLFSISSIHPAWAALLGGLLLGFGALALYRHRASLGGVGILGVYLQERFGIRAGL
FT                   VQLAIDLCVLAAAVFVTTPPVVFYSVLGALVLNLFVAINHRADRYIAI"
FT   gene            608655..609077
FT                   /locus_tag="RHECIAT_CH0000616"
FT   CDS_pept        608655..609077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000616"
FT                   /product="hypothetical protein"
FT                   /note="yhch00183"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000616"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89607"
FT                   /db_xref="UniProtKB/TrEMBL:B3PNP4"
FT                   /protein_id="ACE89607.1"
FT                   /translation="MNYVRFGKACETPHAGRIRQGRFRRRNREGRPRSAQQCRPLGHRA
FT                   RCRCRTGYDRSQLTGYPTDPRFSGRLLGLPSPLRQQQPFIRLTQPLPGASCVPVQTKVP
FT                   AGQMMGLSSPRHNRSRGPISRCSCSRNHPTLRHPRA"
FT   misc_feature    609218..610342
FT                   /note="yich00007; insertion sequence:Integrase, catalytic
FT                   core"
FT   gene            complement(610604..611065)
FT                   /locus_tag="RHECIAT_CH0000617"
FT   CDS_pept        complement(610604..611065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000617"
FT                   /product="hypothetical conserved protein"
FT                   /note="yhch00184"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000617"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89608"
FT                   /db_xref="GOA:B3PNP5"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:B3PNP5"
FT                   /protein_id="ACE89608.1"
FT                   /translation="MQPRFNFAKAAPDAYKAVAALEQYVQSSGLERRFIHLIKLRASQI
FT                   NGCAYCVDMHVKEARHDGLSEQWINLMCVWRESPLYDARERALLGWVDAVTNIAKTGAP
FT                   DADYETLKAHFSEEEMTKITVTIGAINVWNRLAVGFRSQHPIDAVTKAA"
FT   gene            complement(611087..611587)
FT                   /locus_tag="RHECIAT_CH0000618"
FT   CDS_pept        complement(611087..611587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000618"
FT                   /product="putative transcriptional regulator protein"
FT                   /note="ypch00218"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000618"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89609"
FT                   /db_xref="GOA:B3PNP6"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR030489"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B3PNP6"
FT                   /protein_id="ACE89609.1"
FT                   /translation="MKMSDGVEQAIHSVAMLSGLSEGGVLSAAALAEFHGVSTSYLLKH
FT                   LQALSGAGILDTVPGPKGGYRLAKAAEEISLLDILLAVEGPAPAFRCAEIRQRGPNPVS
FT                   DRFFAKPCNISAAMLRAERVYRAELAKTSIADLGIELNALDDGSIAARGCAFLEIHERK
FT                   TAR"
FT   gene            611718..612350
FT                   /locus_tag="RHECIAT_CH0000619"
FT   CDS_pept        611718..612350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000619"
FT                   /product="hypothetical conserved protein"
FT                   /note="yhch00185"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000619"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89610"
FT                   /db_xref="GOA:B3PNP7"
FT                   /db_xref="InterPro:IPR003740"
FT                   /db_xref="UniProtKB/TrEMBL:B3PNP7"
FT                   /protein_id="ACE89610.1"
FT                   /translation="MAANAFTGLLNSSADRHSLFDDAQGIVAGSMLAVLGVSLLSGAGL
FT                   LAGGTAGLAFLAHYATGFSFGLCFFAVNLPFYYLAFRRMGPAFTIKTFAAIALTSVLSE
FT                   FVPGFIGIGHVNPIAGALFGGLVIGAGMLALFRHRASLGGIGILALYIQDRLGWRAGLV
FT                   QLGFDCLILALSFLVASPAIIACSVLGAIVFNLTLAINHRKDRYIAV"
FT   gene            612463..614973
FT                   /gene="lhr"
FT                   /locus_tag="RHECIAT_CH0000620"
FT   CDS_pept        612463..614973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lhr"
FT                   /locus_tag="RHECIAT_CH0000620"
FT                   /product="ATP-dependent RNA/DNA helicase protein"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000620"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89611"
FT                   /db_xref="GOA:B3PNP8"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR013701"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR017170"
FT                   /db_xref="InterPro:IPR026362"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3PNP8"
FT                   /protein_id="ACE89611.1"
FT                   /translation="MDQIDSEASAQLPAAFTRWFAEKGWRPRVHQLELLARAEAGESTL
FT                   LIAPTGAGKTLAGFLPSLTDLTRRGRIPPGSAFTGIHTLYVSPLKALAIDIERNLMKPV
FT                   AEMGLPVTVENRTGDTPNAKRQRQKLNPPDILLTTPEQVALLLANREAERFFKDLKYVV
FT                   LDELHSLVTSKRGHMLSLGLARLRRLAPGLKTIGLSATVAEPMDLQKWLVAQEEGKGHH
FT                   AGLVVVEGGAKPDISILSTEERIPWAGHSAKYAIPDVYRQLLDHRTTLLFVNTRSQAEM
FT                   LFQELWTINDDNLPIALHHGSLDVAQRRKVEAAMAENRLRAVVATSTLDLGIDWGDVDL
FT                   VIHVGAPKGASRLAQRIGRANHRMDEPSKAILVPANRFEVMECQAALDANYLGAQDTPP
FT                   VGRGALDVLAQHVLGMACAEPFDMLELYDEITSASPYADLSWETFERVVDFVATGGYAL
FT                   RTYERYARIRKTKEGRWRVSNPAVAQQYRLNLGTIVESPMLNIRMVKRGEGGRIGRGGA
FT                   TLGKVEEYFLEQLSPGDTFVFSGKVLRFEGIRENECLASQAFSLDPKIPAYNGGKFPLS
FT                   TYLAEQVRAMIADPDRWRHLPDQVRDWLSLQTDKSMLPKRDEFLIETFPRGSRGYMVAY
FT                   PFEGRLAHQTLGMLLTRRLDRAGAKPLGFVATDYSLAIWGLEDMGLMIGNGRLSLSDLF
FT                   DADMLGDDLEAWLNESFLLKRTFRNCAVIAGLIERRHPGKEKSGRQITVSADLIYDVLR
FT                   SHEPDHILLQATRQDAATGLLDISRLGDMLMRIRGHITHRPLDHISPLAVPVMLEIGRE
FT                   AVPGEAHDALLAEAADDLIAEALA"
FT   gene            614996..615724
FT                   /locus_tag="RHECIAT_CH0000621"
FT   CDS_pept        614996..615724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000621"
FT                   /product="putative phosphoesterase protein"
FT                   /note="ypch00219; GO_function: GO:0016787 - hydrolase
FT                   activity"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000621"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89612"
FT                   /db_xref="GOA:B3PNP9"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR024173"
FT                   /db_xref="InterPro:IPR026336"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:B3PNP9"
FT                   /protein_id="ACE89612.1"
FT                   /translation="MMNRLALARDISGLATMPGIETSIHGIAAVCDPLGALYLPDAGLL
FT                   IVSDLHLEKGAAFARRGMMLPPYDTLATLTVLAAVISRYDPKLVVSLGDNFHDRIGSAH
FT                   LPENFRALIVGMARGREWIWINGNHDPDGVVDLPGACADEMHYAGLTFRHEPKNGLQSG
FT                   EIAGHLHPSATVRRRERSIRRPCFATDGARLLMPAFGVMSGGLDLGHQAMKGLFDTSSL
FT                   VAHLLGRDRIYSVRYGNLRG"
FT   gene            complement(615778..616359)
FT                   /locus_tag="RHECIAT_CH0000622"
FT   CDS_pept        complement(615778..616359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000622"
FT                   /product="hypothetical conserved protein"
FT                   /note="yhch00186"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000622"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89613"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:B3PNQ0"
FT                   /protein_id="ACE89613.1"
FT                   /translation="MRTRIVLTVVGLALLAGCATAPKQTRNICAVFDQREGLFSSWQRA
FT                   AERTEKKYGVPVPILMATMYTESGFQPYARPPRTKLFGFIPWTRPSTAYGYSQALDGTW
FT                   DHYQSQTGNWAARRTNFTDAIDFIGWYHYQNSVETGIPLNDAYNLYLAYYSGPTGYKRG
FT                   DWRANGQLQQTAQKFARMAGTYQQQLQGCD"
FT   gene            complement(616515..617072)
FT                   /locus_tag="RHECIAT_CH0000623"
FT   CDS_pept        complement(616515..617072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000623"
FT                   /product="putative dihydrofolate reductase protein"
FT                   /EC_number="1.5.1.3"
FT                   /note="ypch00220; GO_function: GO:0008703 -
FT                   5-amino-6-(5-phosphoribosylamino)uracil reductase activity;
FT                   GO_process: GO:0009231 - riboflavin biosynthetic process"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000623"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89614"
FT                   /db_xref="GOA:B3PNQ1"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:B3PNQ1"
FT                   /protein_id="ACE89614.1"
FT                   /translation="MRKLIVWNLMTLDGYFEGTKPWDIDFHNLAWGPELQRYAEQFGEE
FT                   GDLLVFGRKTYEGMATYWPTAEGEGRIKAYMNGIAKIAVSRTMTEPGWNNARIVSDPIP
FT                   ELTRLKQEEGKTIFIFGSADLADSLLKAGLVDEIRICVVPVILGAGNPLFKPAAAQVPL
FT                   KLIESSTTASGAVILRYEPVKV"
FT   gene            complement(617269..618069)
FT                   /locus_tag="RHECIAT_CH0000624"
FT   CDS_pept        complement(617269..618069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000624"
FT                   /product="hypothetical conserved protein"
FT                   /note="yhch00187"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000624"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89615"
FT                   /db_xref="GOA:B3PNQ2"
FT                   /db_xref="InterPro:IPR019088"
FT                   /db_xref="UniProtKB/TrEMBL:B3PNQ2"
FT                   /protein_id="ACE89615.1"
FT                   /translation="MRLSAAVLAFLCLLPAAAGAQWLPGQSTEAVREGLEIGTSTSEIA
FT                   ITSDFHGADLTIFGALSNTDQLLLAIGQYDVVVVLEGPRQDATVRKKERVFGIWMNTRS
FT                   MTFEAVPHSYSMSSSRMIDDLTTPLELTDQGIGIDHIPLTPVGFVGDGSNLGEFRQAFL
FT                   RLQQGGALYDRNPSGVRFVASNLFKASLRLPANIPNGVHTVRAYLFKSGDLVTEKSLPL
FT                   RVIKTGIEQTITDAAHDQPILYGCAAVALAVVTGWGASLIFRKD"
FT   gene            complement(618069..618992)
FT                   /locus_tag="RHECIAT_CH0000625"
FT   CDS_pept        complement(618069..618992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000625"
FT                   /product="putative permease protein"
FT                   /note="ypch00221; GO_component: GO:0016021 - integral to
FT                   membrane"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000625"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89616"
FT                   /db_xref="GOA:B3PNQ3"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:B3PNQ3"
FT                   /protein_id="ACE89616.1"
FT                   /translation="MTIYLPIAELSVNIFIILGMGAAVGFLSGMFGVGGGFLITPLLIF
FT                   YNIPPVVAVATGANQVVASSISGAITHFRRGTLDVKLGTVLLVGGLSGATVGIWIFSLL
FT                   RALGQLDLFISLLYVIFLGTVGGLMLLESINAMRRAARNEPPAPRKPGHQHWVHKLPLK
FT                   VRFKKSKIFLSVIPIVALGFAIGILTSVMGVGGGFIMVPAMIYLLRIPTNVVVGTSLYQ
FT                   IIFVTAYTTIVQAATNFSVDIVLAFILMVAGVIGAQYGVRVGQKLRGEQLRALLGLLVL
FT                   AVGLRLAIALVVTPTDIYSVVMGTGN"
FT   gene            619005..619235
FT                   /locus_tag="RHECIAT_CH0000626"
FT   CDS_pept        619005..619235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000626"
FT                   /product="hypothetical protein"
FT                   /note="yhch00188"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000626"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89617"
FT                   /db_xref="UniProtKB/TrEMBL:B3PNQ4"
FT                   /protein_id="ACE89617.1"
FT                   /translation="MMTAPAGRFPSRPRSNAHLTAKSLPEAFDQPLGRWRSRVDDSTDA
FT                   PGDLSRIIRLFSDCVTGGGKNGECLGAAGLL"
FT   gene            complement(619322..623083)
FT                   /locus_tag="RHECIAT_CH0000627"
FT   CDS_pept        complement(619322..623083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000627"
FT                   /product="putative hemaglutinin protein"
FT                   /note="ypch00222; GO_process: GO:0000270 - peptidoglycan
FT                   metabolic process"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000627"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89618"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/TrEMBL:B3PNQ5"
FT                   /protein_id="ACE89618.1"
FT                   /translation="MNGSRSNPSRQSDRTSLDALNRTIEGLEARIEGLMGSGRDQRPRT
FT                   ATAERDVYASPNSPRPARAPIEPRPDPLTEIRQRQRALEAGRERPYGREPAPQLREPAP
FT                   RAAASQPAPAFRAGDDTMTEIAQALVNLRHDLKRDISEGVTREMNALRTELREIKTSAG
FT                   DGRFADDIRADMSRLAQSINQLTGRSAGAEAAGLREDFEDLRSLMDGLAREESLRHMEN
FT                   RWDGFENRLAALDTEGLQEELVSLAYRLDDIKRHIGGMGESPAVRALEDKLIAIATAME
FT                   QFGNMIQPHDRVMAEQFAAMDMRLDEISRAIAASGRAAANSDPTLMQRLESRLSALADQ
FT                   IDVMSHDAASRATPADELAMRLEALTERVEELTRAEATSRLDERLEHLSYLLERTQQTA
FT                   AQPDLSGPLSDISRKIDALENGAVNDVLAQRLDYLARRIDEMAHPQPAPAAAIDDGAFR
FT                   RLEGRLSDIAARLEESTAAPPTDPRALKNLEDQIANLSALMSEPRESAADLDRRMGAIE
FT                   DYMATSDEYIIEAARQAAEAVVEAYSRNGALQGTVPAADMSALTALAEDLRHLEDISRD
FT                   SEERTHKTFKALHETLVHIADRLDGMEERGRPAAQMPVADVDFDIDPYALMVAETTRTP
FT                   EAAPAAKASPVIRPAEVAAEPVPAQAAVMSATSAIAIEAATRTPEAATLAPAKPGLLAS
FT                   LGKRLRPGKKAETKAAERAVIDPAPSIDPADVVPTDAANELLEPGSGAPDVKKILERVR
FT                   ASQSAARGKPPVETDRADYIAAARRAAQAAAMEVDANPKQAGKAEKKGATAKADKTGKT
FT                   DQTGKTGKVSAFSRYRRPILLAIGAVLLAIMAFPLARTLTSGEPAPEPPAEVSALTGAT
FT                   ENPQPALPEATSAQPETGAAEVNAPATETAPPAAEQAQPETTPPAAGDHLTDAAPLDGE
FT                   GAATFAPAASSGAPQETSGFVPNTPAAAPQAAITIPDTVQPKSLADAAQGGDALALFEI
FT                   GARYSDGRNGMTVDQKQAANWYQLAADKGFAPAQYRLGSMYEKGNGVERDIAKAKTFYE
FT                   QAANQGNASAMHNLAVLYASGALGQQDYATAASWFTKAANLGITDSQFNLAILCARGNG
FT                   VPTDIEESYKWFAIAAKAGDKDAGQKRDEVANAMKPDQLERARAKADLWKPEPLDHRAN
FT                   GIDIPDEWAGTGAKTASVDMKKAIRNIQAILNNNGFDAGVPDGEMGAKTVTAIKNFQKS
FT                   IGQAPDGKVTDATVKALLERNKQVAKAI"
FT   gene            complement(623402..623767)
FT                   /locus_tag="RHECIAT_CH0000628"
FT   CDS_pept        complement(623402..623767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000628"
FT                   /product="putative lactoylglutathione lyase protein"
FT                   /EC_number="4.4.1.5"
FT                   /note="ypch00223"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000628"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89619"
FT                   /db_xref="GOA:B3PNQ6"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B3PNQ6"
FT                   /protein_id="ACE89619.1"
FT                   /translation="MPRLDHVTIDTRDAPRMIGFLQAILGVKEGYRPPFPSPGHWLYLD
FT                   DRPVIHLSLTSSSTDFPPGIFNHVAFSLYEFAPALERIKASGYRYEYYDIPDTDLGQVF
FT                   VYGPEGVKIELQYKRPA"
FT   gene            complement(623863..624552)
FT                   /locus_tag="RHECIAT_CH0000629"
FT   CDS_pept        complement(623863..624552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000629"
FT                   /product="probable DNA glycosylase protein"
FT                   /note="ypch00224"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000629"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89620"
FT                   /db_xref="GOA:B3PNQ7"
FT                   /db_xref="InterPro:IPR005019"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:B3PNQ7"
FT                   /protein_id="ACE89620.1"
FT                   /translation="MMSFEAIKQRAEERKGGAAALQALLEKHRPDHDRLRAMPDDRILA
FT                   DMTRRIFYSGFVQKVIDAKWPGFEAAFSGFDPAMLNIAPDDYWHEMTSDERIIRNGAKI
FT                   MSVRANAAFIRELAREHGSAGAFLADWPREDQIGLLDLLSKRGSRLGGMTGQYFLRGIG
FT                   RDSFVATMDVLACLRSAGVPLSASGTAKKDQPMIQKAFNDWAEETGLSFIHLSRISAYS
FT                   IDAGAPH"
FT   gene            624793..626589
FT                   /gene="acd1"
FT                   /locus_tag="RHECIAT_CH0000630"
FT   CDS_pept        624793..626589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acd1"
FT                   /locus_tag="RHECIAT_CH0000630"
FT                   /product="acyl-CoA dehydrogenase protein"
FT                   /EC_number="1.3.99.-"
FT                   /note="GO_function: GO:0003995 - acyl-CoA dehydrogenase
FT                   activity; GO_process: GO:0006118 - electron transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000630"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89621"
FT                   /db_xref="GOA:B3PNQ8"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR020953"
FT                   /db_xref="InterPro:IPR025878"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B3PNQ8"
FT                   /protein_id="ACE89621.1"
FT                   /translation="MPVYKAPVNDTLFVLNDVLGLERYNNLPGFADATPDMIEAILGEA
FT                   GKVAEEALFPVNYSGDQEGCHRHDDASVSTPKGFREAYKAYREGGWIGLAVPEEFGGQG
FT                   LPYTLHCAVGEYTSAANMSLMMYPGLTQGAIAAILVHGTQEQKETYLPKMVDGSWSGTM
FT                   NLTEPHCGTDLGMLRTKAVPQADGSYRISGQKIFISAGEHDLTDNIVHLVLARIEGAPE
FT                   GTKGISLFIVPKFLVGKDGAPGARNAVSCGAIEHKMGIHGNATCVMNYDEATGFLIGAE
FT                   NRGLNAMFVMMNEARLMVGLQGIAISEIAYQNAAAYARDRIQGRSLSGVKAPDKKADPI
FT                   IVHPDIRRTLMTIRAFNEAGRAFLLWTALKSDIAHRATDEKERRTADDILGLVTPILKG
FT                   VMTDKGFDHAVMAQQVFGGHGYIEEHGMSQYVRDARIAMIYEGANGIQALDLVGRKLAL
FT                   NGGRAAMALFKEIGDFCEENRSDEKLSFFTKHLKKGLNDVQGATMWFMQNAMAKPDNAG
FT                   AGSTDYMHLFGLVVLGYMWAKMAKAAEDGLASGDASREDFLKNKLVTARFFMERIMPET
FT                   ALRKARIEAGADTMMALAAEAF"
FT   gene            626680..627888
FT                   /gene="fadA"
FT                   /locus_tag="RHECIAT_CH0000631"
FT   CDS_pept        626680..627888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadA"
FT                   /locus_tag="RHECIAT_CH0000631"
FT                   /product="acetyl-CoA C-acyltransferase protein
FT                   (3-ketoacyl-CoA thiolase)"
FT                   /EC_number="2.3.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000631"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89622"
FT                   /db_xref="GOA:B3PNQ9"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:B3PNQ9"
FT                   /protein_id="ACE89622.1"
FT                   /translation="MTEVFIYDHVRTPRGRGKKDGALHEVPSVRLAAKTLEAIRDRNGL
FT                   DTRTVDDIIMGCVDPVMDAGAVIPKAAAFEAGYSTKAPGMQISRFCASGLDAVNFGAGK
FT                   IAQGADDIVIAGGVESMSRVGLGMSGGAWFMDPSVNFPAYFMPQGVSADLIATKYGFSR
FT                   TDVDAYAVESQKRAGHAWEQGWFDKSVIPVKDQNGLTILDKDEHMRPGTDMQALASLNP
FT                   SFQMPGEMGGFEAVGIQAHPEIERINYVHHAGNSSGIVDGAGVVLLGSKAGGESMGIKP
FT                   RARIKAFANIGSDPALMLTGPVDVTEKLLKRTGMRLADIDLFELNEAFAAVVLRYMQAF
FT                   DIDHDRINVNGGAIAMGHPLGATGAMILGTVLDELERRDLNTALVTLCIGAGMGTATVI
FT                   ERV"
FT   gene            627958..630174
FT                   /gene="fadB2"
FT                   /locus_tag="RHECIAT_CH0000632"
FT   CDS_pept        627958..630174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadB2"
FT                   /locus_tag="RHECIAT_CH0000632"
FT                   /product="enoyl-CoA hydratase protein"
FT                   /note="GO_function: GO:0016491 - oxidoreductase activity;
FT                   GO_process: GO:0006631 - fatty acid metabolic process"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000632"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89623"
FT                   /db_xref="GOA:B3PNR0"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B3PNR0"
FT                   /protein_id="ACE89623.1"
FT                   /translation="MSTYTNFTLETDADGIALVTWDMPGKSMNVFTSEVMEELNAIIDA
FT                   TTADAGVKGVVFTSGKSSFSGGADLSMIKSMFSAYQEEKARNPESAVRTLFGLVGRMSG
FT                   LFRKLETSGKPWVSAINGTCMGGAFELSLACHGRVASNAKSVKIALPEVKVGIFPGAGG
FT                   TQRVPRLANAQDALQMMTTGQSLSGSRAKAMNLVHQVVEPDQLIPAAKQMIKDGLKPVA
FT                   PWDDKGFKLPGGGIWTPASAQLWPAAPAILRRETSGNYPAALAILKCVYEGLQVPFDTG
FT                   LKIEQRYFTEVLQTREAFSMIRSLFISMQELGKGARRPAGIPKTELKHVGVVGAGFMGA
FT                   SIAYVTAAAGLPVTLIDRDLEAAAKGKAVCEGLVKDSVGKGRFTQDEAAALLARITPAA
FT                   DYAGLATADLVIEAVFEDREVKKSVIAAVEAVLPEGAIFASNTSTLPITGLAENSKRPA
FT                   DFIGIHFFSPVEKMMLTEVILGKETGDKALAVALDYVAAIKKTPIVVNDTRGFFVNRCV
FT                   LRYMSESYDMLIEGVPPAMIENAAKMAGMPVGPLALNDEVAIDLSLKILKATVADLGEK
FT                   AIDPRHMELISRMVEKEGRFGRKNSKGFYDYPPKPAKKSLWPELKDFYPQKKADEVDVA
FT                   VLKQRFLVTIALEAARTVEEGIVTDPREADVGSILGFGFAPYTGGALSYIDGMGVKAFV
FT                   ELAERLAGAYGDHFKPTPLLKDMAARGETFYGRFDPYAKMGAAA"
FT   gene            630621..630830
FT                   /gene="cspA1"
FT                   /locus_tag="RHECIAT_CH0000633"
FT   CDS_pept        630621..630830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cspA1"
FT                   /locus_tag="RHECIAT_CH0000633"
FT                   /product="cold shock protein"
FT                   /note="GO_function: GO:0003677 - DNA binding; GO_process:
FT                   GO:0006355 - regulation of transcription, DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000633"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89624"
FT                   /db_xref="GOA:B3PNR1"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:B3PNR1"
FT                   /protein_id="ACE89624.1"
FT                   /translation="MNTGTVKWFNATKGFGFIQPDDGAADVFVHISAVERAGMRDLKDG
FT                   QKLSYELVRDNKSGKMSADRLQAA"
FT   gene            complement(631074..631574)
FT                   /locus_tag="RHECIAT_CH0000634"
FT   CDS_pept        complement(631074..631574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000634"
FT                   /product="probable transcriptional regulator protein, MarR
FT                   family"
FT                   /note="ypch00225; GO_component: GO:0005622 - intracellular;
FT                   GO_function: GO:0003700 - transcription factor activity;
FT                   GO_process: GO:0006355 - regulation of transcription,
FT                   DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000634"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89625"
FT                   /db_xref="GOA:B3PNR2"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B3PNR2"
FT                   /protein_id="ACE89625.1"
FT                   /translation="MNEIQNRQHVVKRNRPERTMEGNAFSAFAITALRLAGHLTAAGDQ
FT                   LAKPAGQTSARWQVLAAARRGDMSVAQIARTLGLARQGVQRLADVLEDEGLTAYADNPQ
FT                   HQRAKLVRLTAEGAVRLGVIEMAQAGWADGLGAAFTPAELDAARAVMARVMEMLEGGEA
FT                   AGG"
FT   gene            631632..632036
FT                   /locus_tag="RHECIAT_CH0000635"
FT   CDS_pept        631632..632036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000635"
FT                   /product="hypothetical conserved protein"
FT                   /note="yhch00189; GO_function: GO:0016846 - carbon-sulfur
FT                   lyase activity; GO_process: GO:0008152 - metabolic process"
FT                   /db_xref="EnsemblGenomes-Gn:RHECIAT_CH0000635"
FT                   /db_xref="EnsemblGenomes-Tr:ACE89626"
FT                   /db_xref="GOA:B3PNR3"
FT                   /db_xref="InterPro:IPR006913"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniProtKB/TrEMBL:B3PNR3"
FT                   /protein_id="ACE89626.1"
FT                   /translation="MKKTYKGSCHCGKVHYEVDIDLQAGTGRCNCSICAKRRYWGANVK
FT                   PEDFRLMCDEAVMADYQFNTMSGHHRFCRTCGVPAFGDGYVEAIGGAYVSINIACLDDI
FT                   TPEELAALPVRYSDGRHDAWWNEPEVTSYL"
FT   gene            632158..632601
FT                   /locus_tag="RHECIAT_CH0000636"
FT   CDS_pept        632158..632601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHECIAT_CH0000636"
FT                   /product="hypothetical conserved protein"
FT                   /n