(data stored in ACNUC7421 zone)

EMBL: CP001089

ID   CP001089; SV 1; circular; genomic DNA; STD; PRO; 3917761 BP.
XX
AC   CP001089; AAVG01000000-AAVG01000128;
XX
PR   Project:PRJNA17423;
XX
DT   06-JUN-2008 (Rel. 96, Created)
DT   12-DEC-2013 (Rel. 119, Last updated, Version 3)
XX
DE   Geobacter lovleyi SZ, complete genome.
XX
KW   .
XX
OS   Geobacter lovleyi SZ
OC   Bacteria; Proteobacteria; Deltaproteobacteria; Desulfuromonadales;
OC   Geobacteraceae; Geobacter.
XX
RN   [1]
RP   1-3917761
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Chertkov O., Meincke L., Brettin T.,
RA   Detter J.C., Han C., Tapia R., Kuske C.R., Schmutz J., Larimer F., Land M.,
RA   Hauser L., Kyrpides N., Mikhailova N., Sung Y., Fletcher K.E.,
RA   Ritalahti K.M., Loeffler F.E., Richardson P.;
RT   "Complete sequence of chromosome of Geobacter lovleyi SZ";
RL   Unpublished.
XX
RN   [2]
RP   1-3917761
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Chertkov O., Meincke L., Brettin T.,
RA   Detter J.C., Han C., Tapia R., Kuske C.R., Schmutz J., Larimer F., Land M.,
RA   Hauser L., Kyrpides N., Mikhailova N., Sung Y., Fletcher K.E.,
RA   Ritalahti K.M., Loeffler F.E., Richardson P.;
RT   ;
RL   Submitted (23-MAY-2008) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 238b2860daec0f8f1970a0a9e500f2f2.
DR   BioSample; SAMN00623044.
DR   EnsemblGenomes-Gn; EBG00001124372.
DR   EnsemblGenomes-Gn; EBG00001124373.
DR   EnsemblGenomes-Gn; EBG00001124374.
DR   EnsemblGenomes-Gn; EBG00001124375.
DR   EnsemblGenomes-Gn; EBG00001124376.
DR   EnsemblGenomes-Gn; EBG00001124377.
DR   EnsemblGenomes-Gn; EBG00001124378.
DR   EnsemblGenomes-Gn; EBG00001124379.
DR   EnsemblGenomes-Gn; EBG00001124380.
DR   EnsemblGenomes-Gn; EBG00001124381.
DR   EnsemblGenomes-Gn; EBG00001124382.
DR   EnsemblGenomes-Gn; EBG00001124383.
DR   EnsemblGenomes-Gn; EBG00001124384.
DR   EnsemblGenomes-Gn; EBG00001124385.
DR   EnsemblGenomes-Gn; EBG00001124386.
DR   EnsemblGenomes-Gn; EBG00001124387.
DR   EnsemblGenomes-Gn; EBG00001124388.
DR   EnsemblGenomes-Gn; EBG00001124389.
DR   EnsemblGenomes-Gn; EBG00001124390.
DR   EnsemblGenomes-Gn; EBG00001124391.
DR   EnsemblGenomes-Gn; EBG00001124392.
DR   EnsemblGenomes-Gn; EBG00001124393.
DR   EnsemblGenomes-Gn; EBG00001124394.
DR   EnsemblGenomes-Gn; EBG00001124395.
DR   EnsemblGenomes-Gn; EBG00001124396.
DR   EnsemblGenomes-Gn; EBG00001124397.
DR   EnsemblGenomes-Gn; EBG00001124398.
DR   EnsemblGenomes-Gn; EBG00001124399.
DR   EnsemblGenomes-Gn; EBG00001124400.
DR   EnsemblGenomes-Gn; EBG00001124401.
DR   EnsemblGenomes-Gn; EBG00001124402.
DR   EnsemblGenomes-Gn; EBG00001124403.
DR   EnsemblGenomes-Gn; EBG00001124404.
DR   EnsemblGenomes-Gn; EBG00001124405.
DR   EnsemblGenomes-Gn; EBG00001124406.
DR   EnsemblGenomes-Gn; EBG00001124407.
DR   EnsemblGenomes-Gn; EBG00001124408.
DR   EnsemblGenomes-Gn; EBG00001124409.
DR   EnsemblGenomes-Gn; EBG00001124410.
DR   EnsemblGenomes-Gn; EBG00001124411.
DR   EnsemblGenomes-Gn; EBG00001124412.
DR   EnsemblGenomes-Gn; EBG00001124413.
DR   EnsemblGenomes-Gn; EBG00001124414.
DR   EnsemblGenomes-Gn; EBG00001124415.
DR   EnsemblGenomes-Gn; EBG00001124416.
DR   EnsemblGenomes-Gn; EBG00001124417.
DR   EnsemblGenomes-Gn; EBG00001124418.
DR   EnsemblGenomes-Gn; EBG00001124419.
DR   EnsemblGenomes-Gn; EBG00001124420.
DR   EnsemblGenomes-Gn; EBG00001124421.
DR   EnsemblGenomes-Gn; EBG00001124422.
DR   EnsemblGenomes-Gn; EBG00001124423.
DR   EnsemblGenomes-Gn; EBG00001124424.
DR   EnsemblGenomes-Gn; EBG00001124425.
DR   EnsemblGenomes-Gn; EBG00001124426.
DR   EnsemblGenomes-Gn; EBG00001124427.
DR   EnsemblGenomes-Gn; EBG00001124428.
DR   EnsemblGenomes-Gn; EBG00001124429.
DR   EnsemblGenomes-Gn; EBG00001124430.
DR   EnsemblGenomes-Gn; EBG00001124431.
DR   EnsemblGenomes-Gn; Glov_R0001.
DR   EnsemblGenomes-Gn; Glov_R0002.
DR   EnsemblGenomes-Gn; Glov_R0003.
DR   EnsemblGenomes-Gn; Glov_R0004.
DR   EnsemblGenomes-Gn; Glov_R0005.
DR   EnsemblGenomes-Gn; Glov_R0006.
DR   EnsemblGenomes-Gn; Glov_R0007.
DR   EnsemblGenomes-Gn; Glov_R0008.
DR   EnsemblGenomes-Gn; Glov_R0009.
DR   EnsemblGenomes-Gn; Glov_R0010.
DR   EnsemblGenomes-Gn; Glov_R0011.
DR   EnsemblGenomes-Gn; Glov_R0012.
DR   EnsemblGenomes-Gn; Glov_R0013.
DR   EnsemblGenomes-Gn; Glov_R0014.
DR   EnsemblGenomes-Gn; Glov_R0015.
DR   EnsemblGenomes-Gn; Glov_R0016.
DR   EnsemblGenomes-Gn; Glov_R0017.
DR   EnsemblGenomes-Gn; Glov_R0018.
DR   EnsemblGenomes-Gn; Glov_R0019.
DR   EnsemblGenomes-Gn; Glov_R0020.
DR   EnsemblGenomes-Gn; Glov_R0021.
DR   EnsemblGenomes-Gn; Glov_R0022.
DR   EnsemblGenomes-Gn; Glov_R0023.
DR   EnsemblGenomes-Gn; Glov_R0024.
DR   EnsemblGenomes-Gn; Glov_R0025.
DR   EnsemblGenomes-Gn; Glov_R0026.
DR   EnsemblGenomes-Gn; Glov_R0027.
DR   EnsemblGenomes-Gn; Glov_R0028.
DR   EnsemblGenomes-Gn; Glov_R0029.
DR   EnsemblGenomes-Gn; Glov_R0030.
DR   EnsemblGenomes-Gn; Glov_R0031.
DR   EnsemblGenomes-Gn; Glov_R0032.
DR   EnsemblGenomes-Gn; Glov_R0033.
DR   EnsemblGenomes-Gn; Glov_R0034.
DR   EnsemblGenomes-Gn; Glov_R0035.
DR   EnsemblGenomes-Gn; Glov_R0036.
DR   EnsemblGenomes-Gn; Glov_R0037.
DR   EnsemblGenomes-Gn; Glov_R0038.
DR   EnsemblGenomes-Gn; Glov_R0039.
DR   EnsemblGenomes-Gn; Glov_R0040.
DR   EnsemblGenomes-Gn; Glov_R0041.
DR   EnsemblGenomes-Gn; Glov_R0042.
DR   EnsemblGenomes-Gn; Glov_R0044.
DR   EnsemblGenomes-Gn; Glov_R0045.
DR   EnsemblGenomes-Gn; Glov_R0046.
DR   EnsemblGenomes-Gn; Glov_R0047.
DR   EnsemblGenomes-Gn; Glov_R0048.
DR   EnsemblGenomes-Gn; Glov_R0049.
DR   EnsemblGenomes-Gn; Glov_R0050.
DR   EnsemblGenomes-Gn; Glov_R0051.
DR   EnsemblGenomes-Gn; Glov_R0052.
DR   EnsemblGenomes-Gn; Glov_R0053.
DR   EnsemblGenomes-Gn; Glov_R0054.
DR   EnsemblGenomes-Tr; EBT00001715797.
DR   EnsemblGenomes-Tr; EBT00001715798.
DR   EnsemblGenomes-Tr; EBT00001715799.
DR   EnsemblGenomes-Tr; EBT00001715800.
DR   EnsemblGenomes-Tr; EBT00001715801.
DR   EnsemblGenomes-Tr; EBT00001715802.
DR   EnsemblGenomes-Tr; EBT00001715803.
DR   EnsemblGenomes-Tr; EBT00001715804.
DR   EnsemblGenomes-Tr; EBT00001715805.
DR   EnsemblGenomes-Tr; EBT00001715806.
DR   EnsemblGenomes-Tr; EBT00001715807.
DR   EnsemblGenomes-Tr; EBT00001715808.
DR   EnsemblGenomes-Tr; EBT00001715809.
DR   EnsemblGenomes-Tr; EBT00001715810.
DR   EnsemblGenomes-Tr; EBT00001715811.
DR   EnsemblGenomes-Tr; EBT00001715812.
DR   EnsemblGenomes-Tr; EBT00001715813.
DR   EnsemblGenomes-Tr; EBT00001715814.
DR   EnsemblGenomes-Tr; EBT00001715815.
DR   EnsemblGenomes-Tr; EBT00001715816.
DR   EnsemblGenomes-Tr; EBT00001715817.
DR   EnsemblGenomes-Tr; EBT00001715818.
DR   EnsemblGenomes-Tr; EBT00001715819.
DR   EnsemblGenomes-Tr; EBT00001715820.
DR   EnsemblGenomes-Tr; EBT00001715821.
DR   EnsemblGenomes-Tr; EBT00001715822.
DR   EnsemblGenomes-Tr; EBT00001715823.
DR   EnsemblGenomes-Tr; EBT00001715824.
DR   EnsemblGenomes-Tr; EBT00001715825.
DR   EnsemblGenomes-Tr; EBT00001715826.
DR   EnsemblGenomes-Tr; EBT00001715827.
DR   EnsemblGenomes-Tr; EBT00001715828.
DR   EnsemblGenomes-Tr; EBT00001715829.
DR   EnsemblGenomes-Tr; EBT00001715830.
DR   EnsemblGenomes-Tr; EBT00001715831.
DR   EnsemblGenomes-Tr; EBT00001715832.
DR   EnsemblGenomes-Tr; EBT00001715833.
DR   EnsemblGenomes-Tr; EBT00001715834.
DR   EnsemblGenomes-Tr; EBT00001715835.
DR   EnsemblGenomes-Tr; EBT00001715836.
DR   EnsemblGenomes-Tr; EBT00001715837.
DR   EnsemblGenomes-Tr; EBT00001715838.
DR   EnsemblGenomes-Tr; EBT00001715839.
DR   EnsemblGenomes-Tr; EBT00001715840.
DR   EnsemblGenomes-Tr; EBT00001715841.
DR   EnsemblGenomes-Tr; EBT00001715842.
DR   EnsemblGenomes-Tr; EBT00001715843.
DR   EnsemblGenomes-Tr; EBT00001715844.
DR   EnsemblGenomes-Tr; EBT00001715845.
DR   EnsemblGenomes-Tr; EBT00001715846.
DR   EnsemblGenomes-Tr; EBT00001715847.
DR   EnsemblGenomes-Tr; EBT00001715848.
DR   EnsemblGenomes-Tr; EBT00001715849.
DR   EnsemblGenomes-Tr; EBT00001715850.
DR   EnsemblGenomes-Tr; EBT00001715851.
DR   EnsemblGenomes-Tr; EBT00001715852.
DR   EnsemblGenomes-Tr; EBT00001715853.
DR   EnsemblGenomes-Tr; EBT00001715854.
DR   EnsemblGenomes-Tr; EBT00001715855.
DR   EnsemblGenomes-Tr; EBT00001715856.
DR   EnsemblGenomes-Tr; Glov_R0001-1.
DR   EnsemblGenomes-Tr; Glov_R0002-1.
DR   EnsemblGenomes-Tr; Glov_R0003-1.
DR   EnsemblGenomes-Tr; Glov_R0004-1.
DR   EnsemblGenomes-Tr; Glov_R0005-1.
DR   EnsemblGenomes-Tr; Glov_R0006-1.
DR   EnsemblGenomes-Tr; Glov_R0007-1.
DR   EnsemblGenomes-Tr; Glov_R0008-1.
DR   EnsemblGenomes-Tr; Glov_R0009-1.
DR   EnsemblGenomes-Tr; Glov_R0010-1.
DR   EnsemblGenomes-Tr; Glov_R0011-1.
DR   EnsemblGenomes-Tr; Glov_R0012-1.
DR   EnsemblGenomes-Tr; Glov_R0013-1.
DR   EnsemblGenomes-Tr; Glov_R0014-1.
DR   EnsemblGenomes-Tr; Glov_R0015-1.
DR   EnsemblGenomes-Tr; Glov_R0016-1.
DR   EnsemblGenomes-Tr; Glov_R0017-1.
DR   EnsemblGenomes-Tr; Glov_R0018-1.
DR   EnsemblGenomes-Tr; Glov_R0019-1.
DR   EnsemblGenomes-Tr; Glov_R0020-1.
DR   EnsemblGenomes-Tr; Glov_R0021-1.
DR   EnsemblGenomes-Tr; Glov_R0022-1.
DR   EnsemblGenomes-Tr; Glov_R0023-1.
DR   EnsemblGenomes-Tr; Glov_R0024-1.
DR   EnsemblGenomes-Tr; Glov_R0025-1.
DR   EnsemblGenomes-Tr; Glov_R0026-1.
DR   EnsemblGenomes-Tr; Glov_R0027-1.
DR   EnsemblGenomes-Tr; Glov_R0028-1.
DR   EnsemblGenomes-Tr; Glov_R0029-1.
DR   EnsemblGenomes-Tr; Glov_R0030-1.
DR   EnsemblGenomes-Tr; Glov_R0031-1.
DR   EnsemblGenomes-Tr; Glov_R0032-1.
DR   EnsemblGenomes-Tr; Glov_R0033-1.
DR   EnsemblGenomes-Tr; Glov_R0034-1.
DR   EnsemblGenomes-Tr; Glov_R0035-1.
DR   EnsemblGenomes-Tr; Glov_R0036-1.
DR   EnsemblGenomes-Tr; Glov_R0037-1.
DR   EnsemblGenomes-Tr; Glov_R0038-1.
DR   EnsemblGenomes-Tr; Glov_R0039-1.
DR   EnsemblGenomes-Tr; Glov_R0040-1.
DR   EnsemblGenomes-Tr; Glov_R0041-1.
DR   EnsemblGenomes-Tr; Glov_R0042-1.
DR   EnsemblGenomes-Tr; Glov_R0044-1.
DR   EnsemblGenomes-Tr; Glov_R0045-1.
DR   EnsemblGenomes-Tr; Glov_R0046-1.
DR   EnsemblGenomes-Tr; Glov_R0047-1.
DR   EnsemblGenomes-Tr; Glov_R0048-1.
DR   EnsemblGenomes-Tr; Glov_R0049-1.
DR   EnsemblGenomes-Tr; Glov_R0050-1.
DR   EnsemblGenomes-Tr; Glov_R0051-1.
DR   EnsemblGenomes-Tr; Glov_R0052-1.
DR   EnsemblGenomes-Tr; Glov_R0053-1.
DR   EnsemblGenomes-Tr; Glov_R0054-1.
DR   EuropePMC; PMC2798628; 19897758.
DR   EuropePMC; PMC3403914; 22616984.
DR   EuropePMC; PMC3426716; 22773645.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF01051; c-di-GMP-I.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01733; atoC.
DR   RFAM; RF01749; pan.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP001089.
DR   SILVA-SSU; CP001089.
DR   StrainInfo; 692482; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4002885
CC   Source DNA and bacteria available from Frank Loeffler
CC   (ce.gatech.edu)
CC   Contacts: Frank Loeffler (ce.gatech.edu)
CC             David Bruce (microbe@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3917761
FT                   /organism="Geobacter lovleyi SZ"
FT                   /strain="SZ"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:398767"
FT   gene            261..1640
FT                   /locus_tag="Glov_0001"
FT   CDS_pept        261..1640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0001"
FT                   /product="Chromosomal replication initiator DnaA"
FT                   /note="PFAM: Chromosomal replication initiator DnaA domain;
FT                   Chromosomal replication initiator DnaA; SMART: AAA ATPase;
FT                   KEGG: ppd:Ppro_0001 chromosomal replication initiator
FT                   protein DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93740"
FT                   /db_xref="GOA:B3E8N7"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:B3E8N7"
FT                   /protein_id="ACD93740.1"
FT                   /translation="MPSSKINAMHAVWNQTATNLEKVISPQNYTNWIQPIQFSHADNHS
FT                   LYLIVPNQFFKEWLEDNYVDLINSALSVTADKNMLVTFLIREKEADNAPLEIMEAPQPK
FT                   ESSTLKDLDQAKETTPLNPLNPRYTFDQFVSGAGNQFAHAAAMAVSHNPAITYNPLFIY
FT                   GGVGLGKSHLLNAVGHKIISDNSSTKICYCSAEKFMHEMVNCIKLNKMDEFRERFRSID
FT                   VLLIDDIQFITGKERTQVEFFHTFNALYESHKQIVITSDKFPREMPNLEDRLRSRFEWG
FT                   LIADIQPPDLETKIAILKKKADTNRILLPDDVAYFLASSDTRNIRELEGMLIRLGAYSS
FT                   LQHIPITLTMAQNNLKDILVNKRKEITVELIQKTVADHFGLKVADLKSEKRLKAFVLAR
FT                   QVAIWLCRDMTTASYPDIGARFGGKDHSTVIHATKKIEKLLAEDHKLSKIIDELKESIL
FT                   Q"
FT   gene            1870..2988
FT                   /locus_tag="Glov_0002"
FT   CDS_pept        1870..2988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: ppd:Ppro_0002 DNA polymerase III, beta
FT                   subunit; TIGRFAM: DNA polymerase III, beta subunit; PFAM:
FT                   DNA polymerase III beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93741"
FT                   /db_xref="GOA:B3E8N8"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:B3E8N8"
FT                   /protein_id="ACD93741.1"
FT                   /translation="MNFKIDRDTFLKALQKVQGIVEKRTSMPILSNILIEAQGDNLEII
FT                   ATDLEVGLKGNYPAKVEKDGRITVGAKKLYEIVKELPNQEITFSTKENDWVEITCGKVR
FT                   FNIVGLPSDEFPAVATVKDEQLLELEAALLRKMIEKTSYAICNDETKYNLNGIFTRVEQ
FT                   SEKGQCLKMVATDGHRLSIASGPFSGTANPELLKGVILPKKGIFEIKKITDEGDGLLQF
FT                   GFVDSSAVIKKGDTTLIMRLVDGEFPDYTRVIPAANEQIVKAPREELIHAVRRMAILSS
FT                   EKFKGIMLEIEGNAVKISSSNPELGDAMEELDVSYDGNPFSVRFNARYLLDVLMVCESQ
FT                   HVLMKFKNELSPSIVTPDSDDELLAVIMPMRL"
FT   gene            2996..4102
FT                   /locus_tag="Glov_0003"
FT   CDS_pept        2996..4102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0003"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="TIGRFAM: DNA replication and repair protein RecF;
FT                   PFAM: SMC domain protein; KEGG: ppd:Ppro_0003 DNA
FT                   replication and repair protein RecF"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93742"
FT                   /db_xref="GOA:B3E8N9"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3E8N9"
FT                   /protein_id="ACD93742.1"
FT                   /translation="MFLKQVWLEQYRNIQKACIQPARHLTVLYGRNGQGKTNFLESLYL
FT                   LGNARPFRAAKVPDLISHGSRSAAVRGLVLAAGVESTIVLHVENSTRRVTIDDKAVHRA
FT                   ADLHGKLAVVVFSPDDTAMVKLGPETRRRYLDRSLYASDAAFLSDYHTYYRILKQRNAL
FT                   LKTNQQAGLDLWTEQLATAGIRLMQHRQHYTSRLNQLLQQKYQQIAGEQEKVSVVYQPD
FT                   VICTAEENGTELLLNVFRNQHEQDLRYKSTGRGPHRDDLLFSIGDRPLKSFGSQGQQRS
FT                   FVLALKMAELDHLQETFGEMPLLLLDDIASELDRERMTNLLSYVRQREVQVLITTTDVT
FT                   PFLPVLQQDSKLFRVEEGRLTYEGNGTP"
FT   gene            4099..6507
FT                   /locus_tag="Glov_0004"
FT   CDS_pept        4099..6507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0004"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="KEGG: ppd:Ppro_0004 DNA gyrase, B subunit; TIGRFAM:
FT                   DNA gyrase, B subunit; PFAM: DNA gyrase subunit B domain
FT                   protein; ATP-binding region ATPase domain protein; TOPRIM
FT                   domain protein; DNA topoisomerase type IIA subunit B region
FT                   2 domain protein; SMART: DNA topoisomerase II"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93743"
FT                   /db_xref="GOA:B3E8P0"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B3E8P0"
FT                   /protein_id="ACD93743.1"
FT                   /translation="MSEFEQNGTAASNEYGAGSIKVLEGLSAVRKRPAMYIGSTASAGL
FT                   HHLVYEIVDNSIDEALAGHCNDVSVTINTDGSITVVDNGRGIPTDMHPTEGRSAAEVVL
FT                   TVLHAGGKFDNDSYKVSGGLHGVGVSVVNALSKWLDLEIRRDGKIWRQTYHRGEPQSPL
FT                   EVTGTTRRRGTKITFMPDEEIFETTEYSFDVLSQRLRELAFLNAGVRIKINDERADGKS
FT                   HDFFYEGGINSFVEYLNRAKTPLHQKPIYFKGEKGGVEMEVSMQYNDTYDEKIFSFANN
FT                   INTHEGGTHLAGFKAALTRTMNTYAAGNNLTKNAKVAISGDDLREGMTCVISVKIPQPQ
FT                   FEGQTKTKLGNSEVKGYVESLLNEKLAVYLEENPQVAKRILEKSIEAARAREAARKARD
FT                   LTRRKGALDLGGLPGKLADCQEKDPALCELYLVEGDSAGGSAKQGRDRRFQAILPLKGK
FT                   ILNVEKARFDKMLSSQEIRTLITAMGTGIGKDDFDIAKLRYGRIIVMTDADVDGSHILT
FT                   LLLTFFYRNMQELIERGHLYIAQPPLYKVKRGKKELYLRNEAALQTFLLEEGAEELILS
FT                   MEKGDRSYIGKQIIPVIRQLIEWRALFEKVVKKGIPADLLDLLIRAGVRPGIEEVAGLE
FT                   SYLNTMQGLIDDCDYQYQAEDERVTFRIGNMRSVIDNQTLGVLASHEYELLVESNRKVA
FT                   ELMAGGLARLEENGKGLLETSRHEELLSYFLDYAKKGLAIQRYKGLGEMNPDQLWETTM
FT                   NPENRILLQVKIEDVVEADQIFTVLMGDQVEPRREFIELNALNVVNLDV"
FT   gene            6869..7249
FT                   /locus_tag="Glov_0005"
FT   CDS_pept        6869..7249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0005"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mms:mma_3033 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93744"
FT                   /db_xref="GOA:B3E8P1"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="InterPro:IPR014833"
FT                   /db_xref="UniProtKB/TrEMBL:B3E8P1"
FT                   /protein_id="ACD93744.1"
FT                   /translation="MNTNPESGVLQHGRSRKVVKRSNCGHPVKFASQKCGRSVHLESPL
FT                   EYDLAIQLEFDPSVILFQEQPLALKIEYNGKIRTVYPDLAVYKDDGSTLIIEVKDAKKA
FT                   SQQEVIEKFELERQVLVSLAGR"
FT   gene            complement(7397..8479)
FT                   /locus_tag="Glov_0006"
FT   CDS_pept        complement(7397..8479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0006"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   gsu:GSU2597 ISGsu2, transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93745"
FT                   /db_xref="GOA:B3E2B5"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:B3E2B5"
FT                   /protein_id="ACD93745.1"
FT                   /translation="MRGTDVQNEALFAYVTPESFVPKDHPLRAIRSMADQALSEMSPLF
FT                   DSMYADSGRSSIAPEKLLKAQLLMILFSIRSNRQLVEQIRYNFLYRWFLGMGLDDEIWD
FT                   HSSFTKNHERLIGSDVAAEFLSRILAQAERKRLLSREHFTVDGTLIEAWASIKSFKPKD
FT                   GPPSAGGGKNKSVDFKGKQLKNDTHSSSTDPNARLYRKGNTKEAKLCYQGHTLMENRNG
FT                   LIVKTSVTTATGTGEREAAKAMIRQLPRTTRRITVGADKGYDTEGFVKELRQINVTPHV
FT                   AQNNTRRKSGIDGRTTAHPNYSISQRIRKRIEEGFGWMKTIGRLRKTMYRGIEKIAWQL
FT                   DLHAAAYNLVRMKNLGLGVT"
FT   gene            complement(8837..9946)
FT                   /locus_tag="Glov_0007"
FT   CDS_pept        complement(8837..9946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0007"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="PFAM: transposase IS111A/IS1328/IS1533; transposase
FT                   IS116/IS110/IS902 family protein; KEGG: gme:Gmet_2794
FT                   IS111A/IS1328/IS1533/IS116/IS110/IS902 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93746"
FT                   /db_xref="GOA:B3E8P3"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:B3E8P3"
FT                   /protein_id="ACD93746.1"
FT                   /translation="MEKSITYVGLDVHKNSIDVALAAEGRDKEVRYYGTIDGSLDALDK
FT                   VLRKLVSRGTELRFVYEAGPCGYDIYRHLTRKGFDCIVVAPSLIPKKSGSRIKNDRRDA
FT                   EMLARLHRAGELTPVYVPRIEDEAMRDLCRARIDAKNAERKARQQLNAFLLRSGFRYSG
FT                   KTLWSLAHWRWISDIHMTHSAQQITLQEYVDAVRSNTERVDRITEQICLLAAEWRLGPV
FT                   VEALQALRGVSLVVASTTVAELGDLSRFDNPRHLMAYLGLVPSEHSSGESTQRGGITKT
FT                   GNGHARRMLVEAAWSYRLPARVSRRLRDRQQNLPQAVWEIAWKAQLRLCARYKRLVTKG
FT                   KQAQVVITAIARELSAFMWAIAQAVPVAS"
FT   gene            10298..10477
FT                   /pseudo
FT                   /locus_tag="Glov_0008"
FT   gene            complement(10814..11815)
FT                   /locus_tag="Glov_0009"
FT   CDS_pept        complement(10814..11815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0009"
FT                   /product="cell division protein FtsZ"
FT                   /note="TIGRFAM: cell division protein FtsZ; PFAM:
FT                   Tubulin/FtsZ GTPase; Tubulin/FtsZ domain protein; KEGG:
FT                   pca:Pcar_2196 cell division protein FtsZ"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93747"
FT                   /db_xref="GOA:B3E8P4"
FT                   /db_xref="InterPro:IPR000158"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR018316"
FT                   /db_xref="InterPro:IPR024757"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="InterPro:IPR037103"
FT                   /db_xref="UniProtKB/TrEMBL:B3E8P4"
FT                   /protein_id="ACD93747.1"
FT                   /translation="MDYREQAIEAPTIKVVGIGGAGLNAVNAMLAAGLTDVEYIAVSTS
FT                   QARLRKSHAAVKIRIGSDTRGFGTGGNPETARAAVEVSQQDILNSLTGADLVFLAAGMG
FT                   SGTGTGATPEIAKLAKEAGALVVAVVTKPFAREGKRRTDIAEQGIKMLLSLVDSLIVIP
FT                   NDRLIGISGKGTALLEAFKPADDLLRQAVQGIVEIISKHGHINVDLSDLRTILGARGMA
FT                   MMGTGISSGSDRATAASMMAIHNPLLEGLDIREAKGLLLNIAGSSSMTMDEFDQVCKMM
FT                   TEQISSDATIIVGVVVDEELADQIKVTVIATGIGSTPAADKPILRLAKGRLM"
FT   gene            complement(11831..12718)
FT                   /locus_tag="Glov_0010"
FT   CDS_pept        complement(11831..12718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93748"
FT                   /db_xref="UniProtKB/TrEMBL:B3E8P5"
FT                   /protein_id="ACD93748.1"
FT                   /translation="MDRRTFLTTMLQGSLASVALPNRLASLLAPPHATFHQAPTNYQQN
FT                   LHISAIGIGTFGSSCTHLLTNSARKLHCYQLDFTQQHYGAADILRVVTAYPQTDLLFVF
FT                   ADTRQKRSANILKASLESASASGIQTVVIGPSQSTHWLLHTLAESNALYCTESDPIAAS
FT                   SLVTTLYDFANYGNLDGVVAADVNGYVKAILQKGNWSVFASSYATGPTRGSLASQSVLA
FT                   LLEQQVSDSDIYSGAIACIYCNSATYFNDFDQATIELFRFFLPNSTNKFNIIYNYVIDD
FT                   SLYDSARVAVLAII"
FT   gene            complement(12879..13751)
FT                   /locus_tag="Glov_0011"
FT   CDS_pept        complement(12879..13751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0011"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bmn:BMA10247_3238 cell division protein FtsZ"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93749"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="UniProtKB/TrEMBL:B3E8P6"
FT                   /protein_id="ACD93749.1"
FT                   /translation="MDRRTFLTTMLQGTTLAATLLPHSISPLLIKQYASLRHLGGDSYQ
FT                   NVRISTLGINSLGAVFSRLLAYSIQNVCCYEVLSDQLRSGNLDFSSLNRTIQQTDLLFL
FT                   FADTTDPASDSLLSSCINTTAAAGVQSVVVGPYSTDRPLSALPLTCSTPPHCFVVHHTT
FT                   ARDLVALVADLANTDSFVGIDHGDIKAILRSGNLGLFSCSEATGADRGSRACSQALERL
FT                   QQQGVNSANCRGAMACIYGSPTMPFDYYAQAVSVMDGYFSNDISFVFGAIPDEHLAADT
FT                   IKVAILAMR"
FT   gene            13873..15354
FT                   /locus_tag="Glov_0012"
FT   CDS_pept        13873..15354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0012"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mgm:Mmc1_3050 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93750"
FT                   /db_xref="InterPro:IPR021301"
FT                   /db_xref="InterPro:IPR022765"
FT                   /db_xref="UniProtKB/TrEMBL:B3E8P7"
FT                   /protein_id="ACD93750.1"
FT                   /translation="MKKSAIPGLSKSRYLNGLQCPKYLWLATWRKELRNEFDETTEEIL
FT                   AQGHQVGDIAQELFPGGVEIPYDGLSIDEQLQQTQNVLKQSKVIYEASFEYNGVFVKAD
FT                   ILRKGRGGWELYEVKSSSKLKDTYYDDLAVQYHVITNAGIKITKAHLIHINTSYQRKGK
FT                   LDPHQLFTIVDLTEGVLEMQPAVKKQIATLKKMLAGAEPIVQIGPHCEDPYECAFSEHC
FT                   WQDVPDEGSVFDLAGNGADCFKLYHEGITKLKDIPLDRVKGKQRQQVEAAKKKQTIVNK
FT                   EGLQEFMDSLWYPLCYLDFETFMEAVPSYDGQRPYQQMPFQFSLHIQKKPGGKVYHHEY
FT                   LAPPAIDPRKEFLDELLKVLPDDGCIMVYYKPFEQSRLKELAELYPRKKKQIQQLIDNM
FT                   VDLLDPFKARHLYSWKQQGSHSIKAVLPAFVKDLSYDELEISNGSAAMQAYHSMCASVE
FT                   SPRKLATLRKQLLAYCKQDTLAMVRLLEVISERAR"
FT   gene            15388..16017
FT                   /locus_tag="Glov_0013"
FT   CDS_pept        15388..16017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0013"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93751"
FT                   /db_xref="UniProtKB/TrEMBL:B3E8P8"
FT                   /protein_id="ACD93751.1"
FT                   /translation="MGTTVIIEEKAFLGVLLAAVEAFPGRFYGERKPKGATAEGEVHGL
FT                   LFGQRIQRNDGDVVFNVTLTVPNQIVLERTHDGISVAAKHINKIREAIELFPAYSLLGF
FT                   FHSHPYPADEFKKCSSVEPSETDRDSAISSAEQEEEEMLDLIFSITRLKRPTWILPQFP
FT                   KPYLIHASCGVYKYTLACYSAVTSEHEESYGAVDNLICTTAAGLQA"
FT   gene            16041..16379
FT                   /locus_tag="Glov_0014"
FT   CDS_pept        16041..16379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0014"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93752"
FT                   /db_xref="UniProtKB/TrEMBL:B3E8P9"
FT                   /protein_id="ACD93752.1"
FT                   /translation="MRTVEPIFKVKTGDYKKMEETLKRTIGQYIRHSKECKIGITNDPY
FT                   VRWNSYISANTRYNEMIVFYKTSSYSYICEVEKYLIDHAKDYVDNQRGGGAGIKDCHND
FT                   YFAYIVRL"
FT   gene            16415..16651
FT                   /locus_tag="Glov_0015"
FT   CDS_pept        16415..16651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0015"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93753"
FT                   /db_xref="UniProtKB/TrEMBL:B3E8Q0"
FT                   /protein_id="ACD93753.1"
FT                   /translation="MAHEVSINLHTKVVAHKDLEIEIKTISDKKTTKLGTLLISKGNLE
FT                   WLPAGCSVNKKQMTWTKFAELMEINGKSSKAKQ"
FT   gene            16986..18500
FT                   /locus_tag="Glov_0016"
FT   CDS_pept        16986..18500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0016"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG:
FT                   gur:Gura_2875 integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93754"
FT                   /db_xref="GOA:B3E289"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:B3E289"
FT                   /protein_id="ACD93754.1"
FT                   /translation="MLLVESIRKIRQAYHRDKKPIRQIAREFHLSKNTVKKIIRSDVTD
FT                   QVYTRTEQPRPKLAAFEERLKGLLSEDAVKPVRHRRSAQLLFETLQREGFEGGYDSVRR
FT                   YIQQQRKETGGGVAAAFIPLSFDPGEAFQFDWSYEQIELGGIIVKVKIAQFRLCNSRMP
FT                   FCVAYTRESLEMVLDAHIKAFSFFGGACRRGIYDNLKTVVTKVLMGKDRVFNRRFLSLA
FT                   SHYLFEPIACTPAAGWEKGQVENQVGLVRKRFFAKRRTFTNLSELNQWLQEQCLDYAAT
FT                   QKHPDNPLLTINDLFKEERRQLLTVTVPFDGYLESDAKVSSTSLVSFDRNRYSVHVSAV
FT                   GNPVTVRAYADRLTFVQSGRTVGFHKRHFGRDQVFYDPWHYLEALKKKPGALRNGAPFK
FT                   EWNLPESIEQIRSALAKHRDGDRQFVGILAVVSYYGIEAVTQACTDALAANTISRDVVL
FT                   NLLSRNDEEPTPTADPAAKLPVLIIPPVADCRRYDLLLAGGACATA"
FT   gene            18487..19224
FT                   /locus_tag="Glov_0017"
FT   CDS_pept        18487..19224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0017"
FT                   /product="IstB domain protein ATP-binding protein"
FT                   /note="PFAM: IstB domain protein ATP-binding protein;
FT                   SMART: AAA ATPase; KEGG: gur:Gura_2874 IstB domain protein
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93755"
FT                   /db_xref="GOA:B3E288"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:B3E288"
FT                   /protein_id="ACD93755.1"
FT                   /translation="MLLREKLQKAMETLGLHGMKTACDELIATGIKQRATPEKILFELL
FT                   NAELAERRIRSIRYRLSQARFPVEKDLDHFEFTDTPINETQVRMLYEGGFLTEKSNIIL
FT                   VGGTGTGKTHLAIAIARQVIRNGKRGRYFNLLDLVNQLEQEKLSGRGGKLAEALCRLDL
FT                   VVLDELGYLPFSKAGGQLLFHLISKLYERTSLIITTNLTFGEWPQVFGDGKMTTALLDR
FT                   VTHHCEIVETGNESWRIKTRNSD"
FT   gene            complement(19659..20486)
FT                   /locus_tag="Glov_0018"
FT   CDS_pept        complement(19659..20486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0018"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG: gsu:GSU0048
FT                   integrase"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93756"
FT                   /db_xref="GOA:B3E8Q3"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:B3E8Q3"
FT                   /protein_id="ACD93756.1"
FT                   /translation="MIATGHPDVSVERRCELLGVARASYYRGPASGLRSGDLALMRRID
FT                   ELYLQHPWMGSRSLADHLTIPEEPVGRDRVRRLMLLMGIQSLSPKPGTSKRHPKHPVYP
FT                   YLLRGLTIDRPNQVWATDITYIPMARGFMYLVAIMDWGTRKVLSWRLSNTLDTRFCVEA
FT                   LKEALFKYGAPEIFNSDQGCQFTSEAFTSVLKQWNVRISMDGKGRFKDNIFIERLWRTL
FT                   KYERIYLRTYETGTELFKDLTDWFNWYNNGRKHTSLDKQTPDEAYYQRLKLAA"
FT   gene            complement(20483..20788)
FT                   /locus_tag="Glov_0019"
FT   CDS_pept        complement(20483..20788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0019"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein; KEGG:
FT                   reu:Reut_C5937 transposase IS3/IS911"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93757"
FT                   /db_xref="GOA:B3E8Q4"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="UniProtKB/TrEMBL:B3E8Q4"
FT                   /protein_id="ACD93757.1"
FT                   /translation="MQHRTRYSSEFKAKVALAALTESKTLAELASEYKVHPSQISNWKQ
FT                   ELVENASDLFGKGKKQEVNHDAEVAELHRVIGKLKAENDFLSNLPGLSLTGRRNRK"
FT   gene            complement(20816..21214)
FT                   /locus_tag="Glov_0020"
FT   CDS_pept        complement(20816..21214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93758"
FT                   /db_xref="UniProtKB/TrEMBL:B3E8Q5"
FT                   /protein_id="ACD93758.1"
FT                   /translation="MSLSFLSHSAANSLTCCKRPGENVKYTPLFGVWLIDIILYFGWHR
FT                   PSHPRRWPDIFEDSDFCAMTALDTDHEEQPERVTAGHCMKLLVRQRQKLAKKKLSDSLP
FT                   FFRNIKLLTGMLNLTVKWLRFLRHEYKQ"
FT   gene            complement(21281..22549)
FT                   /locus_tag="Glov_0021"
FT   CDS_pept        complement(21281..22549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0021"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein;
FT                   RNA-metabolising metallo-beta-lactamase; KEGG: dvu:DVU1700
FT                   metallo-beta-lactamase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93759"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR011108"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:B3E8Q6"
FT                   /protein_id="ACD93759.1"
FT                   /translation="MKFTIHRGSHEIGGTCIRISTETISILLDAGLPLAANSQPLTEAD
FT                   LAADALIISHSHQDHCGLLDTIPSSMPVYIGKVAKGLLNATRLFLGHPLLANDFRTIDA
FT                   WLPFSVGDITITPYLMDHSATDAYGFIVEAEGKRLFYTGDFRGHGRKSVLFEKLLNKPP
FT                   QNIDLMLMEGTMLQRDNSSFSDEKSVETEIANILRKQRNISFLISSSQNIDRIVSAYRA
FT                   CKFTGKTLVLDIYSAWVLEQVRQVSQGTPTIDWDSIGVVFDKRKSSVLFDPANRGMFGD
FT                   FINQAVSNRIKGGELRTHPAKYLMLLKVSSASLIFKFACEEEPTTVIYSQWQGYLAPKP
FT                   EEAIHTQVMRSIKDEVRPGVRYVYAHTSGHAPVEDLQRLVKAVKPRQLVPVHTEFPADY
FT                   EFYFGNCLMVNDGTEYDLGSNNL"
FT   gene            complement(22581..23522)
FT                   /locus_tag="Glov_0022"
FT   CDS_pept        complement(22581..23522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0022"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93760"
FT                   /db_xref="UniProtKB/TrEMBL:B3E8Q7"
FT                   /protein_id="ACD93760.1"
FT                   /translation="MDDTTTNLSKEPPVKPKIRGIQFDRVSPKHQEQLRVIVEAVKNDP
FT                   DLDLDLQIRDGYVNIYYKGGSLLKISSFRGRQINFSFDPNYYKRKGKDEWEVDAAWLKE
FT                   IPRDASSWVKCFPKLKNVMNDWFKDGNNKTERELQHKLASESTRNPSSHWIILDIEYAV
FT                   WLHGERSRDKRTAGRRLCRFDMIALERTELHAAGPLTVYLIEFKQGLGAVDGKAGVAEH
FT                   AEDLKQFISGGNDKDARRAFKESVRNILREKIELGLLPGVAAPQENVDIEFKALFLVQG
FT                   VENLQKVADLENAANKVLGEYGASPLFRNSLN"
FT   gene            complement(23532..25043)
FT                   /locus_tag="Glov_0023"
FT   CDS_pept        complement(23532..25043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0023"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93761"
FT                   /db_xref="UniProtKB/TrEMBL:B3E8Q8"
FT                   /protein_id="ACD93761.1"
FT                   /translation="MEYSDVVIKQTKIAWEFLEQARPLITYTKLVPVSEEQISQYEQKQ
FT                   NKIVPPDYRYWLTLHGSGLIEFLEGTLEIVSIFELMECDGRTVSSDDPQDSWKRIYIGY
FT                   PGAPITTALDSTIIDENGCAPVIITEEYGNKVDKVLASSWPMYVVRSVIEIASSLKGNT
FT                   KVGTFTDEQVKAIEELSCQDIFLLDDSMRKAIERAEAHNHTCCAEMDDKNSNSEMLNSM
FT                   LDFFDECLEAKKSRKLIPRLLSRLNTVFSKDDAFTETVTQLEVQIEKGYASLNDDLFFH
FT                   NKVEPHHAKKLKVLLGHPRRQLRKLAEEGWLRINPGEAEKQAERAWDWLTCAENWMIVD
FT                   KSGRESIRCLREAEKRAEDFTAWSACVDFWKDKIKDKDEARRCLLIAEEHVEHTNLGAV
FT                   INLIQLAKCWIEFNERERARNVLLRSDAIPDAADGEMIWLAQIWREDFNDIESAKKCLK
FT                   RAELLAAHEPYSLDRILEEWKAIGDQDEVKRFTAANSRYLADCEL"
FT   gene            complement(25100..26092)
FT                   /locus_tag="Glov_0024"
FT   CDS_pept        complement(25100..26092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0024"
FT                   /product="transcriptional regulator-like protein"
FT                   /note="KEGG: aeh:Mlg_1474 transcriptional regulator-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93762"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="UniProtKB/TrEMBL:B3E8Q9"
FT                   /protein_id="ACD93762.1"
FT                   /translation="MSTLYRHWLILRMIPRRGTGISTVEICSRLKHEDGIETTLRTIQR
FT                   DLIELEALFPIASDGRKPSGWKWTDDAANFDMPNMDPVTALTFTLASQYLEKMFPKGIL
FT                   SALIPYQKTAEQRLKSAVDPKLAAWPNKVRVLSRSLTTIPPTISEEITEKAYTALLEEQ
FT                   RFKATYTTVSGKSKTYEEVNPLGMTFVDGLTYLIASINQHVEPILLLLHRFQTIDLLDK
FT                   PVTVPEDFDLDAWVQELLTFPVGSSIRLKVRFSHKVDMQRLEESPLAANQKIHATADGH
FT                   ELTATVEDTLQLRWWLNGFGSRVEVLAPASLRQEYVELADAYAKMYRPG"
FT   gene            complement(26238..26609)
FT                   /locus_tag="Glov_0025"
FT   CDS_pept        complement(26238..26609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0025"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ppd:Ppro_2295 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93763"
FT                   /db_xref="UniProtKB/TrEMBL:B3E8R0"
FT                   /protein_id="ACD93763.1"
FT                   /translation="MARTAQETAQVLSEIYDESFANDSYEQFQLGWPELRSIAGVPKLT
FT                   PSYLNQIGSHLRDMEMLLVVCDSFLLVARQQDLSHARSVPARLVEQHLPDFEDDEDLEI
FT                   DEDELDDSGDDHQEDDDSF"
FT   gene            complement(26716..27672)
FT                   /locus_tag="Glov_0026"
FT   CDS_pept        complement(26716..27672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0026"
FT                   /product="DnaB domain protein"
FT                   /note="helicase domain protein; PFAM: DnaB domain protein
FT                   helicase domain protein; KEGG: ppd:Ppro_0534 replicative
FT                   DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93764"
FT                   /db_xref="GOA:B3E998"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3E998"
FT                   /protein_id="ACD93764.1"
FT                   /translation="MQSFENQSAQNSLCKPVYRYSGQPIYAVHEFIDESLKMVQQSHEH
FT                   AGAITGYPTGFLDLDHMLCGLQPGTLTVIASRPSNGKSSLAMNIAMNVGLKHTIPTAIF
FT                   SLELSKEQLGIRLLSAVAHVDICRARTGHLSESDLCKLDDAKETLRKSAIYVDDTSGIS
FT                   ITELLAKAIRLKVDHNVQVIIIDYLQLMRDDARSALDPTEISRISSSLKVLARELGVAV
FT                   ILLSQLHSSVGRRKAKKTRPKLSDLGNTGSLEDDADVILLIYRESVYCKACRRRDGSCV
FT                   HNHEDLAEIIVAKHKNGPIGTVFVNFHADTLCFSNLC"
FT   gene            28298..30844
FT                   /locus_tag="Glov_0027"
FT   CDS_pept        28298..30844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0027"
FT                   /product="DNA gyrase, A subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="KEGG: ppd:Ppro_0005 DNA gyrase, A subunit; TIGRFAM:
FT                   DNA gyrase, A subunit; PFAM: DNA gyrase/topoisomerase IV
FT                   subunit A; DNA gyrase repeat beta-propeller"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93765"
FT                   /db_xref="GOA:B3E999"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:B3E999"
FT                   /protein_id="ACD93765.1"
FT                   /translation="MQEQVTQKVAVNIEDEMKRSYMDYAMSVIVGRALPDVRDGLKPVH
FT                   RRCLYAMNDMGNDYNKPYKKSARVVGDVIGKYHPHGDTAVYDTIVRMAQDFSLRYLLVD
FT                   GQGNFGSVDGDSPAAMRYTEIRMKQLTHELLADLEKETVPFTPNYDESLYEPAVLPAKF
FT                   PNLLVNGSSGIAVGMATNIPPHNLGEIIDAIIALIHNPALSYEELLELVPGPDFPTGGT
FT                   IYGRQGIIDGYATGRGVIQIRAKAHVENSKKHDRESIVVTEIPYQVNKARLITSIAELV
FT                   KEKKIEGISDLRDESDRDGMRIVIDLKKDENAEVLLNQLYKHTQMQTSFGINMLAIVHN
FT                   RPKLMSLAEMMHYFIEHRREMVTKRTLFELKKAEARAHILEGLKIALDWLDAVIELIRE
FT                   SKTPPEAKLGLMEGRFADPDYLQRLNLPRPAGYEKAVQLSEIQAQAILEMRLQRLTGLE
FT                   RDKIIAEYEDILRLIARLKEILGSDAEIMKIIVGELTEIKERFGDKRRTEIVHQTADIS
FT                   LEDTIEDAEMVVTVSHTGYIKRSAVDLYRAQRRGGKGKTGMKTREEDFVEQLFIASTKD
FT                   FLLFFSDMGRVYRIKVYEIPEGSRTTKGKAVVNLVNVQEGEKITAILPVKDLNREDLYL
FT                   LMATRNGVVKKTPLVEYLNIRTTGINAVNLDEGDKLISVALTDGQKDVFLASRHGKAIR
FT                   FPESDARPMGRVTRGVRGMNLEARDEVIGMEVVDPTATGSTIFTLTENGFGKRTDLDEY
FT                   RGQSRGGKGLITIKTTTRNGLVVGVMQVNDENQLMVITDQGKILRVPVAGFSVIGRNTQ
FT                   GVRVMVTEEQEKIVAVAKLAERDDEDGIEPEGEEEV"
FT   gene            30849..32444
FT                   /locus_tag="Glov_0028"
FT   CDS_pept        30849..32444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0028"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ppd:Ppro_0006 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93766"
FT                   /db_xref="UniProtKB/TrEMBL:B3E9A0"
FT                   /protein_id="ACD93766.1"
FT                   /translation="MELNAVSRLRTLDTSYRERRRIVRLLDFLTRDELTRDQLERIGRR
FT                   LQKSGRRALPPLVRRLWQEQDHERIYRYTCMLDFFDATIWLDQLVALTLKRRDLADEGR
FT                   LPLLEILQDYGIDVSSPPFSRDEVTGATLNSFLDLCLQEGSWGMVRLMDRFLNADEMLR
FT                   DQLIRRLGSRADQGAAAAACLRMLACFEYREVADLAVESLGTLRHGCALQVLQSLHDLP
FT                   VEGLEERISRSIRRLGFLGIRESEPLPDLFAEPAALLMAQATPLDCYGVRTLWFSWELC
FT                   DTTLAGIVLQLGDQDGVRHAVASRFQNRREHDDYLDEINAEEGLYPVGYAYAVNVLKDA
FT                   LQQSIERSFYLPPDLYAWRYLFGETDLRPADYVPGFPVELLDGLLDRMASLLAGCEELL
FT                   DEPFFEGWLFTDPLIYELAEGCGTTPLGSCSPDTQQLVIERFCTELIEPDKPALLRRLL
FT                   LSADFMQQTDCRKQSIQQVLALGLSLAGSQLPLSRHPFIRRLGFDSIEMARQAMVEGFD
FT                   PRAKQAYDDDEEWE"
FT   gene            32441..33442
FT                   /locus_tag="Glov_0029"
FT   CDS_pept        32441..33442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0029"
FT                   /product="Glycerol-3-phosphate dehydrogenase (NAD(P)(+))"
FT                   /EC_number="1.1.1.94"
FT                   /note="PFAM: NADP oxidoreductase coenzyme F420-dependent;
FT                   NAD-dependent glycerol-3-phosphate dehydrogenase domain
FT                   protein; 3-hydroxyacyl-CoA dehydrogenase NAD-binding; KEGG:
FT                   ppd:Ppro_0007 glycerol-3-phosphate dehydrogenase
FT                   (NAD(P)(+))"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93767"
FT                   /db_xref="GOA:B3E9A1"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3E9A1"
FT                   /protein_id="ACD93767.1"
FT                   /translation="MKIGVIGAGSWGTALANVVAANGHDTTLWAYEPELVTGMAATRVN
FT                   HLFLPGIELHPGLNYTGALAEAVSGAELVLLVTPTQVMRNLLADLAGSIAPTAILASAS
FT                   KGIELGTLCTVSQICCQVLGDAVRERFVALSGPTFAKEVALGLPSLIVAGSANDAAAHT
FT                   VQAAFSNPVFRVYTSDDAIGVELGGAVKNVIAIAAGISDGLGFGHNTRAALITRGLAEM
FT                   KRLGRAMGAQDATFAGLAGMGDLVLTCTGDLSRNRTVGVKLGQGLTLEVIMAEMRMVAE
FT                   GVKSAESVNALAQKLGVEMPITQKVYEILYGNKPARQAVLELMSRDLKPEQA"
FT   sig_peptide     32441..32512
FT                   /locus_tag="Glov_0029"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.932) with cleavage site probability 0.514 at
FT                   residue 24"
FT   gene            complement(33660..34475)
FT                   /locus_tag="Glov_0030"
FT   CDS_pept        complement(33660..34475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0030"
FT                   /product="OmpA/MotB domain protein"
FT                   /note="PFAM: OmpA/MotB domain protein; KEGG: ppd:Ppro_3470
FT                   OmpA/MotB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93768"
FT                   /db_xref="GOA:B3E9A2"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR025713"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:B3E9A2"
FT                   /protein_id="ACD93768.1"
FT                   /translation="MALKKEPEKHANHERWLVSYADFITLLFAVFVTMYAMSQTDKKKV
FT                   EEVAAAMRESFGYSTQAAAGQRGVLQSQDIKPIPAIKPEMAVIPMINKMPPAGPRQGGM
FT                   DKGRGKTKAEEKEFKEIQSAIEAYLIKHGAQNKVSIGITRRGLVVSLKEAGFFDSGSAV
FT                   IKPAGYQLLNTILEAMTQYSNPLRVEGHTDNIPISTPLFPSNWELSVSRATNVLRYLQK
FT                   NYDVEPGKLSATGYGEFRPTAENSTPEGRSKNRRVDIVLLSGDAEQGEP"
FT   gene            complement(34487..35236)
FT                   /locus_tag="Glov_0031"
FT   CDS_pept        complement(34487..35236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0031"
FT                   /product="MotA/TolQ/ExbB proton channel"
FT                   /note="PFAM: MotA/TolQ/ExbB proton channel; KEGG:
FT                   ppd:Ppro_3471 MotA/TolQ/ExbB proton channel"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93769"
FT                   /db_xref="GOA:B3E9A3"
FT                   /db_xref="InterPro:IPR000540"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="UniProtKB/TrEMBL:B3E9A3"
FT                   /protein_id="ACD93769.1"
FT                   /translation="MDLATIIGLALGFGAVFGGAVLEGVHVSALISPTSALIVLGGTFG
FT                   AVFISFPLAACINGFKDIKTAFLPPKVDPEAVVKDIIGYATKARRNGLISLEQEAQNAK
FT                   DPFIKKGISLVVDGIDPQKLRETLEAEIMAYEDHKKHSVEFFEAAGGYSPTIGIIGAVL
FT                   GLIHVMGNLSDTSKLGAGIAAAFVATIYGLMTANIICLPIGSKIKIRMKEEVLRRVMIV
FT                   EGLIAIQNGENPHFIEQKLKAFAGEEH"
FT   gene            complement(35240..35557)
FT                   /locus_tag="Glov_0032"
FT   CDS_pept        complement(35240..35557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0032"
FT                   /product="flagellar FlbD family protein"
FT                   /note="PFAM: flagellar FlbD family protein; KEGG:
FT                   ppd:Ppro_3472 flagellar FlbD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93770"
FT                   /db_xref="InterPro:IPR009384"
FT                   /db_xref="UniProtKB/TrEMBL:B3E9A4"
FT                   /protein_id="ACD93770.1"
FT                   /translation="MILVTRLDRQTMFLNPDHIVSVEETPDTVITLFNGHHILVREHCQ
FT                   VILNRIIAFRSKVLRRSGAVPNGHAYLRRQRNSRYHRTESEHFLADDTKATLHPLHRQD
FT                   T"
FT   gene            complement(35648..36745)
FT                   /locus_tag="Glov_0033"
FT   CDS_pept        complement(35648..36745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0033"
FT                   /product="cobyrinic acid a,c-diamide synthase family
FT                   protein"
FT                   /note="KEGG: ppd:Ppro_3473 cobyrinic acid a,c-diamide
FT                   synthase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93771"
FT                   /db_xref="GOA:B3E9A5"
FT                   /db_xref="InterPro:IPR010766"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028979"
FT                   /db_xref="UniProtKB/TrEMBL:B3E9A5"
FT                   /protein_id="ACD93771.1"
FT                   /translation="MCRKIFIGATGQHCGKTTISLSLMHLALQKYRRVGFMKPIGPKCI
FT                   QYRGLTMDKDAAMFSSVFGMDDVAHLMSPMTLTPGSTRQFLDGKIDPLAPRQAILKACA
FT                   ELEQQFDFLIIEGAGHGGVGSVVGVNNAQVAAMLGAPVLMVTGGGIGNVIDAVELNLAL
FT                   YAREQANVRVIMANKLVPEKRERSLAYLTKAFQHQQLLVTSAFDYSPILADPTLQHVGE
FT                   LLELPLHGDPADRSRICHTIQLGAASSQRVIDSLEESTLLIVTSSRDELIVTASSLHHI
FT                   PEFRQRLAGLIIAGHAPMSGITQRILEDSNIPYIRIEDTTSQVYYRLREHVSKIGPDDT
FT                   EKIELINSIAEKYISFDAIDAMLGS"
FT   gene            complement(36748..37260)
FT                   /locus_tag="Glov_0034"
FT   CDS_pept        complement(36748..37260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0034"
FT                   /product="type IV pilus assembly PilZ"
FT                   /note="PFAM: type IV pilus assembly PilZ; KEGG:
FT                   gur:Gura_0726 type IV pilus assembly PilZ"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93772"
FT                   /db_xref="GOA:B3E9A6"
FT                   /db_xref="InterPro:IPR009875"
FT                   /db_xref="UniProtKB/TrEMBL:B3E9A6"
FT                   /protein_id="ACD93772.1"
FT                   /translation="MVKHKERKSNLVDSPLIVNGILLCVTSPAQSKGAVFKYYGILLFY
FT                   YLSREMVPMADKRNNDRKRKRIALCFGTDEAASRRAFTEDLSPLGLFIKTANVCNPNTV
FT                   LRIELLVDDQPICFDARVMWAKRVPQNLFHLVKKSGMGVRIIRFHNGRDRYMGLCDYPA
FT                   QTVAEGH"
FT   sig_peptide     complement(37165..37260)
FT                   /locus_tag="Glov_0034"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.733) with cleavage site probability 0.716 at
FT                   residue 32"
FT   misc_binding    37261..37360
FT                   /bound_moiety="thiamin/thiaminpyrophosphate"
FT                   /note="TPP riboswitch (THI element) as predicted by Rfam
FT                   (RF00059), score 74.55"
FT   gene            37416..37616
FT                   /locus_tag="Glov_0035"
FT   CDS_pept        37416..37616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0035"
FT                   /product="thiamine biosynthesis protein ThiS"
FT                   /note="TIGRFAM: thiamine biosynthesis protein ThiS; PFAM:
FT                   thiamineS protein; KEGG: pfo:PflO1_5331 sulfur carrier
FT                   protein ThiS"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93773"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR010035"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:B3E9A7"
FT                   /protein_id="ACD93773.1"
FT                   /translation="MQVMINGEMRQLADGTTVGQLLEQLQIPATRVAVERNLEIVPKAR
FT                   YAEQTLQDGDRIEIVHFVGGG"
FT   gene            37620..38399
FT                   /locus_tag="Glov_0036"
FT   CDS_pept        37620..38399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0036"
FT                   /product="thiazole biosynthesis family protein"
FT                   /note="PFAM: thiazole biosynthesis family protein; KEGG:
FT                   gsu:GSU0588 thiazole synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93774"
FT                   /db_xref="GOA:B3E9A8"
FT                   /db_xref="InterPro:IPR008867"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033983"
FT                   /db_xref="UniProtKB/TrEMBL:B3E9A8"
FT                   /protein_id="ACD93774.1"
FT                   /translation="MSKGKLTIAGREFNSRLMVGTGKYASNEQMVAALEASGAEIITVA
FT                   VRRVNLAEMGKGCMLDYIDPKKYTLLPNTAACFTADDAIRTCRLAREAGLSDMVKLEVL
FT                   GDEKTLFPDNEELLKAAKVLVAEGFTVLPYCSDDVILCKKLEQLGCAAVMPLAAPIGSG
FT                   LGIRNPYNLKIIMEAVKVPVIVDAGVGTASDAALAMELGCDGILMNTAIAGAKDPIAMA
FT                   TAMKLGVEAGRLAYEAGRIPKKLYATASSPLTDLIGS"
FT   gene            38396..39016
FT                   /locus_tag="Glov_0037"
FT   CDS_pept        38396..39016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0037"
FT                   /product="thiamine-phosphate pyrophosphorylase"
FT                   /EC_number="2.5.1.3"
FT                   /note="KEGG: gsu:GSU0587 thiamine-phosphate
FT                   pyrophosphorylase; TIGRFAM: thiamine-phosphate
FT                   pyrophosphorylase; PFAM: thiamine monophosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93775"
FT                   /db_xref="GOA:B3E9A9"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR034291"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/TrEMBL:B3E9A9"
FT                   /protein_id="ACD93775.1"
FT                   /translation="MIDFSLYLITDRNQTGGRPLLEVVEAALSGGVRAVQLREKDLTPA
FT                   ELYDLAWEMRALTSRYDARLLINERIDIALAVEADGVHLGVNSLPVTAARRIAPDLLIG
FT                   YSSHSVGEAVAALAKGADFVTFGPVFPTPSKAAYGEPVGLGELERACRQAVGDLVFGLG
FT                   GIKRDNLAQVTAAGCYRVALISDILAAPDPAEAAGAFRRGLGC"
FT   gene            39136..40092
FT                   /locus_tag="Glov_0038"
FT   CDS_pept        39136..40092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0038"
FT                   /product="conserved hypothetical radical SAM protein"
FT                   /note="KEGG: ppd:Ppro_3477 conserved hypothetical radical
FT                   SAM protein; TIGRFAM: conserved hypothetical radical SAM
FT                   protein; PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93776"
FT                   /db_xref="GOA:B3E9B0"
FT                   /db_xref="InterPro:IPR005911"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR032432"
FT                   /db_xref="InterPro:IPR039661"
FT                   /db_xref="UniProtKB/TrEMBL:B3E9B0"
FT                   /protein_id="ACD93776.1"
FT                   /translation="MSAFSSEHIHPDLRINSYGHYLRRRFGCRVSKVNVDAGFTCPNRD
FT                   GSKGTGGCIYCNNVSFSPRDTLAEIPLEEQVTTGMAYHHRRLESDKFIVYFQKYTNTYA
FT                   SVGHLAELYQRALALPDVIGISVGTRPDCLTDEALELLTTLARDHYVCLELGLQSADDA
FT                   ILEQINRGHSLDDFITAVKRASGRGLDICAHLIYGFPGEQPEEFVKSADLLDSLSSITS
FT                   VKLHQLHAVEGTELAAMYRRGAFDPISLEQYVNTAADFLERLPSRISIQRLYGSSPLEI
FT                   RVAPQWGLKNNQMWYAVLNELKRRGSWQGCKKLAAVS"
FT   gene            40278..41126
FT                   /locus_tag="Glov_0039"
FT   CDS_pept        40278..41126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0039"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gur:Gura_3967 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93777"
FT                   /db_xref="InterPro:IPR003497"
FT                   /db_xref="UniProtKB/TrEMBL:B3E9B1"
FT                   /protein_id="ACD93777.1"
FT                   /translation="MTAQQLVKLAVFEGKQIRKTIHNDEWWFAIIDVVEVLTESSLPKR
FT                   YWSDLKKKLTSEGINEAYDKIVRLKMPAADGKKRDTDCANTEGMFRIIQSIPSPKAEPF
FT                   KRWLAQVGYERIQEIENPELAQQRMKELYEQKGYPKDWIDKRLRGIAIRQNLTDEWQER
FT                   GISSERDFSILTAEIAKATFGMTPSQHKNFKGLSRPQDNLRDHMTDLELIFTMLGEKVT
FT                   TEISQTEKPGTFEENKKVAKRGGRVAGTARLETEKELGRSVVSKQNFLPKGLAEDTEKN
FT                   A"
FT   gene            41186..42289
FT                   /locus_tag="Glov_0040"
FT   CDS_pept        41186..42289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0040"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: ppd:Ppro_3575 4Fe-4S ferredoxin, iron-sulfur
FT                   binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93778"
FT                   /db_xref="InterPro:IPR007160"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B3E9B2"
FT                   /protein_id="ACD93778.1"
FT                   /translation="MSKVFFADMRASHKENLFDKIARLLTMCGLAQRVNEGDLTAVKIH
FT                   FGEKGNSAFIRPIFARRVVDELKKLGAKPFLTDSSTLYPGERKEAVSALACGIENGFAY
FT                   AVVNAPLIISDGLRGVTETTVPVAGELLKEVYIGTEIVEADALVALSHFKCHELTGFGG
FT                   AIKNLGMGCASRKGKLVQHSTVAPVVTARHCTACGLCIKACAHDAIRIVDGVAVIDAIK
FT                   CAGCSRCITVCPTKAVAIQWNEAADLVMKKMAEYASGAVANKQGKTVYLNFITQVSPAC
FT                   DCYGHCDAPIVNDIGICASTDPVALDQACADLVNNARGNQDSALKSGHEPGGDKFRGCW
FT                   PEIPWQVQLEHAEKVGLGSRSYELVKL"
FT   gene            42391..42693
FT                   /locus_tag="Glov_0041"
FT   CDS_pept        42391..42693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0041"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93779"
FT                   /db_xref="UniProtKB/TrEMBL:B3E9B3"
FT                   /protein_id="ACD93779.1"
FT                   /translation="MTAWNHHRIRRFCCCLLLLSCLLQLVAAPACLASVDSPSCHTLLE
FT                   CDTMDENGGLVDLDEEDSFILLPPLQQIWVAHAVTPLQVPSPPSPVYRTLYTPPE"
FT   sig_peptide     42391..42492
FT                   /locus_tag="Glov_0041"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.708 at
FT                   residue 34"
FT   gene            42765..42956
FT                   /locus_tag="Glov_0042"
FT   CDS_pept        42765..42956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0042"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93780"
FT                   /db_xref="InterPro:IPR036792"
FT                   /db_xref="UniProtKB/TrEMBL:B3E9B4"
FT                   /protein_id="ACD93780.1"
FT                   /translation="MHVEHCLNPECKRKFEVIEFGHDRPAQPEPRQLVCPYCGHTVYRK
FT                   TRGAFIVHQLDRMMLRND"
FT   gene            complement(42982..45036)
FT                   /locus_tag="Glov_0043"
FT   CDS_pept        complement(42982..45036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0043"
FT                   /product="TonB-dependent receptor"
FT                   /note="PFAM: TonB-dependent receptor; KEGG: gsu:GSU2982
FT                   TonB dependent receptor, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93781"
FT                   /db_xref="GOA:B3E9B5"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:B3E9B5"
FT                   /protein_id="ACD93781.1"
FT                   /translation="MQRPPRRRKAKLLNWLVASLLTLLPAVSPAAEPPGELLPLPSDPR
FT                   EVFRRSGINSFDKGALSNIVIRGYQRENLMITFDGAPYFGATPFRSDAPPFIVNNSEVG
FT                   RITITKGPYNLAYPGGAGGSIEVLSPENPRRFSAGGSLSYGSYDALNGSAFLAVGNQQA
FT                   DFSAGYRGRSSGVPEAGGGVPLVRTPYPNPNNNYRIGTEDLPMYRLDSFWLKGGISPTS
FT                   NNRLELSYSFMQGSEIKFPTQNIDIADEQVHRLNGRLTLRNLSPLVREISLQGWWSRAR
FT                   TLLDDSLRETSDATNTALPYRAFLSRGYATSNRFEVTSTGGRLTSQLALGPGILKKGLD
FT                   VYQRDWNGSYAALLRQGAAAWQYYDNQPLLPDVMTRNLGMFWIYETPLSDTMRALISAR
FT                   GDFSRVDANGLTPDRIRTLYQPYYPGQGIPAGRDFADWSANAQLFWKIRPDLELFLKGG
FT                   RAVRIPDASELYMGQTRQGSNVVSNPFLQQTVVNQIDTGVSWARGGQQVEATFFYGEAT
FT                   NFILPVKRLSSSLPQARSTTNLNAVIWGVECEGIVQLPADLKFSAMLSYSEGENRSSNR
FT                   PLAEVPPLRGRLGLAYDNRRFFASINQTLVARQNRFDATLNETSIPGYAVTDLQAGCRY
FT                   NGFTLTAKLNNLFDTRYVMPLYYQRDPLSPTARIPENGRNFTLSASYRF"
FT   sig_peptide     complement(44941..45036)
FT                   /locus_tag="Glov_0043"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 32"
FT   gene            45211..46083
FT                   /locus_tag="Glov_0044"
FT   CDS_pept        45211..46083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0044"
FT                   /product="ABC-type phosphate/phosphonate transport system
FT                   periplasmic component-like protein"
FT                   /note="KEGG: mgm:Mmc1_3404 phosphonate ABC transporter,
FT                   periplasmic phosphonate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93782"
FT                   /db_xref="UniProtKB/TrEMBL:B3E9B6"
FT                   /protein_id="ACD93782.1"
FT                   /translation="MILPRISFLIVTCLLCALLTLENGPCFAAEPAKNEYVLGVFPFLP
FT                   TANLEGIFAPIAAELSRALGKPVRLRLTSSYGSFIAALKDQSFDIIHVHPFDYVQFGRP
FT                   KGYHPLVARSEDLFAQFSVKINAPITKLADLKGKRLGTPPATGAVTYLALDAVHKAGLT
FT                   PGKNLTVQHFPNHLACLQQLQIGTVDSCATSASTLKTFESQFGLPLKRIGHSLSIPHTL
FT                   FAAHTRIPAADREIIKKTLLSSSLAQVDPQLRQLFIESGDAATGSYFKAVGDRDYDSTR
FT                   RILRQLGSR"
FT   sig_peptide     45211..45297
FT                   /locus_tag="Glov_0044"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 29"
FT   gene            46083..48077
FT                   /locus_tag="Glov_0045"
FT   CDS_pept        46083..48077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0045"
FT                   /product="diguanylate cyclase/phosphodiesterase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; EAL domain protein; histidine kinase
FT                   HAMP region domain protein; KEGG: pae:PA0575 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93783"
FT                   /db_xref="GOA:B3E9B7"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:B3E9B7"
FT                   /protein_id="ACD93783.1"
FT                   /translation="MTISLKYRIALVVFVLQVAIFSPLLWFTFTAYRDADLQQLQTRED
FT                   VFMRLVSQLGRKALLTAEPTDFQLFIAPFSKDSHINRIILLNQSGIVVASTAPVDLGGP
FT                   LPVQKNERNTVWKTSEIANATEQLGAITVHFSRAELDKKVEALVKRGIPIAVAGIILSA
FT                   LVGLGLGSLLTRRLKALEQATRRMGAGDMEVTVAISGNDEVAHLAQVFNEMSGSLRSQF
FT                   DELQQVQQELSFQAQHDPLTGLPNRLLFDLRCSQAIATARQHKQLLALLFFDLDHFKNI
FT                   NDSYGHQVGDAVLRCVAARLTMALKDHNLIARLGGDEFCVLIEQLEQEQEAAAVAESVL
FT                   HMLTVPLECEQHEFFLSASIGICLYPRDGDDEVRLLRNADTAMYRAKAAGRGGYRFYSH
FT                   EQTSSVQERTSLEQRLRKAIERGELRLNYQPQVCLTTGNLVGVEALARWSSPEFGLVAP
FT                   EKFIPIAEESGQILAMGEWILDDACRQMQKWRRDGSTIPRVAVNLSALQIQRSDIATLV
FT                   RRTLDSTGLPANCLELEITEGYILQDADRAVAVLQQLRDLGVSIAIDDFGTGFSSLSYL
FT                   HRLPIDRLKIDKSFVQEIGSTSRAAQVAQAVVSLGKTLGLSIIGEGVEQLHHANALREW
FT                   GCHEGQGFLYAPALAPDQLHLLAPFKRLP"
FT   gene            48074..48514
FT                   /locus_tag="Glov_0046"
FT   CDS_pept        48074..48514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0046"
FT                   /product="D-tyrosyl-tRNA(Tyr) deacylase"
FT                   /note="PFAM: D-tyrosyl-tRNA(Tyr) deacylase; KEGG:
FT                   ppd:Ppro_0496 D-tyrosyl-tRNA deacylase"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93784"
FT                   /db_xref="GOA:B3E9B8"
FT                   /db_xref="InterPro:IPR003732"
FT                   /db_xref="InterPro:IPR023509"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3E9B8"
FT                   /protein_id="ACD93784.1"
FT                   /translation="MKAVIQRVSSAQVAVHGELVGQIGRGIMVLLGVEKGDSEAAADWL
FT                   AEKIVGLRIFEDEAGKMNRALTDIGGAVLAVSQFTLAGNCDKGRRPSFDTAAPADEGKR
FT                   LYDHFVGALKRQGVPVQTGIFQADMQVALVNDGPVTFILERR"
FT   gene            48520..48804
FT                   /locus_tag="Glov_0047"
FT   CDS_pept        48520..48804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0047"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93785"
FT                   /db_xref="GOA:B3E9B9"
FT                   /db_xref="UniProtKB/TrEMBL:B3E9B9"
FT                   /protein_id="ACD93785.1"
FT                   /translation="MQLGSLKAAATSGGFWMAWLLLAAALLIPAPTASFCLAFLAVTCA
FT                   VFPLAFGSRTQRIGAVAAVVLSILLVFSLADKAKNDPWFKKHRSTTSPA"
FT   sig_peptide     48520..48591
FT                   /locus_tag="Glov_0047"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.952) with cleavage site probability 0.426 at
FT                   residue 24"
FT   gene            48991..49605
FT                   /locus_tag="Glov_0048"
FT   CDS_pept        48991..49605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0048"
FT                   /product="protein tyrosine/serine phosphatase"
FT                   /note="PFAM: Dual specificity protein phosphatase; putative
FT                   tyrosine phosphatase; KEGG: gme:Gmet_0085 protein
FT                   tyrosine/serine phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93786"
FT                   /db_xref="GOA:B3E9C0"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR004861"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR020422"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:B3E9C0"
FT                   /protein_id="ACD93786.1"
FT                   /translation="MLLPTCRFLIIVSCCLTILAGSAWANAPAAATKHVADQPIVIRSS
FT                   EHLYNLPGLGNVGRVAPGVYRGEQPGAAGYATLKRLGIKTVIDLRTSESEKTQVEAAGM
FT                   KAIAVPIEMTRKGLRQKVDQVVALMADPANQPVYVHCRHGQDRTGIVVAAYRMTQDNWS
FT                   LKDVEAEMQSFGFNDVWTNFKAFIRTYTPQSNTLSPAGSSR"
FT   sig_peptide     48991..49068
FT                   /locus_tag="Glov_0048"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.993 at
FT                   residue 26"
FT   gene            complement(49624..50739)
FT                   /locus_tag="Glov_0049"
FT   CDS_pept        complement(49624..50739)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0049"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="KEGG: ppd:Ppro_0440 metal dependent
FT                   phosphohydrolase; TIGRFAM: metal dependent phophohydrolase;
FT                   PFAM: nucleic acid binding OB-fold tRNA/helicase-type;
FT                   metal-dependent phosphohydrolase HD sub domain; SMART:
FT                   metal-dependent phosphohydrolase HD region"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93787"
FT                   /db_xref="GOA:B3E9C1"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:B3E9C1"
FT                   /protein_id="ACD93787.1"
FT                   /translation="MPKQFIADLKDRDVVDSPFMVKEKTMAMAKNGKPYMNLKFMDKSG
FT                   EIDGKLWDNVDELDKTFQKGDFVRIRGTASLYMGKMQLVAKEIKRLEEEGVDLADFVPV
FT                   SPVPQAEMRAELAQVVASLSNPYLKALMEGFCGDAEFMAGYCKAPAAKGMHHVYIGGLL
FT                   EHSLSVVRLVDAIVPLYPDLNRDLLVVGALLHDLGKVAELSYDRAFEYTDEGRLIGHIS
FT                   IGVEMLTERIATVPGFPRELAMLLKHLLLSHHGQYEYGSPKRPKTVEATILHYLDDMDS
FT                   KINGIRSHIARETAQGNRWTSHHRLYNLYFFTGNGMEDESEQEMIALSEPLAEAAPQAP
FT                   APAEKDKPKPARESFGNQPFANLKNLDLFGN"
FT   gene            50925..51632
FT                   /locus_tag="Glov_0050"
FT   CDS_pept        50925..51632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0050"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: noc:Noc_0676 two comoponent
FT                   transcriptional regulator, winged helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93788"
FT                   /db_xref="GOA:B3E9C2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B3E9C2"
FT                   /protein_id="ACD93788.1"
FT                   /translation="MENRILVIDDDRELCGLLEEYLVAEGFAVESVHTGPQGAEQGSQG
FT                   NYALIVLDVMLPGLNGFDVLRRIRGESSVPVVMLTARGEEVDRIVGLEMGADDYLPKPF
FT                   NPRELVARIRAIQRRQSTAQKDGTAAEAVLVVGDLVLDPGRRTVLQGERSVVLTSIEFS
FT                   VLELLLAQAGRVISRDDICSQALGRQLNSFDRSIDVHVSSLRRKLGPAGDGSERIKSVR
FT                   GIGYIYLRPAGSP"
FT   gene            51629..52798
FT                   /locus_tag="Glov_0051"
FT   CDS_pept        51629..52798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0051"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; KEGG: noc:Noc_0675 signal
FT                   transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93789"
FT                   /db_xref="GOA:B3E9C3"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B3E9C3"
FT                   /protein_id="ACD93789.1"
FT                   /translation="MRTLFFKLFVAFLLAMSISGAVFFSLAFWARSQQQEHHPTLSADQ
FT                   LRHELKPLLQPLPPKHGPDGMGPPPPLAGHPPPPPFFMLLGFQVGIFLVVGGCICYLLA
FT                   WRITAPVRRLRQAVQQLADGNLQARTGIATGRRGDEITDLGSDFDRMAERIEALVLSQR
FT                   QLVRDISHELRSPLARLQVALGLARRNAPPRTEQALDRIEREGERLNELIGELLTLSLL
FT                   ENGASFSASEPVEMQALLAEIVEDASFEAAESSRRVQLTAVPALVAGNRELLRRALENV
FT                   VRNALHYTAEESCVQVASGLENSTLVIRVLDQGPGVPDEMLSAIFQPFYRVAEARDRLS
FT                   GGTGIGLAITARAVALHGGSVKAVNRPEAGLEVEIRLPVMPLEKKTASC"
FT   sig_peptide     51629..51712
FT                   /locus_tag="Glov_0051"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.936 at
FT                   residue 28"
FT   gene            complement(52803..53312)
FT                   /locus_tag="Glov_0052"
FT   CDS_pept        complement(52803..53312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0052"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93790"
FT                   /db_xref="UniProtKB/TrEMBL:B3E9C4"
FT                   /protein_id="ACD93790.1"
FT                   /translation="MKKLLQTVVMLACCLLMGAVSAVAEEGGCTKTRTLPIKSGKLYQD
FT                   YYGSAVTSDKTILHGYRWGVTNPKPQSMAYFGGTMKATGSFAKFRAKIYIDDGVKAPME
FT                   FSFKNNDRNGELLKSVTVAPGETVDVDFETGGSKKIFVQSELRINHDTARRIVIGEPEF
FT                   YSCITK"
FT   sig_peptide     complement(53238..53312)
FT                   /locus_tag="Glov_0052"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.973 at
FT                   residue 25"
FT   gene            complement(53394..54749)
FT                   /locus_tag="Glov_0053"
FT   CDS_pept        complement(53394..54749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0053"
FT                   /product="MATE efflux family protein"
FT                   /note="TIGRFAM: MATE efflux family protein; PFAM: multi
FT                   antimicrobial extrusion protein MatE; KEGG: dol:Dole_0413
FT                   MATE efflux family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93791"
FT                   /db_xref="GOA:B3E9C5"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:B3E9C5"
FT                   /protein_id="ACD93791.1"
FT                   /translation="MKQRLRFNHIPRLLKLAGPMILSTSAITMMQIIDTIVLSYDSSQA
FT                   LAAIGPSSMAVILFQGFLFGTAGYAGTFVAHNHGRGNRQGVIASAWLGIYTALAAGLAA
FT                   LLVAWPLAQLFLLAGHAPQVARDEQTYFWICMAGSLFPVFGSSLAGWLSGIGRPALVTA
FT                   VTFSSLIINALLAWGLVLGEWGLPRMGIAGAALATVSAQLVAALLYALLFARAGGFSNQ
FT                   AARCLNRVEFRRFLSLAAPMGLRISGELAAWTLFLVVVGRLGTVELAASSIAFRINGIA
FT                   FFPALGLGQAAGILVGHARGAGRDDEVPAIAWQSLAVCEIWMLLMATLFATAAGPLFSI
FT                   FAGTSPESAGIIATGVLLMKFVAVYCVFDAANVMIGCVLASAGETRWIARTFAIASGIF
FT                   VTLLWLIDRSMPDLVAEWALATGFVFCTAVVWVLRFRTGRWREIQLVHRPAA"
FT   gene            complement(54819..57725)
FT                   /locus_tag="Glov_0054"
FT   CDS_pept        complement(54819..57725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0054"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_4; Tetratricopeptide TPR_2 repeat
FT                   protein; SMART: Tetratricopeptide domain protein; KEGG:
FT                   gvi:glr1061 similar to kinesin light chain"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93792"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR024983"
FT                   /db_xref="UniProtKB/TrEMBL:B3E9C6"
FT                   /protein_id="ACD93792.1"
FT                   /translation="MRSLLLLLIVALLTGPVPALAASYEEASDLLMERRYAQKLLAAGR
FT                   YEEALKQARQVLANARRLFGTEHRDTAMSLDTVAAILRKMGRFDESERYFVQALQIVRA
FT                   HRQEAPADYAAALQNLAGLYRETGRYTESEQLYREAIETLKTVEQKDDEALISVYGNLA
FT                   VLYQNQGRYAEAEPLLKAEYEWALKAAQPDALSLRMHLSMDRQRLFLADRMSSLAGLYL
FT                   KMRRTREATELTAAALEIKRQILKPDDPRLIREMNNLGMIYRDNGRPQEAEGLLQQAVT
FT                   SARNVYGNRHPELAVYLDNLALLLQRKEAYAQAEKLQQEAISISAHSLGGSHPTTLMQR
FT                   NNLAVNYLMQERYAAAEQLLHDILTDSLAGPTGTHYPEVATRMTNLADALRLQGKHLEA
FT                   HRLQTEALRIKERKRDDLFQLLTEQQKLQYLQEEMAFVRLHLAHTRQVLAQDPGAAATA
FT                   LDVWLRWKGIVMESQGRYLDALYRTDDPALKQQFEELVAVRRQLAGLQLVQPAPQSAQS
FT                   HATRIELLEYRKEQLETDLTKRSAVYAKAGTSQRFTSNELRKLLPKGAAYIDFVLVEDW
FT                   HFQPLEVRGLRYLAFIVSNQPGATVQMLDLGPSGSINQVITDYRRQIAAQAGGGKADTS
FT                   RLVAVAAELHARIVAPLLPYLQGVSSLIISPDAGLHLLPFEVLRAKGKPYLLEQYAISY
FT                   VGSGRDMARFGTSVASSGKALLFADPDYDLPLHTGEARPHGELLAQLTSLQFSRLPDTK
FT                   VETDAIAGLLRHGTQIKVQNLAGRQALESTLLAQSQPRILHLATHGFFLQDETSGGSET
FT                   RGLKAVQLIKPASGAAHTQLTNPMLRSGIALAGVNGALARGRDDGLVTAEKILGMRLLG
FT                   TDLVTLSACETGVGDIKAGEGVFGLKRAFILAGARTVVLSLWSVPSRETTELMTEFYRL
FT                   MASGTPKAAALRQAQRTMLGKYPHPFYWGAFQLVGSPD"
FT   sig_peptide     complement(57660..57725)
FT                   /locus_tag="Glov_0054"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 22"
FT   gene            57808..58305
FT                   /locus_tag="Glov_0055"
FT   CDS_pept        57808..58305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0055"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93793"
FT                   /db_xref="UniProtKB/TrEMBL:B3E9C7"
FT                   /protein_id="ACD93793.1"
FT                   /translation="MKRLTCWLTTVVTALLVLLPVLVSADQAADDITNARRSRMLRRGL
FT                   PDATAPVVRPPLPAPAAATPQNVSDDATFGYTKENPIKMGGADLSEGIAGSKYYLRSLR
FT                   DKHNKPFAVSRISNVGPGEDGHIVDLYQLIDSEGTSYKLYVDVYHPEIHPKEAKTPQGM
FT                   TR"
FT   sig_peptide     57808..57885
FT                   /locus_tag="Glov_0055"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.691 at
FT                   residue 26"
FT   gene            complement(58353..59588)
FT                   /locus_tag="Glov_0056"
FT   CDS_pept        complement(58353..59588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0056"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   gme:Gmet_0257 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93794"
FT                   /db_xref="GOA:B3E9C8"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B3E9C8"
FT                   /protein_id="ACD93794.1"
FT                   /translation="MPHSFNNLRWRLFFTLALIYILVYFYRVSLAVVSADVSRDLALTP
FT                   QQLGSLAGVLFYVYAVAQIPLGPLIDRVGPRLVISGCGLLTTLGGLLFSQAGSLTAAMA
FT                   GRVLIGIGTAAVLMASFTIFSHWYTRQEFARITGLMIAVGNLGNLAGTAPLAMAVGLMG
FT                   WRSSFLLIALLQGVVTVLIFLKVQDRPARPLETVAPEQLQPPGMLAAWGTIARNRSFWL
FT                   LAAIAFCWYGNYLAVQGLWGGPFLMQLIGLSREGAGQMLMWTSVGFIIGSPLMDRIARS
FT                   LFHSYSRTLLAGQLCLTGLMTGFMGWLPLLPHWGLVLYFLGIGLTVSSGVMIYPIIRAM
FT                   VPVSMVGTGLTSLNFFVLMGAATTQQGMGVIIARCGGYSPEGFRAAFSVPVGGLLLTSL
FT                   LFLFARNYPAGE"
FT   sig_peptide     complement(59493..59588)
FT                   /locus_tag="Glov_0056"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.788) with cleavage site probability 0.546 at
FT                   residue 32"
FT   gene            complement(59588..60541)
FT                   /locus_tag="Glov_0057"
FT   CDS_pept        complement(59588..60541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0057"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="KEGG: ppd:Ppro_0316 metal dependent
FT                   phosphohydrolase; TIGRFAM: metal dependent phophohydrolase;
FT                   PFAM: metal-dependent phosphohydrolase HD sub domain;
FT                   SMART: metal-dependent phosphohydrolase HD region"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93795"
FT                   /db_xref="GOA:B3E9C9"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:B3E9C9"
FT                   /protein_id="ACD93795.1"
FT                   /translation="MFDEKYRPVHTACINPEKFPQVALYMQSGTNLVLYKPADRPITRA
FT                   DLQRLHNNQVEHLYINAGSIREVCDFLEESISEILASDEISGPVKGQLLSQVAMNYVMD
FT                   VFEMPDKLSNLDRCRNLVRQLMQYIAGNPNPLEALHAVVNHDFYTFAHSVHVASLSLLV
FT                   HAEVFGLTADELEDVGIGGILHDVGMIFVPSAILEKTDILTNFEYNLIKKHAERGYECL
FT                   RELGGFSEISLAAVRYHHERINGEGYPFQLAGDEIPRTAQVTAICDVFSALTSNRPYKK
FT                   AMGRSEAITLMEGVGKDVFSPRLLEKFKDVILSEGS"
FT   gene            complement(60648..61232)
FT                   /locus_tag="Glov_0058"
FT   CDS_pept        complement(60648..61232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0058"
FT                   /product="DNA-3-methyladenine glycosylase I"
FT                   /EC_number="3.2.2.20"
FT                   /note="KEGG: gur:Gura_3518 DNA-3-methyladenine glycosylase
FT                   I; TIGRFAM: DNA-3-methyladenine glycosylase I; PFAM:
FT                   methyladenine glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93796"
FT                   /db_xref="GOA:B3E9D0"
FT                   /db_xref="InterPro:IPR004597"
FT                   /db_xref="InterPro:IPR005019"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:B3E9D0"
FT                   /protein_id="ACD93796.1"
FT                   /translation="MTTNSQPTRCAWAGSDPLYRDYHDLEWGVPVHDDRLLFEFLILEG
FT                   AQAGLSWITILRKRAAYRTVFENFDPTVVARFDEQKVAELLLNPGIVRNRLKVASAISN
FT                   ARAFLQVQEQFGSFDAYMWRFVDGRPIQNSWRSIKEVPASTAVSDSLSRDLKKHGFRFV
FT                   GSTICYAMMQAVGMVNDHTVDCFRWQELQQQ"
FT   gene            complement(61396..61722)
FT                   /locus_tag="Glov_0059"
FT   CDS_pept        complement(61396..61722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0059"
FT                   /product="HicB family protein"
FT                   /note="PFAM: HicB family protein; KEGG: ppf:Pput_4242 HicB
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93797"
FT                   /db_xref="GOA:B3E9D1"
FT                   /db_xref="InterPro:IPR008651"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR035069"
FT                   /db_xref="UniProtKB/TrEMBL:B3E9D1"
FT                   /protein_id="ACD93797.1"
FT                   /translation="MSTMTFKGYAAKIEYSDEDACFIGHIAGIKDVIGFHAETVKELRA
FT                   AFEEAVDDYLATCERVGRAPQKPYSGKLMLRVPPEVHARAAMMAQAHGVSINQWASDVL
FT                   AHAS"
FT   gene            complement(61719..61973)
FT                   /locus_tag="Glov_0060"
FT   CDS_pept        complement(61719..61973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0060"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pen:PSEEN1237 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93798"
FT                   /db_xref="GOA:B3E9D2"
FT                   /db_xref="InterPro:IPR012933"
FT                   /db_xref="UniProtKB/TrEMBL:B3E9D2"
FT                   /protein_id="ACD93798.1"
FT                   /translation="MNKSHRSTLLAIFSLPVPATLEWRKIESLFVALGAQTIEGNGSRV
FT                   RFELNGIIGTFHRPHPAKEAKPYQVKDARAFLENAGVKP"
FT   sig_peptide     complement(61908..61973)
FT                   /locus_tag="Glov_0060"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.759) with cleavage site probability 0.745 at
FT                   residue 22"
FT   gene            complement(62105..62902)
FT                   /locus_tag="Glov_0061"
FT   CDS_pept        complement(62105..62902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0061"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: psb:Psyr_1930 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93799"
FT                   /db_xref="InterPro:IPR021223"
FT                   /db_xref="UniProtKB/TrEMBL:B3E9D3"
FT                   /protein_id="ACD93799.1"
FT                   /translation="MDYNPISADTLFHYTSSLSILESILVNEFYPRYCLEDHSMFNSKH
FT                   NRLPHLCERAIPMVCFCDIPLSSIRNHAKNYGNYAIGLSKDWGKSKGISPVLYTYEKAT
FT                   TAGYLRGSYHESVGKLIDLNSIKPATLDFIAVYLELFLFMSKPYEGTLWRNGKYVDGVR
FT                   FYDEREWRYVPSLDSMLQYKFKPSLTKEEFTADDIRNYNNTKLQQFKLSFSPSDIKYII
FT                   LDSETEVLDFIKKLRYIKAKYSKDDIDLLTTRIITMEQIRKDF"
FT   gene            complement(63332..65194)
FT                   /locus_tag="Glov_0062"
FT   CDS_pept        complement(63332..65194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0062"
FT                   /product="Zn-dependent protease-like protein"
FT                   /note="KEGG: tle:Tlet_1538 peptidase U62 modulator of DNA
FT                   gyrase"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93800"
FT                   /db_xref="GOA:B3E9D4"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:B3E9D4"
FT                   /protein_id="ACD93800.1"
FT                   /translation="MKEQILQTLHDLRTYALAKQIDAAFFLHEEESCLMRCANSAISLN
FT                   TNEHLLRLEITAYEGRKRASFELITALGNMAEMRQGVDRAAEMVKHAQALDYQPTMPAF
FT                   SETFIDESGFDAGLAGITNAARLEFFNQAVAGLEADEITLSGIFSTGVTTLAQITTRSE
FT                   HCQYFKTTDAQISIVLSHATRKWELLAEQSARQITDLDPSALHRDLAFLLEQYQQDTPC
FT                   QLALGRYDVVFGSAAIAELIDIMNFIGFDGGSMKRGFSFITGDQVGQKVLSSRFTLSDD
FT                   PTCLDTFPFQRDFMGMPRKPFPIFANGVFRSFTWSQDDADEFGTAPTGHTVMHKSLVLA
FT                   GGNTQVSTLKELVDLPHSNDLLYIPSLHYLNIVNPSTGLITASSRFGALLLTKEGSVVV
FT                   PYNVRITQSLLDIFGNRLAWLSQTQVVSNTSSSYGARNPTAIVVPAFVQVNDLEISHAN
FT                   ARGGISAVARYPIQQGDLKMNTQWQRRTVLLFLSLFFISFSNAWGESWNRAVKNSSSQP
FT                   VTITVDAGHGNVWFTGACTSENGPCTIPPNSQANTKFTTTAGMCNGTFKFKHGTAPECT
FT                   CRYFGGTQSSAPAVRFSTSTCPPNIKCNIFTTTDQWWGYVEITD"
FT   gene            complement(65197..66651)
FT                   /locus_tag="Glov_0063"
FT   CDS_pept        complement(65197..66651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0063"
FT                   /product="peptidase U62 modulator of DNA gyrase"
FT                   /note="PFAM: peptidase U62 modulator of DNA gyrase; KEGG:
FT                   tle:Tlet_1539 peptidase U62 modulator of DNA gyrase"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93801"
FT                   /db_xref="GOA:B3E9D5"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:B3E9D5"
FT                   /protein_id="ACD93801.1"
FT                   /translation="MRKQLQEQIERLKTAGASYVDARWYPVEETEHLMIWNGNLKNAAA
FT                   SRESGVGIRVLYQGAWGFSASSDAGNLSALFDKALDNARVAAQRCTFPVHLADKAPVQG
FT                   TFSSPNRIDPFSIPLADKVGFMKALDDRLNQPGVSQRVCELSFTRKQIVYLDSEGSEIE
FT                   KRIIEVFPSMQVMGLDSHGETHARTFHPTLDSTTRGWETIDPALFNEQAERIVQEMNAV
FT                   RVAETCPTDVRSVILLPGIMYLQTHETIGHALELDRILGYELAYAGGSFVRLEDFGTLQ
FT                   YGSPKLTARADATLPNSPGSFGYDDDGVPAQDNLLIDQGLLVGAITGRQMVAEANARAG
FT                   KTIFKGSGGANRATAFYRAPIERMTNINIDPGTDGSLDEIVRNTEKGIILDGDKSWSIG
FT                   SNREQFHFAVDIGWLVEDGAITRVVKNATYRGETIPFYNALSAVGDRSTWELLSVNNCG
FT                   KGQPNQIMQLGHGVPVCRFDQVTIGE"
FT   gene            complement(66711..67340)
FT                   /locus_tag="Glov_0064"
FT   CDS_pept        complement(66711..67340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0064"
FT                   /product="transglutaminase domain protein"
FT                   /note="SMART: transglutaminase domain protein; KEGG:
FT                   gsu:GSU1549 lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93802"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:B3E9D6"
FT                   /protein_id="ACD93802.1"
FT                   /translation="MMKKYLEQSSWINWQHPAILVKAKLLSAGSTDKTEIARRCFEFVR
FT                   DQIRHSWDYRQNPVTCVASDVLEYGTGYCYAKSHLLAALLRANGIPAGLCYQRLSKTGN
FT                   GAPFCLHGLNAVWLEGHGWYRIDARGNKPGVDAQFCPPKEQLAFHPDQPDEADLLEVLL
FT                   SPLPQVLQVLTRYATVEEVYQNLPDIPITLDSADGVTPIRSDTRHL"
FT   gene            complement(67385..68578)
FT                   /locus_tag="Glov_0065"
FT   CDS_pept        complement(67385..68578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0065"
FT                   /product="acetylornithine and succinylornithine
FT                   aminotransferase"
FT                   /EC_number="2.6.1.11"
FT                   /note="KEGG: dar:Daro_1679 bifunctional
FT                   N-succinyldiaminopimelate-aminotransferase/acetylornithine
FT                   transaminase protein; TIGRFAM: acetylornithine and
FT                   succinylornithine aminotransferase; PFAM: aminotransferase
FT                   class-III"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93803"
FT                   /db_xref="GOA:B3E9D7"
FT                   /db_xref="InterPro:IPR004636"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B3E9D7"
FT                   /protein_id="ACD93803.1"
FT                   /translation="MSESSAFDSLMTITKRPPIVMVAGQGSWLTDSNGKRYLDFIQGWA
FT                   VNCLGHAPAVITQALSQQAAQLISPSPAFYNQPAIRLADLLTANSCFERVFFANSGAEA
FT                   NEGAIKLARKWGSLHKQGAYEIITMVNGFHGRTLATMSASGKPHWQGLFEPKVPGFIKV
FT                   GLNDLEAVTAAISERTVAIMLEPVQGEAGVIPASQLFLQGLRQLADQHQLLLIFDEVQT
FT                   GMGRLGSLFAYQQAGVEPDIMSLGKGIGGGVPLAALLAKEAVCCFEPGDQGGTYNGNPL
FT                   MAAVGCAVLEAMLQPGFLEQVRERGVQLANGLRKLSTRHGLGEVRGSGLLQALALPANN
FT                   GDAVTEAARELGLIINAARPDTLRFMPALNVSADEVDTCLRLLDQVFVAGAEMGCPA"
FT   gene            complement(68932..70086)
FT                   /locus_tag="Glov_0066"
FT   CDS_pept        complement(68932..70086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0066"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: psb:Psyr_0104 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93804"
FT                   /db_xref="GOA:B3E9D8"
FT                   /db_xref="InterPro:IPR000157"
FT                   /db_xref="InterPro:IPR021729"
FT                   /db_xref="InterPro:IPR035897"
FT                   /db_xref="InterPro:IPR037126"
FT                   /db_xref="UniProtKB/TrEMBL:B3E9D8"
FT                   /protein_id="ACD93804.1"
FT                   /translation="MALKVFISYAKEDRESAEHYYELLAKEGVSPWVDSKHLLPGQNWE
FT                   AEIERAFSDANVVVLLLSKRSVTKRGFVQREANDAIERLRYKQLTDIYVIPLLLEPCEV
FT                   PTHIAARLQYVDLNVPGAWDQVKAALRLASEQQSIELEHGVVAGPFNVFTERIEDNWDG
FT                   LPGHNIEIEYPRFQSTSKPDVAKELSALFVGRAYADLIDARQKPWEQEPEFFKTRGAAA
FT                   VNGCWENFAIVHATDRFLSLTYDVGLYYAGAAHPNYYYVTYNFEYVDKVRKLELTDFFS
FT                   DSQGAIKRISEICIHELSKEYWHRTGETPSDFQIESFKNGAGEDASHFKTYTVSADRFT
FT                   FLFPTGQVSGYAMGRWSVDVSFYELLSYLREDGPHLHAVASYNL"
FT   gene            complement(70176..70592)
FT                   /locus_tag="Glov_0067"
FT   CDS_pept        complement(70176..70592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0067"
FT                   /product="PilT protein domain protein"
FT                   /note="PFAM: PilT protein domain protein; KEGG:
FT                   gfo:GFO_3473 PIN domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93805"
FT                   /db_xref="GOA:B3E9D9"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:B3E9D9"
FT                   /protein_id="ACD93805.1"
FT                   /translation="MKPYLFVDTDVVLDLLARREPFYDAAARLFSEAEAGNLTLCVSSL
FT                   TFANLFYLLRKQHSGPQAQQVLRTFKQLVSVVAVDDTIVEQALHAGFTDFEDALQYFCA
FT                   LSARCSGLITRNVRHYRKSSIRVVTAEGYFAAAG"
FT   gene            complement(70589..70834)
FT                   /locus_tag="Glov_0068"
FT   CDS_pept        complement(70589..70834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0068"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gfo:GFO_3474 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93806"
FT                   /db_xref="UniProtKB/TrEMBL:B3E9E0"
FT                   /protein_id="ACD93806.1"
FT                   /translation="MNTKLTLSLDHDVIEQAKRFAQSQHQSLSKLIEGYLRQVSAPKEQ
FT                   TRPVTPLVAQLSGVLDAAKVKDYKRDYTDYLADKYR"
FT   gene            complement(70932..72152)
FT                   /locus_tag="Glov_0069"
FT   CDS_pept        complement(70932..72152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0069"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: protein of unknown function DUF894 DitE; major
FT                   facilitator superfamily MFS_1; KEGG: rso:RS05067 probable
FT                   transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93807"
FT                   /db_xref="GOA:B3E9E1"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B3E9E1"
FT                   /protein_id="ACD93807.1"
FT                   /translation="MTPAHTTKSPLAQPLVLFLFGRMGSSIAFQMLGVAVGWQMYALTS
FT                   SAWYLGLVGLAQFLPMVLLTLVAGHAADRYDRRTIARTCQFIEALAAAALVLGSHYHWL
FT                   GKEALLAVMCVIGSARAFEYPTMHALVPRLVPREHLPRALALSASANQTATIVGPAIGG
FT                   LLYAAGVTTVYSTIGVLFLAACILISCIRPSDTLTTEATGDRSLFAGISFIKQHPVVLG
FT                   AISLDLFAVLLGGATALLPIYARDILVTGPWGLGLLRSAPAAGALGMSLWLARRPLKRR
FT                   VGRTMFRAVALFGIATIVFALSRLFWLSLVALVVLGAADVISVVIRSSLVQIETPDAMR
FT                   GRVSAVNSLFIGTSNQLGEFESGATAALFGTVPSVLVGGIGTLLVVGLWIRLFPQLAQV
FT                   DTLGKRE"
FT   gene            complement(72284..73450)
FT                   /locus_tag="Glov_0070"
FT   CDS_pept        complement(72284..73450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0070"
FT                   /product="Phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase"
FT                   /EC_number="2.1.2.3"
FT                   /note="PFAM: AICARFT/IMPCHase bienzyme formylation region;
FT                   KEGG: cac:CAC2445 5-aminoimidazole-4-carboxamide
FT                   ribonucleotide transformylase"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93808"
FT                   /db_xref="GOA:B3E9E2"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024050"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="UniProtKB/TrEMBL:B3E9E2"
FT                   /protein_id="ACD93808.1"
FT                   /translation="MNIELKYGCNPHQVPASLELPEQAGFKVLNGTPSYINILDALGAW
FT                   QLARELKAATGKPGAASFKHTSPAGAAVSGPLSAEYCASQFLTVGELSPVANAYIRARG
FT                   GDRMCSFGDVAAVSDVVDVSLAKVLKTEVSDLIIAPGFEPEALEILKAKKGGGYLIFQI
FT                   DPTYEAEGVEYRELFGFGLRQQRNTTKITEALFQNAVTTSKELSPEVLETLIVATIALK
FT                   YTQSNSVCLALEGQVIGMGAGQQSRVHCTRLACDKAEKWLLQQHPKVLGLAFKDGLKKP
FT                   EKANIVDQYLLWDQLSEPERAQMLSGLTRAPEPVSSQERLEWVQRFQGICLSSDAYIPF
FT                   RDNIDRANRSNVQFVAHAGSSLRDEEVTVAAQQYGMTMYHTGLRLFLH"
FT   gene            complement(73462..74640)
FT                   /locus_tag="Glov_0071"
FT   CDS_pept        complement(73462..74640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0071"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; KEGG: gme:Gmet_3477
FT                   PAS/PAC sensor hybrid histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93809"
FT                   /db_xref="GOA:B3E9E3"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B3E9E3"
FT                   /protein_id="ACD93809.1"
FT                   /translation="MFNYNDQLILSITIRVIALLWSIVLVIRIRSWKMGLLTLMIMLMS
FT                   FQQSMRFFGIKSEVPGFIVSILVLLVVIFVGRLILHQKSDQLKLKEINEGLEQRVQERT
FT                   SELNDRNAEVQRAYDDLKLAQTQLLQQDKMASVGQLAAGVAHEINNPIGFIISNLASLG
FT                   KYVEKLSAYLDADERLLNGCDPATRALLARERQTYKIDRIRQDLPDLLAETSEGAQRVR
FT                   KIVQDLKSFSRVDGGEFAAADIHEGLESTLSIAANELKYKTNVIRDYGQLPPVWCNLGQ
FT                   LNQVFLNILVNAAHAIAEQGEIRLTTREEDGLVRISISDTGCGIAPEHLQRIFDPFFTT
FT                   KEVGTGTGLGLAIAYDIVVNKHGGRIDVQSEVGVGTTFTILLPLAKEAEGEN"
FT   gene            complement(74731..75366)
FT                   /locus_tag="Glov_0072"
FT   CDS_pept        complement(74731..75366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0072"
FT                   /product="membrane protein-like protein"
FT                   /note="KEGG: gur:Gura_0019 membrane protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93810"
FT                   /db_xref="GOA:B3E9E4"
FT                   /db_xref="InterPro:IPR021125"
FT                   /db_xref="UniProtKB/TrEMBL:B3E9E4"
FT                   /protein_id="ACD93810.1"
FT                   /translation="MTPATGPYQPDDPAEESRTNQTVATPMFEAESTMSARKRKQHART
FT                   HQRTSAKPSVTKGLRAVALFEGAKGMLVILAGCGLLSFIHKDIHTTAVRLVEHLHFNPA
FT                   KHYPRIFLDATERVTDSELWALAVAALMYSGVRFFEAAGLWLGKKWAEWFGVLTGGMYI
FT                   PVELYEVARGVSWPKVILLAGNIGVVAYLLYTLNRKETRRTPALQPSD"
FT   gene            complement(75366..76067)
FT                   /locus_tag="Glov_0073"
FT   CDS_pept        complement(75366..76067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0073"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sus:Acid_0962 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93811"
FT                   /db_xref="UniProtKB/TrEMBL:B3E9E5"
FT                   /protein_id="ACD93811.1"
FT                   /translation="MHTQIRCLTILLLLLAASLASAATPDELSSAVTSNYRITIPGFFG
FT                   NFKAIGNVLIPRREGLGVNRPSNLFKPNLVKNRQLVLVGGGDLPLGDGHGNRLKPGERL
FT                   YLYEVSTGDTYLQLDLYTVATYVVPGMRGPQALQASVRFQYDSGLAALTADQLLDDISD
FT                   WFDTEEETRPAPKPRKAATATRTVQLGQTPEQVTAIFGPPEKQVLLGAKQVFVYSRLKV
FT                   IFVDGKVVDAE"
FT   sig_peptide     complement(75999..76067)
FT                   /locus_tag="Glov_0073"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.991 at
FT                   residue 23"
FT   gene            complement(76093..76416)
FT                   /locus_tag="Glov_0074"
FT   CDS_pept        complement(76093..76416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0074"
FT                   /product="protein of unknown function DUF1634"
FT                   /note="PFAM: protein of unknown function DUF1634; KEGG:
FT                   ppd:Ppro_1198 protein of unknown function DUF1634"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93812"
FT                   /db_xref="GOA:B3E9E6"
FT                   /db_xref="InterPro:IPR012861"
FT                   /db_xref="UniProtKB/TrEMBL:B3E9E6"
FT                   /protein_id="ACD93812.1"
FT                   /translation="MTTHDPELQAPSPHEPIEITLARLLRIGSLVAAALIAAGIATMLL
FT                   GREAVATRLITAGLLALLATPIMRVITAGLIFVRQKDWRFACFCLVVICALAAGILLGQ
FT                   AHA"
FT   gene            complement(76413..77243)
FT                   /locus_tag="Glov_0075"
FT   CDS_pept        complement(76413..77243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0075"
FT                   /product="protein of unknown function DUF81"
FT                   /note="PFAM: protein of unknown function DUF81; KEGG:
FT                   gsu:GSU0268 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93813"
FT                   /db_xref="GOA:B3E9E7"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:B3E9E7"
FT                   /protein_id="ACD93813.1"
FT                   /translation="MLVQTLEIFLIAITAGVFGSMLGLGGGIIIVPVLTLLFGVPMRTA
FT                   VAASTVSIIATSTGAAVAFLQDRLTNTRVAIWLEMGTATGALSGALIAGYLEQRFLYIL
FT                   FGLLLAYSGYNMFKSRKNELPEGVLPDRLSQKLQLQGSYVDRQLGKRIDYQVTGTLPGL
FT                   IIMYFSGIAAGLLGIGAGIFKVPAMDQIMRIPFKASTATSNFMIGVTAASGAVVYFARG
FT                   DVKPMITGPVVLGVLLGAVLGAKLMVRLKTSTIRKLFIPIIIYTAFEMIYRGLK"
FT   gene            complement(77328..77471)
FT                   /pseudo
FT                   /locus_tag="Glov_0076"
FT   gene            complement(77496..78407)
FT                   /locus_tag="Glov_0077"
FT   CDS_pept        complement(77496..78407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0077"
FT                   /product="cyclase family protein"
FT                   /note="PFAM: cyclase family protein; KEGG: rru:Rru_A0142
FT                   putative cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93814"
FT                   /db_xref="GOA:B3E9E8"
FT                   /db_xref="InterPro:IPR007325"
FT                   /db_xref="InterPro:IPR037175"
FT                   /db_xref="UniProtKB/TrEMBL:B3E9E8"
FT                   /protein_id="ACD93814.1"
FT                   /translation="MKRALIVLCVAFLCTACMPQSRITAAPSLWQTYENSLKAAKYVDL
FT                   THTITPSIPVWAGFGPSSFSPALNPATGAPYTWSKDGFEATRYELATDQFGTQLDPPAH
FT                   WNPDYPAIDELPPTFAVRPLVVISIVEQVAQNPGYSLTMADIQNWEARHGRIPEGSVVF
FT                   VRSDWSKEWPNPALATRQVFPGVSLAALKFLHEQRHILFHGHEPLDTDSTPTLEGEAWL
FT                   LRNGYTQAEGVAHLDQVPEAGALVTIGFPKFQGGLGGYARYIAICPPDWLYGVSVGQLP
FT                   ESPLPRAAKPLHWDATRGMRVR"
FT   sig_peptide     complement(78330..78407)
FT                   /locus_tag="Glov_0077"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.564 at
FT                   residue 26"
FT   gene            complement(78461..79150)
FT                   /locus_tag="Glov_0078"
FT   CDS_pept        complement(78461..79150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0078"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   gur:Gura_1556 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93815"
FT                   /db_xref="InterPro:IPR012808"
FT                   /db_xref="InterPro:IPR015996"
FT                   /db_xref="UniProtKB/TrEMBL:B3E9E9"
FT                   /protein_id="ACD93815.1"
FT                   /translation="MADRFNGFSPLAPAFFEQLAVNNTKAWFENHRDEYQELLLEPLKL
FT                   LVSELADTMLALDPALITLPAVDKTISRIYRDTRFSHNKSPYKTCLWITFKRYSPDWKT
FT                   APCFFFEITADSYRYGMGFYSASRQTMDNLRRLIETKPARFRATVAWLAQQDAFELAGD
FT                   CYKRPLNAALPPDLQAWHCRKNIYLVCNREVDGLLFSKGLSDELAKGFRQLQPLYELFW
FT                   QMVQQGG"
FT   gene            complement(79188..79958)
FT                   /locus_tag="Glov_0079"
FT   CDS_pept        complement(79188..79958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0079"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ppd:Ppro_2917 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93816"
FT                   /db_xref="UniProtKB/TrEMBL:B3E9F0"
FT                   /protein_id="ACD93816.1"
FT                   /translation="MHPSDAVKILFGEAADLQRVTAAEVKSAFRRRVRTFHPDSAQSVA
FT                   QHCGEAVSSLVSARDILIEHLASAQKKAAGPAPARPSTPFSTYVRPTVVRPVRPVVEKI
FT                   PKKEHERYYKGVFPTYKLKFGQFLYFATEISWQDLVRGMRWQRDQRPPYGEIAKAWGWL
FT                   TDKDIQIVRAATDIPGVFGEKAVTLGLLTPKQAAFLVRHQHHSQPRLGEYFVKERILLP
FT                   HEVTQHLKAMQRHNSSIERGTGPVPPFNPAGYVR"
FT   gene            complement(80162..80635)
FT                   /locus_tag="Glov_0080"
FT   CDS_pept        complement(80162..80635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93817"
FT                   /db_xref="UniProtKB/TrEMBL:B3E9F1"
FT                   /protein_id="ACD93817.1"
FT                   /translation="MKACLTLLFSGMVLLIGTTASFAIELAALDRVSVLMPKTKVVAIL
FT                   GAPDKVAELEGLAVELYQIHDAAPLLSVGLFYEHERALAGTALVFKGNTATATLARLKQ
FT                   HGFRALEEKGAYLRLEGKDDDTGRPVIVTISRLEDLTTVTTFEKAFYEQRNNR"
FT   sig_peptide     complement(80564..80635)
FT                   /locus_tag="Glov_0080"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.798 at
FT                   residue 24"
FT   gene            complement(80681..81406)
FT                   /locus_tag="Glov_0081"
FT   CDS_pept        complement(80681..81406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0081"
FT                   /product="PEGA domain protein"
FT                   /note="PFAM: PEGA domain protein; KEGG: dps:DP0690
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93818"
FT                   /db_xref="InterPro:IPR013229"
FT                   /db_xref="UniProtKB/TrEMBL:B3E9F2"
FT                   /protein_id="ACD93818.1"
FT                   /translation="MTRTMHHLLMLLLGSLLSILATGCSMPVLKQDIPVSTNPVGARIY
FT                   ADGQFAGVTPARVSLERNRSHILTLVKENYRQADVVITNQYQKERVYLKAIQSGINSGL
FT                   FFKNASMGMGSGMNSISNQEETGEAYILTPPAVSVSLMPLSGSAAAASLQAPTATAAYP
FT                   ESDRNAAMGQGEMTKELLKMGAGAALSQTAPIGKETSSSSSRNYVTSDGTRVQEKTTTS
FT                   VGVKVNPAGLIGVLDTLFQ"
FT   sig_peptide     complement(81314..81406)
FT                   /locus_tag="Glov_0081"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.777 at
FT                   residue 31"
FT   gene            81697..82773
FT                   /locus_tag="Glov_0082"
FT   CDS_pept        81697..82773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0082"
FT                   /product="ribosome small subunit-dependent GTPase A"
FT                   /note="TIGRFAM: ribosome small subunit-dependent GTPase A;
FT                   PFAM: GTPase EngC; KEGG: dol:Dole_2800 GTPase EngC"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93819"
FT                   /db_xref="GOA:B3E9F3"
FT                   /db_xref="InterPro:IPR004881"
FT                   /db_xref="InterPro:IPR010914"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030378"
FT                   /db_xref="UniProtKB/TrEMBL:B3E9F3"
FT                   /protein_id="ACD93819.1"
FT                   /translation="MSTQQIKLEQLGWNPWFDGLLALQGQPLESAARVAAVDREQLLLM
FT                   NSTGLFRARLSGSYLHHNRRPEAFPCVGDWVCVEKGPQDEVGLIHSLLDRRTSLQRKAV
FT                   GSAGEAQMIAANLDYVIIVQSCHFDFNLNRLERYLVMVMQGGAEPVILLTKTDLIEPGQ
FT                   LAELRSRIDNAGIVAPVLTLSTITGQGIDELKQLLVPGKTYCFVGSSGVGKSTLINALA
FT                   GGSRLATQTVSASGEGRHTTVRRELLLLDNGALVIDNPGMREFGILDAADGMASGFSDI
FT                   TGHAAQCRYRDCSHTSEPGCAVLAALATGEINQAHYDNFLKLQSESAFYQLSHAEKRKK
FT                   DRDFGKFIKSVKKDLVRE"
FT   gene            82779..83261
FT                   /locus_tag="Glov_0083"
FT   CDS_pept        82779..83261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0083"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   gur:Gura_1522 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93820"
FT                   /db_xref="GOA:B3E9F4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B3E9F4"
FT                   /protein_id="ACD93820.1"
FT                   /translation="MQGMIVIPATAEDAAAILALQQAAYQSEAELYQDWSIPPLTQSLS
FT                   ELQQEIATITVLKACQGTRLVGSVRAVQQEDNSVAIGRLIVLPDLQGQGIGSSLMAAIE
FT                   AAFPTASRFELFTGSLSLRNIRLYERLGYTVFARKQLSPQVELVFMEKRVSSKKER"
FT   gene            83264..83854
FT                   /locus_tag="Glov_0084"
FT   CDS_pept        83264..83854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0084"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   gsu:GSU2766 decarboxylase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93821"
FT                   /db_xref="GOA:B3E9F5"
FT                   /db_xref="InterPro:IPR005269"
FT                   /db_xref="InterPro:IPR031100"
FT                   /db_xref="UniProtKB/TrEMBL:B3E9F5"
FT                   /protein_id="ACD93821.1"
FT                   /translation="MQRICVFCGSSPGTRPEYSAAARALGQALVAQGIELVYGGASVGL
FT                   MGIVARTVLEGGGRVTGVIPRLLAEKEVALTSLDDLRIVDSMHERKALMAELSDGFIAL
FT                   PGGIGTIEEFVEVLTWAQLGIHTKPCGLLNSAGYYDRLLGFFDQMLAEGFIRPACRSTI
FT                   LVEQDPLNLLEAMGSYCSPTEDKAAWALKLSNS"
FT   gene            83876..84586
FT                   /locus_tag="Glov_0085"
FT   CDS_pept        83876..84586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0085"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: mac:MA0148 ribosomal RNA adenine
FT                   dimethylase"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93822"
FT                   /db_xref="GOA:B3E9F6"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:B3E9F6"
FT                   /protein_id="ACD93822.1"
FT                   /translation="MQNWLFNEYAHCGVDYSDARRAARYDDQHRKFRNYEHEFQQMLAF
FT                   LELGNTTDKTMIDLGCGTATTALLAAQQFKQVYAVDVSEAMLSQARSKNLQQLPNLSLI
FT                   QAGFLSYQHAAQPVDLVITKAALHHLPDFWKQVALQRINRMLKPGGLLYIHDVVFQFEP
FT                   QQYQDRIVAWIDTLHKAAGEQIKAEVETHLRDEYSTFGWVLEGMLERAGFTVEKLRCND
FT                   GFVAEYACCKTQDI"
FT   gene            84641..85255
FT                   /locus_tag="Glov_0086"
FT   CDS_pept        84641..85255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0086"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   gsu:GSU1545 transporter, LysE family"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93823"
FT                   /db_xref="GOA:B3E9F7"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:B3E9F7"
FT                   /protein_id="ACD93823.1"
FT                   /translation="MVTTQFLLTSLIVALVPGTGVIFTVSTGLMQGRRAALFAALGCTV
FT                   GIIPHLLATILGLAALMHTSALAFQTLKYAGVAYLLYLAYATWQDTSTFQLDTSSSRST
FT                   ARGLMLKAVLLNLLNPKLTIFFLAFLPQFISPTTASPLTQMLLLSGLFMAMTLVVFVAY
FT                   GLLAHTFRTRVIASERVQTWLRRSFAAAFAALGIRLACSER"
FT   gene            complement(85390..85854)
FT                   /locus_tag="Glov_0087"
FT   CDS_pept        complement(85390..85854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0087"
FT                   /product="pyridoxamine 5'-phosphate oxidase-related
FT                   FMN-binding"
FT                   /note="PFAM: pyridoxamine 5'-phosphate oxidase-related
FT                   FMN-binding; KEGG: gur:Gura_3517 pyridoxamine 5'-phosphate
FT                   oxidase-related, FMN-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93824"
FT                   /db_xref="GOA:B3E9F8"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR024747"
FT                   /db_xref="UniProtKB/TrEMBL:B3E9F8"
FT                   /protein_id="ACD93824.1"
FT                   /translation="MQHELRRKDRGIAETEARALLQQGEYGVLSLCGADGEPYGLPLSY
FT                   CVLDNAIYFHCALEGRKLALLADNNQASFCVVGATEVVPEKFSTRYESVIVSGRVNEAL
FT                   DAEKQRGLEGLTDKYCPEYREKGLQYIASDAARTRVFKISIDTICGKARR"
FT   gene            complement(85931..87439)
FT                   /locus_tag="Glov_0088"
FT   CDS_pept        complement(85931..87439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0088"
FT                   /product="protein of unknown function DUF853 NPT hydrolase
FT                   putative"
FT                   /note="PFAM: protein of unknown function DUF853 NPT
FT                   hydrolase putative; KEGG: tbd:Tbd_2221 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93825"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033186"
FT                   /db_xref="UniProtKB/TrEMBL:B3E9F9"
FT                   /protein_id="ACD93825.1"
FT                   /translation="MTEPLLIAKNSTTDILLLPQMANRHGLITGATGTGKTVTLQMLAE
FT                   HFSSLGVPCFMADVKGDLAGVSQPGGGNAKVTERVKALKLEGFAHQGYPVTLWDPFGLN
FT                   GHPVRATISDMGPLLLGRMLDLNETQSGVLNLVFKVADDNGLLLLDLKDLRAMLAFVGE
FT                   NAKQFTTDYGNVSTASIGAIQRGLLTLEAQGGEQIFGEPMLNSADLLQTDRGLGVINIL
FT                   SSEKLMQSPKLYATLLLWLLSELFENLPEVGDLDKPKLVFFFDEAHLLFSDAPPVLVEK
FT                   IEQVVRLIRSKGVGVYFVTQNPADVPDKILSQLGNRIQHALRAFSVRDQKGVKAAAETM
FT                   RDNPALDEAAVITELGVGEALVSCLDEKGRPGVVERAYMVPPRGQIGPISADQRSRLLQ
FT                   TSLVAGAYDTLVDRESAYEILKARAKQSADAVDTQTQTGAASSSGSSGLGGVLADMLGG
FT                   GSGHSRGRESAVEALTKSAARAMGSQIGRSIIRGVLGSLFGGRR"
FT   gene            complement(87450..87740)
FT                   /locus_tag="Glov_0089"
FT   CDS_pept        complement(87450..87740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0089"
FT                   /product="YCII-related"
FT                   /note="PFAM: YCII-related; KEGG: ppd:Ppro_1981 YCII-related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93826"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:B3E9G0"
FT                   /protein_id="ACD93826.1"
FT                   /translation="MFIVSVTYQQQLEVVDHHLPAHLAFLDRYFSQGTFIASGRKVPRT
FT                   GGIILATGVSKEQLAEILLEDPFNQHGVASYEVTEFEPNRTGPEYAWFLKL"
FT   gene            complement(87813..88574)
FT                   /locus_tag="Glov_0090"
FT   CDS_pept        complement(87813..88574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0090"
FT                   /product="CoA-substrate-specific enzyme activase"
FT                   /note="TIGRFAM: CoA-substrate-specific enzyme activase;
FT                   PFAM: ATPase BadF/BadG/BcrA/BcrD type; KEGG: gsu:GSU2945
FT                   (R)-2-hydroxyglutaryl-CoA dehydratase activator, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93827"
FT                   /db_xref="InterPro:IPR002731"
FT                   /db_xref="InterPro:IPR008275"
FT                   /db_xref="UniProtKB/TrEMBL:B3E9G1"
FT                   /protein_id="ACD93827.1"
FT                   /translation="MVKVGIDLGSRTIKLVALTQGAISFHTVVESSFEPHRQALAFLEQ
FT                   HAPVRAVATGYGRHLVQQHAEVDVITEIKAHAMGARYFFPQCRTILDVGGQDSKVISLT
FT                   AEGKVQNFQMNDKCAAGTGRFLEMMAVSLGYTMAEFGAAAASIDHATPINSMCAVFAES
FT                   EVVSLKNSGMPPAEIARAVHLAVANRLATMVRKVGYGDHLVFSGGVANSPIMVSLLAQE
FT                   LGVPVLVPDHPSIVGALGAALQAELLHHSSN"
FT   gene            complement(88577..89866)
FT                   /locus_tag="Glov_0091"
FT   CDS_pept        complement(88577..89866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0091"
FT                   /product="2-hydroxyglutaryl-CoA dehydratase D-component"
FT                   /note="PFAM: 2-hydroxyglutaryl-CoA dehydratase D-component;
FT                   KEGG: gsu:GSU2944 (R)-2-hydroxyglutaryl-CoA dehydratase
FT                   alpha-subunit, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93828"
FT                   /db_xref="InterPro:IPR010327"
FT                   /db_xref="UniProtKB/TrEMBL:B3E9G2"
FT                   /protein_id="ACD93828.1"
FT                   /translation="MSAFEVKSDPQLWEKLGMDVARFTGMPAMLTQAYTNIFLAQQNRP
FT                   DRMAYFDGMVENIHTGRIHELMEAKEAGKPVIGTFCVYIPEEVVVAAGGVCVGLCGGAQ
FT                   GSIADAEKVLPRNICPMVKSAFGFKVGKICPYFQAVDFVYGETTCDAKKKTWELLDEYV
FT                   PTHVMEIPQMKRDKDKALWLDEVKEFKVAVDKITGTETGFDELSQAIVTINAKRRALQR
FT                   LNNLRHHTPSPISGKDMLLIEQIAFYDEPNRFVENVNALCDELEERIKQGVAVAPATTP
FT                   RIMVSGTPMALPNWKLHNIIETSGGIVVNEESCIGTRYYKDLIDESSTTLEQQLERLTE
FT                   RYMKIDCSCFTPNTERIDQVLKEYEESGAEGIIDYCLQFCHTYNIEAVKLRKACEERGI
FT                   PFMAIESDYSPDDVGQLKTRVEAFIEQIKG"
FT   gene            complement(90119..90991)
FT                   /locus_tag="Glov_0092"
FT   CDS_pept        complement(90119..90991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0092"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93829"
FT                   /db_xref="GOA:B3E9G3"
FT                   /db_xref="UniProtKB/TrEMBL:B3E9G3"
FT                   /protein_id="ACD93829.1"
FT                   /translation="MTLCISYRHFNREAYDQAMALSDSRLTVVRNKNVENGFVNIPSDT
FT                   EICHQNDFGIKLHVMKSDRKRGRRDIVASVAGAVSLGLQSIIHLEAVIIGLLGGAKFDQ
FT                   LIEIIDETIDNFWRTAYDKEIEYLFMLADDSGRTRIFEKIGTPREVYPLEEVPNEHGVY
FT                   FGVIGDRKNEIKGIILCEVNKLLICKPRMPIETALEIACVRAIRREIEDPQNLLVGGNI
FT                   QAAAMKGHEGYYLSAQYDNHLSFRSASYPSQINISRFPLMHPLWPFNSEIYNPRNAIEE
FT                   IQEHVVTDC"
FT   gene            complement(91105..92319)
FT                   /locus_tag="Glov_0093"
FT   CDS_pept        complement(91105..92319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0093"
FT                   /product="filamentation induced by cAMP protein Fic"
FT                   /note="PFAM: filamentation induced by cAMP protein Fic;
FT                   KEGG: gur:Gura_0426 filamentation induced by cAMP protein
FT                   Fic"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93830"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="InterPro:IPR040198"
FT                   /db_xref="UniProtKB/TrEMBL:B3E9G4"
FT                   /protein_id="ACD93830.1"
FT                   /translation="MQDGFYTNISEMEPMLPADPTGELADLAIAVIRKSAAVSTAVHPV
FT                   TRRGIVELVRKMNSYYSNLIEGHTTHPVDIDRAMRNDFFADPAKRARQLESKAHIEVQK
FT                   AIEARLEAAPETIITAKDFLCWIHSEFYERMPEEFRVVQHADGNVERVIPGLLRTSEVK
FT                   VGRHLPPKSACLSAFMQRFEEVYNPGILNSQQQVIAVAASHHRLAWIHPFLDGNGRVTR
FT                   LMTHAYLKKAGLDGHGLWTVSRGFARNREAYLTALAGADQPRRGDLDGRGNLTQAGLLA
FT                   FCSFFLKTAIDQIDFMAGLLELDGMQQRIQAVVDRQVLLGELKPEAGHLLRDIFLRGEL
FT                   PRGEIPKIIGMPERSARRVISALVGKGYLVSDSEKGPVRLGFPAELAGYYFPRLYPEGV
FT                   EASLG"
FT   gene            complement(92490..93422)
FT                   /locus_tag="Glov_0094"
FT   CDS_pept        complement(92490..93422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0094"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gur:Gura_0800 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93831"
FT                   /db_xref="UniProtKB/TrEMBL:B3E9G5"
FT                   /protein_id="ACD93831.1"
FT                   /translation="MRTLLLVVCLLFATLPASAAVINVEFNFTPYLAPADPNAKQVDTI
FT                   PGKAVVFLNNQVLAEQELEKRDLPVLFEEREISPAVWIPASSMGPGLRKGMNSIRVEFT
FT                   PANPTQPYLARFSWSEVTDKETRTDDGAGRSTATNYGGTGKEERPVKGKVVFERAFTAD
FT                   FAVDRAWHHYPPITVVSPADKSSLAALLKERATLFKPNFAAAYKLLEKQPNLTVAAMQK
FT                   AKCLENAYKVGIRVKAPTAEQLEAVISNSPELVLQGKGGSPLHPFNRAAFEKIKGDENQ
FT                   MCAAMALFTLYPPRLTVVRNPAGKWEIVE"
FT   sig_peptide     complement(93363..93422)
FT                   /locus_tag="Glov_0094"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.995 at
FT                   residue 20"
FT   gene            complement(93523..94710)
FT                   /locus_tag="Glov_0095"
FT   CDS_pept        complement(93523..94710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0095"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   gme:Gmet_0806 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93832"
FT                   /db_xref="GOA:B3E9G6"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B3E9G6"
FT                   /protein_id="ACD93832.1"
FT                   /translation="MTHTKHGRASFVLLCLIGSATFFSSYLRIPVLPLFAATLGAGPAQ
FT                   VGLINGAFMVTAGILSIPAGLLVDRLGRTKPVIGGIVATAASSLLVTQCSSPLQLVAVY
FT                   LLFGAGLAAFAPAMLSLVADIVPSERLGRAYGWYTTAIYVAMTIGPATGGYLAKTVGLR
FT                   NVFLVSGTMLATMALLALLVLPRTAARHKTELHAALAASLTLLHNRPLRACLLATTGSC
FT                   IGFGLFLTFLPLFAASHGLDPGQVGLVFAAQAITNVVGRVPIGMIADRLERRLLVSAGL
FT                   FCLALALPALGQTTQLSWMVLCAVGMGIGMAFTFTAISALIVEQVPTVQRGLAMGMYNS
FT                   CIYLGMMTGSTAMGIAFKWVDYPTGFVAAGVIALLTMLLFLLLISKRTNNAATTC"
FT   sig_peptide     complement(94600..94710)
FT                   /locus_tag="Glov_0095"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.971) with cleavage site probability 0.813 at
FT                   residue 37"
FT   gene            complement(94719..95726)
FT                   /locus_tag="Glov_0096"
FT   CDS_pept        complement(94719..95726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0096"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: gur:Gura_3526
FT                   aldo/keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93833"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:B3E9G7"
FT                   /protein_id="ACD93833.1"
FT                   /translation="MKQRKLGTQGLTVSAQGLGCMGMSDFYGTRDEAESIATIHRAFEL
FT                   GVNFLDTSDMYGPFTNEELVGRAIKGRRDQVVVATKFGIVRSNQAGPNGGWAPITGISG
FT                   SPEYVKAACDASLKRLGIDCIDLYYQHRVDAEVPIEETVGAMAELVTAGKVRYLGLSEA
FT                   SAATIRRAHAVHPISALQSEYSLWSREPEDEVLPTLRELGIGLVAYSPLGRGFLTGQLQ
FT                   SPDDFAPDDYRRNSPRFQGENFLKNLEVVERVKAIAARKGITAGQLALAWVLAQGDDIV
FT                   PIPGTKRRSYLEENIAAGGISISSAELADIAAALPKGAASGERYPASMMAFLNR"
FT   gene            complement(95816..97621)
FT                   /locus_tag="Glov_0097"
FT   CDS_pept        complement(95816..97621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0097"
FT                   /product="beta-lactamase"
FT                   /note="PFAM: beta-lactamase; KEGG: gme:Gmet_1507
FT                   beta-lactamase"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93834"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:B3E9G8"
FT                   /protein_id="ACD93834.1"
FT                   /translation="MHHPFKKIACLLLSALLMLALLAGCASPPVRPQALVPGEYGYLKE
FT                   HITWLIRKEMSKNNVQGLSIALVDDQQVVWAEGFGYADTAARLPATADTVYRIGSVSKL
FT                   FTSTAAMQLVEQGRLDLDAPLATYIPDFSLRSRFSNAKPITLRSIMTHHSGIPSDYAKG
FT                   MWTRQPQPISSLPALIRDEYAAFPPDTFLSYSNLGMSLLGLAVQNVSGQEFAGYMQQAL
FT                   LSPLGMQHSAFSPGIGSAAPAARAYSGSDEKPEPPLRDMPAGGLNASVNDMSRFIRMIL
FT                   AEGEFNGQRIIKPETVREMLRPQNSSVALDQGFRIGLGWMLDGLGGINIKNVGTVAHHS
FT                   GATLYHRAQLVVLPQVKLGVIVLSNSNSAQGLVNTISTEALKLAVEIKTGRKQPEKKPI
FT                   LTGEFLSADELKAYEGSYATMAGLGTLTAGPGYLKAELMDRSFRLVPRQDKKLQIQYRL
FT                   LGLFPIDLGELGHYGVSRVNVSGHELLKASDGEQEVVIGEKVTPVALSAAWQQRLGSYR
FT                   ITNLGDDTQFADEISLRLADGLLLIEYTMREFGNARISQVIRPLSDNEAVTVGLWRGMG
FT                   ETIRVLQENGKEQLSFSGYRLEKAP"
FT   sig_peptide     complement(97541..97621)
FT                   /locus_tag="Glov_0097"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.568 at
FT                   residue 27"
FT   gene            complement(97652..97960)
FT                   /locus_tag="Glov_0098"
FT   CDS_pept        complement(97652..97960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0098"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93835"
FT                   /db_xref="UniProtKB/TrEMBL:B3E9G9"
FT                   /protein_id="ACD93835.1"
FT                   /translation="MVTTRRTTVVLVFGLIAAAAACNAQESVPAENPKPPVVLVPATLA
FT                   EPAVDPLLQTVEKKTDRQLAEKPWAWRLLEGMAIGAATNTTQKQSDGRPQTPTTVKP"
FT   sig_peptide     complement(97886..97960)
FT                   /locus_tag="Glov_0098"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.975 at
FT                   residue 25"
FT   gene            98082..98609
FT                   /locus_tag="Glov_0099"
FT   CDS_pept        98082..98609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0099"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ppr:PBPRB1381 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93836"
FT                   /db_xref="GOA:B3E9H0"
FT                   /db_xref="InterPro:IPR021354"
FT                   /db_xref="UniProtKB/TrEMBL:B3E9H0"
FT                   /protein_id="ACD93836.1"
FT                   /translation="MKQQNLTTTSRTLQWTIVGLWLLTLLIAVLRWTAANLVAWLPPTL
FT                   AAQVGSSSVTPAIRLACFVVELIPLAAAYYALAALYRICRAYGRGEIFRLETGILYRRF
FT                   GRGLLLLGGANALYTSLLSALLSFAVQGKLTISVGLSTADLYLLIVGCAVQMLGMVMDE
FT                   AYRLHDENSQIV"
FT   sig_peptide     98082..98201
FT                   /locus_tag="Glov_0099"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.900) with cleavage site probability 0.384 at
FT                   residue 40"
FT   gene            98619..98831
FT                   /locus_tag="Glov_0100"
FT   CDS_pept        98619..98831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0100"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="SMART: helix-turn-helix domain protein; KEGG:
FT                   bur:Bcep18194_A5039 transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93837"
FT                   /db_xref="GOA:B3E9H1"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B3E9H1"
FT                   /protein_id="ACD93837.1"
FT                   /translation="MSIVVNLDIMLAKRKVKSKDLAEQIGITEANLSLLKSGKVKGVRF
FT                   ATLEAICRYLDCQPGDLLEYQPDQE"
FT   gene            complement(98947..99849)
FT                   /locus_tag="Glov_0101"
FT   CDS_pept        complement(98947..99849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0101"
FT                   /product="Pirin domain protein"
FT                   /note="PFAM: Pirin domain protein; KEGG: gsu:GSU0825 pirin
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93838"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR008778"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B3E9H2"
FT                   /protein_id="ACD93838.1"
FT                   /translation="MQPRSISKVFKSVPTIEGAGVHLKRAFGYHQLPLFDPFLMLDDFH
FT                   TNNPDEYLAGFPWHPHRGIETITYILEGRVEHGDSMGNSGVIGAGDVQWMTAGSGVIHQ
FT                   EMPKLSPSGTMWGFQFWTNLPASQKMIAPRYRDVPAATIPEVTLENGASIKVIAGKVAG
FT                   VQGPVQDILADPELLDVRLLPGTVFEHAVTDGYTVVAYLLSGQGYFDQGRDPYAYDYAG
FT                   TGWLDLERDCCFGPETTILYEHQGEGIRVTAGEQGLRFLLLVGQPLGEPIAWQGPIVMN
FT                   SREELRIAFEEYHNGSFVK"
FT   gene            complement(99871..100329)
FT                   /locus_tag="Glov_0102"
FT   CDS_pept        complement(99871..100329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0102"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gme:Gmet_2622 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93839"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B3E9H3"
FT                   /protein_id="ACD93839.1"
FT                   /translation="MDAVAYIDAEVIGFVNDTLVPLRLAAADPLLGPRYRIKWTPTLLI
FT                   LDAEGVEQYRTLGFYPPQELIPSLLLGIGKARFNQPDRPAACDCFSSIIDRYPASPQAP
FT                   EALYLNGVSRYIETHDVANLVAIYDRLAAGYPDSPWLTRADPYRLLKK"
FT   gene            complement(100345..100443)
FT                   /locus_tag="Glov_0103"
FT   CDS_pept        complement(100345..100443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0103"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93840"
FT                   /db_xref="UniProtKB/TrEMBL:B3E9H4"
FT                   /protein_id="ACD93840.1"
FT                   /translation="MEKIAWIESFEEGLQKARSENKLIFADFFNPN"
FT   gene            complement(100464..100967)
FT                   /locus_tag="Glov_0104"
FT   CDS_pept        complement(100464..100967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0104"
FT                   /product="Ferritin Dps family protein"
FT                   /note="PFAM: Ferritin Dps family protein; KEGG:
FT                   mhu:Mhun_0131 ferritin and Dps"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93841"
FT                   /db_xref="GOA:B3E9H5"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR014490"
FT                   /db_xref="InterPro:IPR033921"
FT                   /db_xref="UniProtKB/TrEMBL:B3E9H5"
FT                   /protein_id="ACD93841.1"
FT                   /translation="MGSKGREIIGMDVDELLELLRRAFSDEWLAYYQYWLGAKLVKGPM
FT                   KDAVGAELLQHATEELLHADMVAMRIIQLGGTPVTRPEEWYRHTNCGYDAPDDPFVKVL
FT                   LEQNIKGEQCAIGVYKRLMDITRDKDPVTYNMVLTILQQEIEHEEDLQALLEDYELLVR
FT                   AMKG"
FT   gene            complement(100994..101608)
FT                   /locus_tag="Glov_0105"
FT   CDS_pept        complement(100994..101608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0105"
FT                   /product="flavoprotein WrbA"
FT                   /note="TIGRFAM: flavoprotein WrbA; PFAM: NADPH-dependent
FT                   FMN reductase; flavodoxin/nitric oxide synthase; KEGG:
FT                   eba:ebA2303 TrpR binding protein WrbA"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93842"
FT                   /db_xref="GOA:B3E9H6"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR010089"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="InterPro:IPR037513"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3E9H6"
FT                   /protein_id="ACD93842.1"
FT                   /translation="MSKIQIVFYSMYGHIHTMAEAVADGVRSVGGCSAELLQVPELISE
FT                   EVLEKYGAKAARAAFAHIPTATVERLAEADAIIFGTPTRFGNMAAQMRNFLDQTGKLWL
FT                   SGGLVGKVGSVFASTATQHGGQETTITSFHSTLLHHGMIIVGVPYTEQRLLTMDEISGG
FT                   SPYGATTLAGGDGSRRPSENELAIARFQGAHVAKITARLTA"
FT   gene            complement(101961..103049)
FT                   /locus_tag="Glov_0106"
FT   CDS_pept        complement(101961..103049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0106"
FT                   /product="NADH:flavin oxidoreductase/NADH oxidase"
FT                   /note="PFAM: NADH:flavin oxidoreductase/NADH oxidase; KEGG:
FT                   pol:Bpro_5550 NADH:flavin oxidoreductase/NADH oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93843"
FT                   /db_xref="GOA:B3E9H7"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B3E9H7"
FT                   /protein_id="ACD93843.1"
FT                   /translation="MKLFSAYTLGTVKLQNRVVMSPMTRSRATDNLPNSLMADYYGQRS
FT                   GAGLIITEGTSPSPNGLGYARIPGAFSPQQTAGWQRVADAAHAGGARIFMQLMHCGRVG
FT                   SRLNLPPGAELVAPSACALSGKIWTDSQGEQPYDPPREMRLHEIEQTINEYVLAAQNAL
FT                   AAGFDGVEVHGANGYLINQFLDPGSNRRSDEYGGDAACRNRFALDVAAAVIAEIGAERV
FT                   GIRLSPYGVFNEMSGAYDGIADQYVALAAAAGGLGLTYLHLVDHSAMGAPRPEPATVQA
FT                   MCRAFRAGGGAGVILSGGYDGERAEADLQSGAADLIAFGRPFIANPDLVARIKAGYPLA
FT                   LPDQTTFYSPGPAGYTDYPAMP"
FT   gene            complement(103081..105405)
FT                   /locus_tag="Glov_0107"
FT   CDS_pept        complement(103081..105405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0107"
FT                   /product="PAS/PAC sensor hybrid histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="KEGG: ppd:Ppro_2061 PAS/PAC sensor hybrid histidine
FT                   kinase; TIGRFAM: PAS sensor protein; PFAM: response
FT                   regulator receiver; ATP-binding region ATPase domain
FT                   protein; histidine kinase A domain protein; PAS fold-4
FT                   domain protein; PAS fold domain protein; SMART: PAS domain
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93844"
FT                   /db_xref="GOA:B3E9H8"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B3E9H8"
FT                   /protein_id="ACD93844.1"
FT                   /translation="MNEEKLRLFVEYAPAALAMFDREMRYLYVSRRWLTDYRLGDRDLR
FT                   GLSHYDVFPEIQQRWKELHSRCLAGESLSADSDRFVRADGTVQWLRWEIRPWFVTPDEI
FT                   GGIVIFSEDITKLKQAEDVLRRYELLSKYSRDIALFIRRGDGRILEANDAAVRTYGYSH
FT                   DELLGMTIYDLRTPDCAAPAPAQMEEADTHGILFETVHRTKEGRAFPVEVSSCGVDIGD
FT                   DRILLSLVREISKRKEAEAELKRNAEVEHARLAELEALMQAVPAAVLISHDPHCHVITG
FT                   NHAAYELLRMEYGSNTSKSNPDAKTSHFKVLHQGKELSVAELPLQQAIATGMPVCNFEE
FT                   EILFDNGDCVSVYGNAVPLRDASGSITGVVAAFVDIGQLVQAQEEARQARLAAEAANRA
FT                   KSAFLANMSHEIRTPLNGIVGTAQLLEFTRLTGEQKDYLADIKSSSSTLLSLLNDVLDL
FT                   SKIEAGKITLESLDFRLRASIDGVIKSLKSLAQSKGLQIELQIPDSVPDCLKGDQTRFK
FT                   QILLNLLGNAVKFTETGGITVSVRLKEQHNDQLLLEIDVKDTGIGISPQMLEMIFEPFT
FT                   QAETSLTKKYGGTGLGLAICKRLVTMMGGQLWAESVAGGGSTFHLAAPFSLCTQQDAEC
FT                   PLDAPPPAATEWDGPPLRILLADDHEINLKFTSRLLEKFGHTVVQARDGQEALQLWEQH
FT                   DFDLILMDVSMPVVSGIEAVGVIRQKERDTHRHLPIIALTGHASVQIKEQVAHQGFDGC
FT                   LIKPIPLEVLLQELKRHLPGC"
FT   gene            105730..107019
FT                   /locus_tag="Glov_0108"
FT   CDS_pept        105730..107019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0108"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG: gsu:GSU3329
FT                   radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93845"
FT                   /db_xref="GOA:B3E9H9"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023874"
FT                   /db_xref="UniProtKB/TrEMBL:B3E9H9"
FT                   /protein_id="ACD93845.1"
FT                   /translation="MATDLMDRLKILADGAKYDVSCSSSGSSRSNSNGIGSAASCGICH
FT                   SWTSDGRCVSLLKILMTNRCIYDCAYCVNRRSNDVQRVALSPAEVAELTIGFYRRNYIE
FT                   GLFLSTGVVRSADYTMELLIQAVRTLREQYRFNGYIHLKLVPGADPLLVQQAGLWADRV
FT                   SVNLELPTRESLQLLAPDKTRDSVVEPMRQVSNLITTNRAERKQSRKVARFAPAGQSTQ
FT                   LIVGATGESDRQIVTLSEQLYQRLDLKRVYYSAFIPAVADSRLPARPEAPLKREHRLYQ
FT                   ADWLLRYYGFSAHELLDEGSPNLDSELDPKTGWALRHIELFPVEINRASYEELLRVPGV
FT                   GVLSAQRIVRARRQGHLGLDDLFRLGVVMKRARYFITARGRSLEAAALDSSSLRSRLID
FT                   RTMSRKPQQLSLDFSNPVDDETRSLITGEL"
FT   gene            107019..107768
FT                   /locus_tag="Glov_0109"
FT   CDS_pept        107019..107768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0109"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gsu:GSU3328 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93846"
FT                   /db_xref="InterPro:IPR023875"
FT                   /db_xref="InterPro:IPR025404"
FT                   /db_xref="UniProtKB/TrEMBL:B3E9I0"
FT                   /protein_id="ACD93846.1"
FT                   /translation="MSGCYCYDGTLAGLLTLYARLLPERVAVERISATPPDQQSLFSSE
FT                   ICIATDQAVAEAFWQRLTKRLSGNSLKLLRRCLLADHPQQELLIYHYLLLEAEQGWKVD
FT                   GMLAHPQVAPVWKLSRQVGREAHRYLGFVRFQQLQDGLYYAAIAPDHRILLLIGAHFAE
FT                   RFRDQQWIIHDQRHGEGIVYDCNSKEWLLLPMEVTAQPDVTPEEAQFQKLWHSYFTTLA
FT                   IPERRNLKLQQGKVPLKVRSYLTEFTV"
FT   gene            complement(107758..108267)
FT                   /locus_tag="Glov_0110"
FT   CDS_pept        complement(107758..108267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93847"
FT                   /db_xref="UniProtKB/TrEMBL:B3E9I1"
FT                   /protein_id="ACD93847.1"
FT                   /translation="MKKFLLRVITLPACVCLGSPADSSLPAAYAAVVHAVHEIVVTGCE
FT                   NESIAISKMKEKRKQLGKKTVFSEISLEPKSMGVVRYHPTPFVSGHNIMTTPDADGAYP
FT                   GKALAKAQQFPDGQGLWIQYSVKDVVSGDKLQRHMYCEKYKFNLYCGSLPASYDLRAHM
FT                   TATLTP"
FT   sig_peptide     complement(108175..108267)
FT                   /locus_tag="Glov_0110"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.627 at
FT                   residue 31"
FT   gene            complement(108414..108716)
FT                   /locus_tag="Glov_0111"
FT   CDS_pept        complement(108414..108716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0111"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93848"
FT                   /db_xref="UniProtKB/TrEMBL:B3E9I2"
FT                   /protein_id="ACD93848.1"
FT                   /translation="MKQVTCLGIKMVLLGCASAGCLLLGGCGGASYVWYQAGRDQAAFK
FT                   QDHLQCEEEAALFAKHMDKRGDKEVISTRMKDCMGVRGYVKVLEEDLPAGAEKLQ"
FT   sig_peptide     complement(108627..108716)
FT                   /locus_tag="Glov_0111"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.807) with cleavage site probability 0.429 at
FT                   residue 30"
FT   gene            complement(108742..110325)
FT                   /locus_tag="Glov_0112"
FT   CDS_pept        complement(108742..110325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0112"
FT                   /product="Thaumatin pathogenesis-related protein"
FT                   /note="SMART: Thaumatin pathogenesis-related protein; KEGG:
FT                   ppp:PHYPADRAFT_154130 hypothetical protein Pfam: Thaumatin
FT                   PROSITE: THAUMATIN"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93849"
FT                   /db_xref="InterPro:IPR001938"
FT                   /db_xref="InterPro:IPR037176"
FT                   /db_xref="UniProtKB/TrEMBL:B3E9I3"
FT                   /protein_id="ACD93849.1"
FT                   /translation="MASVRLKLLALLSITTCLVAAVGQAAEAPGFSKLRYECEKKAAEY
FT                   TYNLDKAGDQEIFARHLQECLEAAQAAPRPLQAAVALPQAESCVPLNFVNNSGEDIFLG
FT                   VWLGKANRGQAPDKSSFPDWKLEAGKTRSWCAPSTFNGRFVARTGCEGNKCAVGDCCQD
FT                   SGGNGCGDNTCTTGNQPASMAEFTLNDKDGKSWYNVSYVDGYNFPIQITLTTTASSSCT
FT                   KTVGCSALPACPWTDRPAGGVCLAPYKLFEADNKDFLKKQQYFILAAKCASDSTCGCGN
FT                   QCSDKAPCPDKNPVTGIASAGCSPLALKAGDYGKWGDSKDKQGKPGKPVDKAAQNQVVC
FT                   IEQEDGCKFVWDAASKRYPDTIKNSGCSGAYTWQYDDAGSLGNCKANEIKGFTISFGKR
FT                   AAGTIPIQLPNFLLHPTGGLSGTYSIDSGSAHPFTSPDAVPLRVKDGTILTLVRNCSGG
FT                   GKLTCLMTYNSKTNFTTNDKTCKNPVVGAISWNEAKDRLHDLNLGIPNKDAIQNGRDAE
FT                   DNQPFTNLCK"
FT   sig_peptide     complement(110248..110325)
FT                   /locus_tag="Glov_0112"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.986 at
FT                   residue 26"
FT   gene            110563..110880
FT                   /locus_tag="Glov_0113"
FT   CDS_pept        110563..110880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0113"
FT                   /product="small multidrug resistance protein"
FT                   /note="PFAM: small multidrug resistance protein; KEGG:
FT                   mca:MCA0758 SugE protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93850"
FT                   /db_xref="GOA:B3E9I4"
FT                   /db_xref="InterPro:IPR000390"
FT                   /db_xref="UniProtKB/TrEMBL:B3E9I4"
FT                   /protein_id="ACD93850.1"
FT                   /translation="MAWTYLILAGLLEIGWPIGLKLGWTENGPRPLWLGFAVLCIILSG
FT                   SFLLQAQRVIPMGTAYAVWTGIGAVGTFAVGIVAFGDAVSMLRIASAGLIIAGVVGLKF
FT                   A"
FT   gene            complement(110999..111760)
FT                   /locus_tag="Glov_0114"
FT   CDS_pept        complement(110999..111760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0114"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; Tellurite resistance methyltransferase, TehB,
FT                   core; KEGG: sat:SYN_02919 6-O-methylguanine DNA
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93851"
FT                   /db_xref="GOA:B3E9I5"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:B3E9I5"
FT                   /protein_id="ACD93851.1"
FT                   /translation="MDRAEPVKPDQQEQWDSQFSRSDAFFGEQPSEFARVSLELFRQNG
FT                   VRSLLEVGCGQGRDTVLFAGQALAVTALDYSEAAVAAVRKKAADAGLLALIHPHSHDVR
FT                   EALPFADEQFDACYSHMLLCMELSNAEIAFVLREMHRVLKPGGLALYSVRSNFDRHYRA
FT                   GTHWGEDIYEIGGFAVQFFTAEKIRRLSRGYELLQVNRMEEGSLPRDLFCVTMRKGAAP
FT                   QTWDLPPCNEDTSCDPLNRCKGSPEPPPGRT"
FT   gene            complement(111949..112050)
FT                   /locus_tag="Glov_0115"
FT   CDS_pept        complement(111949..112050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0115"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93852"
FT                   /db_xref="UniProtKB/TrEMBL:B3E9I6"
FT                   /protein_id="ACD93852.1"
FT                   /translation="MADLKSQWVKIGFTVEDGPLVEAIFRQHRLIKE"
FT   gene            complement(112038..112826)
FT                   /locus_tag="Glov_0116"
FT   CDS_pept        complement(112038..112826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0116"
FT                   /product="restriction endonuclease"
FT                   /note="PFAM: restriction endonuclease; KEGG: gme:Gmet_1797
FT                   DNA topoisomerase I:restriction endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93853"
FT                   /db_xref="GOA:B3E9I7"
FT                   /db_xref="InterPro:IPR007560"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/TrEMBL:B3E9I7"
FT                   /protein_id="ACD93853.1"
FT                   /translation="MPRQKTSPFEELVLATSRLPWWVGIVLALVSYAVLHQIAGRPLTS
FT                   ATVGEMVVKGMLASLAMLGQYILPFGFGLAALISGINALRQKRLYEKAAAAADATALNQ
FT                   MSWGDFERLVAEHFQRAGFQVSRAGGNGPDSGIDLVVRKNSEKHLVQCKQWKAYKVGVQ
FT                   PVREFYGVMAANGAAGGYFVTSGVYTDEAIKFAQGLNLELIDGPQLKSLIDRVRLSPAP
FT                   SVSQQETKALAPACTAPATSRPGFRQITTGPGATGSLWPT"
FT   gene            complement(112965..114128)
FT                   /locus_tag="Glov_0117"
FT   CDS_pept        complement(112965..114128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0117"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   gur:Gura_2886 transposase, IS4 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93854"
FT                   /db_xref="GOA:B3E228"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:B3E228"
FT                   /protein_id="ACD93854.1"
FT                   /translation="MPRHFRPFCRHGKPLVYSRLFKPLVDGLPSLTPLKSRSNRPLTFT
FT                   FEHQLSSLTWFHLHDHQSGRELLQVLDQDAFAKDHIAPPEGVSRGAFFEAMNTRGVQQL
FT                   IEMYHYLQGQAKKLLPAAHPEWGDLIGIDGSLIDAMASMQWADYRDGAHKAKVHVGFDL
FT                   NRGIPEKLFLSAGKADERPFVAKILKSGQTGVMDRYYQCHKNFDEWQEAEKHFVCRIRK
FT                   ATRKTVLKERELLEGSHVFLDVECLLGTKGQNQTEKPVRVIGYKVENKDFYVATDRFDL
FT                   KAEEIALIYKLRWDIEIFFGWWKQHLKVYHLIARSPNGLMAQIMGGLITYLLLAIYCHE
FT                   EHQEKVSIQRVRELRIAIHNEIIQMMAEYENDAKTETSTEYPAHASP"
FT   gene            complement(114710..115261)
FT                   /locus_tag="Glov_0118"
FT   CDS_pept        complement(114710..115261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0118"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ppd:Ppro_1903 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93855"
FT                   /db_xref="GOA:B3E9I9"
FT                   /db_xref="UniProtKB/TrEMBL:B3E9I9"
FT                   /protein_id="ACD93855.1"
FT                   /translation="MTPSTPSMLGVLKLFIIPVGGGIPAGVMLAQAKGLTWPLTAGIYL
FT                   VSDLLLAIVFEPILRMLAMLFGKIPFLARFNAAFKVAMARSTAQFSGTGAGPFALVMIA
FT                   FGVDPMTGRASALAAGHGFIAGWAFAIAGDMLYFAVIAITTLRLNRYIRDPDTTMLIVL
FT                   GIMFMAPILVRSIRRARQPA"
FT   gene            complement(115289..115648)
FT                   /locus_tag="Glov_0119"
FT   CDS_pept        complement(115289..115648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0119"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bte:BTH_II0226 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93856"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:B3E9J0"
FT                   /protein_id="ACD93856.1"
FT                   /translation="MIDQAFAHSFANEWIEAWNNHDLEQVLSHYADDFEMHSPVIAQIA
FT                   GEPSGMLQGKQAVGAYWSQALQLLPDLQFELITVLAGVSSITLYYRGALDRLAAEVFHF
FT                   GPDGKVVKAFAHYGV"
FT   gene            complement(115722..116510)
FT                   /locus_tag="Glov_0120"
FT   CDS_pept        complement(115722..116510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0120"
FT                   /product="Beta-lactamase"
FT                   /EC_number="3.5.2.6"
FT                   /note="PFAM: penicillin-binding protein transpeptidase;
FT                   KEGG: gur:Gura_3505 beta-lactamase"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93857"
FT                   /db_xref="GOA:B3E9J1"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR002137"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:B3E9J1"
FT                   /protein_id="ACD93857.1"
FT                   /translation="MPRLHLYAVLLLLICVVTPARAEDAVLARLFSDRKVSGTLLIANL
FT                   KGNALHLHDEARANKPLLPASTFKIPNTLIALDEGVVTEQERLKWDGTDRGVPAWNRDQ
FT                   TLTSAFKNSCVWCYQELAQRIGIARYRQWLKKIDYGNADPGPGLTSFWLSGDLRISAVQ
FT                   QMLFLHKLYKRELPFKASSYDALARIMLMEEKPGYRLYAKTGWAGYGEKNTPQTGWYVG
FT                   YVETGTEVWFFALNMAITKPAEGAYRQQIVMEALKLKGII"
FT   sig_peptide     complement(116442..116510)
FT                   /locus_tag="Glov_0120"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 23"
FT   gene            complement(116547..116972)
FT                   /locus_tag="Glov_0121"
FT   CDS_pept        complement(116547..116972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0121"
FT                   /product="Cupin 2 conserved barrel domain protein"
FT                   /note="PFAM: Cupin 2 conserved barrel domain protein; KEGG:
FT                   bwe:BcerKBAB4_2394 cupin 2 conserved barrel domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93858"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B3EA30"
FT                   /protein_id="ACD93858.1"
FT                   /translation="MTTTAQNYSADHIGPFEELLNKDFMGFHGKYFIGKELGLTGCEVS
FT                   LNRLPAGKAMPFIHSHKKNEELYIVLRGSGMFYVDGDEFPIQEGSLVRVAPEGERGWKA
FT                   GDEDLYFICIQAEAGSLTQATLEDGKRHDTKASWMQK"
FT   gene            complement(117018..117875)
FT                   /locus_tag="Glov_0122"
FT   CDS_pept        complement(117018..117875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0122"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding protein"
FT                   /note="KEGG: mbn:Mboo_0430 4Fe-4S ferredoxin, iron-sulfur
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93859"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:B3EA31"
FT                   /protein_id="ACD93859.1"
FT                   /translation="MDAVMQIENIIRSFWASHPSNSLHLATGEKAWLEPQLAIARGDDP
FT                   LFLRIKELIGPFLWTPQEAYAQAFPKAPAAAEELRVISYLLPQTPETRADQCQETTVPA
FT                   ERWARSRFHGEEFNCELRLHLAATLTQLGYPAVAPERLPGFAYRQSERFGLASNWSERH
FT                   VAFVAGHGTFGLSDALITRWGKAVRFGSVVSRINLPVTPRVYGDDHHAWCLWYAKGSCG
FT                   ACAKRCPVDAITTANGHDKQACFTYIRETTTPYATATYGTGATPCGLCQVKIPCEARVP
FT                   VALQ"
FT   gene            complement(118038..118592)
FT                   /locus_tag="Glov_0123"
FT   CDS_pept        complement(118038..118592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0123"
FT                   /product="nitroreductase"
FT                   /note="PFAM: nitroreductase; KEGG: gur:Gura_3515
FT                   nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93860"
FT                   /db_xref="GOA:B3EA32"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:B3EA32"
FT                   /protein_id="ACD93860.1"
FT                   /translation="METLEAIKTRRSIRKFSDQPVEPEKLQAVLEAVQQAPSWSNRQCW
FT                   SLVVVQDQDLRNRISELSFVESFFATYGYKSNPAQKGLAQAPIVLVACADPQQSGDLRG
FT                   EQYYMADLGIASQNLMLAAHDLGLGTVFVGVFDEEQLKGLLGIPAHIRIVGLFPLGYPA
FT                   GEAKGGPPRKPLSEFVHYGTW"
FT   gene            complement(118641..119087)
FT                   /locus_tag="Glov_0124"
FT   CDS_pept        complement(118641..119087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0124"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   cph:Cpha266_1314 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93861"
FT                   /db_xref="GOA:B3EA33"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B3EA33"
FT                   /protein_id="ACD93861.1"
FT                   /translation="MSSIALATAADIPRLNELLAILFTQEADFRPDLSRQSAGLRQIIE
FT                   NPALGHILVLREDSAIVGMVNLLYTVSTALGDRVAILEDMIIDPGYRGGGGGSRLLDGA
FT                   IAFARQQGCLRITLLTDRTNSGAIRFYERHGFALSEMVPLRLLL"
FT   gene            complement(119150..119722)
FT                   /locus_tag="Glov_0125"
FT   CDS_pept        complement(119150..119722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0125"
FT                   /product="NADPH-dependent FMN reductase"
FT                   /note="PFAM: NAD(P)H dehydrogenase (quinone);
FT                   NADPH-dependent FMN reductase; KEGG: gsu:GSU0772
FT                   NADPH-dependent FMN reductase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93862"
FT                   /db_xref="GOA:B3EA34"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:B3EA34"
FT                   /protein_id="ACD93862.1"
FT                   /translation="MKIVSLLGSPRSTGNSATIARHLLQTAAGLGAETQTFELNRLAYR
FT                   GCQACYACKQGREDCVLNDDLTEVLAAVQAADAVVLATPVYYGDITAQLKGFIDRSYSY
FT                   LVPDYLTNPQPSRLSSKKLVFILTQGQPEEAMFADIFPRYDFFLKWMGFTETRLIRACG
FT                   IGPANGNDKAPETALQQAAEAARHLMA"
FT   gene            complement(119719..120303)
FT                   /locus_tag="Glov_0126"
FT   CDS_pept        complement(119719..120303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0126"
FT                   /product="flavin reductase domain protein FMN-binding"
FT                   /note="PFAM: flavin reductase domain protein FMN-binding;
FT                   KEGG: gur:Gura_2846 flavin reductase domain protein,
FT                   FMN-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93863"
FT                   /db_xref="GOA:B3EA35"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:B3EA35"
FT                   /protein_id="ACD93863.1"
FT                   /translation="MKQSVGAKTLAMPTPVWLVGSYDADNKPNIMTIAWGGICCSTPPC
FT                   VTVSLRKATHSYAAIEARKAFTVSIPSAEQVAEADFCGIASGRDTDKFGACNWTPVKSE
FT                   LVDAPYVSEAPLVIECRLLHTLEIGLHTQFVGEIVDIKADETVLGAKGYPDITKVKPFI
FT                   WDAAHRRYFGLGEYLGTAWEIGKTITTEESP"
FT   gene            complement(120555..121136)
FT                   /locus_tag="Glov_0127"
FT   CDS_pept        complement(120555..121136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0127"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: ppd:Ppro_2215
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93864"
FT                   /db_xref="GOA:B3EA36"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011075"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:B3EA36"
FT                   /protein_id="ACD93864.1"
FT                   /translation="MEKKDTRSDIIKIGTELISRQGYNATGIEMVLKEAGVPKGSFYHY
FT                   FKSKEEFGLAVMDVFADYYSRRMTALLQDTELSPLSRIRTLLEGSLQRFSNNQCSKGCL
FT                   IGNLGQEMADQNERFRARLDEIFDDWRALFGDCLREAQAAKELDSRLDADAMASFILSG
FT                   WEGAILRAKVMKSPQPLQDFIEVLFNVTLR"
FT   gene            complement(121256..121975)
FT                   /locus_tag="Glov_0128"
FT   CDS_pept        complement(121256..121975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0128"
FT                   /product="LrgB family protein"
FT                   /note="PFAM: LrgB family protein; KEGG: gme:Gmet_1204
FT                   LrgB-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93865"
FT                   /db_xref="GOA:B3EA37"
FT                   /db_xref="InterPro:IPR007300"
FT                   /db_xref="UniProtKB/TrEMBL:B3EA37"
FT                   /protein_id="ACD93865.1"
FT                   /translation="MNSDMSQLWCYLSTSPLLWLTVTLLAYQLGVWCFQRCGCSQLLNP
FT                   VLTAVLVLVLLLKLSATDYQTYFRGAQFIHFLLGPATVALAIPLYREIAVIRKSFMPII
FT                   VALFAGSLAAILSAVGIARLLGGERILLLTLSPKSVTTPIAMGISEQIGGLPALTAVAV
FT                   VLTGITGVVIGDLVLNRMKVHDETARGMAFGIASHGIGTAHAMHKSRVTGAFSALAMAL
FT                   NGLLTALLLPLLVSLLR"
FT   gene            complement(121972..122337)
FT                   /locus_tag="Glov_0129"
FT   CDS_pept        complement(121972..122337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0129"
FT                   /product="LrgA family protein"
FT                   /note="PFAM: LrgA family protein; KEGG: gme:Gmet_1205 LrgA"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93866"
FT                   /db_xref="GOA:B3EA38"
FT                   /db_xref="InterPro:IPR005538"
FT                   /db_xref="UniProtKB/TrEMBL:B3EA38"
FT                   /protein_id="ACD93866.1"
FT                   /translation="MLGPLTVILLCQLVGEIIAKAGGLPIPGPVIGMVILFCGLVLRGN
FT                   LSPELETVTGFLHRYLPLLFVPAGVGVITSLDLLARSWVPLAGAIVIGTAVTIAVTGLV
FT                   MQRANRRHTPDHQEVQP"
FT   gene            complement(122375..122776)
FT                   /locus_tag="Glov_0130"
FT   CDS_pept        complement(122375..122776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0130"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   fre:Franean1_3939 thioesterase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93867"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B3EA39"
FT                   /protein_id="ACD93867.1"
FT                   /translation="MAVEPATLESGNRIPFLQTLGIQLREIGDRHAIMQVTVSEMHRNY
FT                   LGGAHGGLLATLVDTVAFFPRPLLPSGTACTTTSLNVSYIRPAAVGDTLTARSELLHLG
FT                   RRTASVRVEITNQDAGLVAHGVIGLLLLG"
FT   gene            122982..123455
FT                   /locus_tag="Glov_0131"
FT   CDS_pept        122982..123455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0131"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: amt:Amet_3237 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93868"
FT                   /db_xref="GOA:B3EA40"
FT                   /db_xref="UniProtKB/TrEMBL:B3EA40"
FT                   /protein_id="ACD93868.1"
FT                   /translation="MMSATLYGMTAVALLLSWWFDREKTHRALKIGARSLYVLLPKILG
FT                   MIALVGLVLALVPPELITRLFSFRGIGGFVLVAAIGAIITMPAPIAFPLVGSLLRLGAA
FT                   PATLATFVTTLTMVGIITAPIEISYFGRRFTLIRQSLSFVTAIIIGLLMGVFL"
FT   gene            123455..123997
FT                   /locus_tag="Glov_0132"
FT   CDS_pept        123455..123997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0132"
FT                   /product="conserved hypothetical membrane protein"
FT                   /note="KEGG: pth:PTH_0544 hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93869"
FT                   /db_xref="GOA:B3EA41"
FT                   /db_xref="InterPro:IPR005524"
FT                   /db_xref="UniProtKB/TrEMBL:B3EA41"
FT                   /protein_id="ACD93869.1"
FT                   /translation="MKAHLASYRLFLAVLGINLLLLLWQPALARHSTVNSLSFLLEVLS
FT                   IVPPVMILMGLLDVWVPRRLVEAHLGPDAGLLGAVVAILLGTAAAGPLYAAFPVAISLQ
FT                   KKGARLANIVIFLGTWATIKIPMIMMESSFIGLRFALLRLLFTIPCILLAGYLMERVIP
FT                   LESLPDNTASAAKTCQI"
FT   sig_peptide     123455..123544
FT                   /locus_tag="Glov_0132"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.910) with cleavage site probability 0.903 at
FT                   residue 30"
FT   gene            124011..124355
FT                   /locus_tag="Glov_0133"
FT   CDS_pept        124011..124355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0133"
FT                   /product="transcriptional regulator, PadR-like family"
FT                   /note="PFAM: transcriptional regulator PadR family protein;
FT                   KEGG: mba:Mbar_A0520 transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93870"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B3EA42"
FT                   /protein_id="ACD93870.1"
FT                   /translation="MPPKRKQQYRHMPAFILLALAEGPIHGGAIHTVLAERMPLYKPDT
FT                   SAIYRTLQQLEQDGEVVSEWDTSKSGPARKRYQLTGAGWKKLEYWREDIEMRIANLQYF
FT                   LTTYQAIVKG"
FT   gene            124446..125234
FT                   /locus_tag="Glov_0134"
FT   CDS_pept        124446..125234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0134"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tcr:507957.179 mucin-associated surface
FT                   protein (MASP), putative Pfam: TolA Phasin_2 MAP7 Vicilin_N
FT                   PROSITE: ALA_RICH"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93871"
FT                   /db_xref="UniProtKB/TrEMBL:B3EA43"
FT                   /protein_id="ACD93871.1"
FT                   /translation="MELTALLKQYNLPLTGTERALVNGLKSNSSSRPDEYYEQQLKQLA
FT                   DAREALKRLPDKKTSDRQKKSEKIKMLKDRLKMLKQMIPFMSPSAAKSLKAELKQIAAQ
FT                   IASLKDDSGSGGAVFSGSSDSAAGATVASSDAAGTAAEADAAATEAGVVTEAAEASSDT
FT                   EDAENTDAGEKTGEPKDTETANAANSYQEQANQSKAESAADRAEKEELEKLKQLYQAVK
FT                   NMLERKLQRPDDPATQAALQIQAYHAASEIISSSAVSIKG"
FT   gene            complement(125249..126433)
FT                   /locus_tag="Glov_0135"
FT   CDS_pept        complement(125249..126433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0135"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="KEGG: ppd:Ppro_2848 FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93872"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B3EA44"
FT                   /protein_id="ACD93872.1"
FT                   /translation="MIDREAYCSGGLLNDCKQNYSYPIGFAEDIWSREEAERLLPLVEE
FT                   RLQPAVKEKHNLSVYQRRAERLGVSLLDVRQAHVGTDRSKELILRLRGELEARGVRFML
FT                   EREVADIFDEQGRAGVVMAGGETLRCRKVLAAPGRKGFAFLQQVMERMGIAYIDNVVDI
FT                   GIRVETRLENYPIVTDYYDPKFLFPEKVRTFCTNSGHARVVLEQYHGFSLVNGHAFSEQ
FT                   RTGNNLANFALLKTIGLKNPVRSGQQMAVFLARLANEIGGGKPIMQRVGDFRMGRRSNS
FT                   ETFNDDLFSFPPTCPVSAGDLGLVVPAKIMRHLWGALKKLDTIVPGVLHPSTIMYYPEI
FT                   KMYANKPAFLDPFFRVTDNVYMAGDGAGTSRGITGAWASGIRVAEGIGAAGLAH"
FT   gene            complement(126433..128430)
FT                   /locus_tag="Glov_0136"
FT   CDS_pept        complement(126433..128430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0136"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /note="TIGRFAM: PAS sensor protein; PFAM: ATP-binding
FT                   region ATPase domain protein; histidine kinase A domain
FT                   protein; PAS fold-3 domain protein; KEGG: mgm:Mmc1_3070
FT                   multi-sensor hybrid histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93873"
FT                   /db_xref="GOA:B3EA45"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR033425"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B3EA45"
FT                   /protein_id="ACD93873.1"
FT                   /translation="MYDTAGSTSRSLLLKGALFSIFTVLLYLIAQRDYLVFHSFAELFS
FT                   IVIACGIFMLAWNSRAFYDNNYLLFIGITYLFVAFFDTLHTLAYRGTGIFTSFDHNNLA
FT                   PQLWLVARYLESIALLTAPLFFRRRLQITGVFLLAGAVSVLALWSIFWARNFPDCFISG
FT                   LGLTPFKCTSEYLIVLILAAALALLYREKAHFEPNVLRLLTLSISCTIITELFFTIYTD
FT                   LYGVFNFVGHIFKILSFGFMYKAIIETALRQPYSLLFRELKQSEETLRQKEESLLLAQR
FT                   LAHMGSWEWNLHDNSMWWSDEMYALFDYDKQQTTACLERIFERVHPDDMPAVQQATAAY
FT                   LQEKQPLKFSHRIIQRDGSVHHLQVEFNRPRRDQRGTALLAVGIVHDITDQVQAAKMRE
FT                   DIELITHHDLKTPLNPVIGIPEILLMDANLTPEQTELIQMIKTCGYRILNIIDSSLSLY
FT                   KMEQGTYTLTTTSCNLLQLIHEIARGSEQQLTRKQLKLTCLIKGAPAGPDDLFMVPCEE
FT                   LLCYTMLSNLISNAVEASPPGADITVSCEQDALWSSITIHNQGAVPVEIRASFFDRYVT
FT                   HGKQKGTGLGTYSALLAARTHHGDISMTTSEEGGTFSLRCACRTTLKQHSPPRSIPCNP
FT                   VTRISSLSVPVRPDWEPPFSSPARHPVFRS"
FT   gene            complement(128639..129091)
FT                   /locus_tag="Glov_0137"
FT   CDS_pept        complement(128639..129091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0137"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   gur:Gura_4377 multi-sensor signal transduction histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93874"
FT                   /db_xref="GOA:B3EA46"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B3EA46"
FT                   /protein_id="ACD93874.1"
FT                   /translation="MKTEFDQKTALAMLWVEDDEMILELQASLIIASFPAITLYTAANG
FT                   KQGLELFLTHTPDIVVTDINMPEMCGVQMAETIRAIKPDTKLIAISGKTAETGKNGKFS
FT                   LQSPAGKTTEFDCFIVKPVLLADLFSAIEKCLAEIAQQASKPGCSA"
FT   gene            129107..129175
FT                   /pseudo
FT                   /locus_tag="Glov_0138"
FT   gene            complement(129216..129767)
FT                   /locus_tag="Glov_0139"
FT   CDS_pept        complement(129216..129767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0139"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="PFAM: regulatory protein MerR; Transcription
FT                   regulator MerR DNA binding; KEGG: ppd:Ppro_1394
FT                   transcriptional regulator, MerR family"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93875"
FT                   /db_xref="GOA:B3EA47"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:B3EA47"
FT                   /protein_id="ACD93875.1"
FT                   /translation="MYRISQLARSFKLSRSTLLYYDRVGLLCPSGRSEAGYRLYSTADK
FT                   ERLALICSYRQAGLGIEEIRCLLATAADGSEAVIRQRLQAIGSEIRQLQAQQRLLAGML
FT                   TLPTGGELSQAVDKQTWIEMLRAAGMDDQAMLQWHSEFERRAPQAHQAFLLSLGISEQE
FT                   TEQIRKQAASQTTLPFSTST"
FT   gene            complement(129822..130007)
FT                   /locus_tag="Glov_0140"
FT   CDS_pept        complement(129822..130007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0140"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gsu:GSU2778 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93876"
FT                   /db_xref="UniProtKB/TrEMBL:B3EA48"
FT                   /protein_id="ACD93876.1"
FT                   /translation="MQPNVTVEEWVARFRAIGLDQAAMQQWHHLFETENPAGHQSFLEW
FT                   LGLSNERIAEIRAKSA"
FT   gene            complement(130139..130609)
FT                   /locus_tag="Glov_0141"
FT   CDS_pept        complement(130139..130609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0141"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ote:Oter_3606 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93877"
FT                   /db_xref="UniProtKB/TrEMBL:B3EA49"
FT                   /protein_id="ACD93877.1"
FT                   /translation="MRLKILLFLMLISMAATAWAGPFTDEMSKCLVRSTSEADKTLLIK
FT                   WIFAAMATHPDVRSLSAVTPEKGEQLNKETAKLVMRLLTVSCKTETRQAVEFEGEDTFK
FT                   ASFGVLGQVAMQGLMANAEVSNYFSGFEKHLDAKELQRALGKEQTKPATPTK"
FT   sig_peptide     complement(130547..130609)
FT                   /locus_tag="Glov_0141"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 21"
FT   gene            complement(130712..132556)
FT                   /locus_tag="Glov_0142"
FT   CDS_pept        complement(130712..132556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0142"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; KEGG: gur:Gura_3392
FT                   integral membrane sensor signal transduction histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93878"
FT                   /db_xref="GOA:B3EA50"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033463"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B3EA50"
FT                   /protein_id="ACD93878.1"
FT                   /translation="MATTPHIRRRLLLTTLLPLVSALLVCWLAGNHLINARVAGQAQEE
FT                   ARSDLGTARELYQGELSRLSEGLQVISRSPELARLLQGNTTGDISRLLSLLSGSRSFSF
FT                   LTVVDRYGQVRYRAANPERLGDTLRHLKPVAEALAGRASQGTVLLSALQAGQENPLLPD
FT                   QMLVPLLPSQHALPTSKTAEQRGLFLVAAVPITAADGELHGALLAGQLLNNNEPLADRI
FT                   TRLIAPQQQDGLLHETATIFLDDVRIATTVTDKNGQRATGTRLSAEVAQQVLQRGEVWI
FT                   APAYVLHERYFAAYEPLRDPDGAVVGALYVGLPERPYLSLRNNLNLTFAALLLVLTLLA
FT                   VGLTTSLGRQLGRREAEISTLNRTLEQKVQQRTAELEEKSRQLLETEKELARNERLAEL
FT                   GMLSAGVAHEINNPLAIIRGNAELLQMSIPAGADDQEEVSEILTQAGRINRITSSLLSL
FT                   ARQEKRQVSRFPLPDLLDEILNQIGHQVPLAGYTIERRYQQTAIQLEADREQLRQVFTN
FT                   LILNGLQAMEGEGRLTISTEADPDGTCSITVADTGPGIDPEQQERLFSPFFSTKQNGTG
FT                   LGLAVSWGIVRNHGGTIAVQSALGCGARFTVTLPSSRV"
FT   sig_peptide     complement(132446..132556)
FT                   /locus_tag="Glov_0142"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.964) with cleavage site probability 0.397 at
FT                   residue 37"
FT   gene            complement(132564..133913)
FT                   /locus_tag="Glov_0143"
FT   CDS_pept        complement(132564..133913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0143"
FT                   /product="two component, sigma54 specific, transcriptional
FT                   regulator, Fis family"
FT                   /note="PFAM: response regulator receiver; sigma-54 factor
FT                   interaction domain-containing protein; helix-turn-helix
FT                   Fis-type; ATPase associated with various cellular
FT                   activities AAA_5; SMART: AAA ATPase; KEGG: gme:Gmet_1058
FT                   two component, sigma54 specific, transcriptional regulator,
FT                   Fis family"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93879"
FT                   /db_xref="GOA:B3EA51"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3EA51"
FT                   /protein_id="ACD93879.1"
FT                   /translation="MPRILICDDEEGILRYLSKLLKTQGYAVETFSSGTALLARLAVTS
FT                   MEPVDLLLQDVRLPDINGIDILKQVHQLRPEMPVVVMTAHGTVDDAVHAIRLGAYDYVL
FT                   KPFPKEKIMGVLAKALEHHRLADENRRLREELQRGGDDSSIVFSSPRFREVYDLTLQVA
FT                   SSEANILILGESGTGKELIARTVHANSGRREHGFVSLNCAALSDSLLESQLFGHLRGAF
FT                   TGAIMNQKGLLEEADGGTLFLDEIGDVSPTIQAKLLRVIQEKEFIPIGSTKPRTVDVRF
FT                   VAATNRDLQLEVAEGRFREDLYYRLNVISLTLPPLRERPEDIEPLARHFVRRFAARMKK
FT                   ELHGIDPDALLCMSRYHWPGNVRELENVIERAVILAQGTQLTSDLLPVCSRTAPLRNDE
FT                   VTPLVSLDTLERQHILGVYRQTGFHKSKTAEILGISRKTLDRKLQEYKAE"
FT   gene            134137..135267
FT                   /locus_tag="Glov_0144"
FT   CDS_pept        134137..135267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0144"
FT                   /product="hydrogenase (NiFe) small subunit HydA"
FT                   /EC_number="1.12.99.6"
FT                   /note="KEGG: gur:Gura_1943 hydrogenase (NiFe) small subunit
FT                   HydA; TIGRFAM: hydrogenase (NiFe) small subunit HydA; PFAM:
FT                   NADH ubiquinone oxidoreductase 20 kDa subunit; Nickel-iron
FT                   dehydrogenase small subunit domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93880"
FT                   /db_xref="GOA:B3EA52"
FT                   /db_xref="InterPro:IPR001821"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR027394"
FT                   /db_xref="InterPro:IPR037024"
FT                   /db_xref="InterPro:IPR037148"
FT                   /db_xref="UniProtKB/TrEMBL:B3EA52"
FT                   /protein_id="ACD93880.1"
FT                   /translation="MSQLGHFFGSGISRRDFIKTCVATTAVMGLPFSMAAKVAEAAQAP
FT                   DRPPVIWLHFQECTGCSESLLRANHPAPATLLLEMISLDYHETLMAGSGHQAEKSLHDS
FT                   MKANHGKYILIVEGAIPTKENGIYCKVGGKTALESLRKAAEGAAAIISVGTCASYGGIQ
FT                   AAPPNPTGAVGVRDIIKDKPIINIPGCPPSPYNLLSTVLYFLTFKKLPELDQMGRPKFA
FT                   YGRRIHEHCERRPHFDAGRFAKDYGHETHAQGYCLYKLGCKGPATYANCSVQRFNDAGV
FT                   WPVSVGHPCIGCTEPDILFRTAIADKVQIHEPTPFDSYAPVDLKDKGKGASPVTTGVLG
FT                   LAAGAALGAGAMLARKLPDAEQPAEHEQGGDHEHKE"
FT   sig_peptide     134137..134262
FT                   /locus_tag="Glov_0144"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.862) with cleavage site probability 0.405 at
FT                   residue 42"
FT   gene            135251..136192
FT                   /locus_tag="Glov_0145"
FT   CDS_pept        135251..136192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0145"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: gur:Gura_1944 hydrogenase 2 protein HybA"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93881"
FT                   /db_xref="GOA:B3EA53"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR014603"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="UniProtKB/TrEMBL:B3EA53"
FT                   /protein_id="ACD93881.1"
FT                   /translation="MSTKSSRREFLKLAGLAGAGLVTAPAMALAGHPVAGANDEELGML
FT                   YDATKCVGCKACMSACKRVNGDYGSLAYEQATFDPDKLWDAPQDLTGSTRTLIKLVKDT
FT                   PKEWSYVKYSCMHCQKPSCVSVCPVSAMTKDKITGIVDYNKNTCIGCRYCQVACAFNIP
FT                   KFQWEKAIPQIVKCDLCTNTNLKQKGISACAEVCPTGAIMFGKRKDLLAEAKKRLAEHP
FT                   KQYVNHIYGEHELGGTNHLYLAALQFKKLGLPELKSEAPAEFSEKIQHTIYKGFIAPVA
FT                   LYSTLCFIAVRNMKKGSAHTDEQKKNSDGGDQ"
FT   sig_peptide     135251..135337
FT                   /locus_tag="Glov_0145"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.580 at
FT                   residue 29"
FT   gene            136189..137454
FT                   /locus_tag="Glov_0146"
FT   CDS_pept        136189..137454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0146"
FT                   /product="Polysulphide reductase NrfD"
FT                   /note="PFAM: Polysulphide reductase NrfD; KEGG:
FT                   gur:Gura_1945 predicted hydrogenase 2 cytochrome b type
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93882"
FT                   /db_xref="GOA:B3EA54"
FT                   /db_xref="InterPro:IPR005614"
FT                   /db_xref="UniProtKB/TrEMBL:B3EA54"
FT                   /protein_id="ACD93882.1"
FT                   /translation="MSHDEYQIHKAKILTPSFWVLLTLTVIGFALIGVRFIWGIGAVSN
FT                   MSDGYPWGIWITYDVATGTAIACGGYAVAILIYIRNKMHYHPLIRSAVLTSLFGYGLAG
FT                   FSVMVDVGRPWNAYNFFVPSQWQANSAMFEVALCVMAYTTVLAIEFLPAVLTRLQETNW
FT                   SRARAFLEKYHGRFGLDTPVVLEKLEKLRQRAVWLQPKLDKVLIFVIVLGITLPTMHQS
FT                   SLGSLLLIASTKLHPLWHTGFLPLLFLINCMFIGYSIAILESVISSFGFKRPFEIEQLS
FT                   GLASITPYLTTIWLCVVVGDLVWRGQVANALRFDFYSAFFLLEFALVASGSLLLFSKKR
FT                   RQSPRWLFITAVLIVLGGALYRFNVYLIGFNPGQGWRYFPSLAELMITVGIVAFEILGY
FT                   QVLVKLFPVLPRLHGHEVVEKA"
FT   gene            137480..139159
FT                   /locus_tag="Glov_0147"
FT   CDS_pept        137480..139159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0147"
FT                   /product="nickel-dependent hydrogenase large subunit"
FT                   /note="PFAM: nickel-dependent hydrogenase large subunit;
FT                   KEGG: gsu:GSU0785 nickel-dependent hydrogenase, large
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93883"
FT                   /db_xref="GOA:B3EA55"
FT                   /db_xref="InterPro:IPR001501"
FT                   /db_xref="InterPro:IPR018194"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="UniProtKB/TrEMBL:B3EA55"
FT                   /protein_id="ACD93883.1"
FT                   /translation="MARITIDPITRIEGHLRIDVEVTGGQVSKAWSSAQMWRGIETILK
FT                   DRPPQDAWIYAQRFCGVCTTVHAISSIRSVEHALKVEVPLNAQYIRNIIMAQHSVQDHI
FT                   VHFYHLSALDWVDIVSALKADPKKAASIAQSVSDWPGNSEKEFSDVQKRLKAFVDSGKL
FT                   GIFASGYWGHPAMILPPEINLIATAHYLKALDYQQKAAQAVAILGGKNPHIQNLCVGGV
FT                   ATALNMDNLATINMERIAYLKALMTETREFVKKVYYPDLLVIGKAYKDWFKHGKGVVNY
FT                   LAVPEFAEDTKNTSFALPGGLIMGGDVAKARIISTHQDQQLIGSIKESVACAWYEGKSS
FT                   LHPWEGETKPDYTDFQENGKYSWCKAPRIDGKPIQVGPVAQLLAGYAAGNQRVRKLVDS
FT                   TCKAAGVGVADLHSTMGRLAARGIRAHLLSDLSLEYLDKLVDNVGKGDKTYANHTEIPS
FT                   GEHRGVGFHEAPRGVLSHWMVIKNKKIKNYQAVVPSTWNASPRDAEGNAGPYEASLLGN
FT                   PVAKPDQPLEVLRTVHSFDPCIACAVHTIDPEGKEITKVKVV"
FT   gene            139303..139788
FT                   /locus_tag="Glov_0148"
FT   CDS_pept        139303..139788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0148"
FT                   /product="hydrogenase maturation protease"
FT                   /note="TIGRFAM: hydrogenase maturation protease; PFAM:
FT                   peptidase M52 hydrogen uptake protein; KEGG: gur:Gura_1947
FT                   hydrogenase maturation protease"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93884"
FT                   /db_xref="GOA:B3EA56"
FT                   /db_xref="InterPro:IPR000671"
FT                   /db_xref="InterPro:IPR023430"
FT                   /db_xref="UniProtKB/TrEMBL:B3EA56"
FT                   /protein_id="ACD93884.1"
FT                   /translation="MKVLIFGAGNLLLSDEGFGVHLVKYLADNYSFDDDVELYDGGTLG
FT                   FMASHKLEEAGRVYMVDVVTTPGEPGELYRFEKDAFIGRTIPIKMSPHQLGIQEMLLLS
FT                   EIRGRCPDQVTLFGVVPKSYEAGIELSPELAVRLPQLAELMVAELTAAGHQVVAHRA"
FT   gene            139895..141496
FT                   /locus_tag="Glov_0149"
FT   CDS_pept        139895..141496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0149"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: histidine kinase HAMP region domain protein;
FT                   chemotaxis sensory transducer; KEGG: gur:Gura_3063
FT                   methyl-accepting chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93885"
FT                   /db_xref="GOA:B3EA57"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033463"
FT                   /db_xref="UniProtKB/TrEMBL:B3EA57"
FT                   /protein_id="ACD93885.1"
FT                   /translation="MRVKTKFIAVNCLIVTVALILSTVAGLYKFKQEMYRQAQVSQESR
FT                   IKTFWELLRARGNEFSVVDNKLLAGSYALNNNEELPDKLKELCGGTATIFMGDERISTN
FT                   IVKPDGSRAVGTRLSGPAYAAVLQKGESYRGVADILGTPYFTAYDPIKDRNGAVIGIVY
FT                   VGVKTSEFYAAYHHLQIVVAVMALVVLLCAAIISWLVINRLFEPLNRMHDMLKDMAEGD
FT                   GDLTRRLTYCKQDEIGEMSFSFNALMDKLHTIVVKVAEITTQLAAASAQVQGTAQQIAH
FT                   GTGDISSQSTGIATAVEEMAATSGEIANNCVLAVGEAQDTTASAKAGAAIVDQTVTTMH
FT                   SIAERVMATSQTVEALGRRSDQIGEIISTIEDIADQTNLLALNAAIEAARAGEQGRGFA
FT                   VVADEVRALAERTTRATRSIGEMISSIQTETAQAVTSMQQGVGEVKLGVDEAQRSGEAL
FT                   QTILRQIGDVSAQLHQIATAAEQQTATTHEISGNMTRITEAVQETASGAHDSARASQQL
FT                   NTLAHDLKGVVAQFRL"
FT   sig_peptide     139895..139972
FT                   /locus_tag="Glov_0149"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.939) with cleavage site probability 0.869 at
FT                   residue 26"
FT   gene            complement(141588..142325)
FT                   /locus_tag="Glov_0150"
FT   CDS_pept        complement(141588..142325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93886"
FT                   /db_xref="UniProtKB/TrEMBL:B3EA58"
FT                   /protein_id="ACD93886.1"
FT                   /translation="MKSLMVLACGIIAAVSMAAQPAGAEPGKAQVIQLWEQQNNVKGRV
FT                   LDLKSRGGQRPTNELNGKKYLTPVGTCWDYDLVELQKCGCRLFEKASVCCRRGSTKECE
FT                   VRIGTTTSMVDCAKYGKPRFGLSGTVEPEECKVRKQAAACWSRKDLLFGPGVAIGPCTE
FT                   NGPVFTCPKGQDTVTAFLERQCGPTPEDCGCTLVEECSKPQGLACYTQWKADKQAVDCF
FT                   WSQQYDNNYKRWKCYDDLKKSRQ"
FT   sig_peptide     complement(142251..142325)
FT                   /locus_tag="Glov_0150"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.685 at
FT                   residue 25"
FT   gene            complement(142436..142963)
FT                   /locus_tag="Glov_0151"
FT   CDS_pept        complement(142436..142963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0151"
FT                   /product="Lipocalin family protein"
FT                   /note="PFAM: Lipocalin family protein; KEGG: gsu:GSU2326
FT                   outer membrane lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93887"
FT                   /db_xref="GOA:B3EA59"
FT                   /db_xref="InterPro:IPR000566"
FT                   /db_xref="InterPro:IPR002446"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="InterPro:IPR022271"
FT                   /db_xref="InterPro:IPR022272"
FT                   /db_xref="UniProtKB/TrEMBL:B3EA59"
FT                   /protein_id="ACD93887.1"
FT                   /translation="MKVTLIFALLALVAVCPGRQTAQADTGLPPLQTVQQVDLKRYLGQ
FT                   WYEIARYPNWFQKGCLESSASYALRDDGDIEVLNRCKDSEDGRQRQAKGHAWVVDNASN
FT                   AKLKVSFFWPFRGDYWIIELGREYEYAVIGTPNRKYFWILSRTRSMDDSLYAAILQRAK
FT                   QQGFDPGLVVRN"
FT   sig_peptide     complement(142889..142963)
FT                   /locus_tag="Glov_0151"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.825 at
FT                   residue 25"
FT   gene            complement(142998..143906)
FT                   /locus_tag="Glov_0152"
FT   CDS_pept        complement(142998..143906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0152"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: rba:RB3703 probable
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93888"
FT                   /db_xref="GOA:B3EA60"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B3EA60"
FT                   /protein_id="ACD93888.1"
FT                   /translation="MELRHLRYFVNVAQELSFSRAAEKLLVAQPALSTQIADLEQEIGT
FT                   PLLLRNTRSVQLTAAGKVFLIEAQAILAAADAAKDRALRTSRGQEGQLSIGFFSAPTML
FT                   FLPDLIRRYRAIYPNVAIRMHELTPDRQLAAFSRGEIDIGFTRPLPPGYPDLAGEVLFQ
FT                   EHFLAVMAETHPLGSRQSIHLNELAQEPFVLLDRAVAVGLHDHIIAACLKAGFSPLVST
FT                   SPDLMSAVLTMVAAEQGVSIVPEGVQNLRSNQLAFVPIIPALEPIPLIVCWHAKTDAPP
FT                   RDAFLQLIREQHAQVKSDGAW"
FT   gene            144073..145332
FT                   /locus_tag="Glov_0153"
FT   CDS_pept        144073..145332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0153"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   scl:sce8951 permease of the major facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93889"
FT                   /db_xref="GOA:B3EA61"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B3EA61"
FT                   /protein_id="ACD93889.1"
FT                   /translation="MSNSLENSTEPSCPQPSENQLTAALVVFLAAGGGLAVATLYYSQP
FT                   MLGILGVAIGASDHAVGLIPTLTQLGYAMGILLLAPLGDRYDRRRIILVKAAVLALALV
FT                   AAAVAPSILCLLAASLVIVLSATMAQDIVPSAAHLASDSQRGRVVGTVMTGLLLGIVLS
FT                   RVVSGYVAEHFGWRTVFWGASASIVLTGVVAWRRLPRFKPTMQVPYAELMRSLVQLWKR
FT                   HGELRRATLAQGLLAVGFSAFWSTLAIMLHAAPFHLGSQAAGAFGLAGAAGALAAPVAG
FT                   RVADRQGPEQVTKLCAALVALSFAAMFFLPFLSPHAQLWLLGASAIGFDLGVQGTLIAH
FT                   QTIIYSIDPGARSRLNAIMFVGLFIGMAAGSALGSLMQAAWGWMAVTALATIAALGALA
FT                   TRLWPAGRVANRSALATEEA"
FT   gene            complement(145990..146265)
FT                   /pseudo
FT                   /locus_tag="Glov_0154"
FT   gene            146352..147434
FT                   /locus_tag="Glov_0155"
FT   CDS_pept        146352..147434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0155"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   gsu:GSU2597 ISGsu2, transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93890"
FT                   /db_xref="GOA:B3E2B5"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:B3E2B5"
FT                   /protein_id="ACD93890.1"
FT                   /translation="MRGTDVQNEALFAYVTPESFVPKDHPLRAIRSMADQALSEMSPLF
FT                   DSMYADSGRSSIAPEKLLKAQLLMILFSIRSNRQLVEQIRYNFLYRWFLGMGLDDEIWD
FT                   HSSFTKNHERLIGSDVAAEFLSRILAQAERKRLLSREHFTVDGTLIEAWASIKSFKPKD
FT                   GPPSAGGGKNKSVDFKGKQLKNDTHSSSTDPNARLYRKGNTKEAKLCYQGHTLMENRNG
FT                   LIVKTSVTTATGTGEREAAKAMIRQLPRTTRRITVGADKGYDTEGFVKELRQINVTPHV
FT                   AQNNTRRKSGIDGRTTAHPNYSISQRIRKRIEEGFGWMKTIGRLRKTMYRGIEKIAWQL
FT                   DLHAAAYNLVRMKNLGLGVT"
FT   gene            complement(147565..148026)
FT                   /locus_tag="Glov_0156"
FT   CDS_pept        complement(147565..148026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0156"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93891"
FT                   /db_xref="UniProtKB/TrEMBL:B3EA63"
FT                   /protein_id="ACD93891.1"
FT                   /translation="MMIQKYIGLNRALRALNANTRELIDAHFQEGEGFATASLTSVLTR
FT                   SLSDIERIWPVGLDVSVIGEIKQLIATGDYQALWKIVGDLITKLENAVDDYFSAQPYSD
FT                   ISYSILDLLHQRVVVSSYAHFKTGHFRESVLNSVVTIFDLIRSLKIGSI"
FT   gene            complement(148113..148692)
FT                   /pseudo
FT                   /locus_tag="Glov_0157"
FT   gene            148970..150133
FT                   /locus_tag="Glov_0158"
FT   CDS_pept        148970..150133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0158"
FT                   /product="protein of unknown function UPF0027"
FT                   /note="PFAM: protein of unknown function UPF0027; KEGG:
FT                   tde:TDE0804 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93892"
FT                   /db_xref="GOA:B3EA64"
FT                   /db_xref="InterPro:IPR001233"
FT                   /db_xref="InterPro:IPR036025"
FT                   /db_xref="UniProtKB/TrEMBL:B3EA64"
FT                   /protein_id="ACD93892.1"
FT                   /translation="MPEIAIYAELLDQNARDQIRLIQEHPAFEGRVAIMPDAHAGAGCV
FT                   IGFTGRFGCGVIPNIVGVDIGCGVAAVPLARPGRIDFGALDRFIRQQIPLGMTSRRNDR
FT                   YLAECGLSKALASQATTLCRRIETDFYRAEKISKFILPLLQLGTLGGGNHFIEIGREQS
FT                   SGRLYLIVHSGSRNLGKRVAEQFQARARRFTEQHHIQVPRGLEYLPQQEGGADYIHCMQ
FT                   AAQAYARLNRRMMLAIMLGFFGQELDETQVVESVHNYISEQDGLVRKGAISAHAGEAVI
FT                   IPLNMADGTILGTGKGNPAYNRSAPHGAGRLHGRKEMFRRLQEGQFSMRQYADSMQHVF
FT                   STSISRDTFDESKFAYKPFAAIEKHLQETVEIKQILQPVYNLKAAGD"
FT   gene            150133..150687
FT                   /locus_tag="Glov_0159"
FT   CDS_pept        150133..150687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0159"
FT                   /product="2'-5' RNA ligase"
FT                   /note="TIGRFAM: 2'-5' RNA ligase; PFAM: Phosphoesterase
FT                   HXTX; KEGG: ppd:Ppro_2521 2'-5' RNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93893"
FT                   /db_xref="GOA:B3EA65"
FT                   /db_xref="InterPro:IPR004175"
FT                   /db_xref="InterPro:IPR009097"
FT                   /db_xref="InterPro:IPR014051"
FT                   /db_xref="UniProtKB/TrEMBL:B3EA65"
FT                   /protein_id="ACD93893.1"
FT                   /translation="MRLFVAIELPEAVQQQLSLLHAELTGVRWVRPEQLHLTLAFLGEV
FT                   AEVQLGQLTEALGQIRCQPFTLQFGRLGCFPDQRHPRVFWIGLEPNPALQQLAQQVRAA
FT                   VRACGITLEERLFSPHITLARLKEADPRQVAALLTQQPVLPEVAVDAFLLVQSSLSARG
FT                   AQHRVLRRFATPPHPTWPTAG"
FT   gene            complement(150807..151235)
FT                   /locus_tag="Glov_0160"
FT   CDS_pept        complement(150807..151235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0160"
FT                   /product="GreA/GreB family elongation factor"
FT                   /note="PFAM: transcription elongation factor GreA/GreB
FT                   domain protein; KEGG: ppd:Ppro_2844 GreA/GreB family
FT                   elongation factor"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93894"
FT                   /db_xref="GOA:B3EA66"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR029462"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:B3EA66"
FT                   /protein_id="ACD93894.1"
FT                   /translation="MKKSIVPRQIFITDFDLQRLEQLIDSSVTRSLRDSRYIEELEQEL
FT                   LKAEIVDATGVPPDVVTMNSRVSLQDLDSGEQLQYTLVFPGDADLNLGKISILAPIGTA
FT                   LFGYRTGDRISWSVPGGVRKLKIKKVLYQPEAAGDFHL"
FT   gene            complement(151298..152095)
FT                   /locus_tag="Glov_0161"
FT   CDS_pept        complement(151298..152095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0161"
FT                   /product="Actin-like ATPase i"
FT                   /note="nvolved in cell morphogenesis; KEGG: bsu:BSU14470
FT                   cell-shape determining protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93895"
FT                   /db_xref="GOA:B3EA67"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:B3EA67"
FT                   /protein_id="ACD93895.1"
FT                   /translation="MKTRFPLLNWRQQVALDVGTSTIRAASGLRPLIEHCSCLGSKAGV
FT                   RGGVVVDPATVAEILRPILDSTRLFGIVKPCVLACAPSDATQEERQRLHDAIMQAGASS
FT                   VMIIPEPLAAAVGAGIDVSSPYAQMVVDIGEGVTDCALIKMSRIQTTAAVRVGCGQMRT
FT                   GLPPVPFRQSGRLPDRHSLQPVLESITGLIDDFLQDLSPETGCEVIENGILLTGGGALI
FT                   PGLSRYLEQHSGIHVVTAPKPRDSVVEGARAILPVVVMLNLLT"
FT   gene            complement(152331..153632)
FT                   /locus_tag="Glov_0162"
FT   CDS_pept        complement(152331..153632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0162"
FT                   /product="outer membrane efflux protein"
FT                   /note="PFAM: outer membrane efflux protein; KEGG:
FT                   gur:Gura_0814 outer membrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93896"
FT                   /db_xref="GOA:B3EA68"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:B3EA68"
FT                   /protein_id="ACD93896.1"
FT                   /translation="MLRIAIVLITLLVAGQALAAPQLLTLEDCLKIAGDKNLDIQKARE
FT                   YANYVQGRYVEERAAALPQLGLQAGFGYSKDDSTKALYGASQMQANRTVDLSLSQPLYT
FT                   WGKIGAALRAAEVGLKTADQQLRLFRQAAFRDVSIAFYDVLLAKELHRLAQENLAQKER
FT                   HHTEAKRKFEAGVATDYDLLAAEVELQNARPELIRTENSIRTSRERLRFLLGADQPELD
FT                   VAGRIEAKPEQIPGFDESLKIALDKRPELADQKLRIGINQELVTIANADDKPRLDLKGT
FT                   AGWHQLEVSDPGPRRQSDGPAWNAGIYLTFPFFDGLRSRGRTQQARSDLRTSQLQEQKL
FT                   RDSIALELRTARYNLAESAETITALSGTVKQAERLLQMAEKGFEYGVKTRLEVDDAQTN
FT                   LLRAQSNLARANRDYLAASVNLLWAMGMAGEQEL"
FT   sig_peptide     complement(153573..153632)
FT                   /locus_tag="Glov_0162"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 20"
FT   gene            complement(153626..155389)
FT                   /locus_tag="Glov_0163"
FT   CDS_pept        complement(153626..155389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0163"
FT                   /product="para-aminobenzoate synthase, subunit I"
FT                   /note="TIGRFAM: para-aminobenzoate synthase, subunit I;
FT                   PFAM: Chorismate binding-like; KEGG: ppd:Ppro_2808
FT                   para-aminobenzoate synthase, subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93897"
FT                   /db_xref="GOA:B3EA69"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR005802"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:B3EA69"
FT                   /protein_id="ACD93897.1"
FT                   /translation="MPDTCPTILLDSCSADRFSASWRFDGHIRTLIAETSDQVQSVLEQ
FT                   AEAATRQGLYAVGFVVYEAARALNPHLPSLPPRAGLPLAWFSLFRERHCVTAGDGLPDH
FT                   TTATPELQPACSPADYGIAISRIHTAIEQGETYQINHTFPLQGQWQGDPRQLYRSLLLA
FT                   QQPAFGAFLDIGSHTIISASPELFFNIKDGLITTRPMKGTAPRGRFPAEDRALQEQLQQ
FT                   DMKEQAENLMIVDLLRNDLGQVARTGTVQTERLFEVETYPTVHQMTSTITAQLKQDIGL
FT                   LELFRALFPCGSVTGAPKRRSMELIAEIEGQPRGIYCGTIGYLAPGGEMAFSVAIRTLV
FT                   LNKQTGRISLGVGSGITWDARPDAEYVECLHKAAFLKPRPQPRLLESLLLEDGNYPRLE
FT                   QHLERLGWSAARLGYCCDREQIRQALLAHAAGTTGQHKTRLLLAQDSTFQIESALLLQI
FT                   QQPLKLALATTFVDPTDLLLYLKTEQRQRYEQARQEQPEADEVLLCNNRGELTEGSFTN
FT                   LVLKLDGRLVTPPLASGLLPGVMRQQLLEQGTIEEQVLYPQDLQRAEEIWLINSVRGWL
FT                   RAELIKGARTC"
FT   gene            complement(155382..155741)
FT                   /locus_tag="Glov_0164"
FT   CDS_pept        complement(155382..155741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0164"
FT                   /product="protein of unknown function DUF559"
FT                   /note="PFAM: protein of unknown function DUF559; KEGG:
FT                   ppd:Ppro_3609 protein of unknown function DUF559"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93898"
FT                   /db_xref="InterPro:IPR007569"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:B3EA70"
FT                   /protein_id="ACD93898.1"
FT                   /translation="MGFLQYKTTLTSLARNNRKNPTVAEQKMWQELLRNKQFFNYKFTR
FT                   QKPIGGYIVDFYCSDLQLVIEIDGDSHAEAVEYDAERTRKLEAYGLTVVRYTNHEIMHN
FT                   LEGVYDDLRRRIKHA"
FT   gene            complement(155834..158932)
FT                   /locus_tag="Glov_0165"
FT   CDS_pept        complement(155834..158932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0165"
FT                   /product="acriflavin resistance protein"
FT                   /note="PFAM: acriflavin resistance protein; KEGG:
FT                   gsu:GSU2664 outer membrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93899"
FT                   /db_xref="GOA:B3EA71"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:B3EA71"
FT                   /protein_id="ACD93899.1"
FT                   /translation="MILSDLSIKRPIFATVMMLALVALGFFSYKRLSVEMYPNVEMPVI
FT                   SIVTKYPGASPETVEREVSKRVEEAVNQIAGIKHVTSYSRESVSTVVAEFRLEERTNEV
FT                   AQEARAKISSIRGQLPKEVEEPIIQKLDFNAMPSAAVAIQSSSLSQRDLTTLVDKKIRK
FT                   RFESVTGVGKVELVGGAKREVNVEVDPVRLDSLGLGVNDLVNGLKGENINTPLGKITKS
FT                   TAEYPLRIEGKPEQADSYSSMVIAARNNRPISLGEVARVTDGVEERRKLALVNGQPAIG
FT                   LDIYKQSGANQVQVVDNVKKVMQKVKAEMPPGVTISLVRDGSIMTRQSLADVEETLLVG
FT                   GILTVLIVFMFINSWRSTVITGVTLPISVISSFIVMNAMGMTLNVMTLMALSLAIGLLI
FT                   DDAIVVRENIVRHLELGKDHMEASRFGTAEIGLAVFATTMSILAVFVPVAYMRGIVGRF
FT                   FFPFGITVSFAVLVSLFVSFTLDPMLSSRWHDPSIHNRGNRKGLARWLERFNDWFDRSA
FT                   DRYRGIIAWALQHRLKVVISAGIAFVLGLVVMATLESSFMSKEDTSEFQISFQTAPDAS
FT                   IKESEGRLHQLLALIKDIKEISHTYATIGAGDNGTVRDGLLYVKLKEKSERTRGMFEIQ
FT                   QVIRERFRSIAGINFSLEEVGAIGSAAKPLNVNIKGDDTALLKKYAAQLKQEMYSIPGV
FT                   VDISATLEYDTPEYRLRVDREKARSAGVSSSAIVDSLSRLIGGEAVSSYEDEDGDAVDL
FT                   RVRLPRQLREHPAQVRELKISVSDPDGSTRLVPLASITSEVVASSPTEINRRDLSRLVT
FT                   VSANLDNLPIGTAVKQVEAVAKRIKMEPGYSIGFSGEAEDMAESFGYMGESLILAVLFV
FT                   YLILAAQFESFFEPLAIMFSLPLSIVGMAGMLRITGDTINIMSLIGLIMLMGLVTKNAI
FT                   LLVDYAKVLRKRDGLERTAAVIEAGRTRLRPIVMTTLAMIFGMLPLFFGIGAGGEGRAP
FT                   MARAVVGGLITSSVLTLIVVPVMYTYLDDFSNWLKRKWKGEQH"
FT   sig_peptide     complement(158840..158932)
FT                   /locus_tag="Glov_0165"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.632) with cleavage site probability 0.296 at
FT                   residue 31"
FT   gene            complement(158929..160068)
FT                   /locus_tag="Glov_0166"
FT   CDS_pept        complement(158929..160068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0166"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   gur:Gura_0816 efflux transporter, RND family, MFP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93900"
FT                   /db_xref="GOA:B3EA72"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:B3EA72"
FT                   /protein_id="ACD93900.1"
FT                   /translation="MKRYTATLMIVTLALLAGCSKKQAATVKPPLAVELATVAAAELIE
FT                   GVEVTGTLEPKFSADVKTQIPGLVKEVYVTQWVRVHKGQPLARIDVAETEALTKRAEAA
FT                   VVAAKAQLAQSQVSLARAEREEARSVKLKEAGLATQQAVDDSRTETAAARARLDSSKAQ
FT                   IRVAEEELRQSKARLGKGLVTAPLDGVVALRDVNVGDLASDAAAGKPIFRVVDNRILNL
FT                   TVTVPSVDSARIKVGQPLEFSVDALPGKLLSGRVMFINPELNTADRSLKVVAEVRNQPE
FT                   LLKGGLFAKGRIITGKRAGVLQVPRAVLGQYDSAARTASLFVAEGQIARQRQLKTGAAN
FT                   GDLIEVREGLKPGEKYVSRGAFTLRDGDRIAVQGAGAAK"
FT   sig_peptide     complement(160000..160068)
FT                   /locus_tag="Glov_0166"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.947) with cleavage site probability 0.619 at
FT                   residue 23"
FT   gene            complement(160065..160667)
FT                   /locus_tag="Glov_0167"
FT   CDS_pept        complement(160065..160667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0167"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: gur:Gura_0817
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93901"
FT                   /db_xref="GOA:B3EA73"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:B3EA73"
FT                   /protein_id="ACD93901.1"
FT                   /translation="MSTQPVSDTSGNVRQRLLDAALQLFSSKGYAATSVRELVEAAGVT
FT                   KPVLYYYFKNKEGLYLALLGDGLAEFHQVAEQARLAPGSVRERVCGYCTALLDIFVGRL
FT                   PVARLIYAIYYGPPQGAPHIDFEASFSTMLTHMEQLVNEGISTGEFRKVDPVDTAWAIV
FT                   ALLNATMEEQFNQTGQVRVDRAGLLRLLSLMFEGIRK"
FT   gene            160879..161139
FT                   /locus_tag="Glov_0168"
FT   CDS_pept        160879..161139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0168"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   sat:SYN_02733 helix-turn-helix DNA binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93902"
FT                   /db_xref="GOA:B3EA74"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B3EA74"
FT                   /protein_id="ACD93902.1"
FT                   /translation="MRITTAKDIGRLIRQKRKDDGITLEDAAALCSVSYAFLSALENGK
FT                   ETVRLDKVLQVALCLGIEFEAHPRSWTSTGGSHQVLSDCTD"
FT   gene            161301..162317
FT                   /locus_tag="Glov_0169"
FT   CDS_pept        161301..162317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0169"
FT                   /product="FRG domain protein"
FT                   /note="PFAM: FRG domain protein; KEGG: bpd:BURPS668_2136
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93903"
FT                   /db_xref="InterPro:IPR014966"
FT                   /db_xref="UniProtKB/TrEMBL:B3EA75"
FT                   /protein_id="ACD93903.1"
FT                   /translation="MLPTLLEIVRHLKAEQERGQRWAEKHFETLEDGHFTAVAISEEEF
FT                   VLAPYPEFSAIIYRGQSQYYNPCLPSLYREKSTKIERFINIARLSEFELLLRDHPAVND
FT                   LRQWSIMGLKHRVDYEALAQHYHLKTRLLDFTTNVLVAAFFACTETNKSKGYQPIMSCH
FT                   QPPGVLYSLNAAAEHSLRPNNPFSGAVGLQPLRRPAEQYAWGYRLPRRASLNSQPFLSI
FT                   YPFAHSPRDSVAIFDAFEGGKKLFPYDPVLDKAQQISLTRHLSNGALELAIQRTRGFKR
FT                   QSALNALSQKGIEVTDRREHTFSQLELTQIEEDWKQRQPDLLSRIHWRLAAYGNEDC"
FT   gene            162388..162600
FT                   /locus_tag="Glov_0170"
FT   CDS_pept        162388..162600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93904"
FT                   /db_xref="UniProtKB/TrEMBL:B3EA76"
FT                   /protein_id="ACD93904.1"
FT                   /translation="MRSKTMKPLNDEFAGMDAALRRAAKVAQTLARKTKTPCYVWKDGQ
FT                   IVDITAVRRDRKTTSDKASLASTKK"
FT   gene            complement(162723..163523)
FT                   /locus_tag="Glov_0171"
FT   CDS_pept        complement(162723..163523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0171"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   ade:Adeh_1068 beta-lactamase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93905"
FT                   /db_xref="GOA:B3EA77"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR022877"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3EA77"
FT                   /protein_id="ACD93905.1"
FT                   /translation="MKRLLILFTALLFLLAALPALAAPAQLTWYGHAAFKVVTPNGKVL
FT                   LVDPWISNPSNPNAEKDLAALTKVDLIFLTHGHGDHIGDAVEIAKKTGAKLVATFDLQK
FT                   AMVAYKGFPAKQAERAETGSFGGTISLLDGEVTVLFVPAIHGASMDTPNGPVYAGEPGG
FT                   FLISVKNGPRIYHTGDTDLFSDMALLKGQVDLMLLCIGDKFTMGPVRAAQAVDMIRPKK
FT                   AIPMHFGTFPALSGTPEEFKKALRRYGLEFLMYQMKVGETLTWK"
FT   sig_peptide     complement(163455..163523)
FT                   /locus_tag="Glov_0171"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 23"
FT   gene            complement(163539..163982)
FT                   /locus_tag="Glov_0172"
FT   CDS_pept        complement(163539..163982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0172"
FT                   /product="large conductance mechanosensitive channel
FT                   protein"
FT                   /note="TIGRFAM: large conductance mechanosensitive channel
FT                   protein; PFAM: large-conductance mechanosensitive channel;
FT                   KEGG: gsu:GSU2794 large-conductance mechanosensitive
FT                   channel"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93906"
FT                   /db_xref="GOA:B3EA78"
FT                   /db_xref="InterPro:IPR001185"
FT                   /db_xref="InterPro:IPR019823"
FT                   /db_xref="InterPro:IPR036019"
FT                   /db_xref="InterPro:IPR037673"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3EA78"
FT                   /protein_id="ACD93906.1"
FT                   /translation="MLQEFKTFIMKGNVLDLAVGVIIGAAFGKIVNSAVNDLIMPVVGL
FT                   ALGKVDFSNLFISLKGGEYATVAAAKAAGAPTLNYGIFLNTTLDFLIMALVIFMIIKAA
FT                   NKVRKTEEPAPAPVPRECPFCKSAVHDEASRCPHCTSQLNATA"
FT   gene            complement(164012..164230)
FT                   /locus_tag="Glov_0173"
FT   CDS_pept        complement(164012..164230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0173"
FT                   /product="S4 domain protein YaaA"
FT                   /note="TIGRFAM: S4 domain protein YaaA; PFAM: RNA-binding
FT                   S4 domain protein; KEGG: gsu:GSU0464 S4 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93907"
FT                   /db_xref="GOA:B3EA79"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014330"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:B3EA79"
FT                   /protein_id="ACD93907.1"
FT                   /translation="MSEKISIDTDYIKLDSFLKLANLVMSGGEAKIVIQEGQIRVNGAV
FT                   ETRRGRKLYPGDTIALTGSSSFVIEQA"
FT   gene            complement(164223..164759)
FT                   /locus_tag="Glov_0174"
FT   CDS_pept        complement(164223..164759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0174"
FT                   /product="magnesium chelatase ChlI subunit"
FT                   /note="PFAM: magnesium chelatase ChlI subunit; KEGG:
FT                   ppd:Ppro_0137 magnesium chelatase, ChlI subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93908"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3EA80"
FT                   /protein_id="ACD93908.1"
FT                   /translation="MRTSAVLSQNSRERCTHPCPCGYLGDPAHACTCTPIAIKRYRSRI
FT                   SGPLLDRIDLHVEVPAVAYRDLSDSRETESSTVIASRVIRARQVQQERFKGTKVHCNAQ
FT                   MNARLIKRHCELDAAGHRMLELAGDKLGFSARSYSRILKVARTIADLAGSEAIHEPHLA
FT                   EAIQYRSLDRKVSHV"
FT   gene            164843..165196
FT                   /locus_tag="Glov_0175"
FT   CDS_pept        164843..165196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0175"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="KEGG: ppd:Ppro_0153 transcriptional regulator, XRE
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93909"
FT                   /db_xref="GOA:B3EA81"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B3EA81"
FT                   /protein_id="ACD93909.1"
FT                   /translation="MDLGLLQSEVAKIIGVTESSVWNWEHGTEPELQYNPKIIEFLGYV
FT                   PFDCPDDTVGRLAWYKRVNGMNLEYLGEAMGRDPEQLSDWLSGRHRPFRKNRGKIELFL
FT                   EEQGIFLPTKKIS"
FT   gene            complement(166202..166468)
FT                   /locus_tag="Glov_0176"
FT   CDS_pept        complement(166202..166468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0176"
FT                   /product="transcriptional regulator, TraR/DksA family"
FT                   /note="PFAM: zinc finger DksA/TraR C4-type; KEGG:
FT                   pap:PSPA7_5590 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93910"
FT                   /db_xref="GOA:B3EA82"
FT                   /db_xref="InterPro:IPR000962"
FT                   /db_xref="UniProtKB/TrEMBL:B3EA82"
FT                   /protein_id="ACD93910.1"
FT                   /translation="MAVGWSRDGAVQDQIDASVEDAIGQVRSRMPTGDSLTHCEECQTA
FT                   IPEARRKAISGVRLCVGCQAEAEKQQTTFSLYNRRGSKDSQLR"
FT   gene            complement(166660..167811)
FT                   /locus_tag="Glov_0177"
FT   CDS_pept        complement(166660..167811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0177"
FT                   /product="iron-containing alcohol dehydrogenase"
FT                   /note="PFAM: iron-containing alcohol dehydrogenase; KEGG:
FT                   dps:DP2157 NADPH-dependent butanol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93911"
FT                   /db_xref="GOA:B3EA83"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:B3EA83"
FT                   /protein_id="ACD93911.1"
FT                   /translation="MSAFIIPRKTYHGLGSLENLKTVEGRKAVIVTGSGSMKKFGFLDK
FT                   TVSLLREAGIDSAVFEGVEADPSVETVLRGVEFFNRENPDLIIGLGGCSAIDAAKAMWV
FT                   FYEYPEATFEEIIKPFTIKPLRNKARFVAIPSTSGTGTEATCATIITDTCKGIKYPIVS
FT                   YELTPDIAIVDGELAKSMPPNVTADTGMDALSHDVEAFVAALASPYTDALALDSVRLVF
FT                   ENLPRAYADGNNLEARQAMHDASNMGGMAFSNAILGIVHSIAHQIGGMFGVPHGRANAI
FT                   LMPNVIRFNSLDTDKYQLLAQALGKKTVEDFALEIERLRQSVGIEDSFKSYGIDPKVWE
FT                   EKLDTMVQNAMDDPCTGTNPRQPTAEEMKIIFERCFNGEVVDL"
FT   gene            168011..168946
FT                   /locus_tag="Glov_0178"
FT   CDS_pept        168011..168946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0178"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; AraC-type transcriptional regulator domain
FT                   protein; KEGG: mfa:Mfla_0587 transcriptional regulator,
FT                   AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93912"
FT                   /db_xref="GOA:B3EA84"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR009594"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:B3EA84"
FT                   /protein_id="ACD93912.1"
FT                   /translation="MTRVSESQRENRLVELIDFLATGEGLSPSILEGVQFMRSDKYTPP
FT                   IPIIYEPCIVIVGQGRKIGYLGDQVYTYDPYNYLVLSVPLPFVCETKASPEEPLLAVSI
FT                   RVDPATLGELLMEMDDDTSMSGTVPRGIYSTPLTGELIDATVRLLECLRSPIDSRILGP
FT                   QIMREIIYRVLCGEQGGALQAVAARHSRLSQIARVLRRIHTAYQQEMNIEALAGEASMS
FT                   VSTFHHNFKAVTSVSPLQYLKSIRLHKARMLMVQDGLTASSASGKVGYESASQFSREFK
FT                   RFFGNSPADEAIKLRALGPASLHSVSNTGN"
FT   gene            169102..169584
FT                   /locus_tag="Glov_0179"
FT   CDS_pept        169102..169584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0179"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="SMART: helix-turn-helix domain protein; KEGG:
FT                   ppd:Ppro_0153 transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93913"
FT                   /db_xref="GOA:B3EA85"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B3EA85"
FT                   /protein_id="ACD93913.1"
FT                   /translation="MCTFLYYSDSRRHLFSIQIPLEKQPVPGYPEFPITVGEHIRKKRM
FT                   DLGLLQREVAEIIGVTESSIWNWEHGTEPELQYNPRIIKFLGYIPFDCPDDTVGRLAWY
FT                   KRAMGMNLDHLGEAMGRDPEQLSDWLSGRHNPFLKNREKIEQYLKNQETFLLPEKK"
FT   gene            complement(169646..169984)
FT                   /locus_tag="Glov_0180"
FT   CDS_pept        complement(169646..169984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0180"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   ppd:Ppro_0143 transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93914"
FT                   /db_xref="GOA:B3EA86"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B3EA86"
FT                   /protein_id="ACD93914.1"
FT                   /translation="MASPVNRTYLRQTRDAAELLGKLIRLGRKERKMTEEELSGRAGIS
FT                   RRTLQKIERGDPKCEIGLVFEVANIVGVKLFNDEENSVRYTFGRHIDDKLALLPKRIRG
FT                   LVKVNDDF"
FT   gene            complement(170098..170940)
FT                   /locus_tag="Glov_0181"
FT   CDS_pept        complement(170098..170940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0181"
FT                   /product="putative RNA polymerase, sigma 70 family subunit"
FT                   /note="TIGRFAM: RNA polymerase sigma factor RpoH; RNA
FT                   polymerase sigma factor, sigma-70 family; PFAM: sigma-70
FT                   region 2 domain protein; sigma-70 region 4 domain protein;
FT                   sigma-70 region 1.2; KEGG: ppd:Ppro_0114 RNA polymerase,
FT                   sigma 32 subunit, RpoH"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93915"
FT                   /db_xref="GOA:B3EA87"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR012759"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:B3EA87"
FT                   /protein_id="ACD93915.1"
FT                   /translation="MVTNLPIISDSLTLYLSEIRKFNLLTEDEERDYAVKFFEEKDLEA
FT                   AHTLITSNLRYVVKVASEYRHYGLKMLDLIQEGNIGLMMAVRKFNPYRGVRLISYAVWW
FT                   IRAYIQNYIVSAWSLVKIGTTQAQRKLFYGLRKTKEALLKLTGRDSDAFEVSSMLHVPD
FT                   HEVVEMEQRLKGEVSLNEEIIEGDGLTILETIADDRMNQEEMLGEYQQEHSLKKAIAHA
FT                   LQGLNEKEKYIVEHRITNDDPLTLQDIADHFSISRERVRQIEERALVKLKNVLQPQLC"
FT   gene            171161..171610
FT                   /locus_tag="Glov_0182"
FT   CDS_pept        171161..171610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0182"
FT                   /product="heat shock protein Hsp20"
FT                   /note="PFAM: heat shock protein Hsp20; CS; KEGG:
FT                   gsu:GSU2410 heat shock protein, HSP20 family"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93916"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="UniProtKB/TrEMBL:B3EA88"
FT                   /protein_id="ACD93916.1"
FT                   /translation="MATWDVFKELDTLRREIDEAFRGAGYSRPFGPTFLSPVTTRRFPL
FT                   VNFSEDEGHVYIEALVPGVDPKDVDLSVLRNTVTISGERKPFVETEGQIVHRSELGSGK
FT                   FSRTLELPVDIDPEKISAQCKDGIMQITLAKAEHAKPKKIEIRLS"
FT   gene            171644..172042
FT                   /locus_tag="Glov_0183"
FT   CDS_pept        171644..172042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0183"
FT                   /product="heat shock protein Hsp20"
FT                   /note="PFAM: heat shock protein Hsp20; KEGG: gsu:GSU2409
FT                   heat shock protein, HSP20 family"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93917"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR031107"
FT                   /db_xref="UniProtKB/TrEMBL:B3EA89"
FT                   /protein_id="ACD93917.1"
FT                   /translation="MAANSLTERNDERNVQAREETRSNEKYIRPAVNIIETEEGLVLTA
FT                   DIPGASKEALDVNVEKGILTITAPAQHTTQGTSAYREFELASYYRQFTIPESLDHEKAK
FT                   AEYVNGILTLKVPKAEVAKPKRISVQVG"
FT   gene            172072..172554
FT                   /locus_tag="Glov_0184"
FT   CDS_pept        172072..172554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0184"
FT                   /product="heat shock protein Hsp20"
FT                   /note="PFAM: heat shock protein Hsp20; KEGG: gsu:GSU2408
FT                   heat shock protein, HSP20 family"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93918"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR031107"
FT                   /db_xref="UniProtKB/TrEMBL:B3EA90"
FT                   /protein_id="ACD93918.1"
FT                   /translation="MSNLLPERWSEALERVNDKIGHFLTKVAPWKKQEQSPERITTDTL
FT                   PAFMKLGGPLLDMHETPEELIVRAEVPGLNKDDFSVELVGRRLTIHGEKKIVREQKGGD
FT                   GCLISERRYGSFSRSISLPYDIDEKTIKADLKQGVLTVRLPKPEKEQHTRYRVPVS"
FT   gene            172629..173573
FT                   /locus_tag="Glov_0185"
FT   CDS_pept        172629..173573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0185"
FT                   /product="chaperone DnaJ domain protein"
FT                   /note="PFAM: heat shock protein DnaJ domain protein;
FT                   chaperone DnaJ domain protein; KEGG: gsu:GSU2406 DnaJ
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93919"
FT                   /db_xref="GOA:B3EA91"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:B3EA91"
FT                   /protein_id="ACD93919.1"
FT                   /translation="MNNYQDYYKTLGVEKKATQDEIQRAYRKLARKYHPDINKESSAEE
FT                   KFKQLNEAYEVLGDPEKRAKYDHLGSGWDGQFANQGYQDGDNVQYHYSNADPGQFSDFF
FT                   QNLFGGGGWNFTEESNFHGGGVRRRRGRDHETAINISLADAYHGAKKSIELERAELGSD
FT                   GRPTRTRRSYDITIPQGVTDGSLIRLANQGGSGSGGGDAGDLFLRVNILPDSRFTLNGH
FT                   DLATTVDIAPWEAALGGKVLVPTVDGRINLSVPAGTQSGQSLRVRGKGMPVAPGRFGDL
FT                   LVNVRIVVPQHLTARERHLFEELAKESRFEPRK"
FT   gene            173587..173889
FT                   /locus_tag="Glov_0186"
FT   CDS_pept        173587..173889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0186"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gsu:GSU2405 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93920"
FT                   /db_xref="UniProtKB/TrEMBL:B3EA92"
FT                   /protein_id="ACD93920.1"
FT                   /translation="MTVQHYEIIISRKHELVSVPGITIHELSRLCDCHLTVARRLFSIG
FT                   LIEPLTAGDTPLFDQSAVVRARKALRLKRDLRLNFDAIALVMDLLDRIDELERRI"
FT   gene            173915..175042
FT                   /locus_tag="Glov_0187"
FT   CDS_pept        173915..175042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0187"
FT                   /product="2-alkenal reductase"
FT                   /EC_number="1.3.1.74"
FT                   /note="KEGG: sat:SYN_02023 endopeptidase; PFAM: peptidase
FT                   S1 and S6 chymotrypsin/Hap; SMART: PDZ/DHR/GLGF domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93921"
FT                   /db_xref="GOA:B3EA93"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:B3EA93"
FT                   /protein_id="ACD93921.1"
FT                   /translation="MIQKTADPFLRRLRWLTIAVITVLFAWHALSWADRAFQKESATPR
FT                   AVTARGDLAADEKSTIELFERSRDSVVYISTSERVMDFWSRNIFTIPRGTGSGFIWDDK
FT                   GHIVTNFHVIEGASEARVRLSDGKEYKASLVGASPMHDLAVLKIGTRFKGHSLPVGTSH
FT                   NLKVGQKVFAIGNPFGLDWTLTTGIVSALDRSLKGESGSIIEHLIQTDAAINPGNSGGP
FT                   LLDSAGRLIGINTAIYSPSGASAGVGFAVPVDTVNRVVPQLIGQGKYVRPSLGIEIDQD
FT                   LNEAITEQLGVKGVAILKVRSNSPAARAGFRGITINRDRTITPGDIITAVQGKQVETIP
FT                   KLLARLDDFKVGDTVTITILRDGKQQQRSVQLQAE"
FT   sig_peptide     173915..174016
FT                   /locus_tag="Glov_0187"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.782) with cleavage site probability 0.580 at
FT                   residue 34"
FT   gene            175068..175676
FT                   /locus_tag="Glov_0188"
FT   CDS_pept        175068..175676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0188"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gsu:GSU0821 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93922"
FT                   /db_xref="GOA:B3EA94"
FT                   /db_xref="UniProtKB/TrEMBL:B3EA94"
FT                   /protein_id="ACD93922.1"
FT                   /translation="MPQNIDDLIQRIKELQEELEVEFKKKRDEFEFIIEKKRVRFAEEV
FT                   ARQQRRLKIGWFRYLIKSRPLNVLTAPVIYAGFIPFMILDLFLWLYQSICFPVYGIPKA
FT                   KRSDYLIFDREDLPYLNVIEKFNCFYCSYGNGLMAYGREIAARTEQYWCPIKHARRIKA
FT                   AHEHYPRFFEYGDAESWQKGLERLRRQYPKEQQPATEVK"
FT   gene            175678..176121
FT                   /locus_tag="Glov_0189"
FT   CDS_pept        175678..176121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /transl_except=(pos:175891..175893,aa:Sec)
FT                   /locus_tag="Glov_0189"
FT                   /product="Thioredoxin domain"
FT                   /note="Contains selenocysteine; PFAM: Thioredoxin domain;
FT                   KEGG: gur:Gura_0335 thioredoxin domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93923"
FT                   /db_xref="GOA:B3EA95"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B3EA95"
FT                   /protein_id="ACD93923.1"
FT                   /translation="MATASYLISCPSCGTGNRIPADKEGVRGRCGNCKSALPPLYCHPQ
FT                   QMTDRTFDSFINSYPGPVLAEFWAPTUPHCHTFAPVVRTVAEKLAGQAAVVQINTQDNP
FT                   NLAARFGIRGIPVIVLLKQGRVVDQLPGAHPLDAVLAWFRRKV"
FT   gene            complement(176269..176607)
FT                   /locus_tag="Glov_0190"
FT   CDS_pept        complement(176269..176607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0190"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   ppd:Ppro_0143 transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93924"
FT                   /db_xref="GOA:B3EA96"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B3EA96"
FT                   /protein_id="ACD93924.1"
FT                   /translation="MASPVNRTYLRQTRDAAELLGKLIRLGRKERKITEEELSGRAGIS
FT                   RRTLQKIERGDPKCEIGLVFEVANIVGVKLFNDEENSIRYTFGRHIDDKLALLPKRVRR
FT                   PVKVNDDF"
FT   gene            complement(176710..178236)
FT                   /locus_tag="Glov_0191"
FT   CDS_pept        complement(176710..178236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0191"
FT                   /product="filamentation induced by cAMP protein Fic"
FT                   /note="PFAM: filamentation induced by cAMP protein Fic;
FT                   KEGG: ppd:Ppro_0217 filamentation induced by cAMP protein
FT                   Fic"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93925"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="InterPro:IPR040198"
FT                   /db_xref="UniProtKB/TrEMBL:B3EA97"
FT                   /protein_id="ACD93925.1"
FT                   /translation="MKTSPTQQHLADALTVLKKLQDDGKSVIKSTELKRIQLSSLVKNG
FT                   FLRQILKGWYMPSRPDEQMGDSTPWFAAMREFIAGYCTERFGDNWHVSPDLSLSLHAGS
FT                   TLLPKQVTVHSPLAKNGTLSLPNGCSLFDYKAVESMTADKVTMVGTLRVLMPETALIKA
FT                   PPSFYRNHARDAQIVLSGVRDVSTLLRELLEGGHSTIAGRLAGALRAVGRAEHADQILA
FT                   TMRSGGYMVTESNPFEELLPMNLLTHSESRHALRIRLMWHEMRQPVLELFPQEPGIPEN
FT                   IDLFMSRIEEQYQLDAYHSLSIEGYRVSDELISRVSRGDWNPENTREDSESRNAMAARG
FT                   YWLAHNEVMATIRRIFSGANPGTAFRSDHAAWHRSLFSPSVDAGILSAVDLAGYRNAQV
FT                   YIRNAAHVPPSKEAVREMMPELCDLLEAESSSAVRGVLGHFIFVYIHPYMDGNGRIGRF
FT                   LMNAMLASGGFSWTIIPVDRRKEYMEALDAASFGGDIRPFAAFVRSCRVE"
FT   gene            complement(178406..178507)
FT                   /pseudo
FT                   /locus_tag="Glov_0192"
FT   gene            complement(178541..179023)
FT                   /pseudo
FT                   /locus_tag="Glov_0193"
FT   gene            179023..179508
FT                   /locus_tag="Glov_0194"
FT   CDS_pept        179023..179508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0194"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="KEGG: ppd:Ppro_0153 transcriptional regulator, XRE
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93926"
FT                   /db_xref="GOA:B3EA98"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B3EA98"
FT                   /protein_id="ACD93926.1"
FT                   /translation="MLTFLYNSYVRRHSFSIEIPLEKLPLPGYPTNPVTIGDHIRKRRM
FT                   DLGLLQREVAEIIGVTESSVWNWEHGVEPELQYNPRIIKFLGYIPFDCPDDTVGRLAWY
FT                   KRAMGMNLDHLGEAMGRDPEQLSDWLSGRHNPFRKNREKIELFLENQKTFLLPEKRR"
FT   gene            complement(179569..179774)
FT                   /pseudo
FT                   /locus_tag="Glov_0195"
FT   gene            180041..180643
FT                   /locus_tag="Glov_0196"
FT   CDS_pept        180041..180643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0196"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: gme:Gmet_3466
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93927"
FT                   /db_xref="GOA:B3EA99"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013570"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:B3EA99"
FT                   /protein_id="ACD93927.1"
FT                   /translation="MTKRRRETTEVRQQQITEAAMQVIGQKGINGATTVEIASAAGISE
FT                   GNLYRHFRNKEEIIKSVIDKIGNDLAAILAGVAEISDPLQKLEITFKRHLMYIEGNVGV
FT                   PRTIFSEETIVANENLRARVKGTILMYFQGVKEIVEQGQKIGALGTEMDSQAITSMFIG
FT                   TIHFAVTRWLMSNFAPKLTDEAEGLWKNFAIAVTHKD"
FT   gene            180677..181315
FT                   /locus_tag="Glov_0197"
FT   CDS_pept        180677..181315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0197"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ppd:Ppro_3698 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93928"
FT                   /db_xref="UniProtKB/TrEMBL:B3EAA0"
FT                   /protein_id="ACD93928.1"
FT                   /translation="MKKRINKFAGTLAVAVACFGLLLTPRFAAAHCDTMDGPVVQDARK
FT                   ALNTKDVTPVLKWIQVKDEKTVKDAFKKALAAQGKKQQQAAEKKFFESLVRVHRAGEGA
FT                   PFTGLKPAGEVEPVIAEADKALAGGSPDGLVKMVTDSVSQGIRQRYEKVAEALKHKDEK
FT                   VQKGREYVEAYVEYTHYVERLQMDAEGHAAHHGESAHKKHAVQKLEHGH"
FT   sig_peptide     180677..180769
FT                   /locus_tag="Glov_0197"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.859 at
FT                   residue 31"
FT   gene            181386..181580
FT                   /locus_tag="Glov_0198"
FT   CDS_pept        181386..181580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0198"
FT                   /product="ferredoxin family protein, putative"
FT                   /note="KEGG: ppd:Ppro_3697 ferredoxin family protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93929"
FT                   /db_xref="GOA:B3EAA1"
FT                   /db_xref="InterPro:IPR001080"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:B3EAA1"
FT                   /protein_id="ACD93929.1"
FT                   /translation="MAKKAWVDQAECISCGLCVDNLPDVFRFDDSGKAECFDSYAATED
FT                   EIQANAIDICPVSCIHWEE"
FT   gene            181609..182319
FT                   /locus_tag="Glov_0199"
FT   CDS_pept        181609..182319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0199"
FT                   /product="protein of unknown function DUF542 ScdA domain
FT                   protein"
FT                   /note="PFAM: protein of unknown function DUF542 ScdA domain
FT                   protein; Hemerythrin HHE cation binding domain protein;
FT                   KEGG: ppd:Ppro_3700 protein of unknown function DUF542,
FT                   ScdA domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93930"
FT                   /db_xref="GOA:B3EAA2"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="InterPro:IPR019903"
FT                   /db_xref="InterPro:IPR038062"
FT                   /db_xref="UniProtKB/TrEMBL:B3EAA2"
FT                   /protein_id="ACD93930.1"
FT                   /translation="MQEITGNKTIGEIVATDFRTATVFEKHGIDFCCGGKVALAATCTE
FT                   KRLDLNTITSELEAVQNEPVERDQNYSSWSLPFLADYIVNTHHVYLKENDEQIAAYARK
FT                   IAGVHGAHHPEVIRIATIFEKIATDMVGHLKEEEEVFFPALKRADAARTAGSTPEAKDR
FT                   ETIRVSLLRLHREHEEIGDAIHEIRHLANDYVIPDDVCNTFMLTYKKLSEFEDDLHKHV
FT                   HLENNILFLKATQL"
FT   gene            182395..183120
FT                   /locus_tag="Glov_0200"
FT   CDS_pept        182395..183120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0200"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tbd:Tbd_2161 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93931"
FT                   /db_xref="GOA:B3EAA3"
FT                   /db_xref="UniProtKB/TrEMBL:B3EAA3"
FT                   /protein_id="ACD93931.1"
FT                   /translation="MKRILKYDWDAIAGIIAAVAAIVMHMLHVVEAEVLLMISVVLIAL
FT                   LFLRDLRRERQSEHIEASLHQTEVTVKDILSQLSPPDAVLVGPLSIRQAMEDFSRRARN
FT                   EMLWFHVCPVMFKRQELFDALLKTAIENPAVKSIQFILDTSDREMWESEVVPKIKRCAN
FT                   QDKVRETIWTSISGGVSAIISDLDKEGKTECLLSFWGEPFMARTPSHNVPRYVFHVQSH
FT                   SELVGRMVEVVRTACLHKC"
FT   sig_peptide     182395..182493
FT                   /locus_tag="Glov_0200"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.856) with cleavage site probability 0.383 at
FT                   residue 33"
FT   gene            183180..184106
FT                   /locus_tag="Glov_0201"
FT   CDS_pept        183180..184106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0201"
FT                   /product="cytochrome b5"
FT                   /note="PFAM: cytochrome b5; KEGG: mma:MM_1570 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93932"
FT                   /db_xref="GOA:B3EAA4"
FT                   /db_xref="InterPro:IPR001199"
FT                   /db_xref="InterPro:IPR008457"
FT                   /db_xref="InterPro:IPR036400"
FT                   /db_xref="UniProtKB/TrEMBL:B3EAA4"
FT                   /protein_id="ACD93932.1"
FT                   /translation="MPKKVLQQIVGLFLFMSFVMLLPHQVGATEEYAKQTAQACAICHF
FT                   DPGGGGELTTAGKAFAESLQIKKVNPERGTFVKVFRLAIGYIHFLTAIFWFGTILYVHL
FT                   ILKPAYAASGLPRGELRVGIVSMIVIGVTGSILTYYRVSSSDTLFHTRFGILLTIKICL
FT                   YLVMVLSALFVITVIGPRLKAKRKELLYPNSTGELTLEGLASYDGIEGRPAYFAFEGKI
FT                   YDATHSLLWKQGTHMGRHNAGNDLTEALNLAPHGREKVTAMTVVGELIASSPRKAPLHE
FT                   RVFFFMAHMNLTLVFIIILILSLWRWG"
FT   sig_peptide     183180..183266
FT                   /locus_tag="Glov_0201"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.986) with cleavage site probability 0.976 at
FT                   residue 29"
FT   gene            184312..185106
FT                   /locus_tag="Glov_0202"
FT   CDS_pept        184312..185106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0202"
FT                   /product="cytochrome c class I"
FT                   /note="PFAM: cytochrome c class I; KEGG: gme:Gmet_0328
FT                   cytochrome c, class I"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93933"
FT                   /db_xref="GOA:B3EAA5"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:B3EAA5"
FT                   /protein_id="ACD93933.1"
FT                   /translation="MANRNRFLSCFSTLLVLIASSYPVQADQGKDLFDKQCASCHTIGG
FT                   GDGGGPDLKGVTEKQTGDWLVRVIVEPDKLTAAKDPHQAELVKKFGFEMPNLGISSEDA
FT                   KKIIAYLATAGGVAASSSSVPAPEKTELLVTPELIAQGKALFTGSKRFAKGGAPCLSCH
FT                   PFTYPGISGGNLSIADLNKSYKKMGDAGMQGALKALKFPIMKNMYADRPLTDDEIKALM
FT                   ALFKDSAAQKEGTGGFKTFQLAGGILFFGLLLGLALYKRRIR"
FT   sig_peptide     184312..184392
FT                   /locus_tag="Glov_0202"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.945 at
FT                   residue 27"
FT   gene            185106..188681
FT                   /locus_tag="Glov_0203"
FT   CDS_pept        185106..188681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0203"
FT                   /product="nitrate reductase, alpha subunit"
FT                   /EC_number="1.7.99.4"
FT                   /note="KEGG: gme:Gmet_0329 nitrate reductase, alpha
FT                   subunit; TIGRFAM: nitrate reductase, alpha subunit; PFAM:
FT                   molybdopterin oxidoreductase; molydopterin
FT                   dinucleotide-binding region"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93934"
FT                   /db_xref="GOA:B3EAA6"
FT                   /db_xref="InterPro:IPR006468"
FT                   /db_xref="InterPro:IPR006655"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR027467"
FT                   /db_xref="InterPro:IPR037943"
FT                   /db_xref="UniProtKB/TrEMBL:B3EAA6"
FT                   /protein_id="ACD93934.1"
FT                   /translation="MANERIKDDHSPCDRGWEEFYRNRWQHDKVVRSTHGVNCTGGCSW
FT                   MVHVKDGIVGWELQANDYPQFNGDLPNHEPRGCPRGISFSWYLYSPLRVKHPYMRGVLI
FT                   DLWRQARAVHDDPVEAWKSIVENSESRESYVSKRGMGGFRRASWDEANELIAASSLYTA
FT                   KKHGPDRVIGFSPIPAMSMISYAAGTRFLQLLGGVAMSFYDWYCDLPPASPQVWGEQTD
FT                   VNESADWYNASYIVLCGSNVPMTRTPDAHFMTEARYRGTKVVVMSPDYSMASKFADAWL
FT                   PVEQGHDGAFWMAVNHVILTEFYANRQVPFFDEYVRKYTDLPFLVKLIEKDGALLQGEF
FT                   LRAADLERGEGIENADWTLCVGDSAGKVRFPHGSVGSRWSKQEGNWNLDMVDLVDGGDI
FT                   DCCLTNIGQDTRTVRFSFEADGDILRDVPVRRVMTKVGEITVATVFDLLMGQFGVSRGL
FT                   GGDYPANYQDDKPFTPTWQEKYTGIAADTLITIAREWSVNGEQSGGRNMIIIGAGVNHW
FT                   YHNDLIYRAAITALILTGSVGRNGAGLAHYVGQEKVVPLAPWTSIAMAQDWTKASRLQN
FT                   TPSFWYMHSDQWRYDRNFVDYFKPETGVNMPMHTADFNAKAVRLGWLPFSPHFNESPVR
FT                   LMEQAQAAGALSDDEVRAWLIKRLKSGETRFAIEDPDGEGNSPKVWFIWRGNAISSSAK
FT                   GHEFFLKHVIGAPNSSFTAREAAKGQVKDIVWHEKAPTGKMDLVVDLNFRMDTSTLYSD
FT                   IVLPAATWYEKSDLNTTDMHSFVNCMDAAVDPAWESKSDWNIFAGIAKKVSELSPKHFP
FT                   TPFKDIIAAPLQHDTPGEIAQRNVKDWKLGECEAIPGKTMPNLPIVERDYVNLYNRFMS
FT                   LGPHIGHLHAHGVSWEADDVHEKLLTTMPTRSWGDKTFIDMEDVRNVADVIMALAPETN
FT                   GELAHRAYQTLEKRVGKPLAQISEGDRNFRITWEEVTQKPRRHLSSPVWSGLVNENRPY
FT                   APFTLNVEHGVPWRTLSGRQSLYLDHPYYGEFNEGLPTFKGKLNPALMDETEGETGLIL
FT                   NFLTPHGKWSIHSTYSDNQRMLTLSRGGPVVWLNHEDAASAGIEDNEEIEVFNANGVVT
FT                   SRAVVSSRIPRGAAVMYHAPERTLNVKKSRKSGKHGGVHNSLSRIRLKPTLMLGGYAQF
FT                   SYYFNYWGPTGVNRDSYVVVRKLRG"
FT   gene            188686..190137
FT                   /locus_tag="Glov_0204"
FT   CDS_pept        188686..190137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0204"
FT                   /product="nitrate reductase, beta subunit"
FT                   /EC_number="1.7.99.4"
FT                   /note="TIGRFAM: nitrate reductase, beta subunit; KEGG:
FT                   gme:Gmet_0330 respiratory nitrate reductase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93935"
FT                   /db_xref="GOA:B3EAA7"
FT                   /db_xref="InterPro:IPR006547"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR029263"
FT                   /db_xref="InterPro:IPR038262"
FT                   /db_xref="UniProtKB/TrEMBL:B3EAA7"
FT                   /protein_id="ACD93935.1"
FT                   /translation="MNVRAQLVMVFNLDKCIGCHTCSISCKNIWTDRKGAEYMWWNNVE
FT                   TKPGVGYPKKWENQDTFKGGWRREDGKLKLRALGKGPTLLNMFFQPNMPKLEDYYEPFD
FT                   FDYSNLYKAPPGSDQPVAEAFSQVSGVRIEKITGGPNWDDDLSGSQVYAVEDSNLEDRT
FT                   LVEDYGRMFMHYLPRICNHCLNPACVASCPSRAIYKRGEDGVVLVDQEVCKGWRFCTSA
FT                   CPYKKVYFNWQSGKAEKCIFCFPRTETGQCNACAHSCVGRIRHVGVLLYDADRVEEALL
FT                   KPDEQLVAAHRDVILDPHDPTVREAARKNGVSDQWLEAAEKSPVYALVKEFAVALPLHP
FT                   EFRTMPMAYYIPSLSPVISSGGDLHELADHGTFPLLEKMRAPISFLASLLSGGNQEIIA
FT                   DILRKQIALRLFKRAGNLGQPVEESILKNAGLDEAGANRLYRLFTIAPYRERNIIPTQQ
FT                   REEQDSYQRKGASGFGILKKTRGAK"
FT   gene            190134..190679
FT                   /locus_tag="Glov_0205"
FT   CDS_pept        190134..190679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0205"
FT                   /product="nitrate reductase molybdenum cofactor assembly
FT                   chaperone"
FT                   /note="TIGRFAM: nitrate reductase molybdenum cofactor
FT                   assembly chaperone; PFAM: Nitrate reductase delta subunit;
FT                   KEGG: gme:Gmet_0331 respiratory nitrate reductase chaperone
FT                   NarJ"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93936"
FT                   /db_xref="GOA:B3EAA8"
FT                   /db_xref="InterPro:IPR003765"
FT                   /db_xref="InterPro:IPR020945"
FT                   /db_xref="InterPro:IPR036411"
FT                   /db_xref="UniProtKB/TrEMBL:B3EAA8"
FT                   /protein_id="ACD93936.1"
FT                   /translation="MTIADSYDALARMLDYPENKELLQTDYELVSSFLKKQRLENFIYS
FT                   FAEFASVSSLAALQEEYVATFDFNPATAPYLGHHLFGDNQKKGGYMIMLKQEFERCGYN
FT                   PVGTELPDHLSVVLGFLAHLARQEDYGPRRPFITECVLPGVERLHTAFTARQDSHWQVL
FT                   VETARLLCAEDCKEVQSC"
FT   gene            190673..191341
FT                   /locus_tag="Glov_0206"
FT   CDS_pept        190673..191341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0206"
FT                   /product="respiratory nitrate reductase, gamma subunit"
FT                   /note="TIGRFAM: respiratory nitrate reductase, gamma
FT                   subunit; PFAM: Nitrate reductase gamma subunit; KEGG:
FT                   gme:Gmet_0332 respiratory nitrate reductase gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93937"
FT                   /db_xref="GOA:B3EAA9"
FT                   /db_xref="InterPro:IPR003816"
FT                   /db_xref="InterPro:IPR023234"
FT                   /db_xref="InterPro:IPR036197"
FT                   /db_xref="UniProtKB/TrEMBL:B3EAA9"
FT                   /protein_id="ACD93937.1"
FT                   /translation="MLNSFIFVVLPYAALVMILFVTPYRFYTNRLTWSAYSTQFLEQKT
FT                   LYWGAVSWHYGIILILLAHLAGIVCPHGMERLLGNQQTLIVLESIGIGLGLLALFGSVM
FT                   LLLRRVNATILKQVTFASDWVLLFLLVLQTATGVYVSTFMRWGSVWYLHTAVPYIYSLL
FT                   SFRPQMEYVADFPLVFKLHVGMAFLIIALLPFTKLVHLLFFPYRFLADPPILYRWRSRG
FT                   "
FT   gene            191379..192899
FT                   /locus_tag="Glov_0207"
FT   CDS_pept        191379..192899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0207"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   fjo:Fjoh_4629 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93938"
FT                   /db_xref="GOA:B3EAB0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B3EAB0"
FT                   /protein_id="ACD93938.1"
FT                   /translation="MLEVATWKSHKNLFLNTLAFTVCFAAWMFNGVLVTFLVDNQVFNW
FT                   GPVKIGWLFGIPVLTGSLFRLPAGMLTDKFGGKPVYGTLLILCAIPMYLLSKADSFTSF
FT                   ALCSFGFGMAGVSFSIGIAFTSVWYPRERQGTALGIFGAGNAGAALTTLLAPTMLNRLT
FT                   NNGANIERWRDLPVYYALILAAMGVIFFIFSDNKKPASSGKTFVQMLTPLKHMRVWRFG
FT                   LYYFLVFGCFVAFSQWLVPYFVNVYYLPLVTAGLFASMFSLPSGVIRALGGWMSDKFGG
FT                   RQIMYWVLGASTVISLMVMVPKMEIQSPGRGVMAKRAGVVQAVTDKTVVVKELKATSEV
FT                   LGEQPYPLNAKPTVMENFDDRMLILPGKQTWQEPVVKVGQTVKKKELLAKGVTRIYFQA
FT                   NVWIFAGLVLVLGTIWGIGKAAVYKLIPDYFPEEVGVVGGMVGVLGGLGGFVCPIVFGY
FT                   LLEWTGVWTSCWMFMFVLSVVCLVSLHYVVQKMMKDKHPGDMRVFENN"
FT   gene            192920..194293
FT                   /locus_tag="Glov_0208"
FT   CDS_pept        192920..194293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0208"
FT                   /product="nitrite transporter"
FT                   /note="TIGRFAM: nitrite transporter; PFAM: major
FT                   facilitator superfamily MFS_1; KEGG: gme:Gmet_0334 nitrate
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93939"
FT                   /db_xref="GOA:B3EAB1"
FT                   /db_xref="InterPro:IPR004737"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B3EAB1"
FT                   /protein_id="ACD93939.1"
FT                   /translation="MARVLTTWNPEDKEFWESEGKAIANRNLWISIPALLLAFSVWMVW
FT                   SMVVVKLPLIGFQFDTNQLFWLAAVPALSGATLRIFYSFMVPIFGGRRWTAISTASLLI
FT                   PAVGIGFAVRDHTTSYTTLLSLALLCGFGGGNFSSSMANISFFFPKAQKGTALGLNAGL
FT                   GNLGVSAMQFLVPLAITAGVLGPVCGDPQVCVVNGATKQLWLQNAGFIWVPFIIIATIA
FT                   AWFGMNDIADAKASFREQAVIFKRKHNWLMCWLYLGTFGSFIGFSAGFALLTKKLFPEI
FT                   DPTQYAFLGPLVGAIARPIGGWISDKLGGARVTLWTFAAMVFAVFGVLAFLPHNGQGGS
FT                   FFGFLIMFLILFTLTGIGNASTFRMIPIIYITEHQRNARGRSEVQINMDAAKEAAAALG
FT                   FAGALGAYGGFFIPKSFGTSIAMTGGPEAALYGFIIFYMLCIVMTWWFYSRSNAEMPC"
FT   gene            194359..194655
FT                   /locus_tag="Glov_0209"
FT   CDS_pept        194359..194655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0209"
FT                   /product="cytochrome c3"
FT                   /note="KEGG: gme:Gmet_0335 cytochrome c3"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93940"
FT                   /db_xref="GOA:B3EAB2"
FT                   /db_xref="InterPro:IPR002322"
FT                   /db_xref="InterPro:IPR029467"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:B3EAB2"
FT                   /protein_id="ACD93940.1"
FT                   /translation="MKITSKLPAVISLIAISAFAGTVFAADVIELPASMGKVMFPHKKH
FT                   QEMLKDCKKCHEKGPGKIKELGKDWAHKTCKGCHTEGFNGKKGPTACKDCHKK"
FT   sig_peptide     194359..194436
FT                   /locus_tag="Glov_0209"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 26"
FT   gene            194700..195908
FT                   /locus_tag="Glov_0210"
FT   CDS_pept        194700..195908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0210"
FT                   /product="molybdenum cofactor synthesis domain protein"
FT                   /note="TIGRFAM: molybdenum cofactor synthesis domain
FT                   protein; PFAM: molybdopterin binding domain; MoeA domain
FT                   protein domain I and II; MoeA domain protein domain IV;
FT                   KEGG: gur:Gura_0462 molybdenum cofactor synthesis domain"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93941"
FT                   /db_xref="GOA:B3EAB3"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR005111"
FT                   /db_xref="InterPro:IPR008284"
FT                   /db_xref="InterPro:IPR036135"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036688"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:B3EAB3"
FT                   /protein_id="ACD93941.1"
FT                   /translation="MISIEDAQQIIQKHITGAKTIEASLLDSLGRVIAEDVYAPWDIPT
FT                   SDNSAMDGYAFSSLSERNEFRVAAEFIPAGSQRIAPVGLGEAVRIMTGAPVPPGCDTVV
FT                   PIEDVEQIPSGIRLKNEMKPGAHIRLRGEDVEKDELVLAKGSAIRPQEIGLLVSLGKTT
FT                   IKVFRPARVAILATGDELQEAGSVPDAGRIINSNSYSLAAQVLDAGGEAFMIGIAADTA
FT                   QATEEKIREGLKADMLITTGGVSVGDRDFVKESIQNIGGSLLFWKVNMKPGKPVAFAVL
FT                   EDKPVFALPGNPVAAMVAFEMFVRPAMLLKQGCPRIYRPRIKAVLVNDVRNRGDRPHLV
FT                   RVKVTLDHGEYHASIAGNQSSANLASLTQSNGLLHLIPNSSLTAGSRVEVILLDREFEM
FT                   GCA"
FT   gene            196004..197455
FT                   /locus_tag="Glov_0211"
FT   CDS_pept        196004..197455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0211"
FT                   /product="Nitrite reductase (cytochrome; ammonia-forming)"
FT                   /EC_number="1.7.2.2"
FT                   /note="PFAM: cytochrome c552; KEGG: gur:Gura_0665 nitrite
FT                   reductase (cytochrome; ammonia-forming)"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93942"
FT                   /db_xref="GOA:B3EAB4"
FT                   /db_xref="InterPro:IPR003321"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:B3EAB4"
FT                   /protein_id="ACD93942.1"
FT                   /translation="MKMQYARISTVLAILATAVIWAGCSQQKVEPLKTVAIADGTIDPA
FT                   EWGKVYPLQYKLWQQTGEPTPAGKSKYKKGYDVDEDRRDKLDEYPFLALLYNGWGFGSE
FT                   YREPRGHFFMVQDQLEVDPGRVKAGGSCLTCKTPYAPILEKQMGKAYFSTPYKEVLAKL
FT                   PKDQQTLGVACIDCHDNRGMALKISRGFTLGKGLKNIGLDETKLAKAEMRTLVCAQCHV
FT                   SYIITKDKEMHSTDVVFPWKGSKAGYITIENIIAQIKSSPANMEWTQSVTGFKMGFIRH
FT                   PEYELFSNNSPHWTNGVSCADCHMPTVTEDGQKISDHRIMSPLKNDLIACAACHSEKPQ
FT                   ELRDKIIAIQDETMIVYLKAGYATATVAKLFEMTNKVEASGKKINKDLYAQSKEQYEQA
FT                   FYRLIFIGAENSNGFHNPKETMRVLNDAAKYAASADAQLRKLLTQAGEKVPEKIDLELS
FT                   KYTNNRGVKKIMFKPEHEIKSPEVK"
FT   sig_peptide     196004..196087
FT                   /locus_tag="Glov_0211"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.937) with cleavage site probability 0.704 at
FT                   residue 28"
FT   gene            197525..198217
FT                   /locus_tag="Glov_0212"
FT   CDS_pept        197525..198217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0212"
FT                   /product="glutamine amidotransferase class-I"
FT                   /note="PFAM: glutamine amidotransferase class-I; KEGG:
FT                   mms:mma_3646 GMP synthase (glutamine-hydrolyzing)"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93943"
FT                   /db_xref="GOA:B3EAB5"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B3EAB5"
FT                   /protein_id="ACD93943.1"
FT                   /translation="MKVHVLQHVPFEGIGSIRLWLEKHGADVSYTRFFEDHDLPQMNNF
FT                   DLLIVMGGPMSVNDELRITWLRSEKQLLREAIYHGVSVVGICLGAQLIASALGARVYKN
FT                   TQKEIGWFQIESTQNEINTFNFPKKCNVFHWHGETFDLPSGAVCLARSAASENQAFQIG
FT                   KNVIGLQFHLETTPESVNAILENCGSELIAGSYIQTESEMRALKCPSYEESNNLMEKVL
FT                   SYVTRDLS"
FT   gene            198449..200050
FT                   /locus_tag="Glov_0213"
FT   CDS_pept        198449..200050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0213"
FT                   /product="hybrid cluster protein"
FT                   /note="TIGRFAM: hybrid cluster protein; PFAM: Prismane;
FT                   KEGG: ppd:Ppro_3702 hydroxylamine reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93944"
FT                   /db_xref="GOA:B3EAB6"
FT                   /db_xref="InterPro:IPR004137"
FT                   /db_xref="InterPro:IPR010048"
FT                   /db_xref="InterPro:IPR011254"
FT                   /db_xref="InterPro:IPR016099"
FT                   /db_xref="InterPro:IPR016100"
FT                   /db_xref="UniProtKB/TrEMBL:B3EAB6"
FT                   /protein_id="ACD93944.1"
FT                   /translation="MSMFCNQCEQAANGTGCNISGVCGKKPDVAALQDHLVYGLKSLAL
FT                   YADKIGRNAEIDRFTIEGLFTTVTNVDFEAARIGDLIKKCYALKENAKAAYGSSIANPV
FT                   ADWQPAADLTGMITQGEQHGINSQHVNEDIRSVIEILMYGLKGMAAYMDHAMILGRSND
FT                   DVMAFFQKALAATTDTNLGLMDFVGLSMECGKQNLTVMGLLDSAHTDTYGHPVPTPVQL
FT                   GTKSGKAILVSGHDLKMLEEILKQTEGKGINIYTHGEMLPAHGYPGLKKYSHLVGNYGG
FT                   AWQDQAQEFARFPGAIIFNTNCIQKPSDTYIDRLFTWGLVAWPGVKHIDGWDFSAVINK
FT                   ALECPALPENPGQEILTGFGHNAVLGVADKVIAAVKAGQIKHFFLVGGCDGAKSGRNYY
FT                   TEFAEKAPKDTVILTLACGKYRFNKLEFGDIGGIPRLLDIGQCNDAYSAIQIAVALAGA
FT                   FECGVNDLPLSMILSWYEQKAVVILLTLLSLGIKNIKLGPTLPAFITPTVLNFLVENFN
FT                   IGPITTAEADLKAILG"
FT   gene            200246..200680
FT                   /locus_tag="Glov_0214"
FT   CDS_pept        200246..200680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0214"
FT                   /product="putative PAS/PAC sensor protein"
FT                   /note="KEGG: ppd:Ppro_1202 putative PAS/PAC sensor protein;
FT                   TIGRFAM: PAS sensor protein; PFAM: PAS fold-4 domain
FT                   protein; PAS fold domain protein; SMART: PAS domain
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93945"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B3EAB7"
FT                   /protein_id="ACD93945.1"
FT                   /translation="MDNLLNQLVNDAPDAILISDQKGVIRYWNSGAEQMFGHTATEAVG
FT                   QSLDLIIPENLRSRHWEGYWRVMASGETKYKTGLLSSPGVRKDGARVSLEFSMVLLRDD
FT                   DGVMAGCASIMRDVTERWKKEKELKERLSVCEAKLAETSP"
FT   gene            200758..201975
FT                   /locus_tag="Glov_0215"
FT   CDS_pept        200758..201975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0215"
FT                   /product="NADH dehydrogenase (ubiquinone)"
FT                   /EC_number="1.6.5.3"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: gsu:GSU0493 pyridine
FT                   nucleotide-disulphide oxidoreductase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93946"
FT                   /db_xref="GOA:B3EAB8"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B3EAB8"
FT                   /protein_id="ACD93946.1"
FT                   /translation="MGFGGIRTARVLAGKGLDVILADRNNYHLFQPLLYQVATAGLEQE
FT                   SIAHSVRAMARNWSGTRFQLTEVNGVDFVSREVLTDTGCIPYDYLVIGAGSVTNFFGLE
FT                   SVERNSFDLKELADAETLRNHILTAFERAVLEPDPARKRALMTFVIVGGGPTGVEFAGA
FT                   LIELVHFVLAKDYPELSTHAARVVLVEATDKLLASMPAKQRTYTLKKLRSMSVEVLLNA
FT                   RVVDAGPERVTLHDGAIIPAHTLFWSAGVKAAPIAAVIDVPHRAGGRIPVESDLTIPGH
FT                   PEVFVIGDMAYLEQEGSALPMTAPVAMQMGIYVGKAILAKERNSSTPPFRYCDKGSMAT
FT                   IGKNAAVASAFGMDFRGYMAWLVWLLLHLYYLIGFRNRIVVMLNWVWYYWFHERQVRLI
FT                   TRRDGK"
FT   gene            201977..202981
FT                   /locus_tag="Glov_0216"
FT   CDS_pept        201977..202981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0216"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein"
FT                   /note="KEGG: ppd:Ppro_3704 4Fe-4S ferredoxin, iron-sulfur
FT                   binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93947"
FT                   /db_xref="GOA:B3EAB9"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B3EAB9"
FT                   /protein_id="ACD93947.1"
FT                   /translation="MTLRSTKSLSTMRVIIQWCFLFWVVGIGIRFGIFVNAVERGASTS
FT                   FVSRPPGVEGFLPIGALTSLKYWLVSGEIHPVHPAALIIFMTVLFMSLFAKKSFCSWFC
FT                   PVGTLSEGVFKLGRKLVGKNYRMWRWLDYGLRSIKYLLLLMFVKFILVDMSVAALGGFL
FT                   DAPYWAVSDVKMLRFFTHMSVTTMVVLAILTALSLFYKMFWCRYLCPYGALLGVASIIS
FT                   PFKIRRDLAGCTGCKRCSAACPSGLGVHSSTAVSSPECTGCLTCVSHCPERNVLAMQPV
FT                   FWKRPLPVWVFPTVILSIFMAGIGAGIVSGHWQSSLNFADYQRLIPLVPYLSH"
FT   gene            203035..203739
FT                   /locus_tag="Glov_0217"
FT   CDS_pept        203035..203739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0217"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gme:Gmet_3457 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93948"
FT                   /db_xref="UniProtKB/TrEMBL:B3EAC0"
FT                   /protein_id="ACD93948.1"
FT                   /translation="MFNRICRNLYPSLIITLMLPLPALAIPAITCHCFTDRAYDPARPS
FT                   IADPYFLATTANSFFSAAFGVEKKSIVIKKQKGVSADDLWIGYWLAARSGVDPETLLEQ
FT                   RKIKGSWRQVATPLAIPVKSLGGRVAETLNNNFADERLTNAVVDELLLRFRFHSEPELV
FT                   ILRKAGAGNQELIIVALIAAKTGQPAIQLYRDIKEGRTSWGALLQRAKIEPPDIQSEIA
FT                   TLIKTASVFSSS"
FT   sig_peptide     203035..203112
FT                   /locus_tag="Glov_0217"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.948) with cleavage site probability 0.791 at
FT                   residue 26"
FT   gene            complement(203895..204185)
FT                   /locus_tag="Glov_0218"
FT   CDS_pept        complement(203895..204185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0218"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fnu:FN0683 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93949"
FT                   /db_xref="UniProtKB/TrEMBL:B3EAC1"
FT                   /protein_id="ACD93949.1"
FT                   /translation="MCDCGSTKTPGTGPFASGKELVEFVLAAHGGGIAVSPVPNGGLTA
FT                   KCQGCGAPFILKTFVQACPECGGVHAVSPPRAYDSTAIQFAGKDFVLPTVP"
FT   gene            204373..204594
FT                   /locus_tag="Glov_0219"
FT   CDS_pept        204373..204594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0219"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gsu:GSU2659 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93950"
FT                   /db_xref="InterPro:IPR038062"
FT                   /db_xref="UniProtKB/TrEMBL:B3EAC2"
FT                   /protein_id="ACD93950.1"
FT                   /translation="MNFNNTLGDKAIQDVMQAYPEIGEILARYDIGCTTCKVGICLLKD
FT                   VVSIHGLSKEDEVKIEHEINELLAKKGA"
FT   gene            204598..205053
FT                   /locus_tag="Glov_0220"
FT   CDS_pept        204598..205053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0220"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gsu:GSU2660 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93951"
FT                   /db_xref="UniProtKB/TrEMBL:B3EAC3"
FT                   /protein_id="ACD93951.1"
FT                   /translation="MGNLGCGCPGSMAKVIERPVSEDNSSVKAVSELRQWPVQLHLVPP
FT                   SAPYFMKAEILVCADCVAFAMGSMHQDLLKGKALAIACPKLDETDSYVDKLATIFSTNE
FT                   TPSVTVAIMEVPCCRGLDVMVKEAISKSGRDIPLETVIVGIDGNRRN"
FT   gene            205053..205601
FT                   /locus_tag="Glov_0221"
FT   CDS_pept        205053..205601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0221"
FT                   /product="Hemerythrin HHE cation binding domain protein"
FT                   /note="PFAM: Hemerythrin HHE cation binding domain protein;
FT                   KEGG: gsu:GSU2661 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93952"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="UniProtKB/TrEMBL:B3EAW8"
FT                   /protein_id="ACD93952.1"
FT                   /translation="MKTDITKSLVDEHQLILRMITLLEKNAPLTAEGKYLNWQFYLDGI
FT                   DFIRQYADRFHHAKEEDVLFKALVDNGMPKDNSPVAAMLMEHGQGRSFVCAMEIAVLEA
FT                   QSGRTDTYQAIAENVLGYASLLRGHIGKEDDILYPLSERVLPEIVRASILEGYRSAEAQ
FT                   IPSGVRERYNAIVTQYEQE"
FT   gene            205624..205752
FT                   /locus_tag="Glov_0222"
FT   CDS_pept        205624..205752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0222"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93953"
FT                   /db_xref="GOA:B3EAW9"
FT                   /db_xref="UniProtKB/TrEMBL:B3EAW9"
FT                   /protein_id="ACD93953.1"
FT                   /translation="MLTTSEIAATAAIWVLLAIGGFFCIRAAVRKITAKKQTIKNR"
FT   sig_peptide     205624..205707
FT                   /locus_tag="Glov_0222"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.616) with cleavage site probability 0.535 at
FT                   residue 28"
FT   gene            205816..206403
FT                   /locus_tag="Glov_0223"
FT   CDS_pept        205816..206403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0223"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: gur:Gura_3410
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93954"
FT                   /db_xref="GOA:B3EAX0"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041490"
FT                   /db_xref="UniProtKB/TrEMBL:B3EAX0"
FT                   /protein_id="ACD93954.1"
FT                   /translation="MQKKSTRVRKEEIVQAALGVVGKRGVRSLTISAIAESAGMSEANI
FT                   YRHFGGKDDILLAMADFIGTSLVAKAATIAAGSRNPLDKLETIFFLHIALITEHSGIPR
FT                   FVFSDDIHLSHKNIAERLALRICNYIETLAGVVAAGVAEGELRPGLFPRETALTLLGMI
FT                   QFTALRWTISSESFEIRQEAENLWQNFKELVS"
FT   gene            206472..207731
FT                   /locus_tag="Glov_0224"
FT   CDS_pept        206472..207731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0224"
FT                   /product="outer membrane efflux protein"
FT                   /note="PFAM: outer membrane efflux protein; KEGG:
FT                   gur:Gura_3409 outer membrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93955"
FT                   /db_xref="GOA:B3EAX1"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR028351"
FT                   /db_xref="UniProtKB/TrEMBL:B3EAX1"
FT                   /protein_id="ACD93955.1"
FT                   /translation="MKPVILSLIVILMSSLPLFAASPLTLEEAIASALKSHPQVVEARE
FT                   NLNGAEAKTGQLLANYYPQISLSADWIRGQSYFPAQETIKISETNIASLYLKQTIYDFG
FT                   RTSGAVEAARGNREAADNALTVTRQDLTLRVRVAFYLVLALEKQVQAVRENVKAREDVF
FT                   RQAQEFFNQGIRARVDVVRAEANFFAAKTNLIRAESNREIARVELANAMGITSLGERTP
FT                   VATSFALLSLPERHTSQQKALSNRAELQQFAAMKSAANGNLTSAKSSYLPILSGVASIG
FT                   YADRDFPPTGNVWEVGLNLTVPLFSGFSSVEQVREAAAAMNSIEARQNNLKLQIIKEVE
FT                   SAWFGGNDAAARMISTQKEVDAANESKSLAEGRYQEGVGSIIEVTDAQSQTLDAQTANI
FT                   QAMFDYYTALARLDRAVGKQ"
FT   sig_peptide     206472..206534
FT                   /locus_tag="Glov_0224"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 21"
FT   gene            207755..208798
FT                   /locus_tag="Glov_0225"
FT   CDS_pept        207755..208798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0225"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: biotin/lipoyl attachment domain-containing
FT                   protein; secretion protein HlyD family protein; KEGG:
FT                   ppd:Ppro_3711 efflux transporter, RND family, MFP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93956"
FT                   /db_xref="GOA:B3EAX2"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:B3EAX2"
FT                   /protein_id="ACD93956.1"
FT                   /translation="MDLLNRLAGKRKYLIWAVVLVAGGIALKMTLLAPTKVNVVSVEKR
FT                   DLTAQVYGNGTVEAKVVVDVSSKITGRIVELYADQGDLVKRGQLLAKLENEDFRHQEQQ
FT                   SEAGLNKSAANLNVEQANLQKARSNLTLAEKNAKRYKTLAEKNFVSRLEAEQYDTASQV
FT                   AREEVARSQAAVEAVRMEQQAGRASVGFARSRAADTLIYAPQDGIIITRDLEKGATVSP
FT                   GMSIFTQADPQTIWVKANVDESQLKGVAVGRKAIITLRSSSGEQLPGQVARLGRQSDRV
FT                   TEELVVDVAFTVPLKQFRLGEQSDVYIVTDTKKDAPSLPSAAIVARDKKRGVWVIKDGR
FT                   LTFKGYS"
FT   gene            complement(208817..210133)
FT                   /locus_tag="Glov_0226"
FT   CDS_pept        complement(208817..210133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0226"
FT                   /product="transposase IS204/IS1001/IS1096/IS1165 family
FT                   protein"
FT                   /note="PFAM: transposase IS204/IS1001/IS1096/IS1165 family
FT                   protein; KEGG: drm:Dred_0866 transposase,
FT                   IS204/IS1001/IS1096/IS1165 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93957"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR029261"
FT                   /db_xref="InterPro:IPR032877"
FT                   /db_xref="UniProtKB/TrEMBL:B3EAX3"
FT                   /protein_id="ACD93957.1"
FT                   /translation="MLSILNLRRYHVLSTREDTHDYHIAAETANPPTQCIHCGSDNLVG
FT                   GGRQEIMIRDHLVHAKRVAIYVSARRLHCRECNKTFTESLPDVAEGKRMTARLYQWIAE
FT                   QSLKRTFTSIAEDVGCTEGTIRSVFREYIAKLEETVIFETPEWMGIDEIHIIKKPRLVV
FT                   SNIEHNKVVNILSDRNKTTVSNYLFRLPNRNSIKCVTMDMWLPYKNAVNAVLPSAFIVV
FT                   DKFHVVRMANQSLEVVRKSIREDLTTKQRRGLMHDRFFLLKRESELKPFERLTLESWTR
FT                   NFPVLGEAYQAKEDFLRIYDHLDISDALAAYDTWQSGLSLGVATAFKPLITAVKNWRTE
FT                   IFAYFDHPVTNAYTESLNNLIRCVNRIGRGYSFDALRAKILFTKGAHKVIQPTPKFERR
FT                   DPYAIGRMTHYTPTVSAARTINYGVDTSTLLRLLEESKV"
FT   gene            complement(210509..212053)
FT                   /locus_tag="Glov_0227"
FT   CDS_pept        complement(210509..212053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0227"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dme:Dmel_CG2839 CG2839"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93958"
FT                   /db_xref="UniProtKB/TrEMBL:B3EAX4"
FT                   /protein_id="ACD93958.1"
FT                   /translation="MRYLFIMVLLITCSTSSLAETGRGWSPWYKLDDGGLNGIEFSHKN
FT                   DCPPGGTAACNLQWRFSSAYETPVEIEYTIAWENGGPQKRSERVNIQPGVNVSDAFTVK
FT                   GAALDEVTVRLISDKKILAEARKEVTAELKRQEDERKRKEEAARKAELARKAEQARQEK
FT                   LAQAAALPYTPGEAAEVTQLREETAREIEEDLRQQEEKRREERLAEEQRQEREREQRAE
FT                   EERRAQISRDEEEKKAQTRRDEEREAREWREKREAQEAEDRQSTRDYNASIGAQIMQNI
FT                   NNNAATLARIDRQTSAAINESNRVRAAQAAERDRARAEKEEREADRRRDAERDRAARAD
FT                   AQRTADARRVQEDARIRQQEQERQQKQARLEEQAQAQEQARQQEQTRKQEQARKRAEAE
FT                   RAKLASGSGGSSVGPSAEKIYICPSREYFTSLMHYRAKNVETFTFEEACARAEQKAADF
FT                   VAGVGKSRFKDFADKRVVKNVDACRKTKSGDQVVVYVNLEGPELRPCGTASTGVSR"
FT   sig_peptide     complement(211994..212053)
FT                   /locus_tag="Glov_0227"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 20"
FT   gene            complement(212089..212919)
FT                   /locus_tag="Glov_0228"
FT   CDS_pept        complement(212089..212919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0228"
FT                   /product="protein of unknown function DUF323"
FT                   /note="PFAM: protein of unknown function DUF323; KEGG:
FT                   dps:DP2422 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93959"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR042095"
FT                   /db_xref="UniProtKB/TrEMBL:B3EAX5"
FT                   /protein_id="ACD93959.1"
FT                   /translation="MPRVSIPLAIIISILFSISTAFAADAPPVKLKLREPEKPTKENVK
FT                   TVSDPTTGMQFVFVKGGCYQMGSVEIREAKPVHQVCLSDFYMGKYEVTQSQWEKVMGKN
FT                   PSRFEQCGPDCPVENISWNDAQEFIKKLNTQSSKQYRLPTEAEWEYAARSGGKDEKWAG
FT                   TNEEDTLSRYAWYGINSNKKTHKVGMKKPNSLGLYDMSGNVEEWCQDWYSESYYDESPK
FT                   DNPSGPDNGELRVNRGSSWVHGNAFFAQASFRSSEIKPGKGNFSNGVRLLLPAQ"
FT   sig_peptide     complement(212848..212919)
FT                   /locus_tag="Glov_0228"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 24"
FT   gene            213401..213535
FT                   /pseudo
FT                   /locus_tag="Glov_0229"
FT   gene            213544..214746
FT                   /locus_tag="Glov_0230"
FT   CDS_pept        213544..214746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0230"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   gur:Gura_3407 protein of unknown function DUF214"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93960"
FT                   /db_xref="GOA:B3EAX6"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:B3EAX6"
FT                   /protein_id="ACD93960.1"
FT                   /translation="MNLAIRDIRYHRGRFILTSIGLGLLLGVVISMGGIYRGLIADALA
FT                   ILHANKADIWVVQQHTNGPFAESSRIPEDIKYRIRAVPGVAEASPLSFQTVQIERHGKP
FT                   FRFFLMGYELSGFGGPPEIVAGRGIRQKHYEMVAARAMGMQIGEKIHLGLHDYTIVGLT
FT                   GKIVSSSGDPVAYVSLADAQDIQFKKDNDAIRNDRERIGANLANIQTLSPVQGKYLQQN
FT                   ISAITESTHTVNTVVARLAPGANLQEVQERISRWNHFKPISDSEQTAILAKGMIEKARM
FT                   QLGLFRVILLVISAVIISLIIYTSTLDKIKVIATLKLIGSPNRVIIGMILQQSLLMGFI
FT                   AYFIGYGLILLTYEKFPRRIVLETFDMQMLFVIVMAICIISSFVGIRKALKVEPGEALG
FT                   G"
FT   gene            214739..215473
FT                   /locus_tag="Glov_0231"
FT   CDS_pept        214739..215473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0231"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: gur:Gura_3406 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93961"
FT                   /db_xref="GOA:B3EAX7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3EAX7"
FT                   /protein_id="ACD93961.1"
FT                   /translation="MDKNMYAIEVERLTKIYGKGETAVTAIANATLQVKPGELVAILGP
FT                   SGSGKTTLLTCIGLINEPTNGKVVIDGTTVADEGWNSGIDLKRMRREKLGFIFQAHNLI
FT                   PFLTAQENVMIALEINHLTKSEAKGRATELLVSLNLGHRLNNYPSALSGGEAQRVAIAR
FT                   ALANKPKVILADEPTAALDTENGKNVMTLLKKLAVENHSAILVVTHDHRMVEGFDRIFQ
FT                   VNDGRITGEKSNLEVWASHELG"
FT   gene            215460..215543
FT                   /pseudo
FT                   /locus_tag="Glov_0232"
FT   gene            215810..216616
FT                   /locus_tag="Glov_0233"
FT   CDS_pept        215810..216616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0233"
FT                   /product="DNA/RNA non-specific endonuclease"
FT                   /note="PFAM: DNA/RNA non-specific endonuclease; KEGG:
FT                   ppd:Ppro_0175 DNA/RNA non-specific endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93962"
FT                   /db_xref="GOA:B3EAX8"
FT                   /db_xref="InterPro:IPR001604"
FT                   /db_xref="InterPro:IPR018524"
FT                   /db_xref="InterPro:IPR020821"
FT                   /db_xref="InterPro:IPR040255"
FT                   /db_xref="UniProtKB/TrEMBL:B3EAX8"
FT                   /protein_id="ACD93962.1"
FT                   /translation="MSIKRFLLIALSISVLLHPVTGMASQTGCSEHFANGQAPDFINQK
FT                   LTAKTREICYSGFAVKHSGVTRTPLYAAEHLTRDRILQGKGLKRQSKFHPDENIPRSER
FT                   AELHHYARSEYDRGHIAPSADMFDIKSQYECFSLANMVPQIPENNRGPWGGIESAVRMM
FT                   AKSKGNLYVVTGPIYQGGNIKQIGGAVMVPTKLFKAVYDPQRKEAGAYLIDNTAGAQPE
FT                   KISIAELETLTGITIFPAVEETVKSRLMRLPEPRSYKERKRKGGRG"
FT   sig_peptide     215810..215884
FT                   /locus_tag="Glov_0233"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.986 at
FT                   residue 25"
FT   gene            216613..216867
FT                   /locus_tag="Glov_0234"
FT   CDS_pept        216613..216867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0234"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ppd:Ppro_0176 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93963"
FT                   /db_xref="UniProtKB/TrEMBL:B3EAX9"
FT                   /protein_id="ACD93963.1"
FT                   /translation="MSRKGIKPFANESDCLQIGGITIENRVDRVSIFGSIDITRDKEGL
FT                   AAAREMKTILELTLTELESADLPDKVTLRPAKTVKNPFE"
FT   gene            216887..217171
FT                   /locus_tag="Glov_0235"
FT   CDS_pept        216887..217171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0235"
FT                   /product="protein of unknown function UPF0270"
FT                   /note="PFAM: protein of unknown function UPF0270; KEGG:
FT                   ppd:Ppro_0177 protein of unknown function UPF0270"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93964"
FT                   /db_xref="InterPro:IPR010648"
FT                   /db_xref="InterPro:IPR036685"
FT                   /db_xref="UniProtKB/TrEMBL:B3EAY0"
FT                   /protein_id="ACD93964.1"
FT                   /translation="MELPKSIEVTIEPDDNYPQQHQPEHDEDGVDVPWDSINPETLRNL
FT                   ISEFVTREWPDTEYSLETKIDQVLKQLRTGQAKIVFDLVSKTCNIIPSR"
FT   gene            217180..218760
FT                   /locus_tag="Glov_0236"
FT   CDS_pept        217180..218760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0236"
FT                   /product="Exodeoxyribonuclease VII"
FT                   /EC_number="3.1.11.6"
FT                   /note="PFAM: Exonuclease VII large subunit; KEGG:
FT                   ppd:Ppro_0178 exodeoxyribonuclease VII"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93965"
FT                   /db_xref="GOA:B3EAY1"
FT                   /db_xref="InterPro:IPR003753"
FT                   /db_xref="InterPro:IPR020579"
FT                   /db_xref="InterPro:IPR025824"
FT                   /db_xref="UniProtKB/TrEMBL:B3EAY1"
FT                   /protein_id="ACD93965.1"
FT                   /translation="MEKRFFPLSAITKRINELLEPAISKQFWVKAEISTGRERGGAFYC
FT                   DLVETDDGGKIVAKIACTIWQRELSTIKELFKARNMDLVLTNGTVVGFLCSLQFSPQYG
FT                   LSLRVIDADPSIALGEMELKKREIIERLQKEGLFETNKERFVPILPIRLGLITSSGSAA
FT                   YNDFIQTLTASGYGFKIYLADAMVQGDQTEKSVLRALDALTGLDVDLVLILRGGGSKTD
FT                   LYFLDNEAISRKIAGYPKPVWTGIGHEIDTSILDYIANRSFKTPTAAAEELVARFVQMR
FT                   RQLDEATNTLKTVWAYRLKIDQDYLARAVTGIQQGPRKLLDVTASCLREQAQELRARVQ
FT                   RRLSTEQIGIGRRREKLRSLPLTLTKNHMERLAAKRQELSSGVTHCLTRTGETLSGLKQ
FT                   RFEKERFLRRLAVERERNEKNRQQLKARFFSVFKMKYMLLTNIKGRLKQERVLQRIALA
FT                   RTSLNDKMATLKAIDPQTVLKRGFALVYSQQGTLVRSIADVAEKQLIQTRLADGSLISE
FT                   VTAKEINHE"
FT   gene            218753..218959
FT                   /locus_tag="Glov_0237"
FT   CDS_pept        218753..218959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0237"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ppd:Ppro_0179 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93966"
FT                   /db_xref="GOA:B3EAY2"
FT                   /db_xref="InterPro:IPR003761"
FT                   /db_xref="InterPro:IPR037004"
FT                   /db_xref="UniProtKB/TrEMBL:B3EAY2"
FT                   /protein_id="ACD93966.1"
FT                   /translation="MSDTTEPTYEQKVEKLDEILTKLDNSETPIDKLAEDVKEGTRLIR
FT                   ELDKKLKQVETEVLDAFKELESD"
FT   gene            218981..219256
FT                   /locus_tag="Glov_0238"
FT   CDS_pept        218981..219256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0238"
FT                   /product="histone family protein DNA-binding protein"
FT                   /note="PFAM: histone family protein DNA-binding protein;
FT                   KEGG: ppd:Ppro_0180 histone family protein DNA-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93967"
FT                   /db_xref="GOA:B3EAY3"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR005684"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:B3EAY3"
FT                   /protein_id="ACD93967.1"
FT                   /translation="MTKADIVEKIHTNTGMTQKESAEMVEAVFSIMKSTLETGETLKIS
FT                   GFGSFVVKQKNDRRGRNPQTGEAITIEARRILTFKPSTVLRDAINK"
FT   gene            219287..219526
FT                   /locus_tag="Glov_0239"
FT   CDS_pept        219287..219526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0239"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ppd:Ppro_0181 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93968"
FT                   /db_xref="GOA:B3EAY4"
FT                   /db_xref="UniProtKB/TrEMBL:B3EAY4"
FT                   /protein_id="ACD93968.1"
FT                   /translation="MKFGIRTPSLTKRIAARTSLKRYVRQSLGLKAPRGWGWLTNPKKA
FT                   AYNKVYNRTSVGCLIPLTVIYMIIFLAVFAMAKI"
FT   gene            219570..220478
FT                   /locus_tag="Glov_0240"
FT   CDS_pept        219570..220478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0240"
FT                   /product="Exonuclease RNase T and DNA polymerase III"
FT                   /note="PFAM: Exonuclease RNase T and DNA polymerase III;
FT                   SMART: Exonuclease; KEGG: ppd:Ppro_3807 exonuclease, RNase
FT                   T and DNA polymerase III"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93969"
FT                   /db_xref="GOA:B3EAY5"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B3EAY5"
FT                   /protein_id="ACD93969.1"
FT                   /translation="MNPIEAEIAVTGLHATGDYMVLRRMNLSQDSRFAGKVIANPRIGL
FT                   CLDTETTGLNPACDKIIELGIVAFQYDPLTSGIIKIIGRYAGFEDPGIPLSAETTAITG
FT                   ITDEMVSGQSFDDAQVCRLADQASLVIAHNAAFDRKFVEARFPVFSKVPWGCSMTQVDW
FT                   QAERISTRVLEYLLFKFGWFINAHRALDDAEGLLGILLESLPVSGTPIFKVLLERYDEV
FT                   SAKVCAVGAPFEKKDVLKQRGYRWNDGAQGGCKAWWISVPGDMEREELAWLANEVYPRG
FT                   ITDSVEITRVDALDRFSIRER"
FT   gene            220499..221092
FT                   /locus_tag="Glov_0241"
FT   CDS_pept        220499..221092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0241"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="KEGG: gme:Gmet_0498 GCN5-related
FT                   N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93970"
FT                   /db_xref="GOA:B3EAY6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B3EAY6"
FT                   /protein_id="ACD93970.1"
FT                   /translation="MAITEQILTGSAVDDCLNDIASLRIDIFREFPYLYDGRRKDELHY
FT                   LKLYSVTPDSFVIIVKEGEKVAGAATGMPLRHESTELVDPFSGTSYPVDEIFYVGELLF
FT                   YPEHRNHGMGMQVVRMVEEQVRSYSTYRYLTCATVVRPDNHPLRPADYIPIDRFLAHTG
FT                   FNLLTGITTSFTWLETDGVRRSHPMKFWIKELLV"
FT   gene            221089..221259
FT                   /locus_tag="Glov_0242"
FT   CDS_pept        221089..221259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0242"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gme:Gmet_1673 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93971"
FT                   /db_xref="UniProtKB/TrEMBL:B3EAY7"
FT                   /protein_id="ACD93971.1"
FT                   /translation="MIWQLWRQDDNGVRYLVGTYSSKEEAQEKITELTKCHHKQTYWVS
FT                   EAIDAITGAES"
FT   gene            221256..222023
FT                   /locus_tag="Glov_0243"
FT   CDS_pept        221256..222023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0243"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gsu:GSU0819 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93972"
FT                   /db_xref="GOA:B3EAY8"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR020051"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:B3EAY8"
FT                   /protein_id="ACD93972.1"
FT                   /translation="MSKPTITTESGRYFLTDRIREEVNFYCTPQSEGVDPPPVQKPAQP
FT                   GSRIIPLPSRHEWSIKAYDLQTAIADRESHRRFTGDHLSLDELAFLLWSTQGVRAVIHE
FT                   AAVLRTVPSAGCRHPFETYLGVLKVDGLDPGLYRYLPLDHALVHERDLPNLPAYLTAAC
FT                   RGQAFAGQAAVTFIWTAVMARTEWRYAEASYKVIALDAGHVCQNLYLACEAIGCGTCAI
FT                   AAYNQGLADELVAVDGYEEFTVYIAPAGKVTRK"
FT   gene            222020..224206
FT                   /locus_tag="Glov_0244"
FT   CDS_pept        222020..224206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0244"
FT                   /product="helicase, RecD/TraA family"
FT                   /EC_number="3.1.11.5"
FT                   /note="KEGG: ppd:Ppro_0186 helicase, RecD/TraA family;
FT                   TIGRFAM: helicase, RecD/TraA family; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93973"
FT                   /db_xref="GOA:B3EAY9"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR006345"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027785"
FT                   /db_xref="InterPro:IPR029493"
FT                   /db_xref="InterPro:IPR041451"
FT                   /db_xref="UniProtKB/TrEMBL:B3EAY9"
FT                   /protein_id="ACD93973.1"
FT                   /translation="MNGKGTTSDVPVERISGSVERVTFHSEESGFCVLRIKVKGKRELV
FT                   TVIGSAATITPGEFVECVGTWHNDKTHGLQFKTTHLKTVPPSTLEGIEKYLGSGMVKGI
FT                   GPHFAKVLVKAFGVDVFTVIEETPEKMLSLPGIGKKRTDKVTAAWAEQKAIREIMVFLQ
FT                   SHGVGTGRAVRIYKTYGDEAIIKVSENPYRLALDIHGIGFKTADVIADRLGIAPDSLIR
FT                   AQAGVRHVLQELSGDGHCAATHDTLIKESVKLLEIDEAILEEAIREEVTQENLVPEEID
FT                   DVPCLFLSALHRAELGVANSVRRILSGEPPWGKIDMEKALPWVEEKTGLSLSQSQQDAV
FT                   CLALTSKALVITGGPGTGKTTLVNSILKILAAKQLEILLAAPTGRAAKRMTETTGREAK
FT                   TIHRLLEFDPQSFGFKRGRDNPLEADLIVIDESSMVDVVLMNKLLAAVPESTALMIVGD
FT                   VNQLPSVGPGAVLADIITSGSVPTVRLTEIFRQAATSKIIVNAHRINKGELPLRNETEE
FT                   LSDFYFIPAETPEEIHAKLLQVVTERIPKRFGLHPVKDVQVLTPMNRGGLGAHALNAEL
FT                   QKVLNGNSEPKITRFGTTYSPGDKIIQTVNNYDKEVFNGDIGQILEIDTEESSLKADYD
FT                   GRIVEYEFGELDEVSLAYATSIHKSQGSEYPAVVIPLAMQHYMLLERNLIYTAVTRGKK
FT                   LVTIIGQPKALGMAVKNKNATKRLTNLTARLRSA"
FT   gene            224203..224463
FT                   /locus_tag="Glov_0245"
FT   CDS_pept        224203..224463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0245"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ppd:Ppro_0187 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93974"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B3EAZ0"
FT                   /protein_id="ACD93974.1"
FT                   /translation="MTDLILDHPTLTARYFYPWPNRFDDPFYVQGDGFRLGCHYRHISD
FT                   DLPTIIHFHGNGETVADYLGDFEDRITGACQRDCVNDLSVF"
FT   gene            complement(224561..226081)
FT                   /locus_tag="Glov_0246"
FT   CDS_pept        complement(224561..226081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0246"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: sat:SYN_01888 ATPase components of ABC transporters
FT                   with duplicated ATPase domains"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93975"
FT                   /db_xref="GOA:B3EAZ1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3EAZ1"
FT                   /protein_id="ACD93975.1"
FT                   /translation="MSQPFLQFHHISYTYETAHEPLFRDVSLHFAVGWSGIVGANGTGK
FT                   TTLLKLATGLLLPDDGYVDAPPRLVYCDQRTDDPPPQLAELLQDTAKTAAVIRGRLGIQ
FT                   EDWLVRWPTLSHGERKRSQIAVALWLEPEVLAIDEPTNHVDAVARNILLRALQSFPGVG
FT                   LLVSHDRELLDILCQQCLFIEPPEVIARPGNYSKGTQIAAIDAQTIKKEYTQKKQAYKE
FT                   LRREAGLRRDLANQYEHKRSKKGIAKHDHDAKQKIDAARLTGKDIVGGKLLRQLDGRFE
FT                   HAQKELEGIKVKKEYSLGIWLPGSVSKRNVLFQHVSGTLPLNTEKLLAFPQLGIRPTDR
FT                   IALTGQNGAGKSTMLRWLLPQLNVPAGQLIYLPQEIDAAQSRAILAEVQTLPHEQLGQV
FT                   MTIISRLGSRPHRLLDSREPSPGEIRKLLLALGMTRQPHIIVMDEPTNHLDLPSVECLE
FT                   SALADCPCALLLVSHDQRFLHALTRLEWLITQSQEPSVANFLTIKETA"
FT   gene            complement(226478..227179)
FT                   /locus_tag="Glov_0247"
FT   CDS_pept        complement(226478..227179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0247"
FT                   /product="LexA DNA-binding domain protein"
FT                   /note="PFAM: LexA DNA-binding domain protein; pyridoxamine
FT                   5'-phosphate oxidase-related FMN-binding; KEGG:
FT                   ckl:CKL_0497 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93976"
FT                   /db_xref="GOA:B3EAZ2"
FT                   /db_xref="InterPro:IPR006199"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR024747"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B3EAZ2"
FT                   /protein_id="ACD93976.1"
FT                   /translation="MIAITERQQMVLDFITRFTQTHGYSPTVRDIAAHLGVSSPSGVNR
FT                   HLEALEKKGWLKKTGASRGIVLTSHGGQSIPLKEEQMMEVRRSDREITPQESIDILDTA
FT                   EYGILSTVGNDGQPYGVPLSYVHKGSIYFHCAISGHKLENIEHNAKVSFCVVGKTKVLP
FT                   DKFGTEYESAVVFGRVSEVNGAERHHALLWLLEKYCSDFIEEGKRYIEQKDKITKVFKI
FT                   EIARISGKARR"
FT   gene            227290..227796
FT                   /locus_tag="Glov_0248"
FT   CDS_pept        227290..227796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0248"
FT                   /product="Lytic transglycosylase catalytic"
FT                   /note="PFAM: Lytic transglycosylase catalytic; KEGG:
FT                   ppd:Ppro_0193 lytic transglycosylase, catalytic"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93977"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:B3EAZ3"
FT                   /protein_id="ACD93977.1"
FT                   /translation="MCRLPGICLLMISLVSLPIQAKAFCFEEAGSQYGISPQLLWSIAK
FT                   TESNFNPRAINRNSNGTYDYGLMQINSSWAKRLGKTWNELGEPCTNVKVGAWVLAQCIQ
FT                   DYGYTWRAVGCYNSRTPSKGDRYAGKVYRILAEHTKPQATTLIAAISTPRIDSPWDEVF
FT                   GNAVR"
FT   sig_peptide     227290..227355
FT                   /locus_tag="Glov_0248"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.974) with cleavage site probability 0.952 at
FT                   residue 22"
FT   gene            227783..228493
FT                   /locus_tag="Glov_0249"
FT   CDS_pept        227783..228493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0249"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ppd:Ppro_0194 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93978"
FT                   /db_xref="UniProtKB/TrEMBL:B3EAZ4"
FT                   /protein_id="ACD93978.1"
FT                   /translation="MLSADLLHKYGLPEDEIVDAVECAVAKTLTAAFQRTVTVRAEGEL
FT                   EIIAYPKLGHPVEMQLKDIPKKLRRHIIHSVEAELQKRQILLEAKKLQELQGRVFCGAV
FT                   GRIGSRGTLHVTLEIDDLLKPLILFGECPLRYQPPHERSRYRIGEQRSFLVTSVRPVMV
FT                   GGDIAKVRLILNRTSRVLPALLLQDLTGIAGIKCRRRIAGGFSEVVTPVRIPKKSINTV
FT                   GKELREHVQVLIAP"
FT   gene            228468..229841
FT                   /locus_tag="Glov_0250"
FT   CDS_pept        228468..229841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0250"
FT                   /product="TraG family protein"
FT                   /note="KEGG: ppd:Ppro_0195 TraG family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93979"
FT                   /db_xref="InterPro:IPR019476"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032689"
FT                   /db_xref="UniProtKB/TrEMBL:B3EAZ5"
FT                   /protein_id="ACD93979.1"
FT                   /translation="MFKSSSHRSTTNPEFMTSIGNGVQMERPTRIVPISIPDEYRKRHM
FT                   FVFGTTGVGKTRLCENLIEQDIMKGNSVVYFDPKGDQQIFTKIFEVARRAERLKDLMLV
FT                   TPIFPEYSAVIDPMAYYFMPDELVGHIVSGIQGGREPFYRNIAKEITTAIISANIIIAD
FT                   WEKRLPKQNMDTIRQSIRRSSLSSTMGLLQEIKTPEALLNAGMIQDILESPQEYYSKVS
FT                   STLRTCLMELSSGNIGKIIGQADSNRFISRLERKKGVIMVVHTGTMITREAATTLGKVL
FT                   LSMIQSFIGRVYLSDKQKVFPPLSIYIDEAQSLFYQGIEDLFAKAGSADVMVHAFAQSV
FT                   NQIYAAIGEEYGKSILDNTNTKIFMRCSDAETSEYVVRHFGVRNVLTGIFGSNQVTTRE
FT                   VEQDILKVQDILGLQPREFYMLTYSGRYKGVTRDARDPQLKIVFPSAPSSITMSRGAA"
FT   gene            229838..231304
FT                   /locus_tag="Glov_0251"
FT   CDS_pept        229838..231304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0251"
FT                   /product="metal-dependent phosphohydrolase HD sub domain"
FT                   /note="PFAM: metal-dependent phosphohydrolase HD sub
FT                   domain; KEGG: ppd:Ppro_0196 metal dependent
FT                   phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93980"
FT                   /db_xref="GOA:B3EAZ6"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:B3EAZ6"
FT                   /protein_id="ACD93980.1"
FT                   /translation="MIILLYFCGVIGFLMVTYNLWRILTRRPAEVEQEPWVPLSISELE
FT                   PDDDLPCTDLATVSSVWTGRVVHFTDLSRLWREPTPKQEEEAAFPRPTFRHSEIEEFYR
FT                   DIVEPEPLINGKRKTVIVYLLKILDAEGTCPSVVGIKKYAAVGKQISDPDSAYGAAALA
FT                   QLATIPLYRHSLGVARKFVEKNSERIMLPTILIVSLAHDIGKIPSFHSQYYSTADHPQI
FT                   ALIILASIPEYVALSNRDELDSIIRNHHQITPNNPLTACLKRCDQESRNDEMGSFLGQM
FT                   AQVRASEESSLPIAESLPQPDVPVTKEKISQEWDHPLGSPESGKYVPQKIKLPAWFNAD
FT                   TILGGIHGLINQVEKTSSGVKWLAVSLPNGLVYVKPEALWQVIHQVSDGDPMILVADAD
FT                   EETKRNLLHTVVWELSASRDAIATELMTNAYYTTNASIVTNNDKSFNKLLIPFRVDAFG
FT                   VLTSELESTKPPVLRKIVKDIRPKHAEDKE"
FT   gene            231301..232137
FT                   /locus_tag="Glov_0252"
FT   CDS_pept        231301..232137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0252"
FT                   /product="glutaredoxin 2"
FT                   /note="PFAM: glutaredoxin 2; KEGG: ppd:Ppro_0197
FT                   glutaredoxin 2"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93981"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR039555"
FT                   /db_xref="UniProtKB/TrEMBL:B3EAZ7"
FT                   /protein_id="ACD93981.1"
FT                   /translation="MRRLILASILQLSVTTASAGYYADSAKGWWWYQKEPEKQAEKQEK
FT                   KKKPPKSTPSLKDYSYEQVWEMHPDQFQEFAEVLKKKAVQKPSEENVKEYFEVQEIARK
FT                   KALAFSNVAQFVWQKYPELTTKKDYPITTPGNLARISQINEERQRILRDNRDDFALIYF
FT                   QRPDCSYCDEQSRILDWFTNETGWTVKKVNISENPGLAAKFSVEITPTLILIQKGNQDY
FT                   LPVSAGVISADEIEDKAYRAVRLLKGDISPEEYSLYEFQKGGSFDVKKRRLQEERP"
FT   sig_peptide     231301..231372
FT                   /locus_tag="Glov_0252"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.991) with cleavage site probability 0.613 at
FT                   residue 24"
FT   gene            232134..233660
FT                   /locus_tag="Glov_0253"
FT   CDS_pept        232134..233660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0253"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ppd:Ppro_0198 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93982"
FT                   /db_xref="InterPro:IPR010927"
FT                   /db_xref="UniProtKB/TrEMBL:B3EAZ8"
FT                   /protein_id="ACD93982.1"
FT                   /translation="MSLPVPLQQKRGVSVKRTVITRTAAACLAATIALNPVLSWSGWVD
FT                   DWVQQKSSTSPSYYEGSKRGYYTGGSFSARWANTDDHLFTASLPKLKSGCGGIDMFLGG
FT                   FSFLNVDYLVQKLQNILSAAPAAAFDIALKTLAPQVADTIKSLEAITDRLNSLQMNDCK
FT                   AAKALVATAASPFSSVMSDSLKAEMKTAQTDFMVSSGAKDLYQDVSKLFESEQKTNAGN
FT                   KPGVPGTTQTSATSATAGCPTEVLQVFGDGSVLENLAGKKGMSSEYVKLVRGFIGDVII
FT                   QNPATTGTTYQAQYIPPCDKNNSFDSFISGSAQGRDTAGACADITDANKNLMVYVAGKM
FT                   QSIATKIKSKTALTADEEAFLKSTPLSVGLILKNATATNTEGEVIGKLAELTARAYGYY
FT                   MLLDLFGRAVQLQEMARNIMSTQKGNKAGASPETCQLALLGEGMQHIQTLEEKTLQLLS
FT                   VAQQSYANAASEINAVEMIVQNMKKFDDTVFSELSDRFGKGIAMRATGRI"
FT   sig_peptide     232134..232259
FT                   /locus_tag="Glov_0253"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.900) with cleavage site probability 0.600 at
FT                   residue 42"
FT   gene            233682..234083
FT                   /locus_tag="Glov_0254"
FT   CDS_pept        233682..234083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0254"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ppd:Ppro_0199 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93983"
FT                   /db_xref="UniProtKB/TrEMBL:B3EAZ9"
FT                   /protein_id="ACD93983.1"
FT                   /translation="MADKTNKADKGNSTPPASKKVDWQARKLENAKRDDTSVVFCRARD
FT                   TGDFINILNSNDNLVYQMRMNMGRRESLTFEVVKSYIDRSRRIKEELNLMNAEMCQLLD
FT                   YTYKPPRGFDNPLKKQDKQAVPGVETGKK"
FT   gene            234602..235021
FT                   /locus_tag="Glov_0255"
FT   CDS_pept        234602..235021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0255"
FT                   /product="single-strand binding protein"
FT                   /note="TIGRFAM: single-strand binding protein; PFAM:
FT                   single-strand binding protein/Primosomal replication
FT                   protein n; KEGG: gsu:GSU2151 single-strand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93984"
FT                   /db_xref="GOA:B3EB00"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:B3EB00"
FT                   /protein_id="ACD93984.1"
FT                   /translation="MASLNRVELIGNLGRDPEIRYTPGGTAVASFSLATSEKVKTKSGE
FT                   WEVRTEWHNIVLYARLAEVAGEYLSKGKSVYLDGKLKTRKWQDRDGKDRYTTEIIGDKL
FT                   LMLGSKNGSIPDGSDDQPSNSQAHEDIPHDDTDPF"
FT   gene            235131..236087
FT                   /locus_tag="Glov_0256"
FT   CDS_pept        235131..236087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0256"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gsu:GSU2152 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93985"
FT                   /db_xref="UniProtKB/TrEMBL:B3EB01"
FT                   /protein_id="ACD93985.1"
FT                   /translation="MNAPAQIIPINPAASSLTHHAVNISELKAQVNLIQYVMRDVMKSG
FT                   EHYGTIPGCGDKAVLLKPGAEKLMLTFRLANDVDVETIDLHLGHREYRIKVTLYSPAGQ
FT                   RLGTGVGSCSTMESKYRFRVGPVELTNKPVPREYWDLRKENPALAQEIIGGRGFSAKKD
FT                   DSCNWKIARQGEKVEHDNPADFYNTCLKMAKKRGLVDAVLTSTAASDIFTQDIEEDPDL
FT                   YGQTEHNGGNSAGTTSTTSGTSQGHKPDSTPSSHGAGPVSTSEIIGYLTAKGIRMELSA
FT                   DESEISAFPDFNDTSARQWLKDHGFKWDGKGKCWQYR"
FT   gene            236212..236376
FT                   /locus_tag="Glov_0257"
FT   CDS_pept        236212..236376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0257"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ppd:Ppro_0202 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93986"
FT                   /db_xref="GOA:B3EB02"
FT                   /db_xref="UniProtKB/TrEMBL:B3EB02"
FT                   /protein_id="ACD93986.1"
FT                   /translation="MTTHIIKHVTIKGCQIPVYAPVKERQISIDVTRIIAGVIFGSLLT
FT                   AVGTLPFLI"
FT   gene            236389..237363
FT                   /locus_tag="Glov_0258"
FT   CDS_pept        236389..237363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0258"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ppd:Ppro_0203 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93987"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="UniProtKB/TrEMBL:B3EB03"
FT                   /protein_id="ACD93987.1"
FT                   /translation="MSKLAAFLGRAIPTHQKKQSSHLGDRTVYVGASDIAGCPRKAALG
FT                   KQCPSSHDISTLLRFSRGHAAQAMYAEFFKTGGALFEEEVEVRHTDIPEIRCHIDFLFY
FT                   ANRQTKRLHIVEMKSTDGIPDEPYASWVDQLHVQMGLLQLTLDPEVQIGGSILVVDLNA
FT                   GTYREFNNYAPNKLVFNQLMEKAQHILSATRGECAPKTEPGILCGYCTFRQDCPSHVAD
FT                   MELPPEIHQASKAYLELNEQKKALDTRLEVLKNDILTFVNGAYKGASDGILVNVTSVSD
FT                   SVIVDGKKLKNSYPDIYDQVTKPKSGFLKLEIKPFMPLAAQAA"
FT   gene            237448..237648
FT                   /locus_tag="Glov_0259"
FT   CDS_pept        237448..237648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0259"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ppd:Ppro_0204 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93988"
FT                   /db_xref="GOA:B3EB04"
FT                   /db_xref="UniProtKB/TrEMBL:B3EB04"
FT                   /protein_id="ACD93988.1"
FT                   /translation="MKIYRTGTLPPDLKSFSCEKRHEDLKEVLHAIVSLLLIAAMFFMF
FT                   MIAAAAPEPQVYPVGWEEVRG"
FT   sig_peptide     237448..237600
FT                   /locus_tag="Glov_0259"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.966) with cleavage site probability 0.929 at
FT                   residue 51"
FT   gene            237645..237914
FT                   /locus_tag="Glov_0260"
FT   CDS_pept        237645..237914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0260"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ppd:Ppro_0205 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93989"
FT                   /db_xref="UniProtKB/TrEMBL:B3EB05"
FT                   /protein_id="ACD93989.1"
FT                   /translation="MTEPTIAIYTEEETGPSDAAVNEVNLSLHGANRVLERDIPLEALE
FT                   GVRHLLPLLNTKPLKFRYKGVFVVARLVNGSPRIITAWRLLPPS"
FT   gene            238014..238427
FT                   /locus_tag="Glov_0261"
FT   CDS_pept        238014..238427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0261"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ppd:Ppro_0206 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93990"
FT                   /db_xref="InterPro:IPR024434"
FT                   /db_xref="UniProtKB/TrEMBL:B3EB06"
FT                   /protein_id="ACD93990.1"
FT                   /translation="MSPKIPRPKAVPGFTIERRSACGKIYTTVTLSPTTAAPMEVFIRF
FT                   GKAGGCGSAMADGIARLVSYGLRSGLEPTDAFKALTGIGCHLGANTCLNCVAESIGIVL
FT                   EHLKTGRDLNDLIEEADFAAINQIGQGADHHEI"
FT   gene            238417..239340
FT                   /locus_tag="Glov_0262"
FT   CDS_pept        238417..239340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0262"
FT                   /product="ATPase associated with various cellular
FT                   activities AAA_5"
FT                   /note="PFAM: ATPase associated with various cellular
FT                   activities AAA_5; SMART: AAA ATPase; KEGG: ppd:Ppro_0207
FT                   ATPase associated with various cellular activities, AAA_5"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93991"
FT                   /db_xref="GOA:B3EB07"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR013615"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3EB07"
FT                   /protein_id="ACD93991.1"
FT                   /translation="MKYSIKDIFNIPVKESLCVEGRPQSDNPFIPEVDSDYVFRKEILS
FT                   DVLSWYMMGANDGLYLTGPTGSGKSSIVLQTAARLNIPVMVVTGHSRLETPELVGHHVI
FT                   VNNSMEYVYGPLAMAMKEGHWFLLDEIDLLDPATAAGLNGIVEGRPLTIPEKGGEVIKP
FT                   APGFRFIATANTAGSGDRSGLYQGTLRQNGAFLDRFWMVEVDYPDEVQERQILAKAMPS
FT                   LADTVREALVSYANEIRKLFIKGEIEVTFSTRTLVRWAKLVYLFRPASAEGKNPIIHAL
FT                   DRALGYRAEPESREALHELAQRVFGG"
FT   gene            239351..239683
FT                   /locus_tag="Glov_0263"
FT   CDS_pept        239351..239683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0263"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ppd:Ppro_0208 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93992"
FT                   /db_xref="InterPro:IPR008893"
FT                   /db_xref="InterPro:IPR036930"
FT                   /db_xref="UniProtKB/TrEMBL:B3EB08"
FT                   /protein_id="ACD93992.1"
FT                   /translation="MALRQHLHLQCNTTAGGKFWIAQIHDDPPRVTVNWGPTRSQGQTK
FT                   SYDVNSMSEAFTFVSKKKKEKLAKGYYEVASSPPREPVQPTPRKQTDKTIMKDLMSGAN
FT                   TKDWFF"
FT   gene            239761..240645
FT                   /locus_tag="Glov_0264"
FT   CDS_pept        239761..240645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0264"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ppd:Ppro_0209 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93993"
FT                   /db_xref="InterPro:IPR021496"
FT                   /db_xref="UniProtKB/TrEMBL:B3EB09"
FT                   /protein_id="ACD93993.1"
FT                   /translation="MNEILSKLVVVSLSISLWTGRKKLSPEDLGLDFSKLPPEKLATLG
FT                   SKKICDPEKLAVFSALKRRAERQCEAVGVRFLGGYAIPEDKADEVMKILDGVRDEFEKE
FT                   KQEFLSEYDRSLREWIDANPEWAAIIEKGVEPASTAARRLGFAVQAFKVKNIDGLDKGL
FT                   NEHASTLSERLIFEINQQARQAWEESYKGRPSVTRKALRPIKSMLDKLRGLEFLSPYLL
FT                   TLAVQVEDVLASLPKSGPIEGRNLTSLIGILHVLGDLPLDEVPAEEEEDVVENILPETR
FT                   TAEPVSLPSEWFF"
FT   gene            240655..242373
FT                   /locus_tag="Glov_0265"
FT   CDS_pept        240655..242373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0265"
FT                   /product="von Willebrand factor type A"
FT                   /note="PFAM: von Willebrand factor type A; KEGG:
FT                   ppd:Ppro_0210 von Willebrand factor, type A"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93994"
FT                   /db_xref="GOA:B3EB10"
FT                   /db_xref="InterPro:IPR006538"
FT                   /db_xref="InterPro:IPR025861"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:B3EB10"
FT                   /protein_id="ACD93994.1"
FT                   /translation="MKHTTLPLVAKALGEKYDIQVQISGDQAYTNGRIINLPSLPDSKE
FT                   AALLARGYIDHESAHIRFTDFSVKSSTSMLKCLTNILEDIRIEKMMGAKYPGCRSNLKD
FT                   LAEHLKQQGSFTPSLQDPPQTLLAWLCARGRLTLNQDFSDILAMTSSTVNGFLGTGYKK
FT                   LLDLTERIPNLVSTRDSQSMAEEILRLIRDEKHQQEQERKRQEDQKAKTTCSSDGSKPD
FT                   GSSNDQEEYNQTSGTDQQSGKPKQDTDDSSPDGDNTGTAAGDDSQSQAAGNPSPPVPKS
FT                   GSSGELGGNPEALQEMLDCDPGGFGDVGEILKHELITEGETVGNRGGVLLPPEASLRTF
FT                   PIDIHETRRHTALLRARLSGLIQASRLRRRHARRTGSKIDNRVVHRLALNDTRLFLHQE
FT                   EKTEVNTAIMILVDRSGSMQHQKIEVASKTAYVVAEALDSIPGCFAAVAAFPVGNSDGV
FT                   APLVRFGERPCSSKFGMSAGGGTPLAQALYWAGVELLKREEPRKILLSVTDGEPDDLRT
FT                   TKRAIRWLLEQGIEPMGLGICEESVRTIFPTYGVVYSVEELPPALFGMLQEKLTR"
FT   gene            242459..243022
FT                   /locus_tag="Glov_0266"
FT   CDS_pept        242459..243022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0266"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gsu:GSU2162 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93995"
FT                   /db_xref="UniProtKB/TrEMBL:B3EB11"
FT                   /protein_id="ACD93995.1"
FT                   /translation="MKITISNDKASATVICRDLFLDDSVPGARNLFYLTAYGPTQEIRA
FT                   FAQILAMKGALECHSKDDRSINIWSNHPLRVIPKMGEGYSGAYITPSSDSSFLIGSSKA
FT                   DCYQVFTRILDQREFVHRDWYEALFNEVSMEIEPLVGNKRCWKFRAHELKSEIVNRLKY
FT                   GGLKMPPATAHFTIEKEEHHALSN"
FT   gene            243006..243275
FT                   /locus_tag="Glov_0267"
FT   CDS_pept        243006..243275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0267"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gsu:GSU2163 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93996"
FT                   /db_xref="UniProtKB/TrEMBL:B3EB12"
FT                   /protein_id="ACD93996.1"
FT                   /translation="MRYPIERVSDNWERRIVKNGYVQHREVYRNGTHGEWQFYISGFGP
FT                   MVEVGTGRCTVLMEGGSYDHFVPIDADNRIKINGRWYDRRYWDH"
FT   gene            243384..246737
FT                   /locus_tag="Glov_0268"
FT   CDS_pept        243384..246737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0268"
FT                   /product="type III restriction protein res subunit"
FT                   /note="PFAM: type III restriction protein res subunit;
FT                   KEGG: gsu:GSU2164 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93997"
FT                   /db_xref="GOA:B3EB13"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:B3EB13"
FT                   /protein_id="ACD93997.1"
FT                   /translation="MELTTTINSSFSRTRGNELNKGYYPTFPSDVQTVLRILEPSFGWK
FT                   SRRYNALKTISVLDPCAGSGEFLTTITRWLKRRYAASNGSPHEILSYAVELDAGRFARI
FT                   HGTTQKLNSSFFDVELSGKFNLILLNPPYNKAAGNELVTWMEKTAPLLAYEGVMVLIIP
FT                   EYELKGRLLDIIQGTFPFAYAFQSEEYARFKQVVVFLAKNQDNSSEIYHQYTRYQSWPA
FT                   ANLGDGAVRGKYTVPGKRQTLSLGGSNGSNRPLMTARDLTELYRECEDRLDKAAVMVLD
FT                   RQYPSSYDTSIQPISTLRTAHAVQLAAMNSQIESVTINGDFFLAKFMVITKTETFKDPE
FT                   NNCETMVCKPTVEAFLMDRHGHVKPAREHGFDYYELNSRLSSVLLQKLSRLYQPLHEIG
FT                   QDETYLVDELQGIGLLPPQREAVKAVIKAYRSGRRGIGIRANTGTGKTWMAKAVKYLTE
FT                   AKRTVMVSEPQLIPQLAKEYANEGFNVHVIDSWEALKELTATRPHGLYLIAYTRLRMHP
FT                   KYRLCIKSRKTIVKKDGHSSVEYTEVCPSCRSPLSEKIRKGDKPKCLYCGEPLFTYIPE
FT                   NDRPVMTYRRWISEIENNGTATEARTHNKQLPYIRLLKRIPFDLAIFDEAHNAANLMSN
FT                   QGTAFIRLAATAKKVLALTATVTNGMAKSIYNILWGLNPMQMRSAGWEMKSATDFQTKY
FT                   GAFKTVRKTDEKNRHRESERVTTYDTAGISPAALIFTIPNFVNVDSDDFDDLPPVEREV
FT                   IKCQSHALVETCHRSIENIIEKADLPPEDLMAAAAVRNAAFLRVSDTFRHYNDELKLRD
FT                   IPLGTLHRLSLPDGELLLEKEEKLIGIAQGVIDRGERLLVYTGNTQKIDMRPILKRILR
FT                   DNVQGASIEILPDSVAPEKLVGWFEQVTAQVVVVSFHRVATGLNLSQFNNLVWYDYTSN
FT                   TRLAEQGDGRIRRVNTADIHRAQFGEVRPVRYWYLTSSEVQALQLAYTLEKRMVAKLAE
FT                   GETPDIDPAECSSQSFSSLMTKALKEGNFNYTDPSSLLKKMTQHENARVRGDNKGEAPI
FT                   KSNIIHLPITKPEPAPVPPSIAVIHCEDGREVTRDLSFGMYQTLLDAGALEFTLFGVYV
FT                   RNPAPRRKYA"
FT   gene            246820..247254
FT                   /locus_tag="Glov_0269"
FT   CDS_pept        246820..247254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0269"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gsu:GSU2165 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93998"
FT                   /db_xref="UniProtKB/TrEMBL:B3EB14"
FT                   /protein_id="ACD93998.1"
FT                   /translation="MADTISAKRLIIPIHDNSEFFSDNADYAVIDLDATLIERIKKLAV
FT                   VVRQMKAYKISEFNHACDFMVADWDAEPDNGKVALKEFEGRMECNTLNVTDSDFFWSGY
FT                   YKHTDVRWETDTVLLVVLDEPGIHDERETCTDVTGQGESS"
FT   gene            247251..247463
FT                   /locus_tag="Glov_0270"
FT   CDS_pept        247251..247463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ACD93999"
FT                   /db_xref="UniProtKB/TrEMBL:B3EB15"
FT                   /protein_id="ACD93999.1"
FT                   /translation="MRGKDLSSLEWQPVNDPNGMTAYEAFDAKGRSYYLVRNKHKPEMM
FT                   FVISDGFTVPPGWYTDKGGSIRRVS"
FT   gene            247548..248246
FT                   /locus_tag="Glov_0271"
FT   CDS_pept        247548..248246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0271"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ppd:Ppro_0212 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94000"
FT                   /db_xref="UniProtKB/TrEMBL:B3EB16"
FT                   /protein_id="ACD94000.1"
FT                   /translation="MADYMNQSVFQPSIPKHLINDEDRRIIEAFSITFESDGEDKFYLY
FT                   AEEWCCNGYLNPEEPGGEEIEISEDDLFSRFQEIIRRSNGELPWISKESAYTCSRMRPD
FT                   GFGGGAVFITADDIQYSFTGQWLEQRISETETGDIGPHTEDPPPTKPIVGVVLEGGLVQ
FT                   SIVSNVPEQIPEMDVIILDYDVEGFEEECLLKVPQSSGEIARAVGHIEKITESGIDLGM
FT                   VLNQMNARGW"
FT   gene            248248..248769
FT                   /locus_tag="Glov_0272"
FT   CDS_pept        248248..248769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0272"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gsu:GSU2166 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94001"
FT                   /db_xref="UniProtKB/TrEMBL:B3EB17"
FT                   /protein_id="ACD94001.1"
FT                   /translation="MSPLEQTTDEPTNEERADRIDTVMQAYCLTLEGRDFDGDEDDVKD
FT                   MLTDLMHFCKRMKIDFEENLRVARNNYEHERNAETGIPDHFGCLVCGCFLEVSRTDTLL
FT                   GIDREIFDCQNCDETFIRELTVTDSPIERAVKCIGCGNMIPQSSARIFYQRDDYAHFIG
FT                   ECCWDERLRD"
FT   gene            248855..249310
FT                   /locus_tag="Glov_0273"
FT   CDS_pept        248855..249310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0273"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ajs:Ajs_1580 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94002"
FT                   /db_xref="UniProtKB/TrEMBL:B3EB18"
FT                   /protein_id="ACD94002.1"
FT                   /translation="MPTKITLNPGYAGGVYVLDHGEFYTCLGFDVVLKKAAALATELNS
FT                   PEHSPVPTERGTMAAYRKYSALVDKARQKNISTGWRSRVDLTADLIGLEGKRVEVIDCY
FT                   GDRRRFIVGRSTGWIPCHLEIKSRSSSGGEAVWGTPFRSVRVVGGTA"
FT   gene            249346..249858
FT                   /locus_tag="Glov_0274"
FT   CDS_pept        249346..249858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0274"
FT                   /product="zinc finger CHC2-family protein"
FT                   /note="PFAM: zinc finger CHC2-family protein; KEGG:
FT                   ppd:Ppro_0215 zinc finger, CHC2-family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94003"
FT                   /db_xref="GOA:B3EB19"
FT                   /db_xref="InterPro:IPR002694"
FT                   /db_xref="InterPro:IPR036977"
FT                   /db_xref="UniProtKB/TrEMBL:B3EB19"
FT                   /protein_id="ACD94003.1"
FT                   /translation="MTVKTVISAAKEFGVPERYAIMRRLSFLQPQIKHLEREIWGAQRR
FT                   IERSSDPLVKALTESFIRDQEKELRPLKREATALLNHVNGKETVLAPGGITPEMIDQAR
FT                   QYPITSIIDFSKGRYRCCPFHKDRNPSMALYDNHVHCFVCNRSWDSISATMELDGVNFR
FT                   EAVLALQ"
FT   gene            249940..250431
FT                   /locus_tag="Glov_0275"
FT   CDS_pept        249940..250431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0275"
FT                   /product="DNA repair protein RadC"
FT                   /note="PFAM: DNA repair protein RadC; KEGG: ppd:Ppro_0216
FT                   DNA repair protein RadC"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94004"
FT                   /db_xref="GOA:B3EB20"
FT                   /db_xref="InterPro:IPR001405"
FT                   /db_xref="InterPro:IPR025657"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/TrEMBL:B3EB20"
FT                   /protein_id="ACD94004.1"
FT                   /translation="MNLDLFGEPAAPTTKRIFIKSIEARYRNEVVRDNAPQWVSMRFTQ
FT                   PQQVFEMFRDLRLETKEHFIVLHLDGKNRIVCFDRVSIGSLNQAIVHSREVFKTACLSN
FT                   AAAVLLVHNHPTGDPTPSQEDIAITRRLKESGEILGIKVLDHIIVGDDEFLSFVERGLL
FT                   "
FT   gene            250569..250706
FT                   /locus_tag="Glov_0276"
FT   CDS_pept        250569..250706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0276"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94005"
FT                   /db_xref="UniProtKB/TrEMBL:B3EB21"
FT                   /protein_id="ACD94005.1"
FT                   /translation="MSVRARINGREFTLSWEEFEKALQRNNLAGGEFEVLAILSGVKPY
FT                   "
FT   gene            250883..252409
FT                   /locus_tag="Glov_0277"
FT   CDS_pept        250883..252409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0277"
FT                   /product="filamentation induced by cAMP protein Fic"
FT                   /note="PFAM: filamentation induced by cAMP protein Fic;
FT                   KEGG: ppd:Ppro_0217 filamentation induced by cAMP protein
FT                   Fic"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94006"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="InterPro:IPR040198"
FT                   /db_xref="UniProtKB/TrEMBL:B3EB22"
FT                   /protein_id="ACD94006.1"
FT                   /translation="MATTPAQRRLADALDVLKKLQDGGKTAVKSSDLTRLQRESLVSNG
FT                   FLRLIVKGWYMPSRPGEDTGDSTPWYAAMRDFIHGYCDERFGDNWHVSAEYSLLLHAGT
FT                   TISPRQVVIHSPLGKNGLLQLPDDCSILDYKAKDFPSAAKIQAVDGVRALILPLALIRV
FT                   PEAFFVTFAQDAQIALHQLRDASELNRELLEGGHSTISGRLAGALRASGRKELADDVLA
FT                   TMRAAGFVVNETNPFNVTPPSLQFTRAQSPYVLRMRLMWQAMRETVIACFPLEPGTPAD
FT                   IDKYMEVVEETYQTDAYHSLSIEGYRVTAELIQKVATGNWNPDDNASDAEAKNAMAAHG
FT                   YWLAHNEVKATIRGILAGANPGAAFRLDHGSWYRKLFTPNVDAGFLKPADLAGYRADKV
FT                   FIRNASHVPPSQEAVRDMMPELCDLLEAEPNAAVRAVLGHFLFVYIHPYFDGNGRLGRF
FT                   LMNTMLASGGYPWTVIRIELRGDYMAALEAASSQKEIKPFAEFIASSMNR"
FT   gene            complement(252479..252952)
FT                   /locus_tag="Glov_0278"
FT   CDS_pept        complement(252479..252952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0278"
FT                   /product="conserved hypothetical cytosolic protein"
FT                   /note="KEGG: sat:SYN_02749 hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94007"
FT                   /db_xref="GOA:B3EB23"
FT                   /db_xref="InterPro:IPR000157"
FT                   /db_xref="InterPro:IPR035897"
FT                   /db_xref="UniProtKB/TrEMBL:B3EB23"
FT                   /protein_id="ACD94007.1"
FT                   /translation="MPVFLSHRKADKASALKIYAYLEANKIKCYIDEFDEVLQRSKNIT
FT                   DVIMSRIGDCSHLMAIMSHNTSGSWWVPFEVGVASEADRRICSYKIDGVSLPEYLDIWP
FT                   IMNRPEHLAEFVRLYNNDSSVLLEKSESLRASYASVKSSGDFHRMLKSATGQR"
FT   gene            complement(252965..253513)
FT                   /locus_tag="Glov_0279"
FT   CDS_pept        complement(252965..253513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0279"
FT                   /product="Domain of unknown function DUF1863"
FT                   /note="PFAM: Domain of unknown function DUF1863; KEGG:
FT                   sco:SCO5639 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94008"
FT                   /db_xref="InterPro:IPR015032"
FT                   /db_xref="UniProtKB/TrEMBL:B3EB24"
FT                   /protein_id="ACD94008.1"
FT                   /translation="MSNNVRHKVFITYHHADQVEVNDFITTFSDERNVFISRVLGVDME
FT                   ESIISSTDTDYVMKRIRELYLKDSTVTIVLMGKCTWARRYVDWEIQSSLRSGNTLTPNG
FT                   LLGIKLPSFKSGTNFPNRLNLNLKQNDQQVDCYARWIEYPTRKDTLANAIHNAFLARTS
FT                   KTNLIVNPRDRFVNNRSCQ"
FT   gene            complement(253552..255573)
FT                   /locus_tag="Glov_0280"
FT   CDS_pept        complement(253552..255573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0280"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rfr:Rfer_1067 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94009"
FT                   /db_xref="GOA:B3EB25"
FT                   /db_xref="InterPro:IPR000157"
FT                   /db_xref="InterPro:IPR035897"
FT                   /db_xref="InterPro:IPR041160"
FT                   /db_xref="UniProtKB/TrEMBL:B3EB25"
FT                   /protein_id="ACD94009.1"
FT                   /translation="MSPQYKPPIAVHFIWHPLDSDTVDPILEAITRCFSRDINRPFSRN
FT                   LNIPIFFYSSCSPTDVPNDLPSELALRNVLFVFTSVNTRGYTLWDNYINNLKLTRTMRA
FT                   VPVALSHEGLGHGGGGSLKNINFIRVYEWQKEYMVQNTVLAMAHELYRHGFIEIEEQDH
FT                   GKSSSIKLFLSHAKSGDTGRLHAESIKRFIDTTNMSHFFDATTISPGFKFDEEIIKSIK
FT                   ESTVLAICSDDYSSRYWCQREILSAKEHHRPMIAINCLEEFEDRIFPAGSNIPCVHISP
FT                   ESPLKESDVLKILTAAILETIRHCHALSSLEHYQARGWIDSRCALFSRPPEIRQLLTLK
FT                   SDDQKNKLCYPEPPIYSEEGEWHSHLSIETFTPLWSSSDNNSLKGLRVGISVSDVASGC
FT                   FKEHHLPTSQSVRLAQDLARHLLARSATLIYGGDLRKDGFTEFILNEAVALKSRLNTHD
FT                   IHVENHLAWPIHKADKEMTSWRANYRAVMNTVEHDIPADIANDVDTDQYLPPTSPQNKY
FT                   IWSRCLTEMRQQSIDSSHARVCAGGKISGYNGKMPGVLEEILIAIDKNKPIYLLGAFGG
FT                   IVGEVCKILRQEPYPDSLTETWQVTYNAEYVDLQTLASKSGNNANYGQVKTILEGIDVS
FT                   TISKNAGLDEATYLRLMATPFVDECIYLIIQGLKNLST"
FT   gene            complement(255586..255849)
FT                   /locus_tag="Glov_0281"
FT   CDS_pept        complement(255586..255849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0281"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gur:Gura_1028 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94010"
FT                   /db_xref="UniProtKB/TrEMBL:B3EB26"
FT                   /protein_id="ACD94010.1"
FT                   /translation="MSKVKSGVTGPKAASSAAKTLKSGNTAPKSKTAAGSTLSQTNAPK
FT                   KVTSEAAASAASSVLRDGRTSKTSKTAAASALAQRPSKKMTR"
FT   gene            255976..256827
FT                   /locus_tag="Glov_0282"
FT   CDS_pept        255976..256827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0282"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mgm:Mmc1_1356 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94011"
FT                   /db_xref="InterPro:IPR016634"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="UniProtKB/TrEMBL:B3EB27"
FT                   /protein_id="ACD94011.1"
FT                   /translation="MDDQSVTIPWSTRKRLQYLEFKLYWEGRVNRGDLTAEFGISIPQA
FT                   SVDFTKYQEMAPNNISYNSSAKYYEPAESFTPIFIEQSADAYFSTILCSPTDSIATCGS
FT                   DYVAAVPNPTRAIDLDVLRTLVQSIKNKQVVSVDYRSFNNPQPGNTRLISPHAFGTDGS
FT                   RWHVRAYCHESNSFKDFVLGRIASAVMGSESDIDVNSDFKWFNYVDVEIGPNPKLSEAQ
FT                   KSIVVMDYRMTDFKLKFKCRMALFFYLSKKLGIDRNDSERAGEEQQIVAINLDEINASM
FT                   RQ"
FT   gene            256832..257608
FT                   /locus_tag="Glov_0283"
FT   CDS_pept        256832..257608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0283"
FT                   /product="YcgL"
FT                   /note="KEGG: bld:BLi00372 YcgL"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94012"
FT                   /db_xref="InterPro:IPR018775"
FT                   /db_xref="UniProtKB/TrEMBL:B3EB28"
FT                   /protein_id="ACD94012.1"
FT                   /translation="MKISISEQLSNIETAHGVRILYAVESGSRAWGFASRNSDYDVRFI
FT                   YIHIPDWYLSIRERRDVIECPISNDLDISGWDLRKALGLFSKSNPPLLEWLGSPIIYMD
FT                   AFGLASRLREMLTTSFQPQRSMYHYLHMARGNYREYLKGEVVRLKKYLYVLRPILACLW
FT                   IEKHGTMPPTEFSKLVRDARPSVTLSAAIDDLLQQKMSGNELDTAPKIPVLNEFIEQML
FT                   DHYSLLSGKRPTPVADYDALDQLFREMLQSVWGNTP"
FT   gene            257605..258096
FT                   /locus_tag="Glov_0284"
FT   CDS_pept        257605..258096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0284"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ppd:Ppro_0225 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94013"
FT                   /db_xref="InterPro:IPR024755"
FT                   /db_xref="UniProtKB/TrEMBL:B3EB29"
FT                   /protein_id="ACD94013.1"
FT                   /translation="MNVQLEKIVSGGQTGADRAGLDVAMKVGLPVGGYCPKGRLAEDGT
FT                   VPEHYPLVEMTKGGYSARTERNVIESDGTLILNIGKLSGGTRLTVECARKHNKPHLVIQ
FT                   LDTAKPKVSTLAEWIDENNIRVLNVAGPRESKSPGVHQLACRYLEEFFLAAGCQPATGS
FT                   "
FT   gene            258097..259293
FT                   /locus_tag="Glov_0285"
FT   CDS_pept        258097..259293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0285"
FT                   /product="polynucleotide adenylyltransferase/metal
FT                   dependent phosphohydrolase"
FT                   /EC_number="2.7.7.72"
FT                   /note="PFAM: Polynucleotide adenylyltransferase region;
FT                   metal-dependent phosphohydrolase HD sub domain; KEGG:
FT                   ppd:Ppro_2054 metal dependent phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94014"
FT                   /db_xref="GOA:B3EB30"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/TrEMBL:B3EB30"
FT                   /protein_id="ACD94014.1"
FT                   /translation="MTATSIVKSLFPQETWSRIWIVGGTVRDVLNGKDGEDIDLDAVLT
FT                   PEELASYGFRPVDPVTSAPIWFRHIPEIGKIEITSLASVDLLTDDLTRRDFTVNAMAMT
FT                   LDGEVVDLFGGIQDLGQKRLRACSDVSFQGDPIRIFRAFRFESEEWRMDPDTTRMISDV
FT                   SWEKSFSCIPVERFSREMVKALGKGEPERFFRNMVEMNVGSTYLPELFAMNTVPAGPID
FT                   KHPEGDLLTHSLQVLQRTVGASNDPLARFCALFHDLGKLETDPELYPKHHGHDDAGKIT
FT                   AKKFCDRLCLPVSWRRALMGICHLHTNANNWNELRDSTRIRMADQAVKSGITEILPLVS
FT                   AADKPCGSGMAGWEMTVRIVQLNTAELGINQDAMETMPVENRAGFILQKRVDQLRRQI"
FT   gene            complement(259284..259769)
FT                   /locus_tag="Glov_0286"
FT   CDS_pept        complement(259284..259769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0286"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ppd:Ppro_0228 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94015"
FT                   /db_xref="UniProtKB/TrEMBL:B3EB31"
FT                   /protein_id="ACD94015.1"
FT                   /translation="MILWDHEGKPVVCDHKDLTPGALTMISGISDRFDRGVCPFCNRSY
FT                   SQELSCHHLRNILVVEGDAYWHRTFINISGTRFLSVSNDDGLNGPTVQHCEACTSPQQK
FT                   VGMIHVRFTEEDDPRIRVVSYCSDVCAAVHWQLDLKRTREKQFVQQWLQDSSVQTHI"
FT   gene            complement(259766..260854)
FT                   /locus_tag="Glov_0287"
FT   CDS_pept        complement(259766..260854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0287"
FT                   /product="integrase domain protein SAM domain protein"
FT                   /note="PFAM: integrase family protein; integrase domain
FT                   protein SAM domain protein; KEGG: ppd:Ppro_0229 phage
FT                   integrase domain protein SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94016"
FT                   /db_xref="GOA:B3EB32"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:B3EB32"
FT                   /protein_id="ACD94016.1"
FT                   /translation="MNNDIIPTGGPHSALISSQIPDNLPADLEAAVRNWLEREVALGDP
FT                   REDTIKTYTSHLNHWLRWCNARGITPAAMTQADVESFRHELIQAGMKASSIAVKLTVIR
FT                   RFYQVAMNRGLVAINPAANVRPPVAREAKSEQKHLTAGQAELLIMHLPVLGSIKGLRDR
FT                   AIIALMLLEGLRRVEIKRANVEDIEDVEGGVRILVHGKRKDGYIYPREDTVAAIRAYLA
FT                   ARGEVTVEETTIHHRQAFVTPMFLSVRKNGRGRGRISRIGLNSVIDGYLSKAGLKRKRV
FT                   SCHALRHTCGTMLYDVTKDIRAVQDTLRHEDISTSAIYAASGREHKRFTRKIPLVITTA
FT                   PTPPVDDSCIPSAPDQETEESP"
FT   gene            complement(260847..261206)
FT                   /locus_tag="Glov_0288"
FT   CDS_pept        complement(260847..261206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0288"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ppd:Ppro_0230 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94017"
FT                   /db_xref="UniProtKB/TrEMBL:B3EB33"
FT                   /protein_id="ACD94017.1"
FT                   /translation="MYRYSAQKDGQLTGRFYVTLRQEITRGVRLSKITERALSKACISA
FT                   NNNQLKSWDSGLKVERTGTGFTVNRLYRRPRPDRVPSVSLYHGPPREVMAFINGFVSAV
FT                   MHTSLTSIESEHPHE"
FT   gene            complement(261286..261549)
FT                   /locus_tag="Glov_0289"
FT   CDS_pept        complement(261286..261549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0289"
FT                   /product="WGR domain protein"
FT                   /note="PFAM: WGR domain protein; KEGG: ppd:Ppro_0231 WGR
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94018"
FT                   /db_xref="InterPro:IPR008893"
FT                   /db_xref="InterPro:IPR036930"
FT                   /db_xref="UniProtKB/TrEMBL:B3EB34"
FT                   /protein_id="ACD94018.1"
FT                   /translation="MSFTSRFTGYCRCQLVLINPALNRRRIYFLEICQGLFHVVLFRAW
FT                   GRIGYRVRCKEEWYPRIEDAVKEANRLYREKTRKGYRETTLK"
FT   gene            complement(261791..262636)
FT                   /locus_tag="Glov_0290"
FT   CDS_pept        complement(261791..262636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0290"
FT                   /product="HNH endonuclease"
FT                   /note="PFAM: HNH endonuclease; KEGG: ppg:PputGB1_4750 HNH
FT                   endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94019"
FT                   /db_xref="GOA:B3EB35"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:B3EB35"
FT                   /protein_id="ACD94019.1"
FT                   /translation="MALNEYKLAESLSARFRLGLDGCVVSTKDGIRHGFRATDIPSPNG
FT                   FMIQVTTGWKSLEADFVPDTYAGDLIRAMGNSLPQARNVFGTLVESFSELGNRIKISVN
FT                   GSVISKTSELPPAPWNKFELSVRRLTDAATESEDALQSSAEEIAAACLALVLTILPLEE
FT                   TDNAATPLFEGGLPEGACIKVIVNKYERSPVNRAVCIAVYGTVCHVCGFDFGKVYGQIG
FT                   KGYIEVHHRIPVSKMGASYVIDPIRDLVPLCSNCHSAVHRTDPPVELEALRSIVVTSHV
FT                   "
FT   gene            complement(262656..264272)
FT                   /locus_tag="Glov_0291"
FT   CDS_pept        complement(262656..264272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0291"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ppg:PputGB1_4751 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94020"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B3EB36"
FT                   /protein_id="ACD94020.1"
FT                   /translation="MADNSTLSSPYLDVPPDPERIIEGLRDTGYEFNTSMADVIDNSIA
FT                   AQAKNIEVTVAMDFGGNILVSVTDDGCGMDRDGLINAMRYGSKRRADQASLGKFGLGLK
FT                   TASTAFCRRLSVISRSQAGSDVLKATWDLDHIAAVGRWELKLGSAAPDEIKLLDTVASA
FT                   QPGTVILWEKVDRLLKAYAVPDGKAAKTALKRYVDELRFHVSMVYQRFLDVNDKRAIDV
FT                   SIRVNGEKVLPWDPYCVTETKAPIAEKVQKVEIGETEHAEFTVRAYILPRKDEFSDQTT
FT                   VKEARLTNDMQGLYVYRENRLIHGPDWLEMYSKEPHMSLCRIELSFDHKLDDAFQVDIK
FT                   KSRILLDDSLYDWMQKFLQGPRREGQERYRKGVAATITGTAALIHAVSNNAIHAKADNL
FT                   KTAVVTEVDGATGDVTISNKNGVTKLKIKLVEQKNSGECHVQSVDSLQDGVLWEPAFID
FT                   GNQAVRINTGHPYYHKVYVPNKQSGVTIQGLDSLIWGLCAAELGNVSENNKRNFEEMRY
FT                   EVSRILRRLVEDLPEPPEDEV"
FT   gene            complement(264287..264712)
FT                   /locus_tag="Glov_0292"
FT   CDS_pept        complement(264287..264712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0292"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ppg:PputGB1_4752 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94021"
FT                   /db_xref="InterPro:IPR015300"
FT                   /db_xref="InterPro:IPR023372"
FT                   /db_xref="UniProtKB/TrEMBL:B3EB37"
FT                   /protein_id="ACD94021.1"
FT                   /translation="MTYSAQITKILSANDVGETGGHQAGILVPKDLEILSFFPSLNSKE
FT                   KNPRVTLVFREGDGITRWDFNFIYYNNRFFGGTRNEYRLTCMTQYLRARNAKVGDHVVL
FT                   SKCLEGRLTVEVKRANAPEMGQDDVLVLSGGWKVIKI"
FT   gene            complement(264709..266634)
FT                   /locus_tag="Glov_0293"
FT   CDS_pept        complement(264709..266634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0293"
FT                   /product="Non-specific serine/threonine protein kinase"
FT                   /EC_number="2.7.11.1"
FT                   /note="KEGG: ppg:PputGB1_4753 non-specific serine/threonine
FT                   protein kinase; PFAM: SNF2-related protein; helicase domain
FT                   protein; SMART: DEAD-like helicases"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94022"
FT                   /db_xref="GOA:B3EB38"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:B3EB38"
FT                   /protein_id="ACD94022.1"
FT                   /translation="MTGFPTENTNEYTAATWTVEGNNLVYCGKDGVFIKPSAMDVWTSI
FT                   YANNDKFSVNPDSALPEYEFSRFPAEPVILLSGKSPDTIKINLVGRSGSEYTYISSKDS
FT                   DQLFIGNTWYPFTLSDYEECLDKLKAQNVVFGQSITVGQLIWLKTQPDLGIELIDDLQS
FT                   CTPAEIQAPTTLNSAEWGLEAELYNYQKDGVYFLTLIANQGLGCILGDEMGLGKTVQVI
FT                   ALMLAENFQGRSPTLVVAPATILENWRRELAQFSPSLSVLVHAGSNRAGIASKLSGIDV
FT                   VVTSYDIAVRDEPMLSSIRWNLLVLDEAQSIKNPDAQRSIAVKNLNRRVSLAVTGTPVE
FT                   NKLTDLWSLSNFALPGLLGKRADFETLFENTDSDASQLAPLVSPILLRRRVKDVAKDLP
FT                   ERIDIPQPISMSKKMAEMYEQVRLAIIEEYGKSASLVSLQRLRMFCTHPLLAGFALADP
FT                   TEHMPKYQRLIELLEEIFSRREKCLIFTGYTGMTDILMHDLSKRFVDQYFNFIDGRVPV
FT                   PDRQTIVDAFSISPTSGALILNPRAAGVGLNITAANHVIHYNPEWNPALEDQASARAYR
FT                   RKQTRPVTVHQLYFVDSVEEVVVGRLKLKRGLSEHAAIGHKGDSTASAVMRALTLSPLS
FT                   KIGALE"
FT   gene            complement(266668..267879)
FT                   /locus_tag="Glov_0294"
FT   CDS_pept        complement(266668..267879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0294"
FT                   /product="Restriction endonuclease EcoRII"
FT                   /note="PFAM: Restriction endonuclease EcoRII; KEGG:
FT                   rsh:Rsph17029_3386 type II restriction endonuclease,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94023"
FT                   /db_xref="GOA:B3EB39"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR015109"
FT                   /db_xref="InterPro:IPR038365"
FT                   /db_xref="UniProtKB/TrEMBL:B3EB39"
FT                   /protein_id="ACD94023.1"
FT                   /translation="MNHGHLSQYFSAVACKPLSAVEADLCRSHQHELNGVEALIKMFGR
FT                   ATEKHTFQASFMYLCDHDDEPVVADGYVTWYDSRLKNTTRTEHRLYFPTTAVSMCAAEG
FT                   DLLIIGKRTDNSVMIIIAEAESTIASQVSWLFGFGVDVHPGFSVRSELECEQNRIEFAS
FT                   RIILEHIGVQVEEVAENYLDEMLRLFGGKFPNTRDFSEYARASLIDIDPRDGADAALMA
FT                   FVEREEILFRTLERHIIGDRLQVGFVDDVDGFVTYSLSVQNRRKSRAGSSLENHLEVIF
FT                   NAQGIQYTRTPVTENNEKPDFIFPDIIHYRDPDFDVSKLTMLGVKSTCKDRWRQILSEA
FT                   DRIKSKHLLTLEPGISENQTNQMKRSNLQLVVPSALQRTYKTEQQTWLLTFDDFIRLLR
FT                   IRQS"
FT   gene            complement(267954..268418)
FT                   /locus_tag="Glov_0295"
FT   CDS_pept        complement(267954..268418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0295"
FT                   /product="DNA mismatch endonuclease Vsr"
FT                   /note="TIGRFAM: DNA mismatch endonuclease Vsr; PFAM: DNA
FT                   mismatch endonuclease vsr; KEGG: bxe:Bxe_A3371 putative DNA
FT                   mismatch endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94024"
FT                   /db_xref="GOA:B3EB40"
FT                   /db_xref="InterPro:IPR004603"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:B3EB40"
FT                   /protein_id="ACD94024.1"
FT                   /translation="MTDIVDKETRSRMMSGIRGKNTKPEFHIRSLLHRNGFRFRLHTKD
FT                   LPGKPDIVFPRYRAVIFINGCFWHGHDCHLFKLPGTRTDFWKTKIARNKENDSRAMGLL
FT                   AESDWRVATVWECALRGKFRMNDTVITERLAGWIRSAEIKLELRGIQPEV"
FT   gene            complement(268418..268717)
FT                   /locus_tag="Glov_0296"
FT   CDS_pept        complement(268418..268717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0296"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94025"
FT                   /db_xref="UniProtKB/TrEMBL:B3EB41"
FT                   /protein_id="ACD94025.1"
FT                   /translation="MSEKYVWFNFVMKNINQPEKIKDQSLIKGYHQIFEQYPGLHPDGF
FT                   DDPDSGWTDELRPVCAEMWRRVELPEFTVNEEHMYYINKAFRKLAAESATKTSR"
FT   gene            complement(268714..268947)
FT                   /locus_tag="Glov_0297"
FT   CDS_pept        complement(268714..268947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0297"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94026"
FT                   /db_xref="UniProtKB/TrEMBL:B3EB42"
FT                   /protein_id="ACD94026.1"
FT                   /translation="MKKGDIVKFREEADPGDTKVRMLLLEDPDGGRVLVGDLCIVEDSG
FT                   VKQAVTATCRYLEDELEVVSKEDIMKIKAASK"
FT   gene            complement(268959..270206)
FT                   /locus_tag="Glov_0298"
FT   CDS_pept        complement(268959..270206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0298"
FT                   /product="DNA-cytosine methyltransferase"
FT                   /EC_number="2.1.1.37"
FT                   /note="KEGG: bxe:Bxe_A3354 C-5 cytosine-specific DNA
FT                   methylase; TIGRFAM: DNA-cytosine methyltransferase; PFAM:
FT                   C-5 cytosine-specific DNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94027"
FT                   /db_xref="GOA:B3EB43"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR001525"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR018117"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR031303"
FT                   /db_xref="UniProtKB/TrEMBL:B3EB43"
FT                   /protein_id="ACD94027.1"
FT                   /translation="MSYSEALVRLKEARGRFTQKSLAEQLDVSIKTIGRWEREEIKCPS
FT                   HIAPALKELLRSKNQTADNADMFTFIDLFAGIGGIRLGFQSAGGRCVFTSEWNDWSQKT
FT                   YVENFGNEHAIVGDIVPYPAEDIPDHDVLLAGFPCQPFSIAGVSKKNALGRPHGFECTT
FT                   QGTLFFDVARIIATKRPKAFLLENVKNLLSHDKGNTFKVIIQTLKEELGYDVHFRIIDG
FT                   KSWVPQHRERIIIVGFREKTGFSFDSLQLPKEGPKLFSILHPEDGTEQEETPFTVGDKA
FT                   KVHEKYILTNNLWSYLQAYAAKHKAAGNGFGFGLVGKNDTARTLSARYYKDGSEILIDR
FT                   GKGKNPRRLTPRECARLMGFPDSHKIIVSDTQAYRQFGNSVIVPVMREVARIMAPHVID
FT                   LKQQEEMGVSQQWLLA"
FT   gene            complement(270437..270703)
FT                   /pseudo
FT                   /locus_tag="Glov_0299"
FT   gene            complement(270776..272380)
FT                   /locus_tag="Glov_0300"
FT   CDS_pept        complement(270776..272380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0300"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ecp:ECP_4570 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94028"
FT                   /db_xref="UniProtKB/TrEMBL:B3EB44"
FT                   /protein_id="ACD94028.1"
FT                   /translation="MSREFMAMSEVIAQDFIQSILFVDDKAYCPEQDDHPFDVNPIIRE
FT                   SASKGLMATAFAPEHQDDLSMVVSIGRKADVVVLDWRIDIKNISPSTGVDLNEEEDDVA
FT                   DFRGNFAIQIIKSLTAENDVPVDQLKLIFIYTGETNLNEIMTQLSESFVCFKPLDAFTL
FT                   SFGGVRISIWAKESAAPRFMHMPEMKPRLKSYSGLLDEVPIEYAKVSAGLLSNTCLNAL
FT                   TQLRNNTYKLLADFSPSLDPAFVAHRAMLPWPEDAGELLKETICGQLNAILTNADISQQ
FT                   VSSNIVCDWLSSQEFIDTEIKATDKHKINIDSNKRVLWQNKGYIALLNSEVDNSGKAIL
FT                   SEDDIKNFERRRLKKYSCESFRPHNFTNADCDEEFSILTHHKRNFLSTSQRPSLSLGVV
FT                   VKKNENYLLCIQQKCDSVRIAAGTHRKFLFLPMEKDGQNFDVLVKNELQGYVPLSTCYK
FT                   ECHALEIIEFSPFEDTGIVQAQKEDDYYYFIGGPNDEIKFKWILDLKESHAQRIANNFA
FT                   ANLARVGLDESEWLRRN"
FT   gene            complement(272373..275357)
FT                   /locus_tag="Glov_0301"
FT   CDS_pept        complement(272373..275357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0301"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   KEGG: cph:Cpha266_0079 histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94029"
FT                   /db_xref="GOA:B3EB45"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B3EB45"
FT                   /protein_id="ACD94029.1"
FT                   /translation="MANFKTSARALEMLGRQQIAGIPTATSELFKNAYDAYADEVEVDY
FT                   FRHKNCLLIRDNGYGMTRAEFESKWLTIGTDSKYGKKPQINPFSKPERPIMGEKGIGRL
FT                   AISAIGPQVLILTRALRENETQTLVVSFINWDIFGLPGLVLEDIHIPVYEFEDNSFPDS
FT                   DFVQKLVGEVVESLVNAEDKIDEIDYQRVLEQLKSFKINPKEWDSFFDGLLLSNNSIGT
FT                   HFYITPVDESLASSLDKDYNSGDISTMQKMLLGFTNTMNAEAPHVINTAFRDYKNQDLS
FT                   KSNNLIDQAIFFTPDDCAQADHHFSGRFDEYGQFAGQVTVYNEETYQHEILWHGANGRK
FT                   TLCGPFNLTVHYLQGTEKDTLLSRDDWSPLHSKTNILGGLYIYRDGIRILPYGDSDYDW
FT                   LDIEKRRTKSAKYYFFSHRLMMGYIDIKHLDNSGLTEKAGREGFIENKAYRQLRDILIN
FT                   FFLQLANDFFRADGGPKSELWTAKKVEFDRAFKAKQKRDSQASGKKQKFQKALNDFNNN
FT                   KINIPSELETVHAKAEEELRALSIINDHDELARKMLDLELHLLKTVTSIEDSYRISNPK
FT                   GFVLSKDLRQEWEAYQDEWSRFNVDYFQCTKKTISNLIDTYKNEYKVELNKRVRLQQAI
FT                   DDIAANVEKSVGVESKLTNDVIKVVNRQVIDLTREVMVTLSDSLKNIKVEFAKLDISKL
FT                   GDDELFNKRLEIEEKITAEARQHKQILESVQSQLSAIHWSKDEDGHIITQADINDALEN
FT                   ELEELRGQINVDIELSQLGLAVGVIHHEFTSTAQAIRENIKDLKMLSDVNEKYESLYKN
FT                   LRANFEHLDNYLSLFTPLDRRMYRKQENIPYKDISAFILDIFKERFRRHNIELKATRGF
FT                   NLRSIFACRSKIYPVFVNIVDNAVYWLKQTDDNIDKVIRLHADDGGFYISNNGPPIQES
FT                   IKERVFELGYSKKETPNGRGRGMGLHITRDVLKSIGYEVFVADPRDNATVTFCVQKFEG
FT                   GDSDE"
FT   gene            complement(275350..276477)
FT                   /locus_tag="Glov_0302"
FT   CDS_pept        complement(275350..276477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0302"
FT                   /product="DNA-cytosine methyltransferase"
FT                   /note="TIGRFAM: DNA-cytosine methyltransferase; PFAM: C-5
FT                   cytosine-specific DNA methylase; KEGG: cph:Cpha266_0080
FT                   DNA-cytosine methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94030"
FT                   /db_xref="GOA:B3EB46"
FT                   /db_xref="InterPro:IPR001525"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B3EB46"
FT                   /protein_id="ACD94030.1"
FT                   /translation="MDGHHCDGTVMINHDKKNISVFDFFCGCGGTSRGFQKAGMDIAFA
FT                   LDVDKDAKNTFTKNFPSTDFCDKSIKKLTVLDFQHTLDKYKDSYKLFCGCAPCQPFTKQ
FT                   NTESPKQDERKDLLTYFGTIVKECEPDFVFVENVPGLQKVPNHKHGPFPAFEELLHKLN
FT                   YQIAYGVVAAQDYGAPQLRRRFVLLASRHGEISIPEPTHGKDSDTPYKTVYDAIADLPA
FT                   ITAGESYAGNNVLNHRAAMLSEINLERIKASTHDGGGRNNWPRALWPECYTRTNEDGTT
FT                   HSGHTDCYGRLWWKKPATGLTTRCISYSNGRFGHPVQDRAISVREAARLQGFDDTFEFT
FT                   GNLNSMARQIGNAVPVDLAFAMGKQFIKHIEAIHG"
FT   gene            276848..277225
FT                   /locus_tag="Glov_0303"
FT   CDS_pept        276848..277225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0303"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ppd:Ppro_0241 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94031"
FT                   /db_xref="GOA:B3EB47"
FT                   /db_xref="UniProtKB/TrEMBL:B3EB47"
FT                   /protein_id="ACD94031.1"
FT                   /translation="MLSRIQTAHTRRDDVPTSKMRAIIISAVGTVIPCIIAGAIVGIFF
FT                   RSSFWYWTLGIAVLAFLYACLDRIPLRLFTGTMKGLPLGGLLRYGYASTDKRPVPTFYE
FT                   IEDRERFNIYSYDHYYGDREK"
FT   gene            complement(277204..277527)
FT                   /locus_tag="Glov_0304"
FT   CDS_pept        complement(277204..277527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0304"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ppd:Ppro_0242 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94032"
FT                   /db_xref="UniProtKB/TrEMBL:B3EB48"
FT                   /protein_id="ACD94032.1"
FT                   /translation="MIVERLIPVSDGIICLMQDDFTVPESLSDTDVEVSLKDFGAILTV
FT                   KGNEVALPGAILEHFENAEGTSIYFYTVSPYELIPEYRGSITLRRDEVLKAKGAWDYFS
FT                   RSP"
FT   gene            complement(277531..281148)
FT                   /locus_tag="Glov_0305"
FT   CDS_pept        complement(277531..281148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0305"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ppd:Ppro_0243 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94033"
FT                   /db_xref="GOA:B3EB49"
FT                   /db_xref="InterPro:IPR012931"
FT                   /db_xref="UniProtKB/TrEMBL:B3EB49"
FT                   /protein_id="ACD94033.1"
FT                   /translation="MSIRTVSRLVLTALLVLIPTMALALDMEFYVWGGHDAVVNAFGKL
FT                   ALIFGDNAYKSLYFVVITAGLFFGGVTVFAKSLGTANGSVMTWIVPTLIGVMVYLALVV
FT                   PKGTIHVYDPVFNKNQAVGGIPDGVVAVAGILNKIERGLVDIVTTAGDPLNYQTQAGGK
FT                   GFLGLAQLTSIPLSAVDSNLDASMRRYVKDCVSYALMNPNANLTVDELRKTTTNFVGSL
FT                   DKAVNPAIWTVYFNAANPQGQALTCTDSWTNIKAALTPANLGKNIESVCANLGYDVTDA
FT                   AALTQCKTVLNNVNTGTGLGAASIDDFLKQAYVSQRLEEIFRSGNASGATNYQFLLNAS
FT                   GAMKSANEWLPILKAALTAIAVGLLPFLALFIPTPLISKAVGIIAGFFIWLTAWGVTDA
FT                   IVHQFAVDYANRAYEMVRQNKLGMDALYFFPDQTVKILGMFGTLRMSGMMLATVITGML
FT                   IRFGGHAMAMMAGGMVNQVQSAGTRAAHEVEDPAGRASAMQRNVTAMPTQAWSNEHSFQ
FT                   ARQAQSLVGMSAKTTASSDMIRDFGMDFSSRISADSEIGRSIGFGGSGRAMREGGLSSA
FT                   YELKSFDGRLGLDKSAATKDVVSGSYGGNTLAFAKMGVANDRALANVFGSGENYSDFLT
FT                   ANMNKSVGQLQGEMGAYAAARSLGFSGNWRDFHAMRSEVTALGDFANADAVNKIADKYG
FT                   ISSGQLMQMNAQFQQSKHASEVTGLSNQMGGPVAAGTEAGHVLATETGGKIQGIYAGGG
FT                   YENYQQLTSNDVSGRIARNQLVHAAADQMVGKIAPQLKNDPEMYQNGHLTERGFAEVQK
FT                   AMEGQNINFTTSDGKSAVNVGMDGGIVNSSNSGTVAKGDKEQALEMQKQLRAAGFQSAA
FT                   AHVAKLSGQAFDYKADYDRNGNLASFAIDQGGRVQKFDLGQSKSGTDIERLDRNVSTTD
FT                   KGLRKTVGDFIKTGYENQSLNVSRKSGSYMIQAGGKQMMVNGDWYYAKNEKTGNMEVVG
FT                   GSFSNGLDGNVLMYAKDKDGNLHYSQVQGKMDKSGNLIAGQRSEITEDQFVQSSQQGAA
FT                   VVSTRSGGGITGSVRADGGVKADYSNSQVVGTRVESKQNLAGSAATQEFTDGRSIDAGT
FT                   AATMIAVGQGALHETAGVVRDVEGVVGPNLKMAERRERAAKESVREEAQVVRSVERVKA
FT                   DKARDVQQEVQRTSKILQHQSKSSNLPKSGGPPAARRGR"
FT   sig_peptide     complement(281074..281148)
FT                   /locus_tag="Glov_0305"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 25"
FT   gene            complement(281126..281866)
FT                   /locus_tag="Glov_0306"
FT   CDS_pept        complement(281126..281866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0306"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ppd:Ppro_0244 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94034"
FT                   /db_xref="GOA:B3EB50"
FT                   /db_xref="UniProtKB/TrEMBL:B3EB50"
FT                   /protein_id="ACD94034.1"
FT                   /translation="MSKDSNSTPDIMPVPPSNEIHPRGLLEAISYIDQNFANELGGCMI
FT                   KSRFLTTKQRLEFMEVGFRSSFASGIVSAFLTPVAIGVIEQYIPMFGDPSPTFFDKFSA
FT                   FLLALGFSLGYAIFMAKASTCFIGEYTRAMVLNLLGGMIFGAIVKAVVAFIAFHFLYFK
FT                   IFTDNNVVWAVTKLYYTKTSQSTVYSIYNWVQGFKGIFLISAYFVLISTAVFIIIPIIA
FT                   MLFAWRRNLKLIDAGVVHVDTDSI"
FT   gene            complement(281875..282126)
FT                   /locus_tag="Glov_0307"
FT   CDS_pept        complement(281875..282126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0307"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ppd:Ppro_0245 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94035"
FT                   /db_xref="GOA:B3EB51"
FT                   /db_xref="UniProtKB/TrEMBL:B3EB51"
FT                   /protein_id="ACD94035.1"
FT                   /translation="MPIEKLNPLHYMGQAAYTGFWQKLFATLLYGFWGRFFFVALVVSA
FT                   FWVGVRQRNPTLAAICLLLAAIVAYGGGIMNLIRSFTG"
FT   gene            complement(282137..282631)
FT                   /locus_tag="Glov_0308"
FT   CDS_pept        complement(282137..282631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0308"
FT                   /product="type IV secretory protease"
FT                   /note="KEGG: ppd:Ppro_0246 type IV secretory protease"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94036"
FT                   /db_xref="GOA:B3EB52"
FT                   /db_xref="InterPro:IPR019533"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:B3EB52"
FT                   /protein_id="ACD94036.1"
FT                   /translation="MPKPLDLDFHNWRLWLAITCLIVAGTLIPYKFSVTLTPSLKHRIY
FT                   WLTRNPDKVVRGDYVLFHHKEFSAKVGMKKSEEMLKVIGCNEGDQLTVDAEKKFYCNGE
FT                   YLVRAKDISLKGEPLQHFVFNGQIPKGVMFVMGQHKDSYDSRYFGFVEKNRILAKAYPI
FT                   F"
FT   gene            complement(282609..283001)
FT                   /locus_tag="Glov_0309"
FT   CDS_pept        complement(282609..283001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0309"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ppd:Ppro_0247 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94037"
FT                   /db_xref="GOA:B3EB53"
FT                   /db_xref="UniProtKB/TrEMBL:B3EB53"
FT                   /protein_id="ACD94037.1"
FT                   /translation="MNDETNIKINVSQESESNKDAVSVPKEYPKQHPKQHPSLVSMIAI
FT                   CVAVSVGASLSTIVGYDRWFAQKVVAVDIKGYIAQQRDNYLAGKLNDDELKKSFDRLEN
FT                   VITAIPKNRVIIMGDAVVRNAETVRP"
FT   gene            complement(283025..283987)
FT                   /locus_tag="Glov_0310"
FT   CDS_pept        complement(283025..283987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0310"
FT                   /product="type-F conjugative transfer system pilin assembly
FT                   protein TrbC"
FT                   /note="TIGRFAM: type-F conjugative transfer system pilin
FT                   assembly protein TrbC; PFAM: Type-F conjugative transfer
FT                   system pilin assembly protein TrbC; KEGG: ppd:Ppro_0248
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94038"
FT                   /db_xref="InterPro:IPR019106"
FT                   /db_xref="UniProtKB/TrEMBL:B3EB54"
FT                   /protein_id="ACD94038.1"
FT                   /translation="MSCLFIAAPWAVSAAGNPGYITTPDTCCIVDRIVEDTVYLNKVGT
FT                   CNGKPGRAFIQTKLKKVKVVVNGTVWKETDVEGMSVPDLANTLAKADQLAERLAIPKSR
FT                   NDREMSDLAGTLDSYYHSDEFQLRVLSETERIKTEVFGDKVTGYYADKAKKESKGKLTN
FT                   SERIYVFVSSAMPLQTIRNYAASVSRLGDPNVTLVMRGFVDGMTKIQPTISFIASVLQR
FT                   DQSCRPQEGECEMIPTSLAVDPLLFRRYQIDRVPAVVYARGLKAEDAGLSEGDAKNATI
FT                   ADYHTAYGDARLEYLLDQIQRETGSQSLAALLSTPANKN"
FT   gene            complement(283987..285009)
FT                   /locus_tag="Glov_0311"
FT   CDS_pept        complement(283987..285009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0311"
FT                   /product="TraU family protein"
FT                   /note="PFAM: TraU family protein; KEGG: ppd:Ppro_0249 TraU
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94039"
FT                   /db_xref="InterPro:IPR009649"
FT                   /db_xref="UniProtKB/TrEMBL:B3EB55"
FT                   /protein_id="ACD94039.1"
FT                   /translation="MNLSNNITIIALVTLFLTVPVAYGAGGACKGKVLNPVTDICWQCM
FT                   FPVKMGSVSYGNGAEPAPGNVTSPVCACPDSKGILILGVSTAFWEHARLIETVKDPFCF
FT                   PVMGTGMTNPKPGFSSGENRSKEYGDSDFAFQQAHYFYFPAWSILKLFMDFPCAENRAF
FT                   DLAYMTEVDPMWNDDSLSFIINPEALLFGNPVSQLACVADSVAATVTYPIDPLFWCMGS
FT                   WGSFYPLSGSMIENNPLNVNAGLAARMLFKLGRETLLYDTGINQCASAGVVTPILVKSN
FT                   YRLQIARPVRGNDCIPIGRPSLIWGAAKNPPFGTTNTSPDNFLWSLTRRRVCCVGYALN
FT                   "
FT   sig_peptide     complement(284935..285009)
FT                   /locus_tag="Glov_0311"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.987 at
FT                   residue 25"
FT   gene            complement(284993..285463)
FT                   /locus_tag="Glov_0312"
FT   CDS_pept        complement(284993..285463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0312"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94040"
FT                   /db_xref="UniProtKB/TrEMBL:B3EB56"
FT                   /protein_id="ACD94040.1"
FT                   /translation="MNSLIAQSLCIAGVMTLCVGCSHESWTNVEETTRLPSVAALILAP
FT                   VNWVAKAGRAVTSKSSESSDTDRGKQFVLSRKVMDDFSSNGKFMEELLAVQSRFRAHDW
FT                   GAVSPEQLQANGSSNSGKGSVGRYQTGSNGAAIIITDEGSEFKVRYEDEPEQ"
FT   sig_peptide     complement(285389..285463)
FT                   /locus_tag="Glov_0312"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.684) with cleavage site probability 0.550 at
FT                   residue 25"
FT   gene            complement(285460..286116)
FT                   /locus_tag="Glov_0313"
FT   CDS_pept        complement(285460..286116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0313"
FT                   /product="conserved hypothetical cytosolic protein"
FT                   /note="KEGG: ppd:Ppro_0250 conserved hypothetical cytosolic
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94041"
FT                   /db_xref="UniProtKB/TrEMBL:B3EB57"
FT                   /protein_id="ACD94041.1"
FT                   /translation="MIRRTGLAVIALVLGISSAQAKVIGTYGTTYRITERDALAEIEER
FT                   ARQVDWNKVLDKRKIENYQGPPDKASLPRAMRNRSFPVDMTYATEIDVPDGKGGILYPK
FT                   GYTFNPLDYVTYPKTLVVINGTDPDQVKWFAASEYDKRLDVTLLLTEGSFGAVSKRISR
FT                   PLFYADRKIIERLKLQAVPSVIKQKGRLMEITEVALPVGKTKAAARSSQNRKGTP"
FT   sig_peptide     complement(286051..286116)
FT                   /locus_tag="Glov_0313"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 22"
FT   gene            complement(286113..289487)
FT                   /locus_tag="Glov_0314"
FT   CDS_pept        complement(286113..289487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0314"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ppd:Ppro_0251 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94042"
FT                   /db_xref="GOA:B3EB58"
FT                   /db_xref="InterPro:IPR014121"
FT                   /db_xref="UniProtKB/TrEMBL:B3EB58"
FT                   /protein_id="ACD94042.1"
FT                   /translation="MLFRIAYSVLYAVLLLSLSGVTTTAQAVVSCQDSITTGTTYRYSD
FT                   ALAFFTEFNGKTYAIAKSAVSGSQSLPDIYFDFSANISREYLMTGTDTASLKRMLSLGQ
FT                   FGAAKPVSVDSQQTLDFLIKRYGAYLGTATSDKSTYIDAWKEFGPVGFNAIDGSGLPFT
FT                   KWPAAGAYTGQDPQAVVMGSDGIWSSGLDGTRSSQIVEFSGKLDCALSYIDPGTITPPP
FT                   PPPPPPPPDPNAINNIMCGQDLNNNGYAGDPGETANCIQTTQGQFCPVGSTECVETFTA
FT                   PVCPAGSTLETTRDMCQATAQNVCGSGYTWDSGIDKCIKAVTCPENGTFNPVADRCEKL
FT                   VQNDCPVGYSYDANPASQTYDRCVKSATCTDGGAFIAAKDRCEKAWMPVCDTANGYAYN
FT                   GSTGKCERSPICTYGSYNASYNLCVQPFVPSCPGGYSYNSSRGRCEKAPECPAGTTYNV
FT                   VTNKCDAITGASAQQVLSCSPQSFLCAPYADSCCNVSISCPNGPQGQVNVAANYCCLGS
FT                   DAITIQSPLSLLARTELTSTGYALSALQCDSVGNCSYYFMDRYCADGSPASDWMLSGAF
FT                   TMASTQMVCPAGQALINGNQCLSATNPTCSGGNFDPNMDVCWAAYTPTCTQGTYDSASG
FT                   LCILVPSCPNGTLNTTTDLCEATITRDCGTYSFDAAANLCFSSPVCANGAYDASLNVCQ
FT                   ATLTRNCGTYGWSQADFKCLQPVTCPKDPTFSQAATTTFSTTLDKCVSEVQHDCPAGTT
FT                   YTPFPIGKCEAVPICSAAGIYNPQKDSCFEGFNTCPLGTQYACMEYQNKMQCSPNPCFN
FT                   PGAPGSEVTTTLDESMLQDDGPKDANGNCLGQIYIFNGKASRCRPPGMTVGYLNNCCES
FT                   DKVASEDTGSSISTAVQGIQMAYEIGQVAYYGNALVTGAAQISAISTTATGAVTSMTVV
FT                   SAAGTTTTLSGAAATGAYATMASGATGASALGAGLQAYAAALFNPATIIIAVVVLVVMK
FT                   VLMGSGCDQGDIQTGMQKEGKQCHYVGDYCQKKWPLVGCVQKAKSFCCFNSKMARIIHE
FT                   QGRPQLQSFQPNGGWGVPEAPNCRGFTPDEFQALDFSRIDLSEYFEDVQKDLATKIDGS
FT                   QQTIMQNIQNKYQATPK"
FT   sig_peptide     complement(289404..289487)
FT                   /locus_tag="Glov_0314"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.772 at
FT                   residue 28"
FT   gene            complement(289493..291496)
FT                   /locus_tag="Glov_0315"
FT   CDS_pept        complement(289493..291496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0315"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ppd:Ppro_0252 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94043"
FT                   /db_xref="UniProtKB/TrEMBL:B3EB59"
FT                   /protein_id="ACD94043.1"
FT                   /translation="MRMQSVRWSRNTAVSLMMSVTLGSTSAFGIDGKTAGQNAGQSALS
FT                   RFGSKNSVNSNISLPMTNSSNLMQTVNGATSFPATLNAPSSAKFLEVMIQPSGTGDLQQ
FT                   VIISQDLNTDGTIDNVHAVPSLVSGVCANGFISCNAGSWTNCKYYTWAADADGRVTEAP
FT                   ASITDLGGCYCINSSCGSNLVWVNSAIVLKDIGGGIVNAVHTSNTSFTITNVNTDITTI
FT                   TYYGQVTTKTNNAATSVAAFASSPTVDTLTGYYTNWPQLTAARDSAAISQSSDPSSFYY
FT                   MISNSGAAREAQGKSSICTVDRAGRVDTTTKSFNDSGSSALCTDHLVYIRVHKVDDLTY
FT                   QLEYLDTGPGGPGAAHNNCGGSPGGDGWHTVKPVTVSTPDPAKLGQLMSANFNMNNMSG
FT                   GGCNSASASVDGVINGFDTSVQTGIVCPAKGAQGVSFDWSYFFDFKEDTYTEGVEDKCA
FT                   SLANDPDCRLKEEDIDGVVTYQNFNPTGFNQLPSCKNFTGQVGTNKICRDWWHKKRTYV
FT                   CGSQQYDFSDVATRFGKVVSSASDNTANLTFQDPRLGPTGWNIANGSINLPQRDPASEC
FT                   EVACKTRIAKTDTQVTTTGNVTDMRVPAQSYDIFYKTCINNSCPADPGEEIVIDCQCIN
FT                   EFAEAATVIQTLRLAGKDNICSSGQKQPMQSR"
FT   sig_peptide     complement(291407..291496)
FT                   /locus_tag="Glov_0315"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.788 at
FT                   residue 30"
FT   gene            complement(291453..293900)
FT                   /locus_tag="Glov_0316"
FT   CDS_pept        complement(291453..293900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0316"
FT                   /product="sex pilus assembly protein"
FT                   /note="KEGG: ppd:Ppro_0253 sex pilus assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94044"
FT                   /db_xref="InterPro:IPR025955"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3EB60"
FT                   /protein_id="ACD94044.1"
FT                   /translation="MGVASALFGSGGGFTRSELRRLTERDNFSEYFPWIAHDPKNQIYL
FT                   NTDNTFGMMWECAPLAFACETTIRTLEGLFRVNLPDGSIMQFILFADPFVNQIVDTYTS
FT                   MKLRDSKLVRDVSDNVSRFFQEGVEGLGCLSGIPIRNFRMFFTVKFPVKDSAHVNLDEV
FT                   FGTIQEVLRGAGLSPVVVNPGNLLDWLRRMLNEDPSANSSHYDDRNIIRKQVLLGTKVE
FT                   KRFSSLKFGSRHFRCVTPKSFPLNGDPIQTNQLFGGIMGMATDSDQIRTPFFFTLNIVL
FT                   RNQKNKLHTKCNMVLQQQGVGSFAPSLARKKDEYLWAVDELERGTKFYRVIPIMWVYGS
FT                   DEWLVNESVTRAKRVWEGQGYVMQEDKGILPILFISSLPFGLYDHGSNIDTLDRDHILP
FT                   VDSIAVMLPVQGDFSGLGKPVMLFAGRKGNLFGLDIFNKGVNNHNAMVCASSGAGKSFF
FT                   INYLVYNYFAMKSKIRIIDIGGSYKKMTKLFGARYLDFSEDSQVCLNPFTNIIDPEYDI
FT                   PVIAPIVAQMVFSTGKTIPSETEMTLIKGAVRWAWQQKGNDADIDTVHEYLFNFDRYSS
FT                   EGGEIKEAASRLAFNLADFKSDGTFGRFFNGKSNLDISNDEFVVLELEHLKSRKELFRV
FT                   VTLQVINAVTQDLYLSDKSDQRLIVFDEAWQFLGESSTLKEVIEEGYRRARKYHGSFTI
FT                   ITQSVLDMKLFGGVGDVIRNNSAFKFYLESSDFEKALDEKLMDYDDFTMRILKSTKSNK
FT                   PKYSEIFMDTPFGVGVGRLAVDPFSYYVFTSDASEITEIEAMVDGGVSYEDAIREMVKK
FT                   YRS"
FT   gene            complement(293903..294397)
FT                   /locus_tag="Glov_0317"
FT   CDS_pept        complement(293903..294397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0317"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ppd:Ppro_0254 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94045"
FT                   /db_xref="InterPro:IPR014118"
FT                   /db_xref="UniProtKB/TrEMBL:B3EB61"
FT                   /protein_id="ACD94045.1"
FT                   /translation="MKKALITIGMLTMSGCALLNPYESSFSCPETSNGKCVSVQTAYKE
FT                   STASPGKSSEAPAEHKEDDCNADNAAAGLCTEGKKDISLHPSAKENGTYNRYQSALFDK
FT                   FSGLLKEPVTPVVAPPKTMRVLLLPYTGQDNEFYMLRYVYFFVDEPRWLMGDSVTSGEE
FT                   E"
FT   sig_peptide     complement(294338..294397)
FT                   /locus_tag="Glov_0317"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.935) with cleavage site probability 0.775 at
FT                   residue 20"
FT   gene            complement(294394..295662)
FT                   /locus_tag="Glov_0318"
FT   CDS_pept        complement(294394..295662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0318"
FT                   /product="TraB pilus assembly family protein"
FT                   /note="PFAM: TraB pilus assembly family protein; KEGG:
FT                   ppd:Ppro_0255 TraB pilus assembly family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94046"
FT                   /db_xref="GOA:B3EB62"
FT                   /db_xref="InterPro:IPR005498"
FT                   /db_xref="UniProtKB/TrEMBL:B3EB62"
FT                   /protein_id="ACD94046.1"
FT                   /translation="MKNKLLSFWNGLSGSQRRNLVWIMTGCILVAVFTIGYYVMNKGKD
FT                   PALNKSVKQTPLSIEPKLLEKSQFLESQKEIAKRDDKVAELTKKLDEITREKKGDPTTA
FT                   PVAQIGTAPAVPGDNHAQQQGQLQKTGSGRTAISKQPLPPIPPMPQGSSISLPPPPATA
FT                   QGIAAGQLQSPTETEIGDIAIVSSPGSGKSAKADVDDKKKDVGTVQVYLPPSFMEATLL
FT                   SGLDAPTTSEAKGNPVPVLLRVKTPAVLPNSVKANLKGCFVIADGKGNLATERAELLLV
FT                   SLSCLDRKGQAVVDQKIKGFVVDEDGKIGLRGRVVAKMGSMIARSMLAGFFGGAGDAIK
FT                   SAATTMSVSPLGTTQTVDPKDIAMSGLGSGLSSGFKEIQKFYMELARQTMPVIEVGATK
FT                   PVTLVISEGINLDIKKIAKGGGK"
FT   gene            complement(295652..296599)
FT                   /locus_tag="Glov_0319"
FT   CDS_pept        complement(295652..296599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0319"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ppd:Ppro_0256 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94047"
FT                   /db_xref="InterPro:IPR010563"
FT                   /db_xref="UniProtKB/TrEMBL:B3EB63"
FT                   /protein_id="ACD94047.1"
FT                   /translation="MRKTFALLTALLVPTLAHAVEQGGLQKQKASIDQTIEKPVEGEFP
FT                   TVVLPESSTGIRLSSSDINRISCPTDIREVLTSTEKGVTIKITGKDAFVKFKVIKKGDK
FT                   FSYSSTPTELYVVCGDKVFSMVAFPQRVPSQTIRLTSGQEKKIKENLSLYAGLPFEKKV
FT                   LKAIREVYTENIPDSYSINKKEKRFFTFREILLTLKRTVDIEGEGLRIKEYEASLRGET
FT                   PEFKMNEKMFLRTALVENPIAVSLERHVLRAGDTSRVFVVEQRAEKQGVHRLTGDLPVM
FT                   DQPTQSLTVNKSGNPKESSENRTESDLQEADDEK"
FT   sig_peptide     complement(296540..296599)
FT                   /locus_tag="Glov_0319"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 20"
FT   gene            complement(296599..297177)
FT                   /locus_tag="Glov_0320"
FT   CDS_pept        complement(296599..297177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0320"
FT                   /product="conserved hypothetical sex pilus assembly and
FT                   synthesis protein"
FT                   /note="KEGG: ppd:Ppro_0257 conserved hypothetical sex pilus
FT                   assembly and synthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94048"
FT                   /db_xref="GOA:B3EB64"
FT                   /db_xref="InterPro:IPR007973"
FT                   /db_xref="UniProtKB/TrEMBL:B3EB64"
FT                   /protein_id="ACD94048.1"
FT                   /translation="MNLDIFLQKSSNIFAENRLLKFVVVALGIAVVINTAGLFSALNSQ
FT                   RVILVPPTINSKISVSGDKASDEYLKEFTRYILSLALTYNPVNVRSQFSELLAVYDPAE
FT                   FQASRKELYELADKIENTKASSAFYIHSIINDAEKRRLVVTGTKKTYMVDQKAEDVLKV
FT                   YLIEYRFENGKFVLVRLYEKPAQGENKGA"
FT   gene            complement(297200..297466)
FT                   /locus_tag="Glov_0321"
FT   CDS_pept        complement(297200..297466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0321"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ppd:Ppro_0258 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94049"
FT                   /db_xref="GOA:B3EB65"
FT                   /db_xref="InterPro:IPR009838"
FT                   /db_xref="UniProtKB/TrEMBL:B3EB65"
FT                   /protein_id="ACD94049.1"
FT                   /translation="MTRKFPQYLTQPFQVLWFEPDDLAIMTASFIFAQQFGGYLWLTMI
FT                   IVPWAYSRFKRQYPRGFLRHILYFIGLAPMKGYPQFFERDFLE"
FT   gene            complement(297526..297825)
FT                   /locus_tag="Glov_0322"
FT   CDS_pept        complement(297526..297825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0322"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ppd:Ppro_0259 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94050"
FT                   /db_xref="GOA:B3E1F8"
FT                   /db_xref="UniProtKB/TrEMBL:B3E1F8"
FT                   /protein_id="ACD94050.1"
FT                   /translation="MHKRKMLLMSLVAMIVTLAASQAMALVAPVAGSFGFEAYDFFITD
FT                   ILKGPFGAIAGVLAIIAGVVVMIQQKLVPAVLCILGGVLVINSDKIVTSLGMII"
FT   sig_peptide     complement(297748..297825)
FT                   /locus_tag="Glov_0322"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.985 at
FT                   residue 26"
FT   gene            complement(297880..298632)
FT                   /locus_tag="Glov_0323"
FT   CDS_pept        complement(297880..298632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0323"
FT                   /product="protein-disulfide isomerase"
FT                   /note="KEGG: ppd:Ppro_0260 protein-disulfide isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94051"
FT                   /db_xref="GOA:B3E1F9"
FT                   /db_xref="InterPro:IPR009094"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR018950"
FT                   /db_xref="InterPro:IPR033954"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B3E1F9"
FT                   /protein_id="ACD94051.1"
FT                   /translation="MKTANNKKLMVGGLMMFIVTAAGFSMANDNLRTEKETLMKTFPNM
FT                   KLDGFRESPLKGLYEITAGEQVFYFSPEGYLFFGEIWTKDGKNLTAEMREKVVAERINS
FT                   LPLDKALKIGNGPKKVIEFTDPDCPYCRKVDNFLSKRTDVTRYVYFVPLRRIHPDAEKK
FT                   ARYILSQSDRDKAFHEVFEGVLDGKPISIVDGAQQQQLEEMEKIAAGLGVRGTPALWIE
FT                   GAHVNGADIQRITGLLDKGKEVSKPQTH"
FT   sig_peptide     complement(298549..298632)
FT                   /locus_tag="Glov_0323"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 28"
FT   gene            complement(298629..299234)
FT                   /locus_tag="Glov_0324"
FT   CDS_pept        complement(298629..299234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0324"
FT                   /product="OmpA/MotB domain protein"
FT                   /note="PFAM: OmpA/MotB domain protein; KEGG: ppd:Ppro_0261
FT                   OmpA/MotB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94052"
FT                   /db_xref="GOA:B3E1G0"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:B3E1G0"
FT                   /protein_id="ACD94052.1"
FT                   /translation="MLAKFMTTASLVFLIPLSSFASEIRQRPFAYSFDAASAQSGDTFV
FT                   VCSDCPDNKLTILPAIAKLAVRMSDPMTIQPPATQPDVVTVTPRNELPEIKGLLGTVHF
FT                   QLNSSRLSQFEQGNLEKISRDIPAGNAVDVTGYTCTIGTDDYNKKLSFSRAEAVATVLK
FT                   AKGVHIGTIEGKGKCCPASQDKQQNRRVEIIGIRKEEM"
FT   sig_peptide     complement(299169..299234)
FT                   /locus_tag="Glov_0324"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 22"
FT   gene            complement(299514..300806)
FT                   /locus_tag="Glov_0325"
FT   CDS_pept        complement(299514..300806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0325"
FT                   /product="HipA domain protein"
FT                   /note="PFAM: HipA domain protein; KEGG: ppd:Ppro_0263 HipA
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94053"
FT                   /db_xref="InterPro:IPR012893"
FT                   /db_xref="InterPro:IPR017508"
FT                   /db_xref="UniProtKB/TrEMBL:B3E1G1"
FT                   /protein_id="ACD94053.1"
FT                   /translation="MNSEYKELYVWIWLPGETDPVVAGMLTTVGTTYVFNYGKSYLQRD
FT                   NAISIYDAELPLRQGLLPLLSGLSIPGCLRDAAPDAWGRRVILNKKFGNKASGIDPAAL
FT                   DELSYLIESGSDRIGALDFQLSPTQYEPRYASGAPIEELIEATERVEKGIPLTPELAQA
FT                   LQHGTSIGGARPKALIESDSRKFIAKFSTSTDLYSVVKAEYVAMRLAAMAGIDVAPVSL
FT                   ERAAGKDVLLVDRFDRKATANGWQRNSLVSALTMLTLDEMMARYASYETLAEIIRSKFR
FT                   NAPGTLRELFSRIVFNILVGNTDDHARNHAAFWDGQMLTLTPAYDICPQARHGQIATQA
FT                   MLVMGDDRSSRITTCIAAAPQFLLTEDEAVNIIAKQIQCIEQNWANVCDDASLSEVDRN
FT                   LLWGNQILNPYVFEGLEPGPMKDLARRHERG"
FT   gene            complement(300796..301134)
FT                   /locus_tag="Glov_0326"
FT   CDS_pept        complement(300796..301134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0326"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   ppd:Ppro_0264 transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94054"
FT                   /db_xref="GOA:B3E1G2"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B3E1G2"
FT                   /protein_id="ACD94054.1"
FT                   /translation="MASPVNRTYLRQTRDAAELLGKLIRLGRKERKMTEEDLSGRAGIS
FT                   RRTLQKIERGDPKCEIGLVFEVANLVGVNLFGDEGNANISRNISRVDDKLALLPQLVRS
FT                   SMKVNDEF"
FT   gene            complement(301277..301594)
FT                   /locus_tag="Glov_0327"
FT   CDS_pept        complement(301277..301594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0327"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ppd:Ppro_0265 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94055"
FT                   /db_xref="UniProtKB/TrEMBL:B3E1G3"
FT                   /protein_id="ACD94055.1"
FT                   /translation="MAQFTLKIKTYDPDIVNAFARLRKSRKQSAYTHEALKYFLASEQG
FT                   MQVMDLMSRETPPTRTKTQIAMEQPRELLPKPAAIVERRIIPSGEVTDDYCSSVLGKIL
FT                   E"
FT   gene            complement(301604..302485)
FT                   /locus_tag="Glov_0328"
FT   CDS_pept        complement(301604..302485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0328"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ppd:Ppro_0266 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94056"
FT                   /db_xref="InterPro:IPR042051"
FT                   /db_xref="UniProtKB/TrEMBL:B3E1G4"
FT                   /protein_id="ACD94056.1"
FT                   /translation="MGVLVCDLGFSSAKWMYEDRKGRIISAFRYDGENLLLGEEALLSS
FT                   GSSYLKTMEELVRFYPEFVGHCFKAARAEGIVTLAVGLPYSYWQDQNKPGGAVPALAKA
FT                   LTGALVTDVAIFPQGLGGLRDYLDNVEERPEGNVLGIDIGFNTIIFTLFSPQKRQIIYG
FT                   KTLNKRGVHQMATSYLLPRIKDLAPSGTFTPVEIAFLIEKGYLQYGFERHDVRREISDA
FT                   GVAYIEHIIKDVQGELQAHVGMHADFDRVLLFGGGAALLKDGFPAKNIEVIVLPVPEFA
FT                   NARGFRSLAGGM"
FT   gene            complement(302701..303297)
FT                   /locus_tag="Glov_0329"
FT   CDS_pept        complement(302701..303297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0329"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ppd:Ppro_0267 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94057"
FT                   /db_xref="UniProtKB/TrEMBL:B3E1G5"
FT                   /protein_id="ACD94057.1"
FT                   /translation="MRVENLEEKLNSRIVEAFTSGLSVIEITRTLNKNSAEHIHDLLRG
FT                   TGDIDTLPKEGLRRSYGIDVKWESVLRKKGYSFPRWCTGWGFDPVKAARELAQGEQGDV
FT                   HEALKRDFPAVYARMFGEDPPQRVLSTRIHDSHPSVTIVWHPDRNAYVAEMIGNPSINA
FT                   GGIDLEHALQRFLVALRFDEQIKRLELMIAQIQNQ"
FT   gene            complement(303386..303847)
FT                   /locus_tag="Glov_0330"
FT   CDS_pept        complement(303386..303847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0330"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ppd:Ppro_0268 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94058"
FT                   /db_xref="UniProtKB/TrEMBL:B3E1G6"
FT                   /protein_id="ACD94058.1"
FT                   /translation="MKRNAAITKFKPLSQKVLRRLAEDRIIEFPLTDSNQLLLSALCRV
FT                   WTDEWYVAQMNKTFKPDKRAVMLAFPNFGKIERYILSNYLNLKPGMKLRARDMATRIRQ
FT                   HFKIEYPHFKIHRVRQAAYNLRRYSRSGSRKHTLIQLAILEGNHSNFWE"
FT   gene            complement(303903..304547)
FT                   /locus_tag="Glov_0331"
FT   CDS_pept        complement(303903..304547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0331"
FT                   /product="putative RNA polymerase, sigma 70 family subunit"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: sigma-70 region 4 domain protein; KEGG:
FT                   ppd:Ppro_0269 sigma-70 region 4 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94059"
FT                   /db_xref="GOA:B3E1G7"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B3E1G7"
FT                   /protein_id="ACD94059.1"
FT                   /translation="MDFFKAMQWVQDNEPTIKSKIRQYRKFTPYDMCDFLQEAYEAALV
FT                   AVLRSQEKNIPFEAAFWTTFRNKISVLTPDPNFTHGSNSIPSHICYGDIEAVEQTSHRS
FT                   EEGADIEAIFEAISHHLTARERETLSLSLGVAEQGKLTTHEIADLYGCSDFNVRDTLKR
FT                   AFRRIKQLADNGTIVVDRMRLLTQQHQEIMSGCVAIQDFTPLGYSSRSPPS"
FT   gene            complement(304694..305023)
FT                   /locus_tag="Glov_0332"
FT   CDS_pept        complement(304694..305023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0332"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ppd:Ppro_0270 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94060"
FT                   /db_xref="UniProtKB/TrEMBL:B3E1G8"
FT                   /protein_id="ACD94060.1"
FT                   /translation="MNCPVPDDAVTIVITYLRQQGLTITQAGDAYRLVEGLPNINVVIK
FT                   AFRDQAISIAEDGTIHLFGIYLPSGWDTVRIRRKVEDHLRKVSSTEEIIRIASCLGVRL
FT                   SEPVR"
FT   gene            complement(305287..306126)
FT                   /locus_tag="Glov_0333"
FT   CDS_pept        complement(305287..306126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0333"
FT                   /product="TrfA family protein"
FT                   /note="PFAM: TrfA family protein; KEGG: ppd:Ppro_0271 TrfA
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94061"
FT                   /db_xref="InterPro:IPR010751"
FT                   /db_xref="UniProtKB/TrEMBL:B3E1G9"
FT                   /protein_id="ACD94061.1"
FT                   /translation="MQHNRLQHRASSVDDRSSVDSFERILESLAARPKYLPEWPDTQRA
FT                   MPNEILRSALFNCRNRNQARLFMKDAEIAVIGDGQVIYRGEELRQDDELVWLHLMHLAK
FT                   KTRLGDCIDFTPYSFIKMLGWPIKGQSYDRLRVCLSRMQATAIRFQSKRLDSFISVSLI
FT                   LKFRSRNDNNETLSRWEVWVGEEMRLLFDEEFLTRVNWETRRALPDGIASKLFGYWSSH
FT                   RKPFPVKTETLIKLCGSEMELRHFRIELRKALDVLVKVSFLESWEFREDLVSVTRRH"
FT   gene            complement(306314..306436)
FT                   /locus_tag="Glov_0334"
FT   CDS_pept        complement(306314..306436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0334"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94062"
FT                   /db_xref="GOA:B3E1H0"
FT                   /db_xref="UniProtKB/TrEMBL:B3E1H0"
FT                   /protein_id="ACD94062.1"
FT                   /translation="MHFGPIDDICKRFIVYMKHTTVIYSSFIAYVFIIFIKMFS"
FT   gene            306642..307334
FT                   /locus_tag="Glov_0335"
FT   CDS_pept        306642..307334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0335"
FT                   /product="putative phage repressor"
FT                   /note="PFAM: CI repressor; peptidase S24 and S26 domain
FT                   protein; KEGG: ppd:Ppro_0272 putative phage repressor"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94063"
FT                   /db_xref="GOA:B3E1H1"
FT                   /db_xref="InterPro:IPR010744"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019756"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/TrEMBL:B3E1H1"
FT                   /protein_id="ACD94063.1"
FT                   /translation="MSSQNLQNDDNLIETIIEKLKKALDLKNDTDVAKALESDPRLLGT
FT                   WKKRGTVPYDKIIKLCIRHNINLQWIFSDDSSLPTVCRDNGLVSEADGYVQVPRYEVKA
FT                   SAGGGAIIHSEQIVDHLYFKTEWVKNVLGIPRDFLALISVQGDSMEPTLSNGDLILIDV
FT                   RTSKVEDGAIYVVQYDDVLLVKRLQKKYDGSVVIRSDNTLYEPEILHGDEALNLKIVGR
FT                   VVWAGGVI"
FT   gene            307349..308851
FT                   /locus_tag="Glov_0336"
FT   CDS_pept        307349..308851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0336"
FT                   /product="Resolvase domain"
FT                   /note="PFAM: Resolvase domain; Recombinase; KEGG:
FT                   ppd:Ppro_0273 resolvase, N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94064"
FT                   /db_xref="GOA:B3E1H2"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR011109"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="InterPro:IPR038109"
FT                   /db_xref="UniProtKB/TrEMBL:B3E1H2"
FT                   /protein_id="ACD94064.1"
FT                   /translation="MNVGIWIRVSTEDQARGESPKNHEARARMYAELKRWNIVDLYDLS
FT                   GVSGKDVLDNPEAKRMLDDVAAGRIQALIFSKLARLARNTKQLLEISDYFQKHDAALVS
FT                   LEESIDTSSPAGRLLYTVIGALAQWEREEISARVAASIPIRAKLGKNTGGKGAFGYHWI
FT                   DGKIVPNPDEAPVVKRAYQIFLETGKLLTTCNQLKDEGLYSRSKKVYRPTSLKRLLSDT
FT                   IYKGIRRANYAKSLGNKKNWVLKPESDWVYTNVQPLVSEEDWDAANKIFEETARRYTSF
FT                   KSVPKVGRFLFSGILKCQCGEKLYVAPYPSMKIPRYACKKCGMRINEDIIEENFQNALK
FT                   EVVVAPEQLGANEDLENELVEKQERLELLKKEQKEVNGKVDVLIDLYGKQVLDQNGFKE
FT                   RYDPIKIRLDNITLEIPRLQAEIDFIKTNEIGKSYVIERATTLASLWPSLSYEARQQVV
FT                   KELVERIDVGEDSLHFVFFYIPSFAPVEKGSHISRDSWLSPT"
FT   gene            complement(308706..309878)
FT                   /locus_tag="Glov_0337"
FT   CDS_pept        complement(308706..309878)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0337"
FT                   /product="Mg chelatase, subunit ChlI"
FT                   /note="KEGG: gsu:GSU0489 Mg chelatase-related protein;
FT                   TIGRFAM: Mg chelatase, subunit ChlI; PFAM: magnesium
FT                   chelatase ChlI subunit; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94065"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3E1H3"
FT                   /protein_id="ACD94065.1"
FT                   /translation="MLAKVLSATVVGIDAILVDVEVDIAQGLPQFSTVGLPDGAVKESK
FT                   DRVKAALKNSGYDFPPRRITANLAPADLKKEGSAFDLPISIGILTATGTITGDRVNRYI
FT                   LLGELSLDGSLKPVRGALPVAVAARKAGLAGLILPLENGSEAAVVEGVDVLPARTLAEV
FT                   VQFLRGEAAIPPKQVDLQQLFSLKDEHGEDFCEVRGQDHAKRAIEVAAAGSHNLLMIGP
FT                   PGSGKTMLARRIPSILPALGFDEALETTAVFSVSGMLENGTALVTQRPFRAPHHTISDV
FT                   GLIGGGTSPKPGEVSLAHNGLLFLDELPEFKKNALEVLRQPLEDGRVTISRALQSLTYP
FT                   SRFMLVTAMNPWRCVNLSLLARTKGYKRKQNEGNPRRHQSSRQVLSRLAA"
FT   gene            complement(309880..310683)
FT                   /locus_tag="Glov_0338"
FT   CDS_pept        complement(309880..310683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0338"
FT                   /product="protein of unknown function DUF152"
FT                   /note="PFAM: protein of unknown function DUF152; KEGG:
FT                   ppd:Ppro_0281 protein of unknown function DUF152"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94066"
FT                   /db_xref="InterPro:IPR003730"
FT                   /db_xref="InterPro:IPR011324"
FT                   /db_xref="InterPro:IPR038371"
FT                   /db_xref="UniProtKB/TrEMBL:B3E1H4"
FT                   /protein_id="ACD94066.1"
FT                   /translation="METTRIGRIHYLAPSFETTAPATIQGFTTRHEGISRPPYNSLNLG
FT                   MNTDDSPHNVEGNRSLLARAFGIPQERLVTVRQNHGTDILVIDAPNDDFSHFTALEADA
FT                   IITNQPGVMIGVTVADCVPLLLFDPAKKVIAAVHAGWQGTAARIAAQAAEGMKQVFGSR
FT                   PRDIQAAIGPCINPCCYEVDQPVKDGFKNQAELWNAVAEPAGNGKWRLDLALANRMQLE
FT                   DAGLVPGSIQTSGNCVCCQKELFFSYRRDDGETGRQMGFIMLKEA"
FT   gene            complement(310701..311321)
FT                   /locus_tag="Glov_0339"
FT   CDS_pept        complement(310701..311321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0339"
FT                   /product="SNARE associated Golgi protein"
FT                   /note="PFAM: SNARE associated Golgi protein; KEGG:
FT                   ppd:Ppro_0282 DedA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94067"
FT                   /db_xref="GOA:B3E1H5"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:B3E1H5"
FT                   /protein_id="ACD94067.1"
FT                   /translation="MIHELISWLLETVGHLGYPGIFLLMAMESSIIPVPSELVMPPAGY
FT                   LIHQGRMAWLPAILAGTFGSLAGAYANYYAAHYLGRPLILKYGRYVLIPPDKFERVESF
FT                   FLRHGEISTFIGRLLPVIRHLISIPAGVAGMNHLRFTLYTLLGAGIWCSILTWIGYAIG
FT                   QNQELVMAWSHRALAWVILASCGLVAGYIWWQRRRQTLNRNKP"
FT   gene            311406..311843
FT                   /locus_tag="Glov_0340"
FT   CDS_pept        311406..311843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0340"
FT                   /product="lipoprotein, putative"
FT                   /note="KEGG: ppd:Ppro_0284 lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94068"
FT                   /db_xref="UniProtKB/TrEMBL:B3E1H6"
FT                   /protein_id="ACD94068.1"
FT                   /translation="MSIRFCVLLLLLPVLFGGCASFRAKNRQDACEKMIKDYNRMIRWQ
FT                   EAEKAGIAFVDAKQRPSFDKGAEALRRRGVTVADYRILAKECLVEKKKAESTVEFDYFV
FT                   MPNNRLKTVTDHQSWIFIEENPAEPELKEGWRLVSPLPEFK"
FT   sig_peptide     311406..311486
FT                   /locus_tag="Glov_0340"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.820) with cleavage site probability 0.533 at
FT                   residue 27"
FT   gene            311852..312805
FT                   /locus_tag="Glov_0341"
FT   CDS_pept        311852..312805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0341"
FT                   /product="tyrosine recombinase XerC"
FT                   /note="TIGRFAM: tyrosine recombinase XerC; PFAM: integrase
FT                   family protein; integrase domain protein SAM domain
FT                   protein; KEGG: ppd:Ppro_0285 tyrosine recombinase XerC"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94069"
FT                   /db_xref="GOA:B3E1H7"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3E1H7"
FT                   /protein_id="ACD94069.1"
FT                   /translation="MDELAHQVARFLEFLATQRSASPHTIAAYRNDLNGFSSFVRSERG
FT                   NTVSTKTVDHLLLRLYLASLNGGLDKQQRAGYAKSSIGRKLAAVRAFFGWLVRTRQLEV
FT                   NPAELIATPKREQRLPFHLNIDQTVTLIEAPGHTGQEQPTFARDTAILELLYSSGLRVS
FT                   ELTGLAVADLDRAAGMVRVQGKGGKERIVPVGSAALEALEQYLAGRGQLADDAPLFLGC
FT                   RGARINRRTVAQLVKRWASGIPAFRSISPHTLRHTFATHMLEGGADLRSIQELLGHSSL
FT                   STTQKYTHVGLDRLLEVYDKAHPRARETDQQNGESA"
FT   gene            complement(312845..313519)
FT                   /locus_tag="Glov_0342"
FT   CDS_pept        complement(312845..313519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0342"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gsu:GSU2640 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94070"
FT                   /db_xref="UniProtKB/TrEMBL:B3E1H8"
FT                   /protein_id="ACD94070.1"
FT                   /translation="MQTILQQITAIDGVIGTSLYNEQGKILAAACPLILDEKHLSTAAG
FT                   TVLDCLHALQIPQNLVAMDLRFSEGRLMVRPLTGAYISVLCSKNVNMSMVTITLNLALR
FT                   KLEQMLPKPGATPAAEPVAASGHDGMALRIAHLQQGDVSSSFDQLGMVAVSQATAKHIS
FT                   DFFGKTSKKMKISTEAGGGGVFPVMIINDVEMQYENALVIGPGIERKLKVEEGARVTIE
FT                   LA"
FT   gene            complement(313526..314266)
FT                   /locus_tag="Glov_0343"
FT   CDS_pept        complement(313526..314266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0343"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gsu:GSU2641 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94071"
FT                   /db_xref="InterPro:IPR025497"
FT                   /db_xref="UniProtKB/TrEMBL:B3E1H9"
FT                   /protein_id="ACD94071.1"
FT                   /translation="MAEAVSGFQGEIAGLSLADVIQIKGHNRYSGCITVEHLDHRGAIY
FT                   FVDGEIIHAEQASFSGEDAIYEILKWPGGNFSLAPEMTTNVCTIHCSLNFLLLEAHRRM
FT                   DEENNMPEESFADVIETSERRKEPRPVDPASPQRTMSAAAARVMQIDAVTYAVLLDKQG
FT                   HPVQDDSMEAEALAAKALFLAQSGNKLGDFLGLGELKSAAVQTQHFDLLMYDSKQHYLG
FT                   IAVATGNKLDAVEAEIRAALVPGR"
FT   gene            314453..315430
FT                   /locus_tag="Glov_0344"
FT   CDS_pept        314453..315430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0344"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG:
FT                   pca:Pcar_2179 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94072"
FT                   /db_xref="GOA:B3E1I0"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:B3E1I0"
FT                   /protein_id="ACD94072.1"
FT                   /translation="MTIRLHANATTTPRIRRYIQQSSKTDKGLAKELGISLDTVRRWRK
FT                   RSEVHDHSHTPHRLPTTLNEAQEAVVIELRRSLLLPLDDLLVVTREFIHPEASRSALDR
FT                   LLRRHGVSRLADLIPKEDETQAKPKTFKSYEPGFVHVDIKYLPQMPDETSRRYLFVAID
FT                   RASRWVYLELRKSKSAQAAKGFLERLVAKAPFKIHKMLTDNDKAFTDRFSTAGERKPTG
FT                   NHLFDKACLKHNIEHRLIPPRHPQTNGMVERFNGRISDVLATTRFDSAADLEATMLRYA
FT                   HLYNQHIPQRALGHKTPVEALKSWQKSKPDLFHKQVRNHPGPNT"
FT   gene            complement(315525..317120)
FT                   /locus_tag="Glov_0345"
FT   CDS_pept        complement(315525..317120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0345"
FT                   /product="Acetyl-CoA hydrolase"
FT                   /EC_number="3.1.2.1"
FT                   /note="PFAM: acetyl-CoA hydrolase/transferase; KEGG:
FT                   gur:Gura_4029 acetyl-CoA hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94073"
FT                   /db_xref="GOA:B3E1I1"
FT                   /db_xref="InterPro:IPR003702"
FT                   /db_xref="InterPro:IPR026888"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR038460"
FT                   /db_xref="UniProtKB/TrEMBL:B3E1I1"
FT                   /protein_id="ACD94073.1"
FT                   /translation="MSEYGTLQDRVQCKSLLDKVKTPEQCIEYFKDGMNLGWSGFTPAG
FT                   YPKVVPIALAEHVEKNNLQGKLKFNLFIGASVGAETENRWAINDMIDRRWPYQTGKDIA
FT                   AGINAGRIRMGDKHLSLFAQDLGYGFYTKDTETGKLDLAIIEVSEILEDGSLVPTSSCG
FT                   VIPEILMICDKIIIEVNTGQPSFKGIHDLLTPLTPPNRQVFNITRADSRIGSISIPCDP
FT                   SKVIAVVESKLRDQGRAFAEQDDTSEAIANHIIDFFTHEVKAGRLPKNLLPIQSGVGSI
FT                   ANAVIGGLAKGPFKNLTVYTEVLQDTMLDLFDSGKLDAASSCSLSLSADPGFPRFFANM
FT                   DKYFDKITLRPLSISNAPEPIRRLGCIAMNTPVEIDIYAHANSTLVGGTRMINGLGGSG
FT                   DFLRNGFLKMMHTPSSRPSKTDPTGISCVVPHCSHIDHTEHDLDCVITEQGLADLRGVA
FT                   PKERARRIIEKCAHPDYKAQLTEYLNIAEADCLKRKVGHEPQLWDRAFKMHLNLEKNGT
FT                   MKLKNWDVKIDLCE"
FT   gene            complement(317317..318105)
FT                   /locus_tag="Glov_0346"
FT   CDS_pept        complement(317317..318105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0346"
FT                   /product="tRNA pseudouridine synthase A"
FT                   /EC_number="5.4.99.12"
FT                   /note="KEGG: ppd:Ppro_3382 tRNA pseudouridine synthase A;
FT                   TIGRFAM: tRNA pseudouridine synthase A; PFAM: tRNA
FT                   pseudouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94074"
FT                   /db_xref="GOA:B3E1I2"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:B3E1I2"
FT                   /protein_id="ACD94074.1"
FT                   /translation="MRSLTPRLREKTAPFFMRTIKLIIQYDGTNYCGWQEQTNGPSIQE
FT                   TVELALAKILGQRVRVQSSGRTDAGVHAVAMPAVFRTESTIPLKAFVDGVNCHLPDDIA
FT                   IQSAVEVPTGFRAIGGARSKTYRYTIYNAPVRSPLNRRTSWHVREQLDLQAMQQAAAYF
FT                   VGEHDFAAFRGANCSAVTSRRRIDAVQINQSGPLITIDVTGGGFLKYMVRIMAGTLVDV
FT                   GRGRFAPEHVAGLLAEPDRQRGGVTAPPQGLSLLQVIYPG"
FT   gene            complement(318224..319324)
FT                   /locus_tag="Glov_0347"
FT   CDS_pept        complement(318224..319324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0347"
FT                   /product="aspartate-semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.11"
FT                   /note="KEGG: gsu:GSU2878 aspartate-semialdehyde
FT                   dehydrogenase; TIGRFAM: aspartate-semialdehyde
FT                   dehydrogenase; PFAM: Semialdehyde dehydrogenase NAD -
FT                   binding; Semialdehyde dehydrogenase dimerisation region"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94075"
FT                   /db_xref="GOA:B3E1I3"
FT                   /db_xref="InterPro:IPR000319"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR011534"
FT                   /db_xref="InterPro:IPR012080"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B3E1I3"
FT                   /protein_id="ACD94075.1"
FT                   /translation="MKVGIVGWRGMVGSVLMQRMQEENDFALGFEPVFFTTSQAGQPAP
FT                   MGAGTLKKADDIEELKKLDVIITCQGGDYTKAVHPELRKQGWNGYWIDAASTLRMEDNA
FT                   VIILDPVNRNVIDKALANGQKDFIGGNCTVSLMLMGLGGLFRAGLVEWISSMTYQAASG
FT                   AGAPNMRELLSQMGVLQGVVAKELKDAGSAILEIDKKVTQTLRDGSMPTKEFGFPLAGN
FT                   VLPWIDREVEDGQSREELKGFQETNKILGTSAPIPVDGICVRVGAMRCHSQAITIKLNK
FT                   DLPLAEIEQLIANDNQWVKLIPNNKADTLAGLTPAAVSGTLTVPVGRVRKMKMGPQYVQ
FT                   AFTCGDQLLWGAAEPLRRMLRILLEK"
FT   gene            complement(319392..320483)
FT                   /locus_tag="Glov_0348"
FT   CDS_pept        complement(319392..320483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0348"
FT                   /product="3-isopropylmalate dehydrogenase"
FT                   /EC_number="1.1.1.85"
FT                   /note="KEGG: gsu:GSU2879 3-isopropylmalate dehydrogenase;
FT                   TIGRFAM: 3-isopropylmalate dehydrogenase; PFAM:
FT                   isocitrate/isopropylmalate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94076"
FT                   /db_xref="GOA:B3E1I4"
FT                   /db_xref="InterPro:IPR004429"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:B3E1I4"
FT                   /protein_id="ACD94076.1"
FT                   /translation="MAKTFKIAVLPGDGIGPEVMAEATRVLDVIGQKYNVTFEGTFANV
FT                   GGAGIDNEGKALPQTTIDICKDSDAILFGSVGGPKWESLPPDEQPERGALLPLRKIFGL
FT                   YANLRPAIIFPSLTGASSLKEEVIGGGFNVLVIRELTGGIYFSQPKGIEGEGRNRIGID
FT                   TMKYSVPEIERITHVAFQAARKRGKKVCSIDKANVLSSSVLWREVVIDIAKQYPDVELS
FT                   HMYVDNAAMQLVKWPKQFDVILCENMFGDILSDEAAMLTGSLGMLPSASLAEGSFGMYE
FT                   PSGGSAPDIAGQGIANPIAQILSAAMMLKFSCGMVEAADAIDTAVETVLDQGYRTRDIF
FT                   QNKSGEKLVNTKEMGDAIIAALA"
FT   gene            complement(320612..321778)
FT                   /locus_tag="Glov_0349"
FT   CDS_pept        complement(320612..321778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0349"
FT                   /product="Methionine adenosyltransferase"
FT                   /EC_number="2.5.1.6"
FT                   /note="PFAM: S-adenosylmethionine synthetase; KEGG:
FT                   ppd:Ppro_0044 S-adenosylmethionine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94077"
FT                   /db_xref="GOA:B3E1I5"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/TrEMBL:B3E1I5"
FT                   /protein_id="ACD94077.1"
FT                   /translation="MAEKFIFTSESVSEGHPDKMADQISDSILDAILAQDPKARVACET
FT                   MVTTGMAVIAGEITTTAVVNYAEIVRNTIKEIGYCGSETGFDYETCSVLVSLDRQSPDI
FT                   SQGVTEGEGMFKEQGAGDQGLMFGYACNETPELMPMPIQLSHQLVKRLADVRKSGLLKF
FT                   LRPDAKSQVSVEYDNGKPVRVNTVVISTQHTPDVTHETIVEGVMDEVIKKVIPAHLMDE
FT                   QTRFFINPTGRFVVGGPMGDCGLTGRKIIVDTYGGMGRHGGGAFSGKDPSKVDRSAAYM
FT                   GRYVAKNLVAAGLCERCEVQVAYAIGVAEPVSIMVNAFGTGVVSEHRLSELVREVFDMR
FT                   PRAITEQLDLLRPIYQKTAAYGHFGRELPEFTWEKTDKAEILKQKAGL"
FT   gene            complement(321847..322170)
FT                   /locus_tag="Glov_0350"
FT   CDS_pept        complement(321847..322170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0350"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gme:Gmet_0368 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94078"
FT                   /db_xref="GOA:B3E1I6"
FT                   /db_xref="UniProtKB/TrEMBL:B3E1I6"
FT                   /protein_id="ACD94078.1"
FT                   /translation="MSMDPLLLPLFVVNILLVLVDASVGYHLAPLLFQAGGGDPEAAES
FT                   GVGTVRKLLTGVVLLYMFFNCFAFFRYNGPLLLLVTALILFDLGGQLYIRHRSRNHADA
FT                   EDQ"
FT   gene            complement(322170..322934)
FT                   /locus_tag="Glov_0351"
FT   CDS_pept        complement(322170..322934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0351"
FT                   /product="protein of unknown function DUF169"
FT                   /note="PFAM: protein of unknown function DUF169; KEGG:
FT                   sth:STH972 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94079"
FT                   /db_xref="InterPro:IPR003748"
FT                   /db_xref="UniProtKB/TrEMBL:B3E1I7"
FT                   /protein_id="ACD94079.1"
FT                   /translation="MEQLGHFLATVKETVNPVTQPVGVTMVRDLALIAGKKIRVKGQRL
FT                   AVCQQIAYSRMYGWSTWADKQTAHCVLGAGCVGLITPPQRVLDGSVNNGIYQQDQAAAA
FT                   AMQQAMPRLAPDVQGLLTYPLARPVEGIIPDLVVVYVNSAQAMRFVQAFLFHQGGEFTM
FT                   KSSGDAGVCSRAVAQVALTGEPTVEIPCLGDRRFGMTQDHELCIGIPFSWLERTAEGLA
FT                   ATHKAGIRYPVPFQIPSGCDLPPDYITAEGDC"
FT   gene            complement(322970..323299)
FT                   /locus_tag="Glov_0352"
FT   CDS_pept        complement(322970..323299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0352"
FT                   /product="RNP-1 like RNA-binding protein"
FT                   /note="PFAM: RNP-1 like RNA-binding protein; KEGG:
FT                   gsu:GSU1324 RNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94080"
FT                   /db_xref="GOA:B3E1I8"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:B3E1I8"
FT                   /protein_id="ACD94080.1"
FT                   /translation="MAKELYVGHLPYEATADDLRRMFSVAGTVTSVHIITDPATGKSKG
FT                   CGYVRMADEAQLHEAIECLDGALMENRVITVSIANPQKAQTKPLTRGAGNTQPGSRRAR
FT                   ARQKQ"
FT   gene            complement(323446..323703)
FT                   /locus_tag="Glov_0353"
FT   CDS_pept        complement(323446..323703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0353"
FT                   /product="protein of unknown function UPF0153"
FT                   /note="PFAM: protein of unknown function UPF0153; KEGG:
FT                   ppd:Ppro_2988 protein of unknown function UPF0153"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94081"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="UniProtKB/TrEMBL:B3E1I9"
FT                   /protein_id="ACD94081.1"
FT                   /translation="MQCRAGCAACCIAPSISSAIPGMPAGKPAGIRCVQLTPEGRCRIF
FT                   DRPERPAVCSSLRPSSEMCGQNAGEALQRLQQWEQQTAPA"
FT   sig_peptide     complement(323644..323703)
FT                   /locus_tag="Glov_0353"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.927) with cleavage site probability 0.762 at
FT                   residue 20"
FT   gene            complement(323708..324019)
FT                   /locus_tag="Glov_0354"
FT   CDS_pept        complement(323708..324019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0354"
FT                   /product="Rhodanese domain protein"
FT                   /note="PFAM: Rhodanese domain protein; KEGG: gsu:GSU0795
FT                   rhodanese-like domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94082"
FT                   /db_xref="GOA:B3E1J0"
FT                   /db_xref="InterPro:IPR001307"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:B3E1J0"
FT                   /protein_id="ACD94082.1"
FT                   /translation="MNAKELQKQLKSKTPPTVVDVRSAMEYRLGHIPGALLLPFWKVLL
FT                   RMTGSLPKDKQAQLVLYCESGARAEMVGSMLAKRGYSRIAYLDGDMPGWRQAGLPLEK"
FT   gene            complement(324043..324810)
FT                   /locus_tag="Glov_0355"
FT   CDS_pept        complement(324043..324810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0355"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rsq:Rsph17025_0127 RecA-family ATPase-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94083"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3E1J1"
FT                   /protein_id="ACD94083.1"
FT                   /translation="MTIASNLKIEENPFAAKLGIKAWQEREFIKPKPEEYLVEDFIPAN
FT                   ALVSLQTNNVYGKTTLAMQLAMSVAFDLPFLEQFRCLQSGRVLYINARDTDEDCHRRFK
FT                   RLTREWSKSVPELGERVDQNLDNFSHISLFDECYGVSPHLIDISGSMTKTYAYLHQFSS
FT                   YFKCKLIVLDPVEDFFPDNLKNISELYLKLRQLPAAVLLVVGDRNRYDAFNKVEVSMSL
FT                   LENGLRVQSDYLGHRDIGLSMGAGIWFATTGRP"
FT   gene            complement(324888..326282)
FT                   /locus_tag="Glov_0356"
FT   CDS_pept        complement(324888..326282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0356"
FT                   /product="adenosylhomocysteinase"
FT                   /EC_number="3.3.1.1"
FT                   /note="KEGG: tbd:Tbd_2519 S-adenosyl-L-homocysteine
FT                   hydrolase; TIGRFAM: adenosylhomocysteinase; PFAM:
FT                   S-adenosyl-L-homocysteine hydrolase; D-isomer specific
FT                   2-hydroxyacid dehydrogenase NAD-binding;
FT                   S-adenosyl-L-homocysteine hydrolase, NAD binding"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94084"
FT                   /db_xref="GOA:B3E1J2"
FT                   /db_xref="InterPro:IPR000043"
FT                   /db_xref="InterPro:IPR015878"
FT                   /db_xref="InterPro:IPR020082"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR042172"
FT                   /db_xref="UniProtKB/TrEMBL:B3E1J2"
FT                   /protein_id="ACD94084.1"
FT                   /translation="MGTDYIVADLGLADWGRKEIKIAETEMPGLMAIREEYAASQPLKG
FT                   ARITGSLHMTIQTAVLIETLTALGAQVRWASCNIFSTQDHAAAAIAASGVPVFAVKGES
FT                   LTDYWDYTHKIFEWADGGFSNMILDDGGDATLLLHLGSKAEKDLSVLNNPGSEEETILF
FT                   AAIKAKLAVDPTWYSVRLAQIKGVTEETTTGVHRLYQMHERGELAFPAINVNDSVTKSK
FT                   FDNLYGCRESLVDGIKRATDVMVAGKVALVCGYGDVGKGSAQALRALSAQVWVTEIDPI
FT                   CALQAAMEGYRVVTMEYAADKADIFVTCTGNYHVITHEHLLKMKDQAIVCNIGHFDNEI
FT                   EVAALEQYQWEEIKPQVDHIILPSGNRIILLAKGRLVNLGCATGHPSYVMSSSFANQTI
FT                   AQIEIFCNPGKYPTGVYVLPKHLDEKVARLQLKKLNAQLSVLTKEQADYIGVPVEGPYK
FT                   AEHYRY"
FT   gene            complement(326285..327217)
FT                   /locus_tag="Glov_0357"
FT   CDS_pept        complement(326285..327217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0357"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: regulatory protein ArsR; Methionine
FT                   biosynthesis MetW protein; Methyltransferase type 11;
FT                   Methyltransferase type 12; KEGG: gur:Gura_3006
FT                   methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94085"
FT                   /db_xref="GOA:B3E1J3"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR026669"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B3E1J3"
FT                   /protein_id="ACD94085.1"
FT                   /translation="MLLDVLKALADASRLRLVAILLRGEFTVQELTTILEMGQSRISRH
FT                   LKILTEVGVLSVKRQGTWSYYRAGNDSPFFHAIRPALEQELENLPERERDLAAIAGVLE
FT                   ARRQRSRQFFDQHARQWDDLARTLLPVPDYREQLLALIPQGSQVVEIGLGTGGLLPALT
FT                   EKACSVIGVDHSPAMLDEARRRLTASGIEGVDLRLGEMNHLPLPDRSVDCAILNMVLHH
FT                   AADPPSVLAEIRRVLTGGGSLLLADLARHERELAREQLADQWLGFEEEELQHWLKETDF
FT                   GTVAIAQIPPLQGQEAVLLIQAYTTTKGE"
FT   gene            complement(327341..328402)
FT                   /locus_tag="Glov_0358"
FT   CDS_pept        complement(327341..328402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0358"
FT                   /product="2-nitropropane dioxygenase NPD"
FT                   /note="PFAM: 2-nitropropane dioxygenase NPD; KEGG:
FT                   gur:Gura_3007 2-nitropropane dioxygenase, NPD"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94086"
FT                   /db_xref="GOA:B3E1J4"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B3E1J4"
FT                   /protein_id="ACD94086.1"
FT                   /translation="MTKELKIGKHTARYPVIQGGMGVRISGGNLAGHVAKCGGIGLVAA
FT                   AGIALNSDHYTGTNYFQAETQAFQTELRKARAIAPDGIIGVNVMVALSDFEPLVKSAIE
FT                   AGAQVIVCGAGLPLSLPELTAHAPDVALVPIASSVRAAQLIARTWEKRYHRLPDAVVVE
FT                   DPDTAGGHLGEKMENIGTGEYDQYATVRGVKQFFRDEYHVEIPVIAAGGIWDRADLEHA
FT                   LAEGADGVQMASRFVCTEECDADMAFKQAYLDCKQEDIGLLMSPAGLPGRAILTNTPNI
FT                   RQYDLDHHTPCRMGCLKKCSYKESGERFCIVTALDRAQQGDVETGLVFCGTNAWKADKI
FT                   TTVQAIFDELFGD"
FT   gene            328557..329840
FT                   /locus_tag="Glov_0359"
FT   CDS_pept        328557..329840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0359"
FT                   /product="O-acetylhomoserine/O-acetylserine sulfhydrylase"
FT                   /EC_number="2.5.1.49"
FT                   /note="KEGG: gsu:GSU2425 O-acetyl-L-homoserine
FT                   sulfhydrylase; TIGRFAM: O-acetylhomoserine/O-acetylserine
FT                   sulfhydrylase; PFAM: Cys/Met metabolism
FT                   pyridoxal-phosphate-dependent protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94087"
FT                   /db_xref="GOA:B3E1J5"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006235"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B3E1J5"
FT                   /protein_id="ACD94087.1"
FT                   /translation="MDTNWKLETLAIQGGYEPKAGEARIVPIVQSTTFKYDDADYVAKL
FT                   FDLEVPGFFYTRLGNPTADAFEKKIAQMEGGVAALATSSGQAAITLAMLNICQAGQHIV
FT                   SASTLYGGTYNLFSSTLPKLGIEVTFVNPDAPAEEIAAAFRPTTRALYAETIGNPGMNV
FT                   LDFEKFASVAKAQQVPLVIDNTMATPYLCRPFELGANIVVHSATKYIDGHATSLGGVIV
FT                   DGGTFNWDNGKFPELVEPDASYHGMQYVKTFGPAAYIIKARVQLMRDLGATVAPMNAFL
FT                   FNLGLHTLPLRMQRHSENALALARHLEAHPAVSWACYPGLASHSSHGRAQKYLPKGASG
FT                   VLTFGIKGGAAAGKKFMEACKLIALVVHVGDARSCVLHPASTTHRQLSEEQQLSSGVSP
FT                   DLIRLSVGIEHIDDLIADVDQALAISQK"
FT   gene            329896..330741
FT                   /locus_tag="Glov_0360"
FT   CDS_pept        329896..330741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0360"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ppd:Ppro_3411 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94088"
FT                   /db_xref="GOA:B3E1J6"
FT                   /db_xref="InterPro:IPR007354"
FT                   /db_xref="UniProtKB/TrEMBL:B3E1J6"
FT                   /protein_id="ACD94088.1"
FT                   /translation="MLDIAIGTFTMRPYVFAFFAAFLLACVPHVGWKKTLSFTGLGYLI
FT                   AFISEKLSITTGIPYGWYYYIDSTKTRELWIWGVPFFDSLSYVFLTYCSYTTALLILSP
FT                   LATRGADLITLETRAIRRSWAALVLGAFLQTFLDIIIDPVALQGSRWFLGQIYGYREVG
FT                   VHFGVPLSNYIGWLLTSFVLVAVFQWVDRRQETETPRGIFPMPFRSLLGPILYLSVLLF
FT                   NWGVTLWIGEKLMALTGIFIFTLPIVLVVLLALQRVNRYREEELREHLKDYPWSPLGRW
FT                   "
FT   gene            complement(330790..331551)
FT                   /locus_tag="Glov_0361"
FT   CDS_pept        complement(330790..331551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0361"
FT                   /product="purine or other phosphorylase family 1"
FT                   /note="PFAM: purine or other phosphorylase family 1; KEGG:
FT                   gur:Gura_2964 purine or other phosphorylase, family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94089"
FT                   /db_xref="GOA:B3E1J7"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:B3E1J7"
FT                   /protein_id="ACD94089.1"
FT                   /translation="MDTVKHIGIIVAMPEERVALVKRLQQVKRRLMGGIPFYRGMLADR
FT                   LVTVVEGGMGTAAAALAAHQLIKADRPNLLLSAGFCGAVRPGAQVADLVLCKRLFTDNE
FT                   NGLNEVTLPGSELITARLSAELQHRGLRTWQGSFITTGRIVTKSACAGTLPDNLPTPVL
FT                   EMESAAVAQAATAAGIPFLGLRAISDDAAEELGFSLDELTDEQLRISIPRVLFTCLKKP
FT                   RIIPQLARLAANSGRAGKNLGLALQQILPML"
FT   gene            331648..331738
FT                   /locus_tag="Glov_R0001"
FT                   /note="tRNA-Ser1"
FT   tRNA            331648..331738
FT                   /locus_tag="Glov_R0001"
FT                   /product="tRNA-Ser"
FT   gene            331819..334185
FT                   /locus_tag="Glov_0362"
FT   CDS_pept        331819..334185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0362"
FT                   /product="fatty acid cistrans isomerase"
FT                   /note="PFAM: fatty acid cistrans isomerase; KEGG:
FT                   ppd:Ppro_2064 fatty acid cis/trans isomerase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94090"
FT                   /db_xref="GOA:B3E1J8"
FT                   /db_xref="InterPro:IPR010706"
FT                   /db_xref="UniProtKB/TrEMBL:B3E1J8"
FT                   /protein_id="ACD94090.1"
FT                   /translation="MRPARTLSRCAALLLTLVLAGCFAKPLPPVVVPLPTRQIDYQKEV
FT                   KPLLDKRCTVCHSCYNSPCQLKLDSFEGLDRGASKQAVYNGTRLHTMEPTRLFVDAQTT
FT                   GQWRTKGFSSVTGSTVSGNLNDSLMIQMLAHKIKNPKSSGDYHPEADDLTCAKDQDELG
FT                   SYLAKHPNRGMPFGFPPLRQDEFNLIAGWLVQGAKGPDAAQQQELTLPKAADARAVAQW
FT                   ETFLNQDGPKHGMTARYLYEHLFLAHLKFATGTSEFFELVRSRTPPGTPLELIPSVRPY
FT                   DDPGVARVYYRFRKIHSTIVHKTHMVVGLDDAYLKRIQELFIQPEWLQTPHLMGYEPQL
FT                   SANPFLVYEQIPPRSRYQFLLDNAKYIIMTFIHGPVCKGQIALNVIDDHFWVMFMDPAH
FT                   DLMVTYPGFVRLHSDTLRMPIERGSDMGIFSAVSDRYSKGALTFYQARQNFYAAHHYAG
FT                   LGYEAIWKGNRPADAPLLTVYRHFDNASVHKGALGNLPKTLWVIDYPLLERIYYALVAG
FT                   FDVYGNVAHQLSLRLYMDTLRMEGESYFLDFLPADKRQELMQSWYLGLDLKKVEYYPSP
FT                   RPARITFATNDPKREFVEQLVDKHLLPATGIAFDPINYLRAGASYPKLPEKLRSMGDYL
FT                   LAFRSLARPGMPFIAMINDYNANLAYLRIRLNNGKDLVHSVVINRWHDNVAFLFGEDGR
FT                   LDPARDDADFIPGLIGSYPNYFFDVAEYDLPDFFQLLSNFKGTPEDLARLKKYGINRAD
FT                   DRFWDSYDWFQKRFDQESPVNGGLLDLNRYYYQAD"
FT   sig_peptide     331819..331893
FT                   /locus_tag="Glov_0362"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 25"
FT   gene            complement(334196..336214)
FT                   /locus_tag="Glov_0363"
FT   CDS_pept        complement(334196..336214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0363"
FT                   /product="putative site-specific recombinase"
FT                   /note="KEGG: dar:Daro_0463 probable site-specific
FT                   recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94091"
FT                   /db_xref="GOA:B3E1J9"
FT                   /db_xref="InterPro:IPR011385"
FT                   /db_xref="UniProtKB/TrEMBL:B3E1J9"
FT                   /protein_id="ACD94091.1"
FT                   /translation="MQPPFEPLSNADVISRALEQLTVANDDPLPLLVQLFDAVRPGRSS
FT                   SDQALQRWHRMLQLLEIPRYHDGLRTALLTLFAQRRQISLYSESGLLPNTGFFSELHRK
FT                   LAHRLLPELADPAELRDCIRLLFHHPGDAAWLGAIPLEEQQAFWRLLTPPSPRMLEQIS
FT                   EACLVLSHRVCAMGLEPELLRVLPQLKTSRSPFLALHEELAWFTTEALRIEDETSPGEE
FT                   DKRHLLVLTGQCREVVRRAHQQATAVAGTSMSLTFLLTRLEQHLQRLELLVGVLAIRVQ
FT                   TVADGEVMERWSVFLADAVLGELRRNSLRQHFADLTGQVALLVTENAARTGEHYIASDR
FT                   KEWWGMLRAAAGAGVIIALLALMKIKGAGLHLPVLSQGLLNGLIYGGGFLLVHLLHFTI
FT                   ATKQPAMTAAAIAATVSQTRGRLRDQERLLELMVSTARSQFAAVLGNVGVAFPLALVIG
FT                   LVAGLLQYEPVTLKKACALAEEVNPFTTLSLFYAAIAGIWLFVTGLISGYIDNLSAHSQ
FT                   VGPRIARLPWLQRMSGSSGAGRIGSYISSNAGGLTGNLFFGLMLGVTPAVGLMLGLPLD
FT                   IRHIAFSAANIGYALITSGFMLQPSILLAAIGGVMLIGLVNLLVSFSLALWVALRSRGV
FT                   PFSSVRSLLSPLRRRLFNHPLDFLLPVEQRQAPRTPQ"
FT   gene            complement(336214..337830)
FT                   /locus_tag="Glov_0364"
FT   CDS_pept        complement(336214..337830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0364"
FT                   /product="MscS Mechanosensitive ion channel"
FT                   /note="PFAM: MscS Mechanosensitive ion channel; KEGG:
FT                   mms:mma_2431 mechanosensitive ion channel protein (MscS
FT                   family)"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94092"
FT                   /db_xref="GOA:B3E1K0"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:B3E1K0"
FT                   /protein_id="ACD94092.1"
FT                   /translation="MFHQLIRILLCICLFVSSLVAAHAAPPVSPATTQTSATVTVFNRP
FT                   VVEFRAPLLGVPVGERAQRASEVLRRMLATSSSGKVTLQPIPQGISIMLDGVLAFTMVP
FT                   EDVDPLKQESLEQAAKNAATALELVVRETREARDLKVLMRAAGFVLAATLAFLLLVWLL
FT                   HRARKWLTFRLASLAHTHAERLSVGGESLMNRERLLQLVRRAVTLVYWALALFLFYDWL
FT                   GFTLGRFPYTRPWGERLTQYLLDLIARFGGAIARTIPDLLVAVLIFLIAKFMIDLLKTV
FT                   FERVEQGKLEIAWLDRDTVSPTRRLISAGIWLFALVMAYPYLPGSGTEAFKGLSVLIGL
FT                   MVSLGASSLVGQAASGLILMYTRTIRAGEYVQISGHQGTVMELGLFTTRIRTGLGEELT
FT                   LPNALILGNVSRNYSRTVGDGFILETGVTIGYDTPWRQVHAMLIEAAGRTPGVQSEPAP
FT                   RVFQTALSDYYPEYRLACQVLRSGPTQRAEVLSALHGNIQDVFNEYGVQIMSPHYLSDP
FT                   PEAKIVPKEQWYQAPAQRAEN"
FT   sig_peptide     complement(337756..337830)
FT                   /locus_tag="Glov_0364"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.958 at
FT                   residue 25"
FT   gene            338166..339821
FT                   /locus_tag="Glov_0365"
FT   CDS_pept        338166..339821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0365"
FT                   /product="DNA polymerase III, subunits gamma and tau"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: ppd:Ppro_0301 DNA polymerase III, subunits
FT                   gamma and tau; TIGRFAM: DNA polymerase III, subunits gamma
FT                   and tau; PFAM: AAA ATPase central domain protein; SMART:
FT                   AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94093"
FT                   /db_xref="GOA:B3E1K1"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3E1K1"
FT                   /protein_id="ACD94093.1"
FT                   /translation="MSYEVLARKYRPQTFAGLTGQEHVSRTLQNAIDTGRVAHAFLFTG
FT                   ARGVGKTSTARILAKALNCEQGVTLEPCNVCPHCREITDGSSTDVFEIDGASNTGVDDV
FT                   RELRDNSRYLPSHSRYKIYIIDEVHMLSTNAFNALLKTLEEPPPHVKFIFATTEPHKLP
FT                   ITILSRCQRFDFKRVPLIKIVGRLREIADQEGIVINDAALALIARKGDGSMRDSITCFD
FT                   QVLAFCGNTVAVEDVATLVGVVDRRLLAELSSAVFAGDTQGALEGVRRVDAFGYNVRQF
FT                   TQELISHFRNLLVIRSVPKPGEILDLAEAELEELRQQAGEQSAADIQRRLTLLVKAESE
FT                   MAHASFPRLLLEMVLLKMATLQPVLPIHQLLDRIKHLETGVAQTTPELWAAPKQAAARP
FT                   VTPVRHEQPPVQQPAASAPQGGGGWERFVAFCLEQKPALGALLEHGSPLAYAPDRLEIG
FT                   FPEGSYFLNSLQDPDNKQAVDALAAQYMHQPTVVKIVSIAAVADGNSPCSLAEKKKHDE
FT                   EQRRESIQREVKEHPLVQEALRVLGGEIVEIKEL"
FT   gene            339873..340187
FT                   /locus_tag="Glov_0366"
FT   CDS_pept        339873..340187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0366"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   gme:Gmet_3421 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94094"
FT                   /db_xref="GOA:B3E1K2"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/TrEMBL:B3E1K2"
FT                   /protein_id="ACD94094.1"
FT                   /translation="MSKGLAGIMKQAQMIQQKMAKLQEEAALKEAEATAGGGAVTVVVN
FT                   GKNEIKALTIKPEAVDPNDVEMLQDLIIAAANEALKKVHEELSAEMSKITGGMSIPGLF
FT                   "
FT   gene            340321..340914
FT                   /locus_tag="Glov_0367"
FT   CDS_pept        340321..340914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0367"
FT                   /product="recombination protein RecR"
FT                   /note="KEGG: ppd:Ppro_0299 recombination protein RecR;
FT                   TIGRFAM: recombination protein RecR; PFAM: TOPRIM domain
FT                   protein; Zinc finger C4-type, RecR; SMART: Toprim sub
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94095"
FT                   /db_xref="GOA:B3E1K3"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3E1K3"
FT                   /protein_id="ACD94095.1"
FT                   /translation="MLQHAPTLTRLVGELKKLPGIGERTALRLAFHLLKSPQNLGSLAE
FT                   ALTQVQERVCACSVCFALTEQNPCPICSGGRDSSVICVVETSQDMLALERSNAYHGSYH
FT                   VLQGAISPLHGVNPDDLRIRELLMRIEQGKVEEVVIATNFTVEGETTALYLARQLKPLG
FT                   IRVTRLAHGIPLGSDIEFVDPATVQWAMKGRSEL"
FT   gene            340965..344546
FT                   /locus_tag="Glov_0368"
FT   CDS_pept        340965..344546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0368"
FT                   /product="pyruvate flavodoxin/ferredoxin oxidoreductase
FT                   domain protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; pyruvate ferredoxin/flavodoxin oxidoreductase;
FT                   pyruvate flavodoxin/ferredoxin oxidoreductase domain
FT                   protein; KEGG: gsu:GSU0097 pyruvate ferredoxin/flavodoxin
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94096"
FT                   /db_xref="GOA:B3E1K4"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR011895"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019456"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033412"
FT                   /db_xref="UniProtKB/TrEMBL:B3E1K4"
FT                   /protein_id="ACD94096.1"
FT                   /translation="MSKKMVTIDGNTAAAHVAHATNEVIAIYPITPSSVMGEISDAKSA
FT                   VGEKNIWGNVPSVVEMQSEGGAAGAVHGALQAGALTTTFTASQGLLLMIPNMFKIAGEL
FT                   TSTVFHVSARAIAAQALSIFGDHSDVMSCRSTGWAFLCSNNVQEVMDFALIAQSSTLRS
FT                   RVPFLHYFDGFRTSHEIQKVVELSFDEMRAMIDDKLVAEHKARGLNPDKPVMRGTAQNP
FT                   DVYFQGRETVNPFYPACEKIVQEEMDKFGKLTGRKYKLVDYVGAKDAERVVVVMGSGAD
FT                   VVQDTVENLVKKGEKVGVVKIRLYRPFPLDAFIKALPKSVKKIAVLDRTKEPGSLGEPI
FT                   YLDVRTAIGEAMASGKLKMKGYPVIVGGRYGLGSKEFSPAMAKAVLDNLKSAKPKNKFV
FT                   VGIEEDVTNSSLKVDYSYKNPMEGVYQAMFYGLGSDGTVGANKNSIKIIGEETNNNAQA
FT                   YFVYDSKKAGSMTTSHLRFGKKYIRAPYLVQEADFVACHNFSFLEKYDMLAKAKTGSTF
FT                   LLNAPFSASEVWDTMPKEVQQQIIEKKMKFYVIDGVKLGNEIGLGPRINVIMQTAFFKI
FT                   SNIIPVKDAVASIKDAIKKSYGKAGEKVLEMNYKAVDAGLNNFYEVKVPTKASSKLKMA
FT                   AAVSSKAPKFVKDVTGVIVAGLGDQLPVSKMPADGTFPTATSQYEKRNIATEIPVWDEK
FT                   LCIQCGICSFVCPHAAVRMKSFDGKLLKDAPKTYKSADCKIKGQEGKKLTVQVAPEDCT
FT                   GCGACAHNCPAKDKTNANHKALDMTFQPPLRASEAENFEFFLKLPDVDASTLKLDTLSN
FT                   NQLVRPLFEFSGACAGCGETPYLKLLTQLFGDRMIVANATGCSSIYGGNLPTTPYAQRA
FT                   DGRGPAWSNSLFEDNAEFGYGMRLTVDQFTKSAQEYLTELAGDKAFAANAKLFKEILSA
FT                   DQSSQAGIEAQRARVEKLKAAIKGSKNAVAKLLTPIADYLVKKSVWCIGGDGWAYDIGF
FT                   GGLDHVIASGKNINLLVLDTEVYSNTGGQASKSTPLGAVAQFAAGGKPVSKKDLGMIAM
FT                   SYGSVYVATVALSNPAQCVKAMLEAEAFDGPSIILAYSHCIAHGIDMTSGVDNQKKAVQ
FT                   SGYWPLYRYNPALAAECKNPLQLDSKAPTISFEEYTNNENRYRMLKKANPKGAEAMMKK
FT                   AGEWAKTHFAYYQKLAALSFDDSCEKK"
FT   gene            344628..345482
FT                   /locus_tag="Glov_0369"
FT   CDS_pept        344628..345482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0369"
FT                   /product="Hsp33 protein"
FT                   /note="PFAM: Hsp33 protein; KEGG: gme:Gmet_0041 HSP33
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94097"
FT                   /db_xref="GOA:B3E1K5"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="InterPro:IPR016153"
FT                   /db_xref="InterPro:IPR016154"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3E1K5"
FT                   /protein_id="ACD94097.1"
FT                   /translation="MHDHIARAMAVKGKIRAVACVTTNLANDICFLQGTSPIASIALGR
FT                   ALSGAALVGSTLKQGQRTAIKFEGGGPLKKLIAEVEWDGAIRGTVAVPDAVAESVPAAL
FT                   GRAGFLTVTRDLGMKDPYTGMVQLYTSEIAEDLAYYLTDSEQIPSAMGLGVSLADDGQI
FT                   AVSGGFLIQSLPPSDEAAVDQIMTTISKLPPLTTLLKDGTTPQQLLDILLEGVEHHPLE
FT                   STNLFFRCGCSRDKVERALLSLGKAGLERMIEEQGEAAVTCEFCKQQYRFERSELEALS
FT                   RSY"
FT   gene            345457..347913
FT                   /locus_tag="Glov_0370"
FT   CDS_pept        345457..347913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0370"
FT                   /product="peptidase U32"
FT                   /note="PFAM: peptidase U32; KEGG: ppd:Ppro_0065 peptidase
FT                   U32"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94098"
FT                   /db_xref="GOA:B3E1K6"
FT                   /db_xref="InterPro:IPR001539"
FT                   /db_xref="InterPro:IPR020988"
FT                   /db_xref="UniProtKB/TrEMBL:B3E1K6"
FT                   /protein_id="ACD94098.1"
FT                   /translation="MKRSADHTKPVKTSAAKPITNEPVRAKTVAPEVLAPCGSLEAFFA
FT                   AMESGADAVYAGLREFSARARAKNFTLGQMARMLAYAHQRGRKIYITLNTLVKEQELPQ
FT                   LVEALAELARLRVDGVIVQDMAVARLVRNFFPSIPLHASTQMTIHNLPGVKLLEEYGFE
FT                   RVVLARELQLADIASIASQTSAELEIFVHGALCFCVSGQCHFSSLLGGHSGNRGRCAQP
FT                   CRRLYSHRGKEGYYFSPNDLSALELIPELAAAGVTSLKIEGRMKSADYVAKVVKAYRLM
FT                   VDGDATARKETLKAAKELLKDSFGRTPTKGFLASSNPVDIANPWLRGGTGRFSGEVRQA
FT                   RQGQISFETRDGLRVGDRLRLQPKSDQAGQAWTLRELYVNRRKVHECKAGTLVEVACPF
FT                   EARPGDALFKVGAADAFGMSDEAANRKLQAAGPDRVAVRLELRCEQQGPAPGPWTLQIT
FT                   ARIGAAAFSYEFPLGDLEPARNSDMAGVLLARFSETGETPFHLESLQAPDFPALFIPPA
FT                   RLKEIRRELYQRLEQEGTAEERRRIAAAKAEALLELQGQRSRSKGQGEREELLIQVDSP
FT                   SEVRWALSQGARQVVVPLHRAAIHELPRYLSRLKGDADQLVWQLPFMLFDQELPLITEA
FT                   LDALYQAGFRCFEVTNPGQFKLLQRYAGLQLSSGYRLFTLNSQALAFWQEQGIQRATLY
FT                   IEDDRENLTDLLQLSQPLTVLVYSPVEVMATRVRIKEISSGAPLTSDRGEGYRIRGRDG
FT                   FTHISATTPFSLLGRLMELRRMGCRSFMLDLSETPPERRGELLEAFRSDRVVQGATLFN
FT                   YERGLT"
FT   gene            347910..348425
FT                   /locus_tag="Glov_0371"
FT   CDS_pept        347910..348425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0371"
FT                   /product="nuclease (SNase domain protein)"
FT                   /note="PFAM: nuclease (SNase domain protein); KEGG:
FT                   ppd:Ppro_0068 nuclease (SNase domain protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94099"
FT                   /db_xref="GOA:B3E1K7"
FT                   /db_xref="InterPro:IPR002071"
FT                   /db_xref="InterPro:IPR016071"
FT                   /db_xref="InterPro:IPR035437"
FT                   /db_xref="UniProtKB/TrEMBL:B3E1K7"
FT                   /protein_id="ACD94099.1"
FT                   /translation="MNRGLWCVIILLLLLSTGSPATAETLRGMVKAVHDGDTVVLVGRG
FT                   TGRVTVRLYGVDAPETRKPDSPGQPFGSQAKRVLMFKLLGKEVVAEVQDRDQYGRAVAV
FT                   LQLAGRDINAEMVAEGMAWAYRQYLGGPYASRYIALEEQARRQHRGLWRDTNPQPPWEF
FT                   RRGQKRRR"
FT   sig_peptide     347910..347981
FT                   /locus_tag="Glov_0371"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.992 at
FT                   residue 24"
FT   gene            complement(348422..349444)
FT                   /locus_tag="Glov_0372"
FT   CDS_pept        complement(348422..349444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0372"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; General secretory
FT                   system II protein E domain protein; KEGG: gme:Gmet_1737
FT                   response regulator receiver domain protein (CheY-like)"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94100"
FT                   /db_xref="GOA:B3E1K8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007831"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="InterPro:IPR042181"
FT                   /db_xref="UniProtKB/TrEMBL:B3E1K8"
FT                   /protein_id="ACD94100.1"
FT                   /translation="MTKQLGDILVDTELISRKTLERALERQKATAKRLGQVLEEMGVIT
FT                   EAELMEALVSQHSPFADINQKKQLGDILVRAKLISEKTLERALERQHTEGKKLGEVLEE
FT                   MGVITELELVEALGRQFGFKTVTDFSNRTYPAETINLLPTEFVMKRLVFPLKHKDMMLA
FT                   VAITDPFDGETTDMIARITGLQVVPVIATRKEILEAIARHYLNAPVNPDAGNTILVVED
FT                   SPTVATVVQAALVKEGYNVIICKDGIEALKTTLTHRPQLVITDAQMPKLDGHGLLRAIK
FT                   ANPITAAIPVIMLTGRASTDEEQKALDAGFFDFIPKPVQPLRVVSRVKRALELSKKIKN
FT                   "
FT   gene            complement(349468..350112)
FT                   /locus_tag="Glov_0373"
FT   CDS_pept        complement(349468..350112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0373"
FT                   /product="transaldolase"
FT                   /EC_number="2.2.1.2"
FT                   /note="KEGG: ppd:Ppro_0294 putative translaldolase;
FT                   TIGRFAM: transaldolase; PFAM: Transaldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94101"
FT                   /db_xref="GOA:B3E1K9"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR004731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018225"
FT                   /db_xref="InterPro:IPR022999"
FT                   /db_xref="InterPro:IPR033919"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3E1K9"
FT                   /protein_id="ACD94101.1"
FT                   /translation="MKFFIDTADVHEIREAHTLGLVDGVTTNPSLIAKSGRKFKDVIKE
FT                   ITAIVDGPISAEVIALDAEGMVKEAKDLVKIHKNIVIKLPMTPEGLKATKQLSAKGIKT
FT                   NVTLIFTPMQALLAAKAGATYVSPFVGRLDDISQDGMGIIEEIRTIFDNYGYTSEIIVA
FT                   SIRNPIHVLNSALIGADICTIPYSVMLQLSKHPLTDAGIKKFLEDWEKVPK"
FT   gene            complement(350136..350387)
FT                   /locus_tag="Glov_0374"
FT   CDS_pept        complement(350136..350387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0374"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gsu:GSU2978 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94102"
FT                   /db_xref="InterPro:IPR007029"
FT                   /db_xref="UniProtKB/TrEMBL:B3E1L0"
FT                   /protein_id="ACD94102.1"
FT                   /translation="MFRLVIWLLLAYIGFRVFKALVAPRQSSAPKPARNDEETVQDPVC
FT                   KVYLAKQDAIVGTLNGTRHYFCSMDCLDKFRDQLDHTH"
FT   gene            complement(350395..350889)
FT                   /locus_tag="Glov_0375"
FT   CDS_pept        complement(350395..350889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0375"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase"
FT                   /EC_number="2.7.6.3"
FT                   /note="KEGG: ppd:Ppro_0296
FT                   2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase; TIGRFAM:
FT                   2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase; PFAM:
FT                   78-dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94103"
FT                   /db_xref="GOA:B3E1L1"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:B3E1L1"
FT                   /protein_id="ACD94103.1"
FT                   /translation="METDAYIALGSNLGDRELNLLRAVAELGKIAGCRVTALSRFYETS
FT                   PVGMPSGTPSFYNGVARLATTLPPHELLHELQRIEREIFGRTPAARPQSRRLDLDLLLY
FT                   GSTQLATPDLTLPHPRMTARRFVLLPLADIAPELCEPASKRTIAELLTCLETDEQVSPL
FT                   E"
FT   gene            complement(351090..351767)
FT                   /locus_tag="Glov_0376"
FT   CDS_pept        complement(351090..351767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0376"
FT                   /product="HhH-GPD family protein"
FT                   /note="PFAM: helix-hairpin-helix motif; HhH-GPD family
FT                   protein; KEGG: gme:Gmet_0070 DNA-3-methyladenine
FT                   glycosylase III"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94104"
FT                   /db_xref="GOA:B3E1L2"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:B3E1L2"
FT                   /protein_id="ACD94104.1"
FT                   /translation="MADKRLDRIFTTLLERYGPRHWWPGETPFEVCVGAILTQNTNWGN
FT                   VEKAIANLKAADRLSVTGIADLLPAALAALIRPAGYFNVKAVRLQAFTTFLQQQYQGSL
FT                   DRLFAAPWQQTRTELLAVKGIGPETADSILLYAGHKPSFVVDAYTRRIFSRLGLVDERI
FT                   SYDGLRRHFMDRLTLDTALFNEYHALLVELGKQACRPRPQCSSCCLAAQCSYNATKNQS
FT                   KCS"
FT   gene            complement(351757..352344)
FT                   /locus_tag="Glov_0377"
FT   CDS_pept        complement(351757..352344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0377"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94105"
FT                   /db_xref="UniProtKB/TrEMBL:B3E1L3"
FT                   /protein_id="ACD94105.1"
FT                   /translation="MKKLFVLTLLLINCATAQAGFMDEVDKLVTGGQQIREQVPPAQEE
FT                   PAPQPRYEAPAAGEDRHYIQGDDFFISEQPMGENAWIYVTLAKMTQPPNAQTKGEAEFF
FT                   KIANGASQWTKFFWRTRIARPDEIRLGTLMIMFEGNSRNDAYQAPQDKSNARQSSWFMA
FT                   RITDVSDLYKGYVTVSGGYKVNPQNLRVLVGR"
FT   sig_peptide     complement(352285..352344)
FT                   /locus_tag="Glov_0377"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.949 at
FT                   residue 20"
FT   gene            complement(352432..353295)
FT                   /locus_tag="Glov_0378"
FT   CDS_pept        complement(352432..353295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0378"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; KEGG:
FT                   gsu:GSU2647 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94106"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B3E1L4"
FT                   /protein_id="ACD94106.1"
FT                   /translation="MQQLFIAGCGYTGSLVANLALAQGWSVAVHLRDQEKAAALTRAGA
FT                   EVCLCSMDERDDIPRLPLDGRMLLYSVPPQGGGSIDLRARNFCAALERDQTFPSKIVYL
FT                   SATSVYGDTGGAVVTEQSPTEPASAMGKRRLDAEQLFQDFCLKHGIPVVILRVSAIYGK
FT                   GRLPLMQINQGQPLLREELARPSNRIHIDDLARVCLSALLKGTGIYNVSDGHPASMTAY
FT                   FNACADALQKPRQPQIDLEEARRVMPPLLFNYFMESRVVDNRRMLEDLDISLRYPDLQQ
FT                   GIAASL"
FT   sig_peptide     complement(353227..353295)
FT                   /locus_tag="Glov_0378"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.936) with cleavage site probability 0.924 at
FT                   residue 23"
FT   gene            complement(353301..353771)
FT                   /locus_tag="Glov_0379"
FT   CDS_pept        complement(353301..353771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0379"
FT                   /product="rare lipoprotein A"
FT                   /note="TIGRFAM: rare lipoprotein A; PFAM: Rare lipoprotein
FT                   A; KEGG: ppd:Ppro_0489 rare lipoprotein A"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94107"
FT                   /db_xref="GOA:B3E1L5"
FT                   /db_xref="InterPro:IPR009009"
FT                   /db_xref="InterPro:IPR012997"
FT                   /db_xref="InterPro:IPR034718"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:B3E1L5"
FT                   /protein_id="ACD94107.1"
FT                   /translation="MIKRLLILSLLMPGAVQAAHPIERDDMSDAQLLEVLAKDGDTLKD
FT                   PQVGVATYYASRFIGRRTTSGQRYHPDKLTAAHALLPLGTIVTVENIKSGQKVSVVIND
FT                   RCHPRHTVRNLIDLSRAAAQQIGLWGKGAIKVRIVAIEKKHPLDELLDEGKG"
FT   sig_peptide     complement(353715..353771)
FT                   /locus_tag="Glov_0379"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.992 at
FT                   residue 19"
FT   gene            complement(353768..354652)
FT                   /locus_tag="Glov_0380"
FT   CDS_pept        complement(353768..354652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0380"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase;
FT                   dTDP-4-dehydrorhamnose reductase; NmrA family protein; Male
FT                   sterility domain; KEGG: ppd:Ppro_0490 NAD-dependent
FT                   epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94108"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B3E1L6"
FT                   /protein_id="ACD94108.1"
FT                   /translation="MKIFIAGGTGFVGGHLTAELLKRGHELVLLSHARSGSTAAGVTFV
FT                   KGDVVDPAVYGAAMKGCDAAINLVGIIREFPAKGVTFERLHVEATAGMVQATQHAGVLR
FT                   YLQMSALGTRLDAVSGYHRTKWRGEEIVRGSGLAWTIFRPSLIFGPRDAFVNMLADNLR
FT                   LAPVMPTMGDGTYRLQPIHGSDVARCYADALEKPETAGQTFELCGEDRLTYRELLDAIA
FT                   EAMGKGHPWKPSLPLSLMKPVIKALQGFKAFPITMDQLQMLLEENICDGCWRKAFEFEP
FT                   IRFRDGIREYLQR"
FT   gene            complement(354675..355163)
FT                   /locus_tag="Glov_0381"
FT   CDS_pept        complement(354675..355163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0381"
FT                   /product="SNARE associated Golgi protein"
FT                   /note="PFAM: SNARE associated Golgi protein; KEGG:
FT                   gur:Gura_0030 membrane protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94109"
FT                   /db_xref="GOA:B3E1L7"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:B3E1L7"
FT                   /protein_id="ACD94109.1"
FT                   /translation="MDLFDNGFLTYLVPLLNWLQQPGYPALFALSFLASTLVPLGSEWL
FT                   LVLMLVRGYDPAVSVLTATTGNSLGACTTWLVGRYGGDWLLVRLFRISEQQRQRAEAWY
FT                   QRYGILSLLFSWLPVAGDPLCLVGGLLKIRFTTFLLLVGVGKLVRYAAVAWLTVKMAA"
FT   gene            355362..356363
FT                   /locus_tag="Glov_0382"
FT   CDS_pept        355362..356363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0382"
FT                   /product="Helix-turn-helix type 11 domain protein"
FT                   /note="PFAM: Helix-turn-helix type 11 domain protein; KEGG:
FT                   gsu:GSU0473 transcriptional regulator, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94110"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="InterPro:IPR028349"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B3E1L8"
FT                   /protein_id="ACD94110.1"
FT                   /translation="MKTRGKPTGHYTQAARLHNVIRLIETRNGITLDELVEETGVDRRT
FT                   VHRDLVAIQEAGYPLTADRQDGRKIYRFLTSTRQVAPITFTLDELVSLHLLKACAGLLP
FT                   PEPFGAEIDAIFAKIHASLPPRSVAHLERIARVSLPRFQGGRAYAGSAELLSELRRALL
FT                   FQYRVKLSYSRSGKEAALYEIDPYTLVLAKGGLYLLAHAHNRDAVRLFAVERIVGLTVT
FT                   RQRFEMPDDFDPEQHFSDAFGLVTDQPMQLKIRFDREVAHMVRDRVWRTGQTLLSEPDG
FT                   SVLLSFEAAGSLEILAWVLSYGRHAELLEPPELRKELKRQIKGLREIYRKKG"
FT   gene            356542..357678
FT                   /locus_tag="Glov_0383"
FT   CDS_pept        356542..357678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0383"
FT                   /product="protein of unknown function DUF185"
FT                   /note="PFAM: protein of unknown function DUF185; KEGG:
FT                   gsu:GSU0476 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94111"
FT                   /db_xref="InterPro:IPR003788"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038375"
FT                   /db_xref="UniProtKB/TrEMBL:B3E1L9"
FT                   /protein_id="ACD94111.1"
FT                   /translation="MNDMTLHDLIADRIRAAGRITFADYMAACLYEPGLGYYTSPGRKV
FT                   GTEGDFYTSITVHATFGRVIAREIAAMWRSMDCPADFTLVEAGAGHGRLACDIMDFLAE
FT                   QQPDCYAATKLVLVEQEPTLAEAQAALLANHAARLSWLSPAELPGFRFSGVLYSNELLD
FT                   AMPVHRVLMSPQGLKEIYVTLDGDQFQDQSDLPSTPALAAYLDRFGIPLHPGQEAEVSL
FT                   AGLAWFEDVAECLQQGFILTIDYGWAKAELYSPQRNLGTLLCYYKHTVEDNPYQRLGQQ
FT                   DITTHINFSALIERGEELGLKPLWFGEQSRFLLSAGVIEELEQIEASDLPEKDKLRLRL
FT                   IIKRLIMPEGGMGDTFRVLVQSKGVTDPRLGCLRGISL"
FT   gene            357675..358355
FT                   /locus_tag="Glov_0384"
FT   CDS_pept        357675..358355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0384"
FT                   /product="Haloacid dehalogenase domain protein hydrolase"
FT                   /note="PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: ppd:Ppro_0495 haloacid dehalogenase domain
FT                   protein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94112"
FT                   /db_xref="GOA:B3E1M0"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:B3E1M0"
FT                   /protein_id="ACD94112.1"
FT                   /translation="MIPGTIKAIVFDLDGTLYVSEAFEHAVWESVSRYAGQLLGLSADA
FT                   GGRRLKELRDRLTAERGTVQTLAVAIEVLGGTVPEMHRRFAEELEPQQYIQPDPRVRPL
FT                   VNRLGERYTSWLLTNNNQTLTNKILACLDLEQSFQRVITINDTWRPKPDRTVLDQVLKE
FT                   LGLPSEAVLFVGDRYDIDLRLPEQEGCPVLLTKTIDELMQLQTLLDQPSRSIWSQPLPA
FT                   DGRP"
FT   gene            358467..360563
FT                   /locus_tag="Glov_0385"
FT   CDS_pept        358467..360563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0385"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: histidine kinase HAMP region domain protein;
FT                   chemotaxis sensory transducer; KEGG: gur:Gura_4401
FT                   methyl-accepting chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94113"
FT                   /db_xref="GOA:B3E1M1"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:B3E1M1"
FT                   /protein_id="ACD94113.1"
FT                   /translation="MFRARLTAKVLIAIAVTLSVGFACLGVLSLYLSYTSMLDLQRNNA
FT                   RQAAANVIHDLIELKMKGDFQAFNQYVDEVVKRGGALKIQLFHPDGKQYNGTENSELLK
FT                   QAVEAGVQKEQNSVVDGKSALVLATPLANEARCNACHAAGPKFLGGLQLVTSLEEGAAK
FT                   AKKLAVVLTGVGIFFFFLIIGVLYLLISRLVVRPIRELSAQVEDIAKGEGNLTKVLPVR
FT                   SEDEIGHLAGEVNHLTQTVREIIASLYQQACMLGGNTCELSNATERIAKEVQEQMEHAD
FT                   MVATAAEEMSSTIQNVSENTHQAVDLSATVDSAASTGLAVVQETWQCMNSVSESVESTL
FT                   AGIAELERSSASIGDMLSLIEDIADQTNLLALNAAIEAARAGEAGRGFAVVADEVRSLA
FT                   EKTTKSTKDIERVVGKIQQESERAAASIRKESALVRSGLQQAEEARRQLEDIKNCASSS
FT                   RMMSELIAVAAAEQTTVTGEISSKIHHISDAAHGTNQMMKANMETFARFADTVESIYGT
FT                   VGRFSVGNYHDQVKAYAAELSNGVQAAIAEAIKSGTLSEADLFDRNYQPYPKKTDPPKF
FT                   TTRFDGFFDRVVSPMQEAIVNRDSQLAYAICFDNNAYVPCHNLRFSKPLTGNIEQDRVN
FT                   NRTKRIFGDHTGMRCAKNTDGVLLQTYRRDTGEILNDLSVPIFINGKHWGGIRFGYKAP
FT                   CSLK"
FT   sig_peptide     358467..358547
FT                   /locus_tag="Glov_0385"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.927) with cleavage site probability 0.340 at
FT                   residue 27"
FT   gene            360602..361009
FT                   /locus_tag="Glov_0386"
FT   CDS_pept        360602..361009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0386"
FT                   /product="hemerythrin-like metal-binding protein"
FT                   /note="TIGRFAM: hemerythrin-like metal-binding protein;
FT                   PFAM: Hemerythrin HHE cation binding domain protein; KEGG:
FT                   pca:Pcar_0508 hemerythrin"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94114"
FT                   /db_xref="GOA:B3E1M2"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="InterPro:IPR012827"
FT                   /db_xref="InterPro:IPR016131"
FT                   /db_xref="InterPro:IPR035938"
FT                   /db_xref="UniProtKB/TrEMBL:B3E1M2"
FT                   /protein_id="ACD94114.1"
FT                   /translation="MALLLWGPMLEVGVKEIDTQHRKLVDLANELSDAQMAGKAKDVLG
FT                   KTLSELVRYTVTHFSTEERLMDQHKYPAAVDHKQQHKDLVKTVSDFKAKFDKGDAALSQ
FT                   EIMHFLRDWLTKHIMNTDKAFARDLIQKGVK"
FT   gene            361129..364335
FT                   /locus_tag="Glov_0387"
FT   CDS_pept        361129..364335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0387"
FT                   /product="multi-sensor hybrid histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="PFAM: response regulator receiver; ATP-binding
FT                   region ATPase domain protein; histidine kinase A domain
FT                   protein; Hpt domain protein; KEGG: gme:Gmet_2426 Hpt sensor
FT                   hybrid histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94115"
FT                   /db_xref="GOA:B3E1M3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B3E1M3"
FT                   /protein_id="ACD94115.1"
FT                   /translation="MVDHHLTTTSRTAILWALAAGCCGLLLNRFLPIELYYHLSLLLGS
FT                   LLPLVVLGLLGGRFGIPAGVVAASGTLLIWLQPIPFLVLSLEIVLVALLVRRGMRLTQA
FT                   VMLYWLVVGMPLILLAYLFLLDISAQAALVFALKFGLNGAFNAQIAALIIVAIHYWRFR
FT                   KSGAQEHRISFVEALTLLVTAAVYIPPMIMLLVGLRGAQQQHLATMHSTVSQVTDATQA
FT                   LLGDWLQRRLDSVNAVAKEVAVPLGASPETRRLMSLIKQSDPVLLRLGLSDQQGKELLH
FT                   LTSDVIHGSVKNMPADRSQIREPLKNGMPYLGTAVPLEGLLGAGETVATIGQPVIRGGR
FT                   VVGVVTALIPVIRLQERCDFVVSRRNVRLSVLDGSGTPLAMSSGSAANKLAPGLHAVHP
FT                   PKRPGVPWLALMSQAYLANRIPLNAVQQWDLVVEVPYRPGLEEINRRAIREMSMILALM
FT                   LLVCMASRIATKALSLTAFRLRQVTEQLSWQISRGTMPVWPAPTFLREIDALSNNVKEM
FT                   AESLGQTFFELKTVNEQLEKRIEERTKELADAKQAAEAANEAKSRFLAVMSHEIRTPMN
FT                   GIMGINNLLKQSQLTPDQRELLGYASDSADALLLIINDILDFSKIEANKLELCPSVFRL
FT                   GRLMESLCNMYQLVADKKGLRLVCDYDRELPELVTGDQDRLRQVLTNLLNNAIKFTRQG
FT                   EVRLWVHRLSSSSADGMLRIAFQVTDSGIGIAPEKQERIFDMFSQADSSTTREFGGTGL
FT                   GLAICKSLVGLMGGTIQVTSTPGVGSTFRVELPFSPAAGLAEAEGEGGQIGRRMPAVRI
FT                   LLAEDQAINRLVLSRLLNDLGHQVVAVENGRRLLEELAQGGYDLVITDVSMPELDGFQA
FT                   VRAIRSRQLPGIDSAIPVLAMTAHALGEDRERCLESGMDGYLSKPVDIEKLVAALQQLL
FT                   PEHCREGGGMTMTDSAGVSQEQVAEDPLDREYHHKNYLALGCGDVLLDVFRIYLESAPL
FT                   KVEQLRTLLKTGDLEQIVSLAHGLKGESGSVGGRFIMAAAAAMEKAARAGDLEEANRLL
FT                   PELEQQLQRVVAAIQQELKA"
FT   gene            364332..365855
FT                   /locus_tag="Glov_0388"
FT   CDS_pept        364332..365855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0388"
FT                   /product="glycogen/starch synthase, ADP-glucose type"
FT                   /EC_number="2.4.1.21"
FT                   /note="KEGG: ppd:Ppro_0293 glycogen/starch synthases,
FT                   ADP-glucose type; TIGRFAM: glycogen/starch synthase,
FT                   ADP-glucose type; PFAM: glycosyl transferase group 1;
FT                   Starch synthase catalytic domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94116"
FT                   /db_xref="GOA:B3E1M4"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR011835"
FT                   /db_xref="InterPro:IPR013534"
FT                   /db_xref="UniProtKB/TrEMBL:B3E1M4"
FT                   /protein_id="ACD94116.1"
FT                   /translation="MKKKSQGQGSTGSSQEKPLAILFAASEAAPYAKTGGLGEVVGDLP
FT                   RYLHAMGHDVRVVLPRYYSIDPDRYGLKLLPGTLVVPMGIIGEMYCGVWEGRLPKSEVP
FT                   VYFLEHQGLYGRDGIYGVDNVGFMDNDNRYVFLSRAALELPKFLCWQPDILHAHDWHTA
FT                   AVPVFLNTSYRNDPLVGNAASILTIHNMQYQGNFYPGLMEVLDIGWEYFTFLGLEKDDQ
FT                   VNLLKGGIYHATLLNTVSRGYAREIQTPLYGWGLEGVLQERTADLYGILNGVDYDEWNP
FT                   ATDQYLPATYTADDLSGKLACKRALQRRFGLPEIDVPLFGIVSRMVPQKGTDLLAEAIH
FT                   NMIRLDLQVVVVGNGEPWAHFFFGGMAHRHPDKVGCYIGYDNALAHLVEAGSDFFLMPS
FT                   AFEPCGLNQMYSLAYGTPPVVRATGGLDDSVENFDESALTGDGFKFWTRSAAALYDTVG
FT                   WATWTFYNNPQGLAALRKNGMAKRFTWEESACKYDALYREALRRRRGAE"
FT   gene            365845..367815
FT                   /locus_tag="Glov_0389"
FT   CDS_pept        365845..367815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0389"
FT                   /product="penicillin-binding protein, 1A family"
FT                   /EC_number="2.4.1.129"
FT                   /note="KEGG: gur:Gura_2430 penicillin-binding protein, 1A
FT                   family; TIGRFAM: penicillin-binding protein, 1A family;
FT                   PFAM: glycosyl transferase family 51; penicillin-binding
FT                   protein transpeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94117"
FT                   /db_xref="GOA:B3E1M5"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:B3E1M5"
FT                   /protein_id="ACD94117.1"
FT                   /translation="MQSSLFQCWAITFTCLAVFGGSSALAQEPIAAYPILPTGYHSIKV
FT                   FDSQSRFVGRLLPEKRYWVSIDRIPLFLQKAIVAVEDARFYEHGGVDLRGIARAAVKNV
FT                   VRGRLAEGGSTITQQLIKNKYLSSEKTLDRKVNEGLMALEFEKKYTKKQILEMYLNEIY
FT                   YGNGAWGIAQAARIYFDKSPEELTDIECSFLAGIPKNPGRYNPLGKPADVARRRSIVLQ
FT                   RMVDVGVLSSSQLRQQISHTAAPVPPNRAPWYLGLVQSKLVERYGPAVFEQGGLEVTTA
FT                   MDLGLQLKAEQIVHDSVVKLSPQLQGALVALEPATGNLLAAVGGTSYVKGGFNRALQAK
FT                   RQPGSAIKPLIYAAALEQGVTAASLWNDAAVSYPQGNGENWTPRNYDGKAHGTMTLRQA
FT                   LASSNNVIAVKLLETIGIPAFTELAAKNGLALHGNNLSLALGTEEVTLHDLVLAYAPFA
FT                   TGGVRTEPRSILRIYETYRKNWFENTTGSSQALSPANAFITTSMLKDVLTSGTAKGLKT
FT                   FSQKYPAAGKTGTTNDYHDAWFVGYTPHLVTGVWVGHDQPRSGGKGFTGGAVAAPIWER
FT                   FMRQALAGKPADDFTRPDSVVSVSVDPVNALLATPACPAKREEFFVSGTEPDDYCPMHG
FT                   GEPAAAPAATPPAPPAPASIP"
FT   sig_peptide     365845..365925
FT                   /locus_tag="Glov_0389"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 27"
FT   gene            367963..368256
FT                   /locus_tag="Glov_0390"
FT   CDS_pept        367963..368256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0390"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pca:Pcar_0362 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94118"
FT                   /db_xref="UniProtKB/TrEMBL:B3E1M6"
FT                   /protein_id="ACD94118.1"
FT                   /translation="MPLSQRKNLVLCCLMTAMLPMLTWAGNDRPPRGERRRPPQAAFDA
FT                   CKGKTEGASITIATPHGSFKAICRNFEGTLAAVPEGAPPSPPTDGSVPTQGR"
FT   sig_peptide     367963..368040
FT                   /locus_tag="Glov_0390"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 26"
FT   gene            368271..368519
FT                   /locus_tag="Glov_0391"
FT   CDS_pept        368271..368519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0391"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94119"
FT                   /db_xref="UniProtKB/TrEMBL:B3E1M7"
FT                   /protein_id="ACD94119.1"
FT                   /translation="MASYEQTFLEQITHLHGQDFSSWQGWQLLMDWVKRQPWRLEFFGG
FT                   AKIPARMLHPPTLVMELTRFLEGAPVVPEESSPDVRT"
FT   gene            368687..369328
FT                   /locus_tag="Glov_0392"
FT   CDS_pept        368687..369328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0392"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; Transcriptional
FT                   regulator TetR; KEGG: pca:Pcar_0813 AcrR/TetR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94120"
FT                   /db_xref="GOA:B3E1M8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR015292"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:B3E1M8"
FT                   /protein_id="ACD94120.1"
FT                   /translation="MVRKKSDIKKEKLLGAASDVFAEKGFRDATVAEICSRAGANVSAV
FT                   NYHFGSKEALYQETWRHSFSESLKAFPLDGGVGATASAEERLRGQLTSMIQRIADENNR
FT                   DFFIAQMELINPTGLLQEVMQAELIPMRQQTLALVRELLGPEASEAEVQFCEISTISMC
FT                   VHPMVMQRIARRTQGRGMPVVIEDITAFAEHVVRFALAGIKAHRIKGRTP"
FT   gene            369325..370518
FT                   /locus_tag="Glov_0393"
FT   CDS_pept        369325..370518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0393"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   ppd:Ppro_2220 efflux transporter, RND family, MFP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94121"
FT                   /db_xref="GOA:B3E1M9"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:B3E1M9"
FT                   /protein_id="ACD94121.1"
FT                   /translation="MNVPKKKQIIIAVIVIVLVTAGIAIARKFMAPAKITYITAPAVRM
FT                   DLEESVLATGILKAFKTVAVGAQVNGQLKTLHVALGAKVKKGQLLAEIDPVLPQNTLKD
FT                   AEAQVENLQAQKRSKQALLKQYELAYQRQGQMHAKDAGSRADLESAQAQLESTRYDISA
FT                   LAAQIKKAIIAVDTARANLGYTRIHAPIDGTVISIDTEEGQTVVSNQTATTILTLATLD
FT                   NMTIKAKISEADVTRVKAGLPTYFTLLGDSDTRYYGKLRAIEPGPVSGSTTTGSTSSSS
FT                   SSSSAIYYYGLFEVPNPDTKLKVSMTAQVAIVLNQARQALCIPVSALAERQKGGRATVK
FT                   VLAGEQVEVRAIQTGISDNVQIQVVNGLREGEKVIIGDSSNLPKSDPNTTPPPPGRR"
FT   sig_peptide     369325..369405
FT                   /locus_tag="Glov_0393"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.950) with cleavage site probability 0.892 at
FT                   residue 27"
FT   gene            370521..372479
FT                   /locus_tag="Glov_0394"
FT   CDS_pept        370521..372479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0394"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; protein of unknown
FT                   function DUF214; SMART: AAA ATPase; KEGG: ppd:Ppro_2219 ABC
FT                   transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94122"
FT                   /db_xref="GOA:B3E1N0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017911"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3E1N0"
FT                   /protein_id="ACD94122.1"
FT                   /translation="MAKPLLEIDAVVRRFSTGGQQVEVLKGIDLTIHSGEMVAIIGASG
FT                   SGKSTLMNILGCLDRPSEGSYRIDGRETGSLSNDELASLRRDYFGFIFQRYHLLPHLTA
FT                   IQNTEIPAIYAGANKHLRQERARKILERLGLGDRCDHRPNQLSGGQQQRVSIARALMNG
FT                   GDVILADEPTGALDSKSGKEMMEVLHELHASGHTIILVTHDQQVAAHAERIIEISDGAI
FT                   IRDQANPKRQASVTAALAEKVAVKQAANFLQANWGRFAEAFKMALIAMLSHRMRTLLTM
FT                   LGIIIGITSVVSVVALGQGAQQKVIKDISAMGTNVIDVNPGKDWGDEDAAGIQTLVQSD
FT                   LEALKAQVYVDSASPTTGGSQLLRYRNLTANASVNGVGEQYFRVKGYEIADGIAFSAAD
FT                   VKQQAQVVVIDQNTRKKFFSNQDPIGMILFVGSLPCRVIGITKVKDGPMGNSSNLEVWI
FT                   PYTAAMNRLLGQQYFSSITVRVKDGISNPVAEQSITRLVTQRHGRKDFYTNSSDSIMKT
FT                   INKTTTTLKLMISAIAVISLIVGGIGVMNIMLVSVTERTHEIGIRMAVGARQEDIMQQF
FT                   LIESVLVCLLGGMIGIICSWGVAKVFSLFVTSFAMQFSLMSIVSAFLCSTMIGVIFGFL
FT                   PARNAARLDPIEALARE"
FT   gene            372488..373882
FT                   /locus_tag="Glov_0395"
FT   CDS_pept        372488..373882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0395"
FT                   /product="RND efflux system, outer membrane lipoprotein,
FT                   NodT family"
FT                   /note="TIGRFAM: RND efflux system, outer membrane
FT                   lipoprotein, NodT family; PFAM: outer membrane efflux
FT                   protein; KEGG: ppd:Ppro_2218 RND efflux system, outer
FT                   membrane lipoprotein, NodT family"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94123"
FT                   /db_xref="GOA:B3E1N1"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:B3E1N1"
FT                   /protein_id="ACD94123.1"
FT                   /translation="MKILSIVTYAFVLPICCFLAGCSGLLPRSQYTRPEVTLPRQWQAT
FT                   GVTGSAVATKRQWWRDYNDQTLSELIELALRSNNNLAAATIKVKRAQLSARLTNTNLTP
FT                   TVSADLSSSLSRDLTTRSETKSSGATLSASYELDLWGKLASARDASKWEAEATEYDRQS
FT                   TALALVGTVATNYWTIAYLNERIASVDASILNAERVLGLVEVKYQAGAVSALDKLQAQQ
FT                   TVASQKAQLTELWQQRTEARNALAILFNQAPEHTVPERQRLPEGALPQVQAGLPASLLG
FT                   QRPDLQAAEQRLKKYLANVDTTRASYYPSFTLTGTLGRSSTSLVEVVKNPYAALGAGLV
FT                   LPFIQWNTMRLHVETAQADYEEAVVNFRQTLYAALSDVENALAARKNYAEELKQLQDSL
FT                   DLAKKAEQLAEVRYLTGSTDLQTWLDTQERRRDAERAFAVVRLAQLKNSMALYQVIGGT
FT                   TALPVP"
FT   gene            373971..375362
FT                   /locus_tag="Glov_0396"
FT   CDS_pept        373971..375362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0396"
FT                   /product="UbiD family decarboxylase"
FT                   /note="TIGRFAM: UbiD family decarboxylase; PFAM:
FT                   Carboxylyase-related protein; KEGG: ppd:Ppro_0291 UbiD
FT                   family decarboxylases"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94124"
FT                   /db_xref="GOA:B3E1N2"
FT                   /db_xref="InterPro:IPR002830"
FT                   /db_xref="UniProtKB/TrEMBL:B3E1N2"
FT                   /protein_id="ACD94124.1"
FT                   /translation="MLSSLHDFIERLEHLRDLQQVSVPVATRLEIAAITRRISSYPKGG
FT                   PALLFQQPDESPFPVATNLFGSQRRMRLALGLDSLEDLTVSFDAILQTLPVQGLSGLGG
FT                   LLAGHPDLACCKPVTVAHGPCQEELVPGADLLQFPFLHNWPDDGTAAGTGRYLTLGQVV
FT                   TTAPDGSDPNCGIYRCQIHDAHTLAIRWRRGSGAVQHHQQFIQQGMRMPVAIVLGGPPS
FT                   LTLTAAWPLPVGLDEVSCAGWLRGASIPMVACPHGPLQVPAEAELVIEGFAEPDRPLVE
FT                   GPFGNHTGQYDPAGPAARVTVTRITRRRDPIVPATVVGPPPQEDCWMMLGWERLLAALL
FT                   SRLVPGVRDIRMPLPWVFRSSAVISLENPSPHMVRKTVQALWQLPWFRKAHLLIVVDAE
FT                   IAARDLQQVAWRTVNETDWLDDLIRDEAGGRLAVDATRRSIEALLPDAATDRLLIQRWK
FT                   EYGLP"
FT   gene            375359..376225
FT                   /locus_tag="Glov_0397"
FT   CDS_pept        375359..376225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0397"
FT                   /product="4-hydroxybenzoate polyprenyltransferase"
FT                   /note="TIGRFAM: 4-hydroxybenzoate polyprenyltransferase;
FT                   PFAM: UbiA prenyltransferase; KEGG: gsu:GSU0439
FT                   prenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94125"
FT                   /db_xref="GOA:B3E1N3"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006371"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/TrEMBL:B3E1N3"
FT                   /protein_id="ACD94125.1"
FT                   /translation="MTAVLQKITIFMEMIKFSHTIFALPFALSGALLAIRGLPGARQLL
FT                   FIILAMVGARTAAMAMNRLIDADIDAKNPRTASRAIPAGLLSKGAVFGAIVLSVALLLW
FT                   SAAMLNPLCLKLSPIALGFLVLYSYCKRFTALAHIVLGICLAAAPIGAWVALTGKIELP
FT                   AIVLGLIVLFWVSAFDMLYALQDLEYDRSVGLHSIPVALGVNGSLWLSRLFHLITVGLL
FT                   VWLIVLLGLGPWFWAGSAVMAAMLLYEHWLLRGGDLTKLDAAFFTMNGYISLTFLAATA
FT                   ADVFLGR"
FT   gene            376229..376810
FT                   /locus_tag="Glov_0398"
FT   CDS_pept        376229..376810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0398"
FT                   /product="3-octaprenyl-4-hydroxybenzoate carboxy-lyase"
FT                   /note="TIGRFAM: 3-octaprenyl-4-hydroxybenzoate
FT                   carboxy-lyase; PFAM: flavoprotein; KEGG: ppd:Ppro_0289
FT                   3-octaprenyl-4-hydroxybenzoate carboxy-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94126"
FT                   /db_xref="GOA:B3E1N4"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR004507"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:B3E1N4"
FT                   /protein_id="ACD94126.1"
FT                   /translation="MKILLAITGASGSIYGLRLLEELLRAGHQVTLVASQSGQEVCRYE
FT                   TGVDLGDSEALKLLWNLPDAPVTIRNVTDLWAPEASGSAAPDAMVIAPCSMGTLGRISN
FT                   GISGNLIERAADVMLKEHRPLLLLPRETPFSTIHLENLLKLSQCGARIIPAMPAFYQKP
FT                   ESLDDLVNFVVGKLLDQLGIEHSLFQKWGV"
FT   gene            complement(376846..378036)
FT                   /locus_tag="Glov_0399"
FT   CDS_pept        complement(376846..378036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0399"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein;
FT                   flavodoxin/nitric oxide synthase; KEGG: gur:Gura_0371
FT                   beta-lactamase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94127"
FT                   /db_xref="GOA:B3E1N5"
FT                   /db_xref="InterPro:IPR001226"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR016440"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:B3E1N5"
FT                   /protein_id="ACD94127.1"
FT                   /translation="MIGTIEIKTGIHWLGAQHPELRVFDDLFPTEHGTTYNSYLVQGSE
FT                   KIAIIDTVKIKFVDQFMDKLKSLVDPAKIDYIIVNHAEPDHSGSLSFLLEHCPNAVVVS
FT                   TQAAKNFVGNMIHKPFQSKTVKDGETIDLGGRTLRFIMAPFLHWPDTMFTRLEEENVLF
FT                   TCDAFGAHYCNTRSIFNDEIEDFTSAREFYFDCLMRPFKDKVLAAVEKIRHDVIDMICP
FT                   SHGPIVRKDPWRVIEQYENWSKPKSFGKKVLVFYISPHGSTEKMAQALVAGAARDEIEV
FT                   ASHHIVGLSDNELRDLMEEADALVFGVPTINRDVPKPMWDVLAYLSTIKLKTNLAAVFG
FT                   SYGWSGEACKMVEERLKGMGFKLVADPLRAVFTPTADLLEQCKALGAAVSEEVSKK"
FT   gene            378223..379575
FT                   /locus_tag="Glov_0400"
FT   CDS_pept        378223..379575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0400"
FT                   /product="DNA repair protein RadA"
FT                   /EC_number="2.1.1.63"
FT                   /note="KEGG: ppd:Ppro_0422 DNA repair protein RadA;
FT                   TIGRFAM: DNA repair protein RadA; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94128"
FT                   /db_xref="GOA:B3E1N6"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/TrEMBL:B3E1N6"
FT                   /protein_id="ACD94128.1"
FT                   /translation="MRQKTVFSCSQCGSQSPKWLGKCPDCGAWNSMVEEQQPSAAAARS
FT                   GRPLSSKSVALPIGEVPPQAEVRLGCGIGELDRVLGGGLVPGSLVLIGGDPGIGKSTLL
FT                   LQAMHHLAADGPVLYVSGEESAAQTRLRGERLGVSGRQLLVLAENGLEEIVAQVEKLKP
FT                   RAVVVDSIQTVWTQALESAPGSVSQVRESAGRLMLLAKGSGIPIFIVGHVTKDGAIAGP
FT                   RVLEHMVDTVLYFEGDRGHPYRILRAVKNRFGSTNEIGVFEMKSGGLAEVANPSELFLS
FT                   ERPLDAPGSVVTASLEGSRTLLVEIQALVTPSAYGTPRRTTIGVDSNRLALLVAVLEKK
FT                   AGLHLGGQDIFLNVAGGARLNEPAADLAMLLAVASSHLDRPVAAGAVVFGEVGLAGEVR
FT                   AVNQPEPRLGEATKLGFKQCILPAGNLRRLSDASLELHGVATVQEVLQFLL"
FT   gene            379651..380007
FT                   /locus_tag="Glov_0401"
FT   CDS_pept        379651..380007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0401"
FT                   /product="transcriptional regulator, TraR/DksA family"
FT                   /note="TIGRFAM: RNA polymerase-binding protein DksA; PFAM:
FT                   zinc finger DksA/TraR C4-type; KEGG: ppd:Ppro_0421
FT                   transcriptional regulator, TraR/DksA family"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94129"
FT                   /db_xref="GOA:B3E1N7"
FT                   /db_xref="InterPro:IPR000962"
FT                   /db_xref="InterPro:IPR012784"
FT                   /db_xref="InterPro:IPR020458"
FT                   /db_xref="InterPro:IPR037187"
FT                   /db_xref="UniProtKB/TrEMBL:B3E1N7"
FT                   /protein_id="ACD94129.1"
FT                   /translation="MDAEKLEQFRQLLQEEMKALLSEADKTVQEMGDDASHFPDPTDRA
FT                   TQESDRTFELRIRDRERKLANKVREALERIDDGSYGICEDCGGEISEARLKARPVTTQC
FT                   IDCKIEAEEKEKRL"
FT   gene            380066..381475
FT                   /locus_tag="Glov_0402"
FT   CDS_pept        380066..381475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0402"
FT                   /product="GAF sensor signal transduction histidine kinase"
FT                   /note="PFAM: GAF domain protein; ATP-binding region ATPase
FT                   domain protein; histidine kinase A domain protein; KEGG:
FT                   ppd:Ppro_0420 GAF sensor signal transduction histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94130"
FT                   /db_xref="GOA:B3E1N8"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B3E1N8"
FT                   /protein_id="ACD94130.1"
FT                   /translation="MPDTTIEKSSASATEALQAQRDLQLFYLFSTTLLSTMQLNKLLHL
FT                   ILSALVCEDNGLFCRAMLFLYNQKTDMLQGMLGICRSNTDGFRVVFSDPDNPLSGYWDL
FT                   DADAIARQMQSDLCLKVRETRIDLSEGCRIVSHVVENKRLYRINDVECLNCRDCDFISR
FT                   FGISSFVAVPLVTRNNLIGVIIVDNPVKHQPITDQQLKVLQLFANQAGMAIENTRLYRN
FT                   LEETHNELQDTRQRLVHGAHLAAIGEMAASISHELKTPLITIGGFAARLGRMLPENTPQ
FT                   RHYLDTIISESHRLERLLGDILAFSRKPTICFQECNLRGVVKECLDDYVVLLGERKITL
FT                   ETSVPSGSWTVLGDSNQLKQVCINLLVNAQEAMPQGGRLQVGLRAGGDGGRPCAVVSIT
FT                   DSGGGIPEELQSKIFTPFFTTKRHGTGLGLAIVNRIVQNHGGSLKVFNTDDGAEFQVIL
FT                   PLAPFDDPQTA"
FT   gene            complement(381619..382323)
FT                   /locus_tag="Glov_0403"
FT   CDS_pept        complement(381619..382323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0403"
FT                   /product="type IV pilus assembly PilZ"
FT                   /note="PFAM: type IV pilus assembly PilZ; KEGG:
FT                   gme:Gmet_0191 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94131"
FT                   /db_xref="GOA:B3E1N9"
FT                   /db_xref="InterPro:IPR009875"
FT                   /db_xref="UniProtKB/TrEMBL:B3E1N9"
FT                   /protein_id="ACD94131.1"
FT                   /translation="MENMQYEEQLRLLDRGEPGEILELLLRISQQASHDLQFFNHYKEV
FT                   PISSAAEVLYLFGNTLVCRSNPTQTRALKASRHTIIRSSRLGHDVYASAEYDAETDEIT
FT                   LSEFSYVEVLPDRRNTLRVKIGGLFQVPMEAGTTTFTAKLKDLSLGGCALEVPDKSLLG
FT                   NFTYFYLNLSFDLKNQPEAQKIRVMARLLRFESTEKPCRCILLFEHDRRSEDLIGRYIA
FT                   QRQTEIIRELKD"
FT   gene            382441..383904
FT                   /locus_tag="Glov_0404"
FT   CDS_pept        382441..383904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0404"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /EC_number="6.1.1.16"
FT                   /note="KEGG: ppd:Ppro_0031 cysteinyl-tRNA synthetase;
FT                   TIGRFAM: cysteinyl-tRNA synthetase; PFAM: Cysteinyl-tRNA
FT                   synthetase class Ia DALR; tRNA synthetase class I (M);
FT                   Cysteinyl-tRNA synthetase class Ia"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94132"
FT                   /db_xref="GOA:B3E1P0"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3E1P0"
FT                   /protein_id="ACD94132.1"
FT                   /translation="MALRLYNTLSGEKEPFVPRVAGKVGMYVCGVTVYDFCHIGHARAG
FT                   IVFDMIYRYLRFSGYDVTYIRNYTDIDDKIINRANQEGTDYRTIADRYIATFDEDMDRL
FT                   GMLRPTIEPKATDHIEDIISIIQRLIDNGHAYAVDGDVYFAVETFPAYLKLSGRNLDDM
FT                   LAGARVDVDERKRNPMDFALWKGSKPGEPWWESPWGKGRPGWHIECSAMSMRFLGPSFD
FT                   IHGGGKDLVFPHHENEIAQSEGANGCQFVKYWLHNGFVNINSEKMSKSLGNFFTIREVL
FT                   ELFDPETLRFFILQAHYRSPLDYSDQNLREAQAGLSRIYEALAALDQALEKPATAIHLP
FT                   ASAAEFAEKVAGLLPRFREAMDDDFNTAQALGTLFDSIRTLNRLLAEGGGSSSASRADL
FT                   EQLRAAVTEIGAVLGLFRIKPSDWLAAREAEKARHLEISPEEIEGLIVERAAARKNKDF
FT                   KRSDEIRDYLLSRDIQLVDTPQGTAWKVK"
FT   gene            384016..385677
FT                   /locus_tag="Glov_0405"
FT   CDS_pept        384016..385677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0405"
FT                   /product="GAF sensor signal transduction histidine kinase"
FT                   /note="PFAM: GAF domain protein; histidine kinase A domain
FT                   protein; KEGG: ppd:Ppro_0030 GAF sensor signal transduction
FT                   histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94133"
FT                   /db_xref="GOA:B3E1P1"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B3E1P1"
FT                   /protein_id="ACD94133.1"
FT                   /translation="MEITAITEWECCWDRDSIVMGDCPNIGEGDEDLLSSRSRRILEKC
FT                   CECEKFRRDLARFRDSGHPLAPIFSILHADYRRQKNQIQSLANFLDTKTLEVRFLHELG
FT                   SVLQSSVDLDEVLSVALTAITAGKGFGMNRAFLLLADKERHILKGHLAIGPRSAEEAGQ
FT                   TWHEIESGDQDLQGLSQEFRKHKLTAERYKFHDILERLIIPLDDEQHIIVRALEERKPL
FT                   MVSDAFHNPDVDSEFARVLGVDTFLVLPLIARNRRVGAIIADNFITHRTISEQDMRSIE
FT                   TFTFPVAFAIERASLYERVQEEVDKLRQANSRLQEQQEQLVRMEKMALVGRITSSIAHS
FT                   IRNPLMVIGGFARSILKNTPGNDPKRTFIESIVTEARQLEEVLGEILTYSDALFPSCDF
FT                   WDPNQLVESALRDVQERIVTQDYSCRFHAGELLPPVYIDYKQTTYCIRNILLSTIDGLQ
FT                   NGFIDISTRVEGEHVDVRIVDHNRTLSEDELEALLTPFTETCEMGSGLNMALSRSMLDK
FT                   QNIPLIVVAPPEGGVTYTIKLPIHKEEKNHEQIAGS"
FT   gene            385655..386035
FT                   /locus_tag="Glov_0406"
FT   CDS_pept        385655..386035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0406"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   ppd:Ppro_0029 response regulator receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94134"
FT                   /db_xref="GOA:B3E1P2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B3E1P2"
FT                   /protein_id="ACD94134.1"
FT                   /translation="MSRLLVVDDEANIRLLYSEELSDEGYSVETAATIAEAVEKLEQQA
FT                   FDLAVLDIKLKNESGIELLQKIVKERHDMPVILCSAFSCYKDDFSAWLADSYVVKSGDM
FT                   TELKEEIKRVLAKKAQRRAAGM"
FT   gene            386179..388686
FT                   /locus_tag="Glov_0407"
FT   CDS_pept        386179..388686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0407"
FT                   /product="Nucleotidyl transferase"
FT                   /note="PFAM: transferase hexapeptide repeat containing
FT                   protein; Nucleotidyl transferase;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain I; KEGG: ppd:Ppro_0028 nucleotidyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94135"
FT                   /db_xref="GOA:B3E1P3"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:B3E1P3"
FT                   /protein_id="ACD94135.1"
FT                   /translation="MKAVIMAGGFGTRIQPLTSSMPKPMIPLFNRPIMLHIVELLKKHD
FT                   ITDLVMLLYHQPEVIKKFFRDGSDFGVKITYVTPIEDMGTAGAVKAAEKYLDERFLVIS
FT                   GDLLTDFNLKKVLDFHADNKAMATITLTSVKDPLQFGVVITDKEKRITQFLEKPGWGEV
FT                   ISDTINTGIYVLEPEIFNYIPKGENFDFSQDLFPLMLQNSDPLFGFSAKGYWRDIGNTD
FT                   SYREAYHDIFKGKVNLKIDEEKQDFVGKDLRIGADVTLEDASGLSGTVVIGDNSQIRGE
FT                   VQIKDSVIGRNCTIEAGVKLNRCVLWDNAYVKKGAKVTDSVICTNVRVGQNAVLDEGVI
FT                   VADDTSIGDDVKIKADVKIWPRKMIEAGSTVTANLIWGEKWKKSLFEGAIIKGLSNVEL
FT                   TPEFVAKLGCAYGTTLPKGSYVLGGRDANRSSRMLKRCFVGGLLSAGVNVRDMTMTSLP
FT                   LIRYKLKTFGEVGGFHFRQSSDDPASMEIIFLDGDGLDFSSNMAKNLERIFFKENFRRA
FT                   HHTEPGALIDIPQAIDFYREGYLRALNVEVCRKAAWTVVVDFNYSPASQVLPMLLNELG
FT                   CNVIALNAYVDDGRGGCVPKPKQEGLRQLSAIVSSLGAQAGFWLEPAVESITLLDETGT
FT                   IYDGIQLLTLVIALQLKTDQRGTIAVPVQAPSTIEQMALKKKCGVTRTKSSDRAMLEAA
FT                   SSSEVILAASPDGRFAFPRFQAAFDGMYAIAKLVELGITVGVPFSRVLEEAPKRAFLQA
FT                   SIPCPFEMKGGIMRKMSEDSLEQEASFIDGIKVQFDNDWALVLPDQYSSFVHIFAEAKD
FT                   EKTAGKLLDEYRKKVEKWKKELE"
FT   gene            388694..390883
FT                   /locus_tag="Glov_0408"
FT   CDS_pept        388694..390883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0408"
FT                   /product="glycoside hydrolase family 57"
FT                   /note="PFAM: glycoside hydrolase family 57; KEGG:
FT                   ppd:Ppro_0027 glycoside hydrolase, family 57"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94136"
FT                   /db_xref="GOA:B3E1P4"
FT                   /db_xref="InterPro:IPR004300"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:B3E1P4"
FT                   /protein_id="ACD94136.1"
FT                   /translation="MTTPIDVIFLWHMHQPYYKDPVKGEYALPWTYLHAIKDYYDMPAI
FT                   VEDTPGARAVFNLVPSLVEQLLEYAAGTAVDPFLIKGQMNPADMSEEDRIFLLENFFSA
FT                   NRQRMIEPHRRYLELLYMAGEGKPGAVRERVRHFSHQDLQDLQVCFFLSWTGEAARRRF
FT                   PVFQELLAKGQGYTAEDRALLFATQHKLLNEIVPLYKRLHASGQIELSVTPYFHPILPL
FT                   LCDTQLAREAMPKVTLPQERFRHPEDARAHIGHGLRYFQEVFGITPRGMWPSEGSVSDE
FT                   ALQLIRECGLSWVATDEEVLARSLDGGLGPHHERLYHPWRFATAKGDLGIFFRDHQLSD
FT                   LIGFTYSQWDARRAVADFTGRLRQIGRQVGSEGKVIPVILDGENAWEFYPDNAYDFLSG
FT                   IYAAVAEARDLNLTTCSDVLAQSSFEGRLHRIHPGSWINANYGIWIGHPEENLAWDLVA
FT                   GARRAIVEHHPEAARQLANAGMDGDQVARLLCTSLYAAEGSDWFWWFGDDHFSPHSDRF
FT                   DRLFRQHLTNIYTMLGISPPRELLEPIKKKSPAGLVREPAGFIEPEINGRVGDYFEWLA
FT                   AGLFDLTRQGSAMHSSDRLLQGFYWGYNHAQLYFRIDGIQELSRLLKENDILALHLIAD
FT                   REYRLPMQRSMEEGLLLVRELGNWTPTNSCCRWAIDRTCEVALPLEGLHLLPKSKLFAS
FT                   VTLTRNSEEIGRWPSDAPLMLNYEGPDLEANDWLI"
FT   gene            391024..392049
FT                   /locus_tag="Glov_0409"
FT   CDS_pept        391024..392049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0409"
FT                   /product="galactose-1-phosphate uridylyltransferase"
FT                   /EC_number="2.7.7.12"
FT                   /note="TIGRFAM: galactose-1-phosphate uridylyltransferase;
FT                   KEGG: gur:Gura_0857 galactose-1-phosphate
FT                   uridylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94137"
FT                   /db_xref="GOA:B3E1P5"
FT                   /db_xref="InterPro:IPR001937"
FT                   /db_xref="InterPro:IPR005849"
FT                   /db_xref="InterPro:IPR005850"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:B3E1P5"
FT                   /protein_id="ACD94137.1"
FT                   /translation="MSELRWDPLKLHWVIIATERGRRPRDFQSEPEPLPVTSCPFCYGN
FT                   EDKTPPEIFAIRPSGMPNTPNWKVRVIPNKYPALRIEGELENRGHGPYDVMNGIGAHEV
FT                   IIETPDHDKSMADLAPAELTDVLVTWRTRLLDLRRDFRFRYMILFKNHGARAGASLAHS
FT                   HSQLIAVPMLPPVATTELKVCRTHYANKERCLFCDLITFELEQGVRVVREFSNFVTLAP
FT                   YAASFPFELRLYPKRHSHDFALMNDAQLAELAVALKDMLMRVKLVLKDAPYNFILHTCP
FT                   PMHKRPGKPAMWTSLEYDYHWHIELVPRLTSIAGFEWGTGFFINPTSPEDAALFLREAE
FT                   V"
FT   gene            392050..392913
FT                   /locus_tag="Glov_0410"
FT   CDS_pept        392050..392913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0410"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   gur:Gura_0608 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94138"
FT                   /db_xref="GOA:B3E1P6"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR014127"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:B3E1P6"
FT                   /protein_id="ACD94138.1"
FT                   /translation="MSHPRSLKKILEQLYADRSPQHLANDPLSFCHRYHAPADQEVAAL
FT                   IAAVFAYGSVKVIKGSLSRIFSIMGDSPAGFVDGFDPKRDRQLCSGFKHRFNDADDLAA
FT                   LFWAIRLMRQQQGGIERFFCRFFEANAATVEQALNGFCAAVTALDYRLLFGSAALPPES
FT                   SFRFLFPSPSGGSACKRLCMFLRWVVRPADGIDLGLWQQVRPAQLVIPVDRHIERISRM
FT                   LGLTSRRTPDWRMACEITAALRQFDPLDPVKYDFSICHLGISEGCNGTSSASCPGCPVK
FT                   RHCRAV"
FT   gene            393009..394652
FT                   /locus_tag="Glov_0411"
FT   CDS_pept        393009..394652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0411"
FT                   /product="MJ0042 family finger-like protein"
FT                   /note="TIGRFAM: MJ0042 family finger-like protein; KEGG:
FT                   gur:Gura_3397 MJ0042 family finger-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94139"
FT                   /db_xref="GOA:B3E1P7"
FT                   /db_xref="InterPro:IPR011723"
FT                   /db_xref="InterPro:IPR021834"
FT                   /db_xref="UniProtKB/TrEMBL:B3E1P7"
FT                   /protein_id="ACD94139.1"
FT                   /translation="MIIQCEQCRTKFKLDDEKVSDRGVKVRCAKCRHVFTVRKDVAQAG
FT                   AVDAMLPETVAAAPFPVSDETVRMAAAPASEPEVAGFSAEPEVAFDFGAAPVEAAVPDA
FT                   VPFSFEQPEAAAGSSFDFGDVAFTTEPPVAPAAADFGEMTMVMPPKQQAAEAIPEFSLE
FT                   FGSAAVAAPATPAADEAAFDFGDALASSSISDATAQKVEFDFGDQASSAVAQTGDIDLA
FT                   GFDFGTAPAAAVTIPTGIDTTDFSDFSAATAPQSAVAGGFSFDDAVPQPATAATDSFDF
FT                   SGVDLGMGQPQTTVPASEVDTFSLGEVDFSSDTAAVAVDASATAPAGTLFAPVEESVVR
FT                   QQEIAKPDISFDLPGATDEQPPSITSRRRQSSTLSILIAVITVVVLAVLGYMAYSFISD
FT                   GPKAVSLFGNKAGVPVEDGKITVQNIKAYFIPKAAAGELLVITGEALNNFKKPRAALQV
FT                   KGMVFGAANQAVATKTAYAGNLLTKEQLAEMPAEKIEAAMNNQFGDSLANLEVQPGKTI
FT                   PFTIVIINPPVDGKEFGVEPVGSTVAAAGK"
FT   gene            complement(394784..395281)
FT                   /locus_tag="Glov_0412"
FT   CDS_pept        complement(394784..395281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0412"
FT                   /product="peptidylprolyl isomerase FKBP-type"
FT                   /note="PFAM: peptidylprolyl isomerase FKBP-type; KEGG:
FT                   ppd:Ppro_0023 peptidylprolyl isomerase, FKBP-type"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94140"
FT                   /db_xref="GOA:B3E1P8"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniProtKB/TrEMBL:B3E1P8"
FT                   /protein_id="ACD94140.1"
FT                   /translation="MAQAQQGDTVRVHYTGTLQDGSIFDSSETVEQDSCGCSCSSSGGC
FT                   GTGSDCGCEPLEFTIGGGNVIPGFEKAVLGLSVGESIKVTIPADEAYGPRHEQMVAVVD
FT                   RSELSGEIEPIEGQQLEVVLQDDSSMPVLITEVTETTVTLDANHPLAGQDLTFEIKLVE
FT                   IV"
FT   gene            complement(395338..395643)
FT                   /locus_tag="Glov_0413"
FT   CDS_pept        complement(395338..395643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0413"
FT                   /product="protein of unknown function DUF167"
FT                   /note="PFAM: protein of unknown function DUF167; KEGG:
FT                   gme:Gmet_1164 protein of unknown function DUF167"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94141"
FT                   /db_xref="InterPro:IPR003746"
FT                   /db_xref="InterPro:IPR005228"
FT                   /db_xref="InterPro:IPR036591"
FT                   /db_xref="UniProtKB/TrEMBL:B3E1P9"
FT                   /protein_id="ACD94141.1"
FT                   /translation="MNSSPALPWSQQGDALLLRVFVQPRASRNQFCGIHEGELKLRLTS
FT                   PPVDGAANECCREFLAKQLKVPKSAVTLISGDSSRHKRLRIAGATTQQIEQLIPPA"
FT   gene            complement(395633..396082)
FT                   /locus_tag="Glov_0414"
FT   CDS_pept        complement(395633..396082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0414"
FT                   /product="DivIVA family protein"
FT                   /note="PFAM: DivIVA family protein; KEGG: gme:Gmet_1165
FT                   DivIVA"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94142"
FT                   /db_xref="GOA:B3E1Q0"
FT                   /db_xref="InterPro:IPR007793"
FT                   /db_xref="InterPro:IPR019933"
FT                   /db_xref="UniProtKB/TrEMBL:B3E1Q0"
FT                   /protein_id="ACD94142.1"
FT                   /translation="MTITPLDIRQQQFKGKMLGGLDPDDVDSFLQAVAVEMEGLLRENT
FT                   ELKEQANRQTRELSEHAQREKDLRETMLAAQRITDEMKANAQKEAALIVSEAQLQARRL
FT                   VDEAERKVADLQARIQDVRRQKLQFEMEFKALLDNHVRMIGSGEQ"
FT   gene            complement(396089..396412)
FT                   /locus_tag="Glov_0415"
FT   CDS_pept        complement(396089..396412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0415"
FT                   /product="protein of unknown function YGGT"
FT                   /note="PFAM: protein of unknown function YGGT; KEGG:
FT                   ppd:Ppro_0020 protein of unknown function YGGT"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94143"
FT                   /db_xref="GOA:B3E1Q1"
FT                   /db_xref="InterPro:IPR003425"
FT                   /db_xref="UniProtKB/TrEMBL:B3E1Q1"
FT                   /protein_id="ACD94143.1"
FT                   /translation="MILFGNILYALAKIVELADGLLTVYKYILIAAALITWVNPDPYNP
FT                   IVSFLYRVTEPLLSRIRRRMPAMGPVDLSPLVAFALIYVVQIVVLNTLYQYLINYSMIL
FT                   KLR"
FT   gene            396573..397364
FT                   /locus_tag="Glov_0416"
FT   CDS_pept        396573..397364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0416"
FT                   /product="Inositol-phosphate phosphatase"
FT                   /EC_number="3.1.3.25"
FT                   /note="PFAM: inositol monophosphatase; KEGG: ppd:Ppro_0018
FT                   inositol monophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94144"
FT                   /db_xref="GOA:B3E1Q2"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR020550"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="InterPro:IPR022337"
FT                   /db_xref="InterPro:IPR033942"
FT                   /db_xref="UniProtKB/TrEMBL:B3E1Q2"
FT                   /protein_id="ACD94144.1"
FT                   /translation="MPASRFLDCAIEAALAAGQLQRSRFDAAFSIDLKGAKNLVTELDL
FT                   ASEALIVEKIHARFPEHGILAEEGDYPAGDGRHVWIIDPLDGTTNYAHGYPWFCVSIAL
FT                   AVGGELVVGAIYNPMTDELFSATTGGGAFRNGRRLSVSNRQPLASALLGTGFPYDCATD
FT                   PENNFDHFIRFQKAARGIRRAGAAALDLAYLAAGRLDGFWEVKLKPWDVAAGTLLVREA
FT                   GGLVSAFDGSDYEVTDHRILASNGLIHDEMIALLAAEEEQP"
FT   gene            397361..397696
FT                   /locus_tag="Glov_0417"
FT   CDS_pept        397361..397696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0417"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ppd:Ppro_0017 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94145"
FT                   /db_xref="GOA:B3E1Q3"
FT                   /db_xref="UniProtKB/TrEMBL:B3E1Q3"
FT                   /protein_id="ACD94145.1"
FT                   /translation="MKRPIIALLLSGLILPGLGQLYLGRRNKGIALIMAVNLLLLAALF
FT                   FVMKIASPVIGAYLTGTPLTPALILQQLQPYNFWAKLLLAAVFGLWGFGLVDLFSAFKE
FT                   QDDVTRN"
FT   sig_peptide     397361..397420
FT                   /locus_tag="Glov_0417"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.923) with cleavage site probability 0.833 at
FT                   residue 20"
FT   gene            397774..398757
FT                   /locus_tag="Glov_0418"
FT   CDS_pept        397774..398757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0418"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) synthase III"
FT                   /EC_number="2.3.1.41"
FT                   /note="KEGG: ppd:Ppro_0016 3-oxoacyl-(acyl-carrier-protein)
FT                   synthase III; TIGRFAM: 3-oxoacyl-(acyl-carrier-protein)
FT                   synthase III; PFAM: 3-Oxoacyl-[acyl-carrier-protein (ACP)]
FT                   synthase III domain protein;
FT                   3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94146"
FT                   /db_xref="GOA:B3E1Q4"
FT                   /db_xref="InterPro:IPR004655"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:B3E1Q4"
FT                   /protein_id="ACD94146.1"
FT                   /translation="MMQSCIIGSGAGLPERVVGNDFFSYLVDDADEWISSRTGIRERRF
FT                   VSPDESTSDLATRAARAALTDAAISADEIDCIVVGTSTPDMILPATACMVQKEIGAKNA
FT                   FAFDINSVCGSFVFALDTADSFIRAGKARTALVIGADTYSKILNFDDKTTAPLFGDGAA
FT                   AVIIRGEEGSEKGIITSFIRTDGNGWPLIQVPSSGSRKPVTAETIAAKENTFYMAGKPV
FT                   YVFATSAIPELIQTICSKAGIQPADLDWLIPHQANLRIIDAVAKKHDIPKEKFLVNLQK
FT                   YGNTSAASVGLALNEFRQDGTIKPGQLVLVMGFGGGLSWGGLLIRF"
FT   gene            398904..399452
FT                   /locus_tag="Glov_0419"
FT   CDS_pept        398904..399452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0419"
FT                   /product="response regulator receiver and ANTAR domain
FT                   protein"
FT                   /note="PFAM: response regulator receiver; ANTAR domain
FT                   protein; KEGG: ppd:Ppro_3459 response regulator receiver
FT                   and ANTAR domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94147"
FT                   /db_xref="GOA:B3E1Q5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR005561"
FT                   /db_xref="InterPro:IPR008327"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B3E1Q5"
FT                   /protein_id="ACD94147.1"
FT                   /translation="MLICSPDPVFQGHLTRLLETIGGYRVAVTAGPAAALQYALAQPPD
FT                   LLICSHDPLHCDGIALAETLHGKVWVPVVLAAQPWTQELVKAAVAAGVAAFLTSFPAEA
FT                   ELRHALLEACVRLEHEDRLRSKLRESEQRLADRKVIEKAKGLLMERERISEDAAFKLMR
FT                   SQSMTRRISMAKLAEELLT"
FT   gene            complement(399445..400350)
FT                   /locus_tag="Glov_0420"
FT   CDS_pept        complement(399445..400350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0420"
FT                   /product="ADP-ribosyl-(dinitrogen reductase) hydrolase"
FT                   /EC_number="3.2.2.24"
FT                   /note="KEGG: ppd:Ppro_3462 ADP-ribosyl-(dinitrogen
FT                   reductase) hydrolase; TIGRFAM: ADP-ribosyl-[dinitrogen
FT                   reductase] hydrolase; PFAM: ADP-ribosylation/Crystallin J1"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94148"
FT                   /db_xref="GOA:B3E295"
FT                   /db_xref="InterPro:IPR005502"
FT                   /db_xref="InterPro:IPR013479"
FT                   /db_xref="InterPro:IPR036705"
FT                   /db_xref="UniProtKB/TrEMBL:B3E295"
FT                   /protein_id="ACD94148.1"
FT                   /translation="MILNIDPSELKERARAAFVGMAIGDALGATVEFMTTAEIAAKYGV
FT                   FKEVTGGGWLRLKPGQITDDTEMALCIARAVAKNQGWSREAIAQQFAAWLKSRPVDCGD
FT                   TCRKGIRAFMLHGTLEVPYNQWDGGNGAAMRMLPAALLSLPDTELMKKYALEQARLTHH
FT                   QALSDAACICLGTLLHQILQGASKSSLRREVDGFVIRFPTFCFEPYRGLATGYVVDTMQ
FT                   TVFHWFFKGKDFEDCLVGTVNQGADADTTGAICGMLAGAYYGMESIPRRWLKKMDVKLL
FT                   RELEEHADRLILASPAGRFM"
FT   gene            400380..400820
FT                   /locus_tag="Glov_0421"
FT   CDS_pept        400380..400820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0421"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gsu:GSU2376 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94149"
FT                   /db_xref="UniProtKB/TrEMBL:B3E296"
FT                   /protein_id="ACD94149.1"
FT                   /translation="MREMQVDIWSYQGQAVIAITTNGSLTRDGRAIMGKGVAKQAAERF
FT                   PELRHQLGRLLQVRGNHVHEIMPGLVSFPVEETPYSLPELRLIRRSAEELRLLADQCGW
FT                   TQVLVPRPGCGGGGMRWQEVQPVLEEFFDDRFIVVSAPEHEN"
FT   gene            400984..401805
FT                   /locus_tag="Glov_0422"
FT   CDS_pept        400984..401805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0422"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG:
FT                   ppd:Ppro_3463 radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94150"
FT                   /db_xref="GOA:B3E297"
FT                   /db_xref="InterPro:IPR005980"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B3E297"
FT                   /protein_id="ACD94150.1"
FT                   /translation="MATSCEQMKKIQGHPCFEGNHHKTGRMHLAVAPACNIKCGYCTRK
FT                   HDCANESRPGVASRLMTPSEALDKVREVMASPILGPTMRVVGIAGPGDPLANQQTFETF
FT                   KLVGEAFPDLIKCMSTNGLLLPESLERLHALGLHSLTVTINATNAETAAQIYRHIYYHG
FT                   KRYSGRDAAEILLASQYEGVQRAVELGMVVKVNTVLIPGINEAEVPLIAERIKGLGAFV
FT                   MNVMPLIPQADLAHIPAPSAEQLAEVRNNNERIISQMRHCKQCRADAIGLL"
FT   gene            401858..402658
FT                   /locus_tag="Glov_0423"
FT   CDS_pept        401858..402658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0423"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   gur:Gura_1210 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94151"
FT                   /db_xref="GOA:B3E298"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR041496"
FT                   /db_xref="UniProtKB/TrEMBL:B3E298"
FT                   /protein_id="ACD94151.1"
FT                   /translation="MQISNFTPNDIHPFLSMAKDEGWISTRRELAFLLERSPQGCLVCH
FT                   DGEKPVGFVTAVRHGKSGWIGNLLVAAGERGRGIGTALFKQAMQVLQRADVLTLWLTAS
FT                   SAGRPIYERNGFTVCDRIRRWEGLGGEPEPAAAVKKMHSGWEEIDFLGWGDDRTALLAH
FT                   AADGGSVRGSEGGFLVVQSLGNHRQIGPYGALNLPTAEALMDGIQQQGGATMLDVPAAN
FT                   RAASKLLTSRGFTVCSEVDLMYAGQPPAYHPEYIFGLASMGSMG"
FT   gene            402675..403817
FT                   /locus_tag="Glov_0424"
FT   CDS_pept        402675..403817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0424"
FT                   /product="homocitrate synthase"
FT                   /note="TIGRFAM: homocitrate synthase; PFAM: pyruvate
FT                   carboxyltransferase; KEGG: gur:Gura_3368
FT                   trans-homoaconitate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94152"
FT                   /db_xref="GOA:B3E299"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR013477"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B3E299"
FT                   /protein_id="ACD94152.1"
FT                   /translation="MKTSEIIIDDTTLRDGEQTAGVVFSRREKLAIARLLDLIGVQEIE
FT                   CGIPAMGADEQDSIRALVEMELSARLITWNRALIPEIQASIDCGIKAVDISLSVSDQMI
FT                   SRKLKKDRTAVKEQLKTALGFARQHDLYVSVGGEDASRADLGFLVELLQITRELGGDRF
FT                   RFCDTLGIMDPFSMYDKVAWLRAAVPEVEIEVHTHNDLGMATANAIAGIRAGARFVNTT
FT                   VNGLGERAGNAALEEVVMGLKHACGIETGIDTHRFRELSLMVAKASRRELPSWKAVVGE
FT                   RVFAHESGLHADGVLKDPHNYEGFDPAEVGLVRQIVVGKHSGASGLIDRYRSLGIVLSR
FT                   DDAGLLLPVVRLEALRRKRDLKDRELVNIYLNGAELLKAA"
FT   gene            403957..404190
FT                   /locus_tag="Glov_0425"
FT   CDS_pept        403957..404190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0425"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pca:Pcar_1359 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94153"
FT                   /db_xref="UniProtKB/TrEMBL:B3E2A0"
FT                   /protein_id="ACD94153.1"
FT                   /translation="MCTSGTTVPIAEAAALLATTETRVLMMLKKNELQGNQVDGDWFVD
FT                   KASLQLCGKPLPSDIVKKGCGGGCGSGGCGSH"
FT   gene            404346..404636
FT                   /locus_tag="Glov_0426"
FT   CDS_pept        404346..404636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0426"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ppd:Ppro_1921 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94154"
FT                   /db_xref="UniProtKB/TrEMBL:B3E2A1"
FT                   /protein_id="ACD94154.1"
FT                   /translation="MLIVKAFDLKFKYRKYVETRDEPKFSGLPDPAPFNRDDLYEVLPM
FT                   MGAVMDQLGTADGEILNRLEDFLNTMPRFITSREETFHYLVGCGSQSMEGY"
FT   gene            404649..405080
FT                   /locus_tag="Glov_0427"
FT   CDS_pept        404649..405080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0427"
FT                   /product="nitrogenase-associated protein"
FT                   /note="TIGRFAM: nitrogenase-associated protein; PFAM:
FT                   arsenate reductase and related; KEGG: mca:MCA0223
FT                   nitrogenase-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94155"
FT                   /db_xref="InterPro:IPR006503"
FT                   /db_xref="InterPro:IPR006660"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B3E2A2"
FT                   /protein_id="ACD94155.1"
FT                   /translation="MARITFYTKIGCLTSQKQLALLQEAGHQVVLQDLLAHPWTAEELR
FT                   SYFGDLPVQDWFNPNATRIKSGEIDPEAYAADEALAVMLQDHLLIRRPLMESGNSRRCG
FT                   FDPAVIHDWVGLAKHGDAFVFRGDLSSCSNPGAVASACP"
FT   gene            405274..406401
FT                   /locus_tag="Glov_0428"
FT   CDS_pept        405274..406401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0428"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cvi:CV_1615 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94156"
FT                   /db_xref="UniProtKB/TrEMBL:B3E2A3"
FT                   /protein_id="ACD94156.1"
FT                   /translation="MSMRSCIPAVLSLFSLLVAGCTHTLPPHQEVNQALQKTLNSSGYN
FT                   YTSKSSITNLAVPVKDLKTAASKQQYLEKSLEMARGLSIIADGAIDMKNKKSEVLYNLH
FT                   YDQDNVEVSIKVPLLFDYTTQTLYVGTTLFNTIFPMAPGNKGKLIRIDLNDLLKLTGEK
FT                   SDKLKNLLGKKYFDSVNEGLKQGVLKGFAGLKDERFSDQPLTGDDKAAGLVRHITVRLN
FT                   HEESVTLLLTIADTLIQRLYQDGVLSKEEYGTLMILTDKQKVDTYLATFSMAVTLDIGL
FT                   ASTGQISRIESRFTVAGKDNRYQVGVANISRFSRYDDPLFTIRPELTGTVDHKEILESI
FT                   LAARAAQKAEAEAKKAKEPKEAEPEAPKEEKKIAE"
FT   sig_peptide     405274..405348
FT                   /locus_tag="Glov_0428"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.985) with cleavage site probability 0.449 at
FT                   residue 25"
FT   gene            complement(406437..406733)
FT                   /locus_tag="Glov_0429"
FT   CDS_pept        complement(406437..406733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0429"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ppd:Ppro_1312 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94157"
FT                   /db_xref="GOA:B3E2A4"
FT                   /db_xref="InterPro:IPR024899"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3E2A4"
FT                   /protein_id="ACD94157.1"
FT                   /translation="MSKPDRYVSFVGIDGDSNARKLVALLRRHIDDPARTNRFWELFKD
FT                   KLEKINKPDETSGFSQDELYLVHAYINNIRELFETYDDQPALALLDRIEAESC"
FT   gene            complement(406730..407158)
FT                   /locus_tag="Glov_0430"
FT   CDS_pept        complement(406730..407158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0430"
FT                   /product="peptidylprolyl isomerase FKBP-type"
FT                   /note="PFAM: peptidylprolyl isomerase FKBP-type; KEGG:
FT                   gur:Gura_3325 peptidylprolyl isomerase, FKBP-type"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94158"
FT                   /db_xref="GOA:B3E2A5"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniProtKB/TrEMBL:B3E2A5"
FT                   /protein_id="ACD94158.1"
FT                   /translation="MKQARHGSTVTVSYIGTLDTGRIFDSTETSGPLTFTIGNDQVFSA
FT                   LEQAIIGMAAGETKNILIPAAEAYGPRLDANIIKVKREMFPAERELRIGEKLRIEFSGG
FT                   RERILVILEADQKEVTLDGNHPLAGCDLTFALRLDALQ"
FT   gene            complement(407155..407478)
FT                   /locus_tag="Glov_0431"
FT   CDS_pept        complement(407155..407478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0431"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pca:Pcar_3054 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94159"
FT                   /db_xref="UniProtKB/TrEMBL:B3E2A6"
FT                   /protein_id="ACD94159.1"
FT                   /translation="MALPIDRAEGKRLFRKYRSQRDGIRNCPEMASVCLICESIHIADK
FT                   PDADGMRYCCNCGFAFYRYSCPSCGRTVDGRDPQNPACSRCGRRICSCGACGCPKPDKE
FT                   TPL"
FT   gene            407613..408182
FT                   /locus_tag="Glov_0432"
FT   CDS_pept        407613..408182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0432"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94160"
FT                   /db_xref="UniProtKB/TrEMBL:B3E2A7"
FT                   /protein_id="ACD94160.1"
FT                   /translation="MHTKEATVPLSTSGTALKYLGMRRYQLTMEGRFDPGWICGLSHGL
FT                   AQRKVNITRVEAARGIGRNWQSCLDLDFGAAVLAPDAIDYLALSKSNATVQALAEPIAL
FT                   DDYQLERSTRCEGSLYLEANGPDRLGVLSALLNTFSLFSLFPAEMLAETKNKRIFDRFW
FT                   LKGMGGSAPSREAVAALRERMQEFTL"
FT   gene            complement(408267..408605)
FT                   /locus_tag="Glov_0433"
FT   CDS_pept        complement(408267..408605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0433"
FT                   /product="alkylphosphonate utilization operon protein PhnA"
FT                   /note="TIGRFAM: alkylphosphonate utilization operon protein
FT                   PhnA; PFAM: PhnA protein; KEGG: azo:azo1313 putative
FT                   phosphonoacetate hydrolase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94161"
FT                   /db_xref="InterPro:IPR004624"
FT                   /db_xref="InterPro:IPR013987"
FT                   /db_xref="InterPro:IPR013988"
FT                   /db_xref="UniProtKB/TrEMBL:B3E2A8"
FT                   /protein_id="ACD94161.1"
FT                   /translation="MSELPKCPSCSSSYTYEDGDNYVCPECAHEWPVVAAEEAVAARVV
FT                   RDAFGTELKDGDSVTVIKDLKVKGASAPVKVGTKVRNIRIVDGDHDIDCRIDGFGSMGL
FT                   KSEFVKKA"
FT   gene            complement(408660..409844)
FT                   /locus_tag="Glov_0434"
FT   CDS_pept        complement(408660..409844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0434"
FT                   /product="phosphoribosylglycinamide formyltransferase 2"
FT                   /EC_number="4.1.1.21"
FT                   /note="KEGG: ppd:Ppro_1390 phosphoribosylglycinamide
FT                   formyltransferase 2; TIGRFAM: phosphoribosylglycinamide
FT                   formyltransferase 2; PFAM: phosphoribosylglycinamide
FT                   synthetase; ATP-dependent carboxylate-amine ligase domain
FT                   protein ATP-grasp"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94162"
FT                   /db_xref="GOA:B3E2A9"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005862"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:B3E2A9"
FT                   /protein_id="ACD94162.1"
FT                   /translation="MSIGTPLKAGATKLLLLGSGELGKEVALEAQRLGVEVIAVDRYAD
FT                   APAMQVAHRSHVISMLDREALRRVIEQERPDLIVPEIEAIDTVFLLELEQAGQRVIPTA
FT                   RAANLTMNREGIRRLAAEELGLPTAPYAFASSAAELRAAADSIGFPCVVKPIMSSSGKG
FT                   QSVVKTAAEVDTAWQYAMDGARGASDTVIIEGFIDFDYEITQLTVRHAGGTSFCPPIGH
FT                   VQIKGDYHESWQPMAMSPAALAEARRQAEMVTTALGGYGIFGVELFIKGDTVLFSEVSP
FT                   RPHDTGMVTMISQNLSQFELHVRAILGLPVPEILNLAPSASHVILATDSQETVRFTGVA
FT                   EALSVPTAKLRLFGKPDTRPGRRMGVALTQGASTDEARSRAEASAHCVRIVPQG"
FT   gene            complement(410145..410681)
FT                   /locus_tag="Glov_0435"
FT   CDS_pept        complement(410145..410681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0435"
FT                   /product="Peptidase M23"
FT                   /note="PFAM: Peptidase M23; KEGG: gur:Gura_3990 peptidase
FT                   M23B"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94163"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:B3E2B0"
FT                   /protein_id="ACD94163.1"
FT                   /translation="MKRSGIKILGTLAVIAVILISCGLLVPERLMIPVQGATKADWNAK
FT                   SFWFSPWGASGVHKGIDIFAREGTPVIAASSGLVVNAGYIPAGGNVVSILGPKWRVHYY
FT                   AHLKTVHVTSGAFVSKGSVIGTVGATGNAAGKAPHLHYAIITQIPYPWLFKAEKYGFER
FT                   MFYLNPLEKLHTQSR"
FT   gene            complement(410706..411434)
FT                   /locus_tag="Glov_0436"
FT   CDS_pept        complement(410706..411434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0436"
FT                   /product="SMC domain protein"
FT                   /note="PFAM: SMC domain protein; SMART: AAA ATPase; KEGG:
FT                   mmw:Mmwyl1_2458 SMC domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94164"
FT                   /db_xref="GOA:B3E2B1"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038729"
FT                   /db_xref="UniProtKB/TrEMBL:B3E2B1"
FT                   /protein_id="ACD94164.1"
FT                   /translation="MQARPYLKAISLKEDMITDWDKYPFNIPAIRNINTLQFHSGVTFF
FT                   VGENGAGKSTLIESIALAMGFSSEGGTRNFNLATADTISTLHRYLKTIRSFATPKDYYF
FT                   LRAESFYNVATYMDQVGGITSGYGDKLLHERSHGEAFMAALTLKLRGKGLYIFDEPEAA
FT                   LSPTRQMAAISAIHQLVKKESQFIIATHSPILLSYPDAKILHLDEHGISEISYEETEHF
FT                   SITRSFLNNYKKLLPTLLED"
FT   gene            complement(411458..411916)
FT                   /locus_tag="Glov_0437"
FT   CDS_pept        complement(411458..411916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0437"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94165"
FT                   /db_xref="UniProtKB/TrEMBL:B3E2B2"
FT                   /protein_id="ACD94165.1"
FT                   /translation="MCYMVHISTDSSTDLTDRNTELVRFEKVTNPESDPCLSVLEFPNK
FT                   WEVGSKTGCGCTFRHLYVESVELGFSKPEDWYQEEKDELDATRQLYQALNDLLESGCQV
FT                   DLVDRWEEAAPDDITTIKVSLDEVSEEAFRMFEGHKFKLKKTKIQPHR"
FT   gene            complement(411993..412625)
FT                   /locus_tag="Glov_0438"
FT   CDS_pept        complement(411993..412625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0438"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gfo:GFO_0869 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94166"
FT                   /db_xref="UniProtKB/TrEMBL:B3E2B3"
FT                   /protein_id="ACD94166.1"
FT                   /translation="MIQQGEEVRRTYRSDGSGWGWVDTGAMKGFRSAALSFIERVYGKD
FT                   HSHYLEFHKAADGTDKHDAEVGIAILTSIKREISGGWLFSLKGLISAEIFSDFIEMAQH
FT                   LLSQNYKDPAAVIAGSVLEEHLRQLAISNGVEIEVETDGVLRPKKADRLNSDLAKAEVY
FT                   SKLDQKAVTMWLDLRNKAAHGHFQEYTKDQVSNMIQSVIEFMVRVSP"
FT   gene            412752..413861
FT                   /locus_tag="Glov_0439"
FT   CDS_pept        412752..413861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0439"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="PFAM: transposase IS111A/IS1328/IS1533; transposase
FT                   IS116/IS110/IS902 family protein; KEGG: gme:Gmet_2794
FT                   IS111A/IS1328/IS1533/IS116/IS110/IS902 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94167"
FT                   /db_xref="GOA:B3E2B4"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:B3E2B4"
FT                   /protein_id="ACD94167.1"
FT                   /translation="MEKCITYVGLDVHKNSIDVALADEGRDKEVRYYGTIDGSLDALDK
FT                   VLRKLVSRGTELRFVYEAGPCGYDIYRHLTRKGFDCIVVAPSLIPKKSGSRIKNDRRDA
FT                   EMLARLHRAGELTPVYVPRIEDEAMRDLCRARIDAKNAERKARQQLNAFLLRSGFRYSG
FT                   KTLWSLAHWRWISDIHMTHSAQQITLQEYVDAVRSNTERVDRITEQICLLAAEWRLGPV
FT                   VEALQALRGVSLVVASTTVAELGDLSRFDNPRHLMAYLGLVPSEHSSGESTQRGGITKT
FT                   GNGHARRMLVEAAWSYRLPARVSRRLRDRQQNLPQAVWEIAWKAQLRLCARYKRLVTKG
FT                   KQAQVVITAIARELSAFMWAIAQAVPVAS"
FT   gene            414219..415301
FT                   /locus_tag="Glov_0440"
FT   CDS_pept        414219..415301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0440"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   gsu:GSU2597 ISGsu2, transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94168"
FT                   /db_xref="GOA:B3E2B5"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:B3E2B5"
FT                   /protein_id="ACD94168.1"
FT                   /translation="MRGTDVQNEALFAYVTPESFVPKDHPLRAIRSMADQALSEMSPLF
FT                   DSMYADSGRSSIAPEKLLKAQLLMILFSIRSNRQLVEQIRYNFLYRWFLGMGLDDEIWD
FT                   HSSFTKNHERLIGSDVAAEFLSRILAQAERKRLLSREHFTVDGTLIEAWASIKSFKPKD
FT                   GPPSAGGGKNKSVDFKGKQLKNDTHSSSTDPNARLYRKGNTKEAKLCYQGHTLMENRNG
FT                   LIVKTSVTTATGTGEREAAKAMIRQLPRTTRRITVGADKGYDTEGFVKELRQINVTPHV
FT                   AQNNTRRKSGIDGRTTAHPNYSISQRIRKRIEEGFGWMKTIGRLRKTMYRGIEKIAWQL
FT                   DLHAAAYNLVRMKNLGLGVT"
FT   gene            complement(415896..416363)
FT                   /locus_tag="Glov_0441"
FT   CDS_pept        complement(415896..416363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0441"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ppd:Ppro_2216 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94169"
FT                   /db_xref="GOA:B3E2B6"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR025517"
FT                   /db_xref="UniProtKB/TrEMBL:B3E2B6"
FT                   /protein_id="ACD94169.1"
FT                   /translation="MISSTEHRTMLSPLVLTTFLVVGISGVLLAFHVKTGGVKALHEWI
FT                   GYAFMAAGMLHLAVNWRTFASYVRQRASLMAITAGLVISLFTLYAGASLSPQKSHPLIQ
FT                   VFDQDRNGELDADEIADATITLQKMDNNRDGSVSPSELMADSTRSKGKQKI"
FT   sig_peptide     complement(416271..416363)
FT                   /locus_tag="Glov_0441"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.729) with cleavage site probability 0.700 at
FT                   residue 31"
FT   gene            416703..417365
FT                   /locus_tag="Glov_0442"
FT   CDS_pept        416703..417365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0442"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: swo:Swol_1688 methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94170"
FT                   /db_xref="GOA:B3E2B7"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR026669"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B3E2B7"
FT                   /protein_id="ACD94170.1"
FT                   /translation="MQIDAKKFDLIARNVFAPAYSLLAEQIMERTGIMSGLCLDLGSGG
FT                   GYLGLALAWNSKLRVCLLDESAEMQAIAEQNIYDKRLDNRVVALCGDVHYLPLKNNSVD
FT                   LVVSRGSVYFWDDLAQVLREIWRVLAPGGQVCIGGGFGSKALKDEIVAKMRQTEPDWQP
FT                   RCGKFDDACFHDAVKLAGIPDAELLKDESGTWLIFKKPFEYLLERMADNYVTACDYK"
FT   gene            417376..417732
FT                   /locus_tag="Glov_0443"
FT   CDS_pept        417376..417732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0443"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sfu:Sfum_3702 periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94171"
FT                   /db_xref="UniProtKB/TrEMBL:B3E2B8"
FT                   /protein_id="ACD94171.1"
FT                   /translation="MTIQDGIRSLLCSVTALALLALPLISEARTITDMTGRKVQVPDRI
FT                   TRVYASSPPATYLLYALDPALIVGLNFPLNETEERFLKPADSRFRTAVRRSAAFMITTK
FT                   QCVLPEQGRQLIST"
FT   sig_peptide     417376..417462
FT                   /locus_tag="Glov_0443"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.983) with cleavage site probability 0.828 at
FT                   residue 29"
FT   gene            417729..418811
FT                   /locus_tag="Glov_0444"
FT   CDS_pept        417729..418811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0444"
FT                   /product="ABC-type Fe3+ transport system periplasmic
FT                   component-like protein"
FT                   /note="KEGG: gur:Gura_3328 ABC-type Fe3+ transport system
FT                   periplasmic component-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94172"
FT                   /db_xref="UniProtKB/TrEMBL:B3E2B9"
FT                   /protein_id="ACD94172.1"
FT                   /translation="MKLQSVMPGFVLACVMHPSQNYENSQRRGSTPMIGAGLNLLALLP
FT                   CPVKVPIEQAFDEYLATLPPERAAALRCQLEGNANIESDYYNTVEQLTELDQFPDIIIS
FT                   PGFNSLFERPFVERFIQTNRFVSVNDYAGDRHLSALGVCDPTGHYTMLAMNLLVPVVDH
FT                   RRLGGRPVPRCWADLLKREYENSLAIRGHKDGTFCETLLLAIYKDTGVEGLRTMGRNVR
FT                   YGWHPSQMVKAALGSSADAPAISVMPLFFAQTLVGKEQYSIIWPDDGALISPVTMLVKT
FT                   EKRAELDDLLAFWAGPQVASIFSGAFFPAVHPGVDNQLPEAATFKWIGWDYIINNDIKK
FT                   LISGVNAAFRQGRGENIRCA"
FT   sig_peptide     417729..417794
FT                   /locus_tag="Glov_0444"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.729) with cleavage site probability 0.716 at
FT                   residue 22"
FT   gene            418802..419488
FT                   /locus_tag="Glov_0445"
FT   CDS_pept        418802..419488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0445"
FT                   /product="cobalamin synthesis protein P47K"
FT                   /note="PFAM: cobalamin synthesis protein P47K; KEGG:
FT                   ppd:Ppro_0345 cobalamin synthesis protein, P47K"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94173"
FT                   /db_xref="GOA:B3E2C0"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR012202"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3E2C0"
FT                   /protein_id="ACD94173.1"
FT                   /translation="MRLITVAGPPSSGKTAIICKTAEALQADGVSVGVIKFDCLSSGDQ
FT                   ALYERRGIPARTGLSGNLCPDHFYVSNIEECLDWGLQSGFDLLISESAGLCNRCAPHIK
FT                   EVCAVCVIDNLSGVETPRKIGPMLKMADIVVITKGDIVSQAEREVFVHRIRQVNSSAVI
FT                   IHVNGLTGQGGHELGRLLQDAAAVDSLQGKLLRFSMPAALCSYCLGQRRIGADFQMGNV
FT                   KKMELG"
FT   gene            419494..420495
FT                   /locus_tag="Glov_0446"
FT   CDS_pept        419494..420495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0446"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: gur:Gura_3326 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94174"
FT                   /db_xref="GOA:B3E2C1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3E2C1"
FT                   /protein_id="ACD94174.1"
FT                   /translation="MERTYAAMTLERLFSEHPHAREFFSALGLSALPEDQTLGRTVAAL
FT                   DEELLLDVGIERQELLGQFCDYMAGVERLRNQQQALVSSVTVLGGHDKSGNPENFRLEL
FT                   RPGEVTCIVGPTGSGKSRFLADIEWLAQGDSPTGRTVLINGAAPDLARRYAVEQKLVAQ
FT                   LSQNMNFVMDLSAEEFIRLHAESRMIADPAAITATILELANSLAGEQFTPVTPVTALSG
FT                   GQSRALMIADVACLSSSPIVLIDEIENAGIDRKRALSLLADQDKIVLMATHDPILALMG
FT                   QQRLIFKNGGVSSIRSTSPAERANLTLFEQMDARLTAVRHALRNGEEIAGNF"
FT   gene            420782..421588
FT                   /locus_tag="Glov_0447"
FT   CDS_pept        420782..421588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0447"
FT                   /product="transcriptional regulator, ModE family"
FT                   /note="PFAM: regulatory protein LysR; TOBE domain protein;
FT                   KEGG: pvi:Cvib_1354 transcriptional regulator, ModE family"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94175"
FT                   /db_xref="GOA:B3E2C2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR004606"
FT                   /db_xref="InterPro:IPR005116"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR016462"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B3E2C2"
FT                   /protein_id="ACD94175.1"
FT                   /translation="MNSAGTVELNGNLWFTRDTSKFLGNDRIALLEKIDELGSITRAAK
FT                   AVGISYKTAWEIVNQINNLAAVPLVDRATGGKGGGGASLTVTGREVLEQFRVVQEEHGK
FT                   FLKNLDMRLGDTNNLYQFLRRISMKVSARNVFSGTVTSIAKGAVNAEVSLGLKGATAIT
FT                   AVVTNGAITNLGLQEGMSAYAIVKASSVVIGTDLAEAKLSTRNQLTGTIAKLVEGPVSC
FT                   EVDLELPGGNTISAVITDGSAKRLGLKVGGTATALFKASSVILGVS"
FT   gene            421627..422631
FT                   /locus_tag="Glov_0448"
FT   CDS_pept        421627..422631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0448"
FT                   /product="modD protein"
FT                   /note="TIGRFAM: modD protein; PFAM: Quinolinate
FT                   phosphoribosyl transferase; KEGG: cte:CT0453 molybdenum
FT                   transport system protein ModD"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94176"
FT                   /db_xref="GOA:B3E2C3"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR006242"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022412"
FT                   /db_xref="InterPro:IPR027277"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR037128"
FT                   /db_xref="UniProtKB/TrEMBL:B3E2C3"
FT                   /protein_id="ACD94176.1"
FT                   /translation="MGRFCRLSPDKGSGEGLQGWGGLRTQGASIELSLFSALSLYFEHH
FT                   NGERGLGMVNCLADSEIERFLEEDIPYGDLTTHLLGIGQQQGEIRFSTRHHTTLCCTEE
FT                   AARVLTKSGCKITWQTASGTRLPPGETFLLATGPAQALHAGWKVAVNLLEYGSGIATRT
FT                   AGIVTAAREVNPCIAVLTTRKTFPGTKKLAIKAICAGGALPHRLGLSETVLVFKQHTAF
FT                   MGGLEPLLRHVETLKREALETKIIVEADSPEEALLIAQSGADVVQMDKLPADQLKVLVH
FT                   EVRQINPAVKVSAAGGINEQNAAEYAASGVDILVLSSVYFGKPADIGAVIVPV"
FT   gene            422659..423414
FT                   /locus_tag="Glov_0449"
FT   CDS_pept        422659..423414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0449"
FT                   /product="molybdenum ABC transporter, periplasmic
FT                   molybdate-binding protein"
FT                   /note="TIGRFAM: molybdenum ABC transporter, periplasmic
FT                   molybdate-binding protein; PFAM: extracellular
FT                   solute-binding protein family 1; KEGG: mca:MCA1377
FT                   molybdenum ABC transporter, periplasmic molybdate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94177"
FT                   /db_xref="GOA:B3E2C4"
FT                   /db_xref="InterPro:IPR005950"
FT                   /db_xref="UniProtKB/TrEMBL:B3E2C4"
FT                   /protein_id="ACD94177.1"
FT                   /translation="MKTVVTFILMAGLSLCLTISASAADLHLAVAANFTGPMEQLKPLF
FT                   EKASGHKLIISYGTVGKFYAQIKNGAPFELLISADDETPIRLEKDGLALPETRFTYAIG
FT                   KLMLWSTKPGLVDASGEVLKQADFKRLAIASPKLAVYGAAGVEVMKKLGVYEQLQSRLV
FT                   FGENISQAYQFVATGNADLGFVALSQIYKNGNYAAGSHWQVPSNLYPRIRQDAVLLSKG
FT                   RDNPAGKALLVFLKTTETKKIIRSYGYDI"
FT   sig_peptide     422659..422730
FT                   /locus_tag="Glov_0449"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.985 at
FT                   residue 24"
FT   gene            423435..424202
FT                   /locus_tag="Glov_0450"
FT   CDS_pept        423435..424202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0450"
FT                   /product="molybdenum ABC transporter, periplasmic
FT                   molybdate-binding protein"
FT                   /note="TIGRFAM: molybdenum ABC transporter, periplasmic
FT                   molybdate-binding protein; PFAM: extracellular
FT                   solute-binding protein family 1; KEGG: mca:MCA1378
FT                   molybdenum ABC transporter, periplasmic molybdate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94178"
FT                   /db_xref="GOA:B3E2C5"
FT                   /db_xref="InterPro:IPR005950"
FT                   /db_xref="UniProtKB/TrEMBL:B3E2C5"
FT                   /protein_id="ACD94178.1"
FT                   /translation="MKLFKTLLVVSLLLLSTVVAHAEKITVAAAADLKFAMDEIVTGFK
FT                   KSHNGAELDVIYGSSGKFHTQIQQGAPYDLFFSADIKYPQELAAKGLAASSVVPYAVGR
FT                   VVLWSNSLDASKMTLSSLTDPKITRIAIANPKHAPYGKRAEEALKSSGLWDKLQPKLVY
FT                   GENIAHTAQFVQTGNAQVGIIALSLALNPELSKKGGYHLIPDKLHNPLEQGYIITKRGA
FT                   GKPLARQFAEYMGTKPARSVMTKYGFVLPGEVK"
FT   sig_peptide     423435..423503
FT                   /locus_tag="Glov_0450"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.991 at
FT                   residue 23"
FT   gene            424205..424882
FT                   /locus_tag="Glov_0451"
FT   CDS_pept        424205..424882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0451"
FT                   /product="molybdate ABC transporter, inner membrane
FT                   subunit"
FT                   /note="TIGRFAM: molybdate ABC transporter, inner membrane
FT                   subunit; PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: mca:MCA1379 molybdenum ABC
FT                   transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94179"
FT                   /db_xref="GOA:B3E2C6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011867"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B3E2C6"
FT                   /protein_id="ACD94179.1"
FT                   /translation="MLLSDSDLQAVWLTIRLASVVTVILLLVGTPLAWWLARTRSWAKG
FT                   PLGAMVALPLVLPPSVLGFYLLLAMGPNGPLGWLTTRLGVGPLPFTFWGLVLASVFYSL
FT                   PFMVQPLQNSFEAIGERPLQVAATLGASPLNTFFTVALPLAKPGFLTASIMTFAHTVGE
FT                   FGVVLMIGGNIPGVTRVASVQIYDHVEALEYGQAHRLAAVMLIFSFLVLLGMYAWKPRP
FT                   QKG"
FT   gene            424889..425941
FT                   /locus_tag="Glov_0452"
FT   CDS_pept        424889..425941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0452"
FT                   /product="molybdate ABC transporter, ATPase subunit"
FT                   /note="KEGG: ppd:Ppro_1457 molybdate ABC transporter,
FT                   ATPase subunit; TIGRFAM: molybdate ABC transporter, ATPase
FT                   subunit; PFAM: ABC transporter related; TOBE domain
FT                   protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94180"
FT                   /db_xref="GOA:B3E2C7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005116"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR011868"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3E2C7"
FT                   /protein_id="ACD94180.1"
FT                   /translation="MELQLQLRKQQGDFALELDLKVSGERIGIFGPSGSGKSTLVNLLA
FT                   GLARPDAGQILLDGQPLFDSSNRINLLPHRRRIALVFQQHGLFPHLTVRKNLLYGYQRC
FT                   PAAERRIELAEVAEVLEITDLMGQMPDTLSGGQSQRVALGRAILASPRLLLMDEPLSAL
FT                   DDDLRYRIIPYLNLVSERFRIPFVFISHSLVEMRLMADQVAVLEKGQLAGVVAPEELAR
FT                   QRMGQSASGYINLLELGMPEEQEGLLAFPWAGQELLLSGGAGTEPGTFELSSRDIILCK
FT                   RHPDAISARNLLPCMVRSLFESGKKTGIELDCNGSSLVAEVVPAAAQELQITPGSTVWA
FT                   AIKASAFRRL"
FT   gene            complement(425944..426987)
FT                   /locus_tag="Glov_0453"
FT   CDS_pept        complement(425944..426987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0453"
FT                   /product="Ion transport 2 domain protein"
FT                   /note="PFAM: TrkA-N domain protein; Ion transport 2 domain
FT                   protein; KEGG: bha:BH3340 potassium channel protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94181"
FT                   /db_xref="GOA:B3E2C8"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B3E2C8"
FT                   /protein_id="ACD94181.1"
FT                   /translation="MYQVLHYFMKTMLRNPPEYLRVLVLMLAVLLYGTTGFLYFELPAN
FT                   PDLSWADGLWYTIVTIATVGYGDFFPKSFGGRFLVGWPIMVFGIGLLGYALSMVAAALV
FT                   TSKTKEIKGMSIFKLSDHLVIFNFAGLAKVERILLELALDKAVGISMPVILVDEQLDEL
FT                   PVELQKRGVHYVRGNPTRDETLQRAAIDQARHAVILTRDPTDPASDNLNVAIALAIEGR
FT                   CKQVNTVVECIDPASEELLRKAGCDRIVCTSRFDAHFLSQELLNPGVQEVLGDLLSNGQ
FT                   GQQIYLVPVSNTGSFEGLAARCRQQGHLALGISCTDGKVRMNPPGIEQVTAGCRLVTIG
FT                   PSRLDGV"
FT   gene            complement(426998..427576)
FT                   /locus_tag="Glov_0454"
FT   CDS_pept        complement(426998..427576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0454"
FT                   /product="nuclease (SNase domain protein)"
FT                   /note="PFAM: nuclease (SNase domain protein); KEGG:
FT                   pfu:PF1298 putative endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94182"
FT                   /db_xref="InterPro:IPR016071"
FT                   /db_xref="InterPro:IPR035437"
FT                   /db_xref="UniProtKB/TrEMBL:B3E2C9"
FT                   /protein_id="ACD94182.1"
FT                   /translation="MGRATVAFWSVILILAGASAFYGINAEKQRRSVQSAGGKIESGDL
FT                   VRLVKVIDGDSLVAAREGQPPVTIRIVGIKSFDAKVEKDVVTPFAQAAMETIQRSMLDR
FT                   PVRVLLATTPKDKYGRYLATLYVDDEDIAIRLIRQGLALVYTVYPFPAMQGYLQEQEQA
FT                   RAGRRGLWSNATATERALALIREWRNQNQ"
FT   gene            427684..428847
FT                   /locus_tag="Glov_0455"
FT   CDS_pept        427684..428847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0455"
FT                   /product="aminotransferase class I and II"
FT                   /note="PFAM: aromatic amino acid beta-eliminating
FT                   lyase/threonine aldolase; aminotransferase class I and II;
FT                   KEGG: gur:Gura_3621 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94183"
FT                   /db_xref="GOA:B3E2D0"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B3E2D0"
FT                   /protein_id="ACD94183.1"
FT                   /translation="MRFSLNEHVKAVHPPPISEVKEWAAQRPADAAALIDLCQAVPDYA
FT                   PPAGMISHIQQMALDPLTSRYSPDEGLAEVRESVCHRYRRRYAAKINPEQVCLTVGASA
FT                   AFWLAMLTLCHAGDEVIVQLPCYFDHPMALGSLGIRPVYAPYKENEKGLPNPDSIARLI
FT                   TPRTRAILLVSPSNPTGTVIPPDLLRRLYFLAQQHRIALILDETYSDFIEGMPHDLFTM
FT                   EEWGSTLLQIMSFGKSYALTGYRAGMLAAAPEVIRQALKIQDTMTVCQPRITQLALQYG
FT                   LDHLDQWVEINRRMMTFRHNLFTEEFSLPGNRFRLAASGSFFAWVKHPFPGKSGREVAR
FT                   RLAVEAGILTLPGEVFGPGLEDYLRLAFGNIKEKAIPEAIHRFRRFA"
FT   gene            428894..429496
FT                   /locus_tag="Glov_0456"
FT   CDS_pept        428894..429496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0456"
FT                   /product="small GTP-binding protein"
FT                   /note="TIGRFAM: small GTP-binding protein; PFAM:
FT                   GTP-binding protein HSR1-related; KEGG: ppd:Ppro_3276
FT                   GTPase EngB"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94184"
FT                   /db_xref="GOA:B3E2D1"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019987"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030393"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3E2D1"
FT                   /protein_id="ACD94184.1"
FT                   /translation="MHIHQTTFIKSAVKPADYPPVDLPEIAFAGRSNVGKSSLINVIVE
FT                   RKALVRTSSTPGRTQLINFFQVTGVPFSLNLVDLPGYGYAKVPLDVKRQWGPMMERYLS
FT                   GRESLRGVVLILDIRRIPSEEDLQMLNWLRSYKRRPIIVLTKCDKVTKNERARQTAAIA
FT                   ARLEMDKSQLIHFSALSKDGRDTVWQAIQDAVEEDAP"
FT   gene            429493..430293
FT                   /locus_tag="Glov_0457"
FT   CDS_pept        429493..430293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0457"
FT                   /product="protein of unknown function DUF198"
FT                   /note="PFAM: protein of unknown function DUF198; KEGG:
FT                   ppd:Ppro_3275 protein of unknown function DUF198"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94185"
FT                   /db_xref="GOA:B3E2D2"
FT                   /db_xref="InterPro:IPR003801"
FT                   /db_xref="InterPro:IPR022838"
FT                   /db_xref="UniProtKB/TrEMBL:B3E2D2"
FT                   /protein_id="ACD94185.1"
FT                   /translation="MTRTMPDLQQSRDHRKIPIRKVGVKNISYPIVVQDKHRSLQHTVA
FT                   TVDMYVDLPHQFKGTHMSRFVEILNRHREQIALDRLEEILQEMRQKLGAETAHLRVEFP
FT                   YFIDKAAPVSRARSLMEYTCEFDACLNGDQLDFVLGVKVPVTSLCPCSKELSQFGAHNQ
FT                   RSIMTVKVRYREFIWIEDLVELIEQCGSSPLYALLKRADEKHVTEQAYLNPRFVEDMVR
FT                   EAYLRLAASENITWFSVEAENFESIHNHSAYAEVELDRRDLRQP"
FT   gene            430290..431018
FT                   /locus_tag="Glov_0458"
FT   CDS_pept        430290..431018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0458"
FT                   /product="purine or other phosphorylase family 1"
FT                   /note="PFAM: purine or other phosphorylase family 1; KEGG:
FT                   ppd:Ppro_3274 purine and other phosphorylases, family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94186"
FT                   /db_xref="GOA:B3E2D3"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR019963"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:B3E2D3"
FT                   /protein_id="ACD94186.1"
FT                   /translation="MRPILILSAVPCELELLLNALEEPYCDPDAVFSATEGNIGATRLV
FT                   CCAGGIGKANAASAATSLVERYHPQLIINIGCGGAYPGSGLSVGDLAVASDEIFGDEGV
FT                   LTPAGWMDMKQVGLPLFSEGERAWYNSIPLARHEAQKAMQLADSHGLQLVRGRFVTVSS
FT                   CSGTKARGLELARRYQAVCENMEGAAIALTALRYGGIPCLEIRGISNLVEDRDMARWDI
FT                   GRAVEAAQRFVIKVIEEYSK"
FT   gene            complement(431025..431576)
FT                   /locus_tag="Glov_0459"
FT   CDS_pept        complement(431025..431576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0459"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ppd:Ppro_1156 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94187"
FT                   /db_xref="InterPro:IPR025392"
FT                   /db_xref="UniProtKB/TrEMBL:B3E2D4"
FT                   /protein_id="ACD94187.1"
FT                   /translation="MTRLALLALALLLPVSSGAATYSWTDPAGTIHFTDDIGAVPPKYR
FT                   TKALRQVAGEETGSDTRPAAATPASRPDAAPAAKAGPPAADANGGATATSATRFGDRSA
FT                   AAWQTEFRQLRAELKRIEQDRELLKQQIGEGKRMLSNQQVTDYNIRTKQLNQEYEATRL
FT                   RFNQLVEQANKAGLPPEFSQ"
FT   sig_peptide     complement(431517..431576)
FT                   /locus_tag="Glov_0459"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.932 at
FT                   residue 20"
FT   gene            complement(431605..432291)
FT                   /locus_tag="Glov_0460"
FT   CDS_pept        complement(431605..432291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0460"
FT                   /product="alanine racemase domain protein"
FT                   /note="PFAM: alanine racemase domain protein; KEGG:
FT                   gsu:GSU2544 conserved hypothetical protein TIGR00044"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94188"
FT                   /db_xref="GOA:B3E2D5"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR011078"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:B3E2D5"
FT                   /protein_id="ACD94188.1"
FT                   /translation="MSVTGNLAAVQARIQRACTISGRAPSTVRLVAVSKLHPAALVAEA
FT                   AAAGQTVFGENYVQELVDKAAQLARPVEWHMIGHLQSNKVKYLPGIVSMIHTVDRLSLA
FT                   QEIDRQWRDKQSAACDILVQVNVSGEATKSGTTATEAVELVRHIAKLPNVRVRGLMTMP
FT                   PFFDDPEAARPYFRELRLLADRISSEQIPAVEMTELSMGMSGDFEVAIEEGATLVRVGT
FT                   AIFGGR"
FT   gene            complement(432295..434004)
FT                   /locus_tag="Glov_0461"
FT   CDS_pept        complement(432295..434004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0461"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: histidine kinase HAMP region domain protein;
FT                   chemotaxis sensory transducer; Cache type 2 domain protein;
FT                   KEGG: gme:Gmet_2825 methyl-accepting chemotaxis sensory
FT                   transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94189"
FT                   /db_xref="GOA:B3E2D6"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR033480"
FT                   /db_xref="UniProtKB/TrEMBL:B3E2D6"
FT                   /protein_id="ACD94189.1"
FT                   /translation="MKRYRDWCIQCKIVSITLLTMLLLISALFGYILPMFRDNLMTEKE
FT                   LATRHIVELAMGVLEQYDAAAKSGKLPLEQAQQEATEQIARLRYEGKEYLWINDLGKPA
FT                   PRMIMHPTVPALNGKVLDDTKFNKATLMQDAADGPTKKLDNMNLFSAFVEVADRAGHGF
FT                   VMYQWPKPKQGGGTTEELYPKLSYVKKFAPWGWVLGSGIYVDDVDKQAARVMWTLLAGT
FT                   LLLAACGIAIAVAIGRGVVRPMNTMQQALEQMASGEGDLTRRLPIQREDETGVLARTFN
FT                   RFLENLHNIIRDVSQGTQELNSAADRLHATAEHIADSSLEMSSQSVSVATAVEEMAATS
FT                   QSIAQSCAQAYENANRACLTAQDGSAVVSQAVASIRAIADRVQESSHTVETLGARSDQI
FT                   GQIIGTIEDIADQTNLLALNAAIEAARAGEMGRGFAVVADEVRALAERTTRATREIGEM
FT                   IKVIQQETATAVASMGAGVQAVEQGTIEAAKSGQALEEILAQISEVTSQINQIATAAEE
FT                   QTATTNDISGNMQRIVSAVDTSTAQAHATGQEATELANMSGNLANLVGRFRV"
FT   sig_peptide     complement(433912..434004)
FT                   /locus_tag="Glov_0461"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.802) with cleavage site probability 0.801 at
FT                   residue 31"
FT   gene            complement(434004..434603)
FT                   /locus_tag="Glov_0462"
FT   CDS_pept        complement(434004..434603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0462"
FT                   /product="maf protein"
FT                   /note="TIGRFAM: maf protein; PFAM: Maf family protein;
FT                   KEGG: ppd:Ppro_3255 maf protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94190"
FT                   /db_xref="GOA:B3E2D7"
FT                   /db_xref="InterPro:IPR003697"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:B3E2D7"
FT                   /protein_id="ACD94190.1"
FT                   /translation="MAATDPVVLASASPRRSELLELAGIRFRVAPADIPEEPMPGEEAV
FT                   EHALRLAEEKARAAAGREADGQFFIGADTIVVLDGRIMGKPTDQNDAVRMLTELSGKGH
FT                   EVVTAYAVLDKQSNVCIKRAVRTQVVFKQLSEQEISDYVKTGCPMDKAGAYAIQGGAAH
FT                   FVREIHGSYTNVVGLPTCELVETLHTIGAWPKEEQH"
FT   gene            complement(434590..434868)
FT                   /locus_tag="Glov_0463"
FT   CDS_pept        complement(434590..434868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0463"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gsu:GSU2546 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94191"
FT                   /db_xref="GOA:B3E2D8"
FT                   /db_xref="UniProtKB/TrEMBL:B3E2D8"
FT                   /protein_id="ACD94191.1"
FT                   /translation="MQHDDQKELQEASLVGRIFSLEVALFLMGVASLIYGLMNHIESNI
FT                   FFGILIIPGVFILHKVKKKDWKAHWAELEEQKRREQEREEERRRGGN"
FT   gene            complement(434858..436258)
FT                   /locus_tag="Glov_0464"
FT   CDS_pept        complement(434858..436258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0464"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="PFAM: FAD linked oxidase domain protein; KEGG:
FT                   gsu:GSU3296 glycolate oxidase subunit GlcD, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94192"
FT                   /db_xref="GOA:B3E2D9"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:B3E2D9"
FT                   /protein_id="ACD94192.1"
FT                   /translation="MLALSIIEELRAIVGPENLATEKQDLICYGYDATQMEFLPAAVVH
FT                   PANAEETAAVLRLANQRTFPVFPRGAGSGFTGGALPKAGGVVLVTTRMNRILRIDTENL
FT                   IAEVEPGVVTEDFQKAVEKLGLFYPPDPASLKFSTLGGNVAENAGGPRCVKYGVTKDFV
FT                   MGLELVLPTGEIIRTGTETYKAVVGYDLTRLLCGSEGTLGVITKIIFKLLPLPEAKKTM
FT                   LTIFDSIDGAARAVSTIIGAKIIPTTLEFMDYATLQCVEKRFNLGIPPEGRAVLLIEVD
FT                   GDRELIEKQAARIHDLIKPLGLVQFRAAKDDAESEALWKVRRLVSPSLRDVNPHKFNED
FT                   IVVPRSKVPVVIRQIEKIQQKYDIPIVNFGHAGDGNIHVNVMINKEIPGQEEKAHEAIK
FT                   EIFQAALDLNGTMSGEHGVGLAKQPFIEMELTPAQIRVMQGIKLALDPNNILNPGKIFP
FT                   WKDTPHAA"
FT   gene            complement(436363..437772)
FT                   /locus_tag="Glov_0465"
FT   CDS_pept        complement(436363..437772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0465"
FT                   /product="PAS/PAC sensor signal transduction histidine
FT                   kinase"
FT                   /note="KEGG: ppd:Ppro_3595 PAS/PAC sensor signal
FT                   transduction histidine kinase; TIGRFAM: PAS sensor protein;
FT                   PFAM: ATP-binding region ATPase domain protein; histidine
FT                   kinase A domain protein; PAS fold-3 domain protein; PAS
FT                   fold-4 domain protein; PAS fold domain protein; SMART: PAS
FT                   domain containing protein; PAC repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94193"
FT                   /db_xref="GOA:B3E2E0"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B3E2E0"
FT                   /protein_id="ACD94193.1"
FT                   /translation="MRRRSEEHSRDWSELRNRIIGLGEQSSHKNYYSELKARLRELEES
FT                   RRSLAAANASLQAVMDAATEVAIIATSPDGTITIFNQGAENLLGYRAEELIGTATVLLF
FT                   HLPLEVEQRGAELSAQYSHTVTGFQTFIESTEHGHAEKREWTYICKDGRYLQVELVVTA
FT                   IRGENGVINGYLGVAQDITERKQAEASLRRMNLDLEEARQATEKLNRLLEQRISEALVD
FT                   IRHKDRLLIQQGRQAAMGEMISNIAHQWRQPLNNIALLIQNLQLLCNSGELSPQQCDQD
FT                   VAKALEIIQFMSGTINNFRNIFRQDATPQRFSVNQAVAKIVDFLAAGMTGHGITVSCVE
FT                   KEEVSITGYPGEYHQALINILNNAREALLFRAVPKALIRITIFKEQGQGVVTVWDNGGG
FT                   IDAAILPKIFDPYFTTKFKSQGTGLGLFMAKAIIENSMQGRLTARNINGGAELRIEVSS
FT                   PETVSGRPVSA"
FT   gene            complement(437756..438910)
FT                   /locus_tag="Glov_0466"
FT   CDS_pept        complement(437756..438910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0466"
FT                   /product="iron-containing alcohol dehydrogenase"
FT                   /note="PFAM: iron-containing alcohol dehydrogenase; KEGG:
FT                   gur:Gura_3532 iron-containing alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94194"
FT                   /db_xref="GOA:B3E2E1"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:B3E2E1"
FT                   /protein_id="ACD94194.1"
FT                   /translation="MAVDTLLRKFLIPEMIYGNGAHQLTGQYAGRFGISNALVVSDPGV
FT                   VEVGWTGRIMENLALAGITAVPFTEITPNPKDHEVMAGVERYHAAGCDGIVTVGGGSPM
FT                   DCAKGIGIVCSNGGHILDYEGVDQVPMAMPPLICVPSTAGSAADVSQFAIITDTADRRK
FT                   VAIISKSVVPDLALIDPLLTTTMPAELTACTGMDALVHAIEAYVSNASSSFTDLHALHA
FT                   IRLVTRHLAEAIEKPASLEARNGMMLASTQAGMAFSNASLGAVHAMAHSLGGLIDSPHG
FT                   ECNAQLLEHVIAYNYGSAAERYQEVSHAMGIDCPAGQDSCTALTAGIRTLRMSIGITRT
FT                   ISAPGIHYEQIPSLAEKAMLDACMVTNPRRPTQKDIEKIYAAAF"
FT   gene            439103..441406
FT                   /locus_tag="Glov_0467"
FT   CDS_pept        439103..441406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0467"
FT                   /product="transcriptional regulator, Fis family"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; sigma-54 factor interaction domain-containing
FT                   protein; helix-turn-helix Fis-type; Fe-S cluster domain
FT                   protein; ATPase associated with various cellular activities
FT                   AAA_5; SMART: AAA ATPase; KEGG: gur:Gura_4176 sigma-54
FT                   specific transcriptional regulator, fis family"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94195"
FT                   /db_xref="GOA:B3E2E2"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004108"
FT                   /db_xref="InterPro:IPR007202"
FT                   /db_xref="InterPro:IPR009016"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3E2E2"
FT                   /protein_id="ACD94195.1"
FT                   /translation="MQPIITYKERCRTCYSCVRTCPVKAIKVDEGYAEIIYERCIGCGN
FT                   CLNCPQKAKVVVDRMVKTQELLASGDPVVAVLGCSFPAFFHSYTPGQLVAGLKSLGFHE
FT                   VHEGAYGARMIAPHYASEIARTDRPLISTHCPAVVDLIERHYPKLLPNLMPVVSPMVAM
FT                   GRFIKEALGPQAKVVYLSTCIAAKFEIQSPEVASLVDVVLTYSEIELFFRRRGITPANL
FT                   TEAAFDGIDPQQGRMFTLSGGPLRALDIATDFLDTETVAAEGESHTLEIVRDLAAGRIS
FT                   PRYVDLRFCDGGCVDGPGKNRDLTNLFKRNLIIRYNSSNIPYRTAAHYRSAVSPAQLSQ
FT                   SFQDKSIKLPAPKGDDVRRILHATAKFSQGDELNCRACGYATCREHAVAVFQGLADIGM
FT                   CLPYNLRKMEEDRGLLMQKYELMSRELDKQLGEDMIIGDDRENAAVVDLIRQVGPTPTT
FT                   VLIRGETGTGKELTARAIHRLSTRADKPLVTVNCTTLADSLLESELFGHKKGAFTGAIA
FT                   DRKGLFEAADGGTIFLDEIGDITPKLQAELLRLLDQGEVRPVGGTAVKRVNVRLIAATN
FT                   KDLEQGVRDGWFREDLYYRLNVFSIDLPPLRERTESIPILSRHFLEKARKKLNKRLTGI
FT                   EERAVTAMRNYRWPGNIREMQNIIERAAVLSQDGVVRLENLPSIFREIFEERAGVLPGV
FT                   RRTSFKAERETHVVRLERNLILRYLEESGGNVSKAARLADLPRRTFYRLLEKNGISVQR
FT                   KLERTLGAVYEELQ"
FT   gene            441619..441801
FT                   /locus_tag="Glov_0468"
FT   CDS_pept        441619..441801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0468"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gsu:GSU3364 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94196"
FT                   /db_xref="GOA:B3E2E3"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="UniProtKB/TrEMBL:B3E2E3"
FT                   /protein_id="ACD94196.1"
FT                   /translation="MGRMRENPRYNVISMRVSDEEREQLESLVRRTHKSVSDIMREAMV
FT                   ALTMQLDHRDLRKAA"
FT   gene            complement(441897..443408)
FT                   /locus_tag="Glov_0469"
FT   CDS_pept        complement(441897..443408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0469"
FT                   /product="ribonuclease, Rne/Rng family"
FT                   /note="TIGRFAM: ribonuclease, Rne/Rng family; PFAM: RNA
FT                   binding S1 domain protein; KEGG: ppd:Ppro_0350
FT                   ribonuclease, Rne/Rng family"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94197"
FT                   /db_xref="GOA:B3E2E4"
FT                   /db_xref="InterPro:IPR004659"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019307"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:B3E2E4"
FT                   /protein_id="ACD94197.1"
FT                   /translation="MASELVINVTAHETRISLIEKGTIAELYIERTREKGIVGNIYKGR
FT                   VVRVLPGMQAAFVDIGLEKAAFLYVADVFDAIEEYENLMDGGKKEDHHDDSSDQEFKVL
FT                   HPIEDLLQEGQELLVQVSKEPIGTKGARITSHISLPGRHVVYMPTVDHVGISRRIEEEE
FT                   ERERLREIVDRLRQPGCGFIVRTASEGKTEEDLRADMEYLAKIWAEIVNKKEKATAPCL
FT                   IHADLDVVQKVVRDIVTDDVNRIVIDSKADHDRIVQFISTFMPKMKSSIELYDEEEPIF
FT                   DQYGLEVEISRALGRKVWLKSGGYIIIEQTEALTAIDVNTGRFVGKHNLEDTILKTNLE
FT                   AVKEIAYQLRLRNIGGIIIIDFIDMEKEVNREKVYAALEDALKSDKSKTNILKISELGL
FT                   VEMTRKRVRESIGRMMCEPCPYCEGRGYVKSKTTICHEIFRELRREMLDIRGTKVLLSV
FT                   HPQVADLLYDEERRGLEELEKKFKKRVTVRAKPGFHQEQFEVVIS"
FT   gene            complement(443445..445931)
FT                   /locus_tag="Glov_0470"
FT   CDS_pept        complement(443445..445931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0470"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB; KEGG: ppd:Ppro_0351 radical SAM domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94198"
FT                   /db_xref="GOA:B3E2E5"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR018768"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR023862"
FT                   /db_xref="UniProtKB/TrEMBL:B3E2E5"
FT                   /protein_id="ACD94198.1"
FT                   /translation="MPLDLLSVEKPARYMGGEMGSVVKPTADLRIALAFPDLYEVGMSH
FT                   LGLRILYQILNNQDGIAAERVYTPWPDMAAQMAAEQAPLTTLETATPLAETDIIGFTLQ
FT                   YELSCTNILTMLRQAAIPVRAEDRAQGWPLIIGGGPGAYNPEPLAPFFDAFLLGDGEEA
FT                   VIEIAQHVRDWKEAGSSNKQELLEQLATIPGVYVPSFFNVVYHDDGRVAAVQPLKPGYT
FT                   TVRRRFLPDIEAADFPDSPIIPFLKTIHDRVAIEVARGCTRGCRFCQAGYIYRPLRERS
FT                   PQRINELIETSLKNTGYEEISLLSLSTGDYSCIAPLLQELMARHAQGRVAVSLPSLRVG
FT                   TLTPELIDEIRKVRKTGFTLAPEAGSERMRRVINKGISEQDLLDGAYNIFAAGWRLIKL
FT                   YFMMGLPTETRDDLQAIPELARQVKNQARRSGGQGEVNVAVSTFVPKPHTPFQWQRQLS
FT                   LEETRDRQRFLKDEMRRRKLNFKYQDAELSFMEGVLARGDRRLADVLERVVELGACFDG
FT                   WNEHFSLQRWLQAFSECDIDPNWYLRERDQNELLPWDHLDAGIDKAFLLKELNRAHGEA
FT                   ATPDCRFGACSNCGVCDFKTVANRVVQPPTFGAARELPAAPGEITQRRLRMRFSKTGRI
FT                   RYLSHLELINLFTRAVQRAGVPILYSQGFHPHPRFSFATATSVGVESQAEYLDLFVGDI
FT                   GADEALQRLNQVLPAGMSILEATEVDLKAPSLSPLIEATRYRVTLPDCDPETLRNQCVQ
FT                   FMAQSSWVLVRAKKGQQQTIDLRKETRELSANGHSLEFTIGRGKASELTAAITGLTPDA
FT                   LKTVHIEKTSVVFVAY"
FT   gene            complement(445995..446081)
FT                   /locus_tag="Glov_R0002"
FT                   /note="tRNA-Leu5"
FT   tRNA            complement(445995..446081)
FT                   /locus_tag="Glov_R0002"
FT                   /product="tRNA-Leu"
FT   gene            complement(446215..447705)
FT                   /locus_tag="Glov_0471"
FT   CDS_pept        complement(446215..447705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0471"
FT                   /product="ammonium transporter"
FT                   /note="TIGRFAM: ammonium transporter; PFAM: Rh family
FT                   protein/ammonium transporter; KEGG: ppd:Ppro_0487 ammonium
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94199"
FT                   /db_xref="GOA:B3E2E6"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:B3E2E6"
FT                   /protein_id="ACD94199.1"
FT                   /translation="MKLKHSLIVVMLTLFTALVGVSAMAEEKKDAAPAAAVATEAPKAP
FT                   EAAAPAAAPVAAPAAAAPAALPDVKPVLNTGDTAWMLVSSALVLLMIPGLALFYGGMVR
FT                   QKNVLSTMMHSFVAMGIVGVQWAVIGYSLAFAPDMGGMGLIGNFSKFMLNGLIVMKDAA
FT                   SGTVEWTLFQNYTKEPGAIPELVFAMYQAMFAMITVALISGAMAERVKFSAYCLFVLLW
FT                   TTLVYDPLAHWVWMTEGWLFKKGALDFAGGTVVHLSSGISALVFLAFLGKRHGFPNERM
FT                   APHNLPLTLLGVGLLWFGWYGFNAGSAIVGVNNSDAAGGLAGLAFATTTIAPAAAGLSW
FT                   MIAEWIHSGKPSALGFGSGVVAGLVVITPAAGFVQPGAALIMGVAAGLVCYGGILLKAK
FT                   LKYDDSLDAFGVHGIGGTFGAIITGVFATVGATGLLAGNAKQLMIQLIAVLAAGAYAVV
FT                   VTLIITFILDKTIGLRVEKEDEIMGLDQTQHSESGYNM"
FT   sig_peptide     complement(447628..447705)
FT                   /locus_tag="Glov_0471"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 26"
FT   gene            complement(447748..448086)
FT                   /locus_tag="Glov_0472"
FT   CDS_pept        complement(447748..448086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0472"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /note="PFAM: nitrogen regulatory protein P-II; KEGG:
FT                   gur:Gura_3366 nitrogen regulatory protein P-II"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94200"
FT                   /db_xref="GOA:B3E2E7"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR002332"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:B3E2E7"
FT                   /protein_id="ACD94200.1"
FT                   /translation="MKLVEAIIKPFKLDEVKDALNEIGIEGITVSEVKGFGRQKGHTEL
FT                   YRGAEYVVDFIPKVKLEIAVSDELVAKVVETIQNTAKTGRIGDGKIFVIALEEAVRIRT
FT                   GETGGEAI"
FT   gene            448440..448739
FT                   /locus_tag="Glov_0473"
FT   CDS_pept        448440..448739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0473"
FT                   /product="Rieske (2Fe-2S) domain protein"
FT                   /note="PFAM: Rieske [2Fe-2S] domain protein; KEGG:
FT                   gur:Gura_0303 Rieske (2Fe-2S) domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94201"
FT                   /db_xref="GOA:B3E2E8"
FT                   /db_xref="InterPro:IPR012748"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:B3E2E8"
FT                   /protein_id="ACD94201.1"
FT                   /translation="MPVVARLDEVPAMGKKLIQIAGQEILLVNLKGTIYAVENECPHQG
FT                   APMSGALLKDTYLSCPRHGYRFELKDGSCKEHPECRLKTWPVRVEDNEIIVDLA"
FT   gene            448726..450177
FT                   /locus_tag="Glov_0474"
FT   CDS_pept        448726..450177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0474"
FT                   /product="phospholipase D/Transphosphatidylase"
FT                   /note="PFAM: phospholipase D/Transphosphatidylase; KEGG:
FT                   gur:Gura_0191 phospholipase D/transphosphatidylase"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94202"
FT                   /db_xref="GOA:B3E2E9"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="InterPro:IPR027379"
FT                   /db_xref="UniProtKB/TrEMBL:B3E2E9"
FT                   /protein_id="ACD94202.1"
FT                   /translation="MTWREKTILDDITLLVLLGAALAAAVWAAGHALLHKRDPRSALVW
FT                   VSLSLTLPVMGALLYWLLGINRITRRAHHWHKSGRRLGFQELYPPAVAQPPALPPLFQG
FT                   LHNLEILSDRIVRTRNHASNRLFPLKNGEEAYPAMLAAIDAASHSIHLCSYIFDGDRIG
FT                   GVFVNSLAAAVKRGVVVRVIVDAMGERYSAVTARAALLGSGVDIRHYLPLYKGPFINLR
FT                   NHRKLLLVDGRVAFTGGMNIRSNHCVETAGLLHAASDLHFQVQGPVVNDLQRIFLEDWY
FT                   FVSGQRLDDQAYFPLLDAGGTALVRAIADGPDREFRKLEWIVMGALSTAKQRVRIMTPY
FT                   FIPDRPMVTALVTAALRGVEITLVLPQQNNLPFVAWASRASYWELIKNGIQILEQPPPF
FT                   AHTKLLLVDDLWSLIGSANLDTRSFRLNFELNLSVYDQQFAAVLNEHFDAIQAGSYLVS
FT                   LQEMDSRPLAIKLRDGAARLFTPYL"
FT   sig_peptide     448726..448812
FT                   /locus_tag="Glov_0474"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.977 at
FT                   residue 29"
FT   gene            450276..450872
FT                   /locus_tag="Glov_0475"
FT   CDS_pept        450276..450872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0475"
FT                   /product="alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; Redoxin domain protein; KEGG:
FT                   gsu:GSU3246 thioredoxin peroxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94203"
FT                   /db_xref="GOA:B3E2F0"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B3E2F0"
FT                   /protein_id="ACD94203.1"
FT                   /translation="MSTCTLVTKAAPDFTADAVMADNSFGQVSLSSYQGKYVYLLFYPL
FT                   DFTFVCPSEILAFNKKLDEFKQRNCELISISIDSKFTHLAWKNTKVEDGGIGQVQFPMV
FT                   ADLNKEITKAYGIEHSASVALRGLFLIDPKGVVRHCVINDLPLGRSVDEALRMLDALQF
FT                   TDTHGEVCPANWKQGEEAMKPTAEGVASYLAKHAK"
FT   gene            450983..453106
FT                   /locus_tag="Glov_0476"
FT   CDS_pept        450983..453106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0476"
FT                   /product="DNA polymerase B, exonuclease"
FT                   /note="KEGG: gme:Gmet_3187 DNA polymerase B, exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94204"
FT                   /db_xref="GOA:B3E2F1"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B3E2F1"
FT                   /protein_id="ACD94204.1"
FT                   /translation="MPHSELPPHTASGSRTTVDGVVALEPVGQFFRVFARNEFGVTFRD
FT                   HPFHPFVLLSDPGLADAIAVVTRRYRLQGSGGLCWLVQLDSWRDWCLLREYLQQLSRPA
FT                   VWFAFPESSQQFLVASGITCFKGLEPSDLKLLCITVSVNRADTQMPGHGQCGNAAITAI
FT                   AVSNGTDFEEVISAERLTESEMLRRLTMIIQEQDPDIITGYQLSEDELPCLVSRARRHG
FT                   VRLAWGRNGAEPCLQHIPEHHAGRPHYDVYGRTLLDIRALVRQYDRQVRPLPGSGLQQA
FT                   AAWFGCSMLSDADQHPLLTAVRETVALYQLLMPYWYSQAQLYPVSPQGVFARSSAAAVN
FT                   ALLVREYLFQRHAVPFPAAVWMAAESNGSLVLRRGRLGPVVHCELSSLAAAIMLAYRIA
FT                   PHGDELGIFPAALHAVLRLCSEQAESVFGRQKQAACRLLLPAWSELLARGQYPFSDPAA
FT                   AGELERLRNVLVRDLLDWLREEGAEPVVADLQGIYFMPPAGHDGTDEIKMLARRLDRIL
FT                   PRGADLYCSGRYQAMLVYKQNNYALLEQGGELVVRGSSFVSRAMEPFLREFLVEAVRLL
FT                   LAGQGEQVHQLYEMFLRRLTSHACPVSWVMRSETVLDSRENYLQGIQSGRRNRAAVYEL
FT                   ALARPETWRVGDRVEYYVSGHAKNVVVHESCRLVADFDPAHPDLNIPWYAERLHQLFRR
FT                   LEPLLPAEPSLFG"
FT   gene            complement(453160..453381)
FT                   /locus_tag="Glov_0477"
FT   CDS_pept        complement(453160..453381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0477"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gur:Gura_1451 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94205"
FT                   /db_xref="UniProtKB/TrEMBL:B3E2F2"
FT                   /protein_id="ACD94205.1"
FT                   /translation="MKKIIASLIATVAFAGFAFAAEPAAPAAAPAEKAPAAEKAPAKKK
FT                   VAKKKAAKKAEKKEAAAPAAAPAAAPAK"
FT   sig_peptide     complement(453319..453381)
FT                   /locus_tag="Glov_0477"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 21"
FT   gene            complement(453627..454508)
FT                   /locus_tag="Glov_0478"
FT   CDS_pept        complement(453627..454508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0478"
FT                   /product="glucose-1-phosphate thymidylyltransferase"
FT                   /note="TIGRFAM: glucose-1-phosphate thymidylyltransferase;
FT                   PFAM: Nucleotidyl transferase; KEGG: pol:Bpro_4018
FT                   glucose-1-phosphate thymidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94206"
FT                   /db_xref="GOA:B3E2F3"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005907"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B3E2F3"
FT                   /protein_id="ACD94206.1"
FT                   /translation="MNRKGIILAGGAGTRLHPATLAVSKQLLPVYDKPMIYYPLSTLML
FT                   AGIREILIISTPQDTPRFEQLLGDGSQWGLELQYAVQPSPDGLAQAFIIGEQFIGTSPS
FT                   ALVLGDNIFYGHDFHQLLGNAMQRETGASVFAYHVNDPERYGVVAFDAGGKAISLEEKP
FT                   QQPKSNYAVTGLYFYDNSVVERARDLKPSPRGELEITDLNRLYLEEEKLSVEIMGRGYA
FT                   WLDTGTHESLLEAGQFIATLENRQGLKVACPEEIAWRQDWITAQQLEKLALPLAKNGYG
FT                   QYLMRLLKDQIL"
FT   sig_peptide     complement(454440..454508)
FT                   /locus_tag="Glov_0478"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.623) with cleavage site probability 0.505 at
FT                   residue 23"
FT   gene            complement(454533..455546)
FT                   /locus_tag="Glov_0479"
FT   CDS_pept        complement(454533..455546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0479"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; polysaccharide
FT                   biosynthesis protein CapD; dTDP-4-dehydrorhamnose
FT                   reductase; Male sterility domain; KEGG: gsu:GSU2241
FT                   capsular polysaccharide biosynthesis protein I"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94207"
FT                   /db_xref="GOA:B3E2F4"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B3E2F4"
FT                   /protein_id="ACD94207.1"
FT                   /translation="MRILVTGAAGFIGFHLCRRLLARGDAVLGLDNLNSYYDVSLKQAR
FT                   LAQLQPHPGFSFVQADLADRPAMEQLFSVEQFDIVIHLAAQAGVRYSLENPHAYVDSNL
FT                   TGFMNILEGCRHTGVKHLVFASSSSVYGANTAIPFSIHQNVDHPVSLYAATKKANELMA
FT                   HSYASLFNLPVTGLRLFTVYGPWGRPDMAYFSFTRAILEGRPINIFNRGRMQRDFTYVD
FT                   DIVEGIVRIAEKPAEKNPTWSGTQPDPGTSFAPYRIYNIGNNKPVELLQFIEILEQQLG
FT                   ITAQKNFLPMQAGDVPATFADIDELAAATGFRPATSLEDGIARFVAWFRSYYSHPA"
FT   gene            complement(455552..456772)
FT                   /locus_tag="Glov_0480"
FT   CDS_pept        complement(455552..456772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0480"
FT                   /product="threonine dehydratase"
FT                   /note="TIGRFAM: threonine dehydratase; PFAM:
FT                   Pyridoxal-5'-phosphate-dependent protein beta subunit;
FT                   amino acid-binding ACT domain protein; KEGG: gsu:GSU0486
FT                   threonine dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94208"
FT                   /db_xref="GOA:B3E2F5"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005789"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:B3E2F5"
FT                   /protein_id="ACD94208.1"
FT                   /translation="MESITLNYELVLEAQDRLRKRVRHTELISSNHFSRQLGYPLLLKC
FT                   ENLQTTGAFKLRGAMNFMTARDRSGLAQGVTAASAGNHAQGVAYAADLLGVPAKIFMPE
FT                   STPPQKVQATRDLGAEVVLTGANFDESFAAAQADSNQHGTVFIHPFDDPLVMAGQGTIG
FT                   LEILKDLPDVANLLVPIGGGGLLAGIATAIKEHNPQVRIIGVESAAAPCMFRAVHDNAI
FT                   AEVPLGTTIADGIAVKKAGQITTPIIQNLVDDLVLVEEEEIALAIVALLEKSKLLVEGA
FT                   GAVPLAALLNGRAKGIRGKTVCLLSGGNIDVRTLALVVERGLLAAGRYLKLRIEMQDTP
FT                   GALAHLATDLAEAKANIHDITHDRRTKGLVMGTTAVQLLLETRGQEHAHEVLGLLAKRG
FT                   YSVTTEQ"
FT   gene            complement(456776..458986)
FT                   /locus_tag="Glov_0481"
FT   CDS_pept        complement(456776..458986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0481"
FT                   /product="UvrD/REP helicase"
FT                   /note="PFAM: UvrD/REP helicase; KEGG: ppd:Ppro_3458
FT                   UvrD/REP helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94209"
FT                   /db_xref="GOA:B3E2F6"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:B3E2F6"
FT                   /protein_id="ACD94209.1"
FT                   /translation="MDLLAHLNTPQKQAVLHTEGPLLILAGAGSGKTRVITHRIVHLIR
FT                   EHGIRPWNILAVTFTNKAAKEMAERVRHLLGSHDTPLIATFHATCGRILRQDIHQLGYE
FT                   SSFAIYDDKDSERLLKDLIKELNLDDKRYPANGIGARIDDCKNRGLLPEELPAGDLWNQ
FT                   QFIRIYAAYQERLKRCNALDFGDMILQTVRLFEQFPEVLSRWQHRFQWLLVDEYQDTNP
FT                   VQYRLIRLLAGERQNLCVVGDDDQSIYSWRGADIRNILEFEKDFPQVTVIRLEQNYRST
FT                   PTILQAAGAVVARNFGRKAKTLWTDNPDGEPIRCERLESDRAEARFVSSEIALLQRNGL
FT                   LLSEMAAFYRTNAQSRLLEEALAAEGIPYHIVGGVRFYARLEIKDTLAYLRLLENPSDD
FT                   VSLKRVINVPPRGIGAATVERVAELARQGQITLFEAFERAVDSNLLGSGPRSKVAAFVE
FT                   LLQRFRRLAATQLMPELVRAVLEESGYLARLKESRDEEDSERLENLAQLVSAVEEFSTA
FT                   NPEAGLADFLEQVALVSDLERGEAGRPSVTLMTLHAAKGLEYKAVFMVGMEERLFPHVR
FT                   SLDDPDGMEEERRLCYVGMTRARERLYLLYARRRMIFGQEQANLPSRFLKEIPAELMER
FT                   NHVSCNPELPSSAQPKSSFSPAPSHNLAAVASAMAEVEVVPEPGDDYGSGIYVGLKVRH
FT                   AKFGVGTIRKLEGKGDDQKAIVWFAGCGPKKLLLRFAGLERA"
FT   gene            complement(459018..459998)
FT                   /locus_tag="Glov_0482"
FT   CDS_pept        complement(459018..459998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0482"
FT                   /product="pseudouridine synthase, RluA family"
FT                   /EC_number="3.2.1.17"
FT                   /note="KEGG: ppd:Ppro_3196 pseudouridine synthase, RluA
FT                   family; TIGRFAM: pseudouridine synthase, RluA family; PFAM:
FT                   RNA-binding S4 domain protein; pseudouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94210"
FT                   /db_xref="GOA:B3E2F7"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:B3E2F7"
FT                   /protein_id="ACD94210.1"
FT                   /translation="METTYYCIEVPAEAAGQRLDAFLATRLTDLSRAAVQRLIDDGQVL
FT                   LTEGKPRSSMKLAGGEQITVEIPPPAPAVPLAEQIPLDVLYEDHDLIVINKSAGMTVHP
FT                   GAGVDSGTLVNALLGHCTDLSGIGGEIRPGIVHRLDKGTSGVLVVAKNDIAHRGLAEQF
FT                   AAHSIKRLYWALIYGSPNEDTGKVSNSIGRHPTDRLRMSGKAKHGKEATTNWRVLERFG
FT                   AASLVQLRLETGRTHQIRVHLSEANMPLLGDPLYPDGGRFNNLKDTRLKGMISHLGRQA
FT                   LHARVLGFIHPLTGQYLEFSSEPPEDFSGILAYLRETAAVTTTFS"
FT   gene            complement(460077..460340)
FT                   /locus_tag="Glov_0483"
FT   CDS_pept        complement(460077..460340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0483"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ppd:Ppro_3197 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94211"
FT                   /db_xref="UniProtKB/TrEMBL:B3E2F8"
FT                   /protein_id="ACD94211.1"
FT                   /translation="MNIITTKEQAARLARAIISDVAIYNQEKVESGIKNDNIFDVLSEE
FT                   IEEGRQHFYSRVAPELDPERMFDLTLVDILIKRAGKIESAIW"
FT   gene            complement(460420..461586)
FT                   /locus_tag="Glov_0484"
FT   CDS_pept        complement(460420..461586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0484"
FT                   /product="2-alkenal reductase"
FT                   /EC_number="1.3.1.74"
FT                   /note="PFAM: peptidase S1 and S6 chymotrypsin/Hap;
FT                   PDZ/DHR/GLGF domain protein; KEGG: ppd:Ppro_3198 protease
FT                   Do"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94212"
FT                   /db_xref="GOA:B3E2F9"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:B3E2F9"
FT                   /protein_id="ACD94212.1"
FT                   /translation="MMRTPIRLLLLISAAVILGSCSSSKDEPLFFKSKRPAAEAEPPVK
FT                   DVPADILSTQRAFSQVSKKVTPIVVNISTISRKKLVRPFPDLPPLFEEFFGGGPQTRRD
FT                   KSLGSGFIISRDGFIVTNEHVVRDAESIRVKLSNDKVYEARVVGGDPKTDIAVIKIDAG
FT                   DLPVAVLGDSDRLEVGQWAIAIGNPFGLERSMTVGIISATGRSNVGIESIENFIQTDAS
FT                   INPGNSGGPLLNIHGEVVGINTAIVAAGQGIGFAIPTNMARPIISQLVEKGKVTRAWLG
FT                   VSIKPVTEEEARSLGLSKPAGVVIAAVQGDGPAAKGGIQAGDLVVAFGSTEVRDPSHLQ
FT                   QLVAVTRIGAAVPVVVLRGGRKITVTVRPGNADSASSARRIEQEDSAR"
FT   sig_peptide     complement(461509..461586)
FT                   /locus_tag="Glov_0484"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.694 at
FT                   residue 26"
FT   gene            461720..462313
FT                   /locus_tag="Glov_0485"
FT   CDS_pept        461720..462313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0485"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; Cupin 2
FT                   conserved barrel domain protein; KEGG: gme:Gmet_3438
FT                   transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94213"
FT                   /db_xref="GOA:B3E2G0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B3E2G0"
FT                   /protein_id="ACD94213.1"
FT                   /translation="MTDIKAQIKEFRIGEKIRGQRQQRRLTLQELSELTGLSKPLLSQI
FT                   ENEQVVPPLATLLKISRGLKVDIHFFFEDEGNRQRLVLTRGDDLRPDLQRQAVNAENRP
FT                   YTYHSLAHGMRQKHMEPFLVEVKNSTWDDKLFFRHEGEEEFLYVLEGEIDLHYGNEIHR
FT                   VKSGDSVYYDSSEPHGLVSVGDQKARIVAVLYSK"
FT   gene            complement(462374..463027)
FT                   /locus_tag="Glov_0486"
FT   CDS_pept        complement(462374..463027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0486"
FT                   /product="ThiJ/PfpI domain protein"
FT                   /note="PFAM: ThiJ/PfpI domain protein; KEGG: ppd:Ppro_3200
FT                   isoprenoid biosynthesis protein with amidotransferase-like
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94214"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR026041"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B3E2G1"
FT                   /protein_id="ACD94214.1"
FT                   /translation="MKKIGVILSGCGFRDGSEIHEAVCALLAIDQAGAEAVCMAPDIEL
FT                   NEMNHCSMELTGAKRRVLVESARIARGKIRNISEVQAAELDALVLPGGFGAALNLCDFG
FT                   QKGAAASVNPEVARLTQEIHAAGKPIGAICIAPALIAAILGKKAHPTLTIGTDPGTAAE
FT                   VEKTGAKHQDCPVNEIVIDQANRIVSTPAYMLAERISEVYEGIGKCVKTVVEMA"
FT   gene            complement(463024..463941)
FT                   /locus_tag="Glov_0487"
FT   CDS_pept        complement(463024..463941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0487"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; NmrA family
FT                   protein; Male sterility domain; KEGG: ppd:Ppro_3201
FT                   NAD-dependent epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94215"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B3E2G2"
FT                   /protein_id="ACD94215.1"
FT                   /translation="MIRQEQTTILVTGANGFIGRRLVKELLQRGYRVRCMVRRPSDLPA
FT                   EVEQIQADLLQPDSLPAALNGIDTVYYLVHSMGQSKGDFAEQDRLAARNFVASADLAGV
FT                   KRVIYLGGLGETGDNLSHHLASRLEVAHILQTGCFSTTFLRAAVIIGFGGSSYEMVHSL
FT                   VKRLPVMITPRWVSTRNQPIAVADVIAYLAGCLEEPKTAGGTFDIGGPEIMTYKEMMER
FT                   FAVLEGKRLWIIPVPVLTPKLSSYWVGLVTPVKPAIAIALIEGLKNEVICRDTRIRELL
FT                   PIRLTPYDDAIRTALAEQHAGGSL"
FT   gene            464009..464587
FT                   /locus_tag="Glov_0488"
FT   CDS_pept        464009..464587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0488"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gsu:GSU0076 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94216"
FT                   /db_xref="UniProtKB/TrEMBL:B3E2G3"
FT                   /protein_id="ACD94216.1"
FT                   /translation="MSAKAPLQIACQQVLQEDSSVFSIQWTDLPLELAKGMTPQRLLEA
FT                   YLRAIRRMTWGLIRPKETDDGVAFCLLGRLALLRFLRPEPEGDWLALRICGGLLVQRDQ
FT                   CDRGELAFRCEQLPDGQIRVTLRLSDYCPLLLGSQRPSVVRRWLYRLTQATLHRLVTIR
FT                   FLALLYRELGGIDGTVETIQVQVRSGRDT"
FT   gene            464661..466979
FT                   /locus_tag="Glov_0489"
FT   CDS_pept        464661..466979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0489"
FT                   /product="ATP-dependent protease La"
FT                   /EC_number="3.4.21.53"
FT                   /note="KEGG: ppd:Ppro_3207 ATP-dependent protease La;
FT                   TIGRFAM: ATP-dependent protease La; PFAM: peptidase S16 lon
FT                   domain protein; AAA ATPase central domain protein; ATPase
FT                   associated with various cellular activities AAA_5; SMART:
FT                   AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94217"
FT                   /db_xref="GOA:B3E2G4"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004815"
FT                   /db_xref="InterPro:IPR008268"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027543"
FT                   /db_xref="UniProtKB/TrEMBL:B3E2G4"
FT                   /protein_id="ACD94217.1"
FT                   /translation="MPHNELTIPAILPLYPLKDMVAFPYMVFPLYLDEPELALFRAAQD
FT                   QYDGFVAVSFPRKEPQGSDILSTLHEIGTVCRVTQIKKVSGGRFKVTLEGINRIRLIEL
FT                   ERVAPYPLVQAAVVREFVEKGLVSEALVQSLIGLLKISLSYGKPLPDDVMKMIDYIDNP
FT                   ARLSDLVALYVNLPQSDLQELLETVDPLERLKKVYVHLTNEVQKLQVHGEMKTELNKRV
FT                   GKNQKDYLLREQMKQIQEELGEEDPRNADVADLRKRIDEAEMPEEVRKIALKELKRLEK
FT                   INQASPEYNVSRTYLDYLAGMPWSISTEDSLDISKAEAVLDEDHYNLKKVKERILEFLA
FT                   VRSLKDTMKGPVLCFVGPPGVGKTSLGRSIARSLGRKFVRVSLGGVRDEAEIRGHRRTY
FT                   IGALPGRIIKEIYRCGSNNPVLMLDEIDKLSHDFRGDPSSALLEVLDPEQNFSFQDHYL
FT                   DVPFDLSKVMFITTANQMDPIPGPLKDRMEIIRLAGYSSEEKQHIANRFIIPREIEENG
FT                   LAKTPPGFTREGLIKLIREYTREAGVRNLQRTIAQVLRKLAKEVTQGKPLREQITPEVV
FT                   AELLGPRKFHDEVAAESDRVGVVTGLAWTETGGDILFIEATSMPGKPELILTGSLGDVM
FT                   KESARAALSYVQAHAAEFGIPDGVFENRTIHIHVPSGAIPKDGPSAGVTMVTALVSLLT
FT                   GKPARRTVAMTGEITLTGRVLAIGGLKEKVLAAHRAGVKTVLAPSRNRDDLEDIPENVR
FT                   QELEFQFIDEAAQAVTAVL"
FT   gene            466982..467755
FT                   /locus_tag="Glov_0490"
FT   CDS_pept        466982..467755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0490"
FT                   /product="protein of unknown function DUF140"
FT                   /note="PFAM: protein of unknown function DUF140; KEGG:
FT                   ppd:Ppro_3208 protein of unknown function DUF140"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94218"
FT                   /db_xref="GOA:B3E2G5"
FT                   /db_xref="InterPro:IPR003453"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:B3E2G5"
FT                   /protein_id="ACD94218.1"
FT                   /translation="MIRLSAIDQRMLQFFARFQAFFFLAWQAFVRIFHKPYYYRDFAIQ
FT                   FDKLGFSSLFICVLTGLFTGMVMALQALIQLKPFAATSYVGGMVAVTMIKELGPVLAAL
FT                   MVAGRVGSAITAELGTMVVTEQVDAMRVEGTDIIQRLVTPRLKAMLLALPLLTIITDAV
FT                   SMLGGYLIASGYSISPVMYLSTFTQFMVPLDYLEGVTKPLVFAFLITMISCQTGLNTGG
FT                   GAEGVGAAAKRAVVLSSVLVLMCDFFIAKIFVVFR"
FT   gene            467772..468320
FT                   /locus_tag="Glov_0491"
FT   CDS_pept        467772..468320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0491"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gme:Gmet_1056 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94219"
FT                   /db_xref="UniProtKB/TrEMBL:B3E2G6"
FT                   /protein_id="ACD94219.1"
FT                   /translation="MDFKLVTEKLAAAFLQNKVQYALIGGYAVSLWGLPRATVDLDFLV
FT                   RRTDMEMVREIVESLGYHCMHTSENVTQFDAADNALGEVDFLHAFRPASLAMLERAELK
FT                   TVFDGQEPVPVILPEDLIGLKVQAIANKPSRMAIDKADIEGLMQLCGDQLDWQQVADYF
FT                   ALFDMTTLYLELKERHYGH"
FT   gene            468310..468525
FT                   /locus_tag="Glov_0492"
FT   CDS_pept        468310..468525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0492"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94220"
FT                   /db_xref="UniProtKB/TrEMBL:B3E2G7"
FT                   /protein_id="ACD94220.1"
FT                   /translation="MATKPIPNLLTDATPEEMNADFEIMQRNRECRMKEHPPTAQQMAV
FT                   FQQQFNEFIHHRRRPFEPMVETMMKL"
FT   gene            468529..469284
FT                   /locus_tag="Glov_0493"
FT   CDS_pept        468529..469284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0493"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: ppd:Ppro_3213 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94221"
FT                   /db_xref="GOA:B3E2G8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3E2G8"
FT                   /protein_id="ACD94221.1"
FT                   /translation="MHIEEQCIRMEQVCYTVGGRVILNDFDMELERGVNRTILGVSGSG
FT                   KTTILKLILGLIHPQSGRISINGMEITNRPESAYREQRKKIAIVFQGGALFDSMTVGEN
FT                   VGYRLFEEGRLSQAEVEEIVREKLRFVGVEPALDLYPAELSGGMKKRVAIARALAADPE
FT                   YIFFDEPTTGLDPIGVYNIVSLMNRLQEAGKTTLMVTHDLPTAFATSQRFSLIHESRLV
FT                   FEGTEAELRDCPLANVQEFLQPTDRSLFV"
FT   gene            469290..469790
FT                   /locus_tag="Glov_0494"
FT   CDS_pept        469290..469790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0494"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tdn:Tmden_1337 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94222"
FT                   /db_xref="GOA:B3E2G9"
FT                   /db_xref="UniProtKB/TrEMBL:B3E2G9"
FT                   /protein_id="ACD94222.1"
FT                   /translation="MALQGALFRWLIFGSPTYCVYACVAKLLAAWIASLNWHRNKGAAT
FT                   VKFIPLLFLVLLVAGCSHGPLHEKDYQRWWCEKHGGELEHRLPDNTRVDCLTKEYALEV
FT                   EYAPKWAESIGQALYYGQSTGRKPAVLVIVRDKDDERFLKRLRAVAKEQGIKVWTVRPK
FT                   DLE"
FT   gene            469820..470902
FT                   /locus_tag="Glov_0495"
FT   CDS_pept        469820..470902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0495"
FT                   /product="Mammalian cell entry related domain protein"
FT                   /note="PFAM: Mammalian cell entry related domain protein;
FT                   KEGG: ppd:Ppro_3214 mammalian cell entry related domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94223"
FT                   /db_xref="GOA:B3E2H0"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="UniProtKB/TrEMBL:B3E2H0"
FT                   /protein_id="ACD94223.1"
FT                   /translation="MERSNQIGWAQVRAGVFILITLLLAAGAILLMGQKTKLFIPTSTI
FT                   RITMKNVMGLKEGAPVWLAGVDVGVVQQIRFENPRDTNEVLIVAEVDSKAHKKIGPDSI
FT                   ITIKTRGLMGEKYVDILPSASYYDRPVSRFNGKAVHTLDDVAQKAGVTFEKLNSIVDNV
FT                   QSGKGTLGLLATDTKLYINAVQLSSELNTLAGNINRGQGTLGKLARSGEPYDKLMQILS
FT                   RADKTLQDIQTADGSLNRLIHDKALYTKLVSLAEKSNQAADDVRELNRRLTSKDTTLGM
FT                   LLSDRELYDKGLSLITRADNSMKDLESAAARIKAGEGTAGKLINEKELYEKLNRAVDNM
FT                   DALMVDIRKNPGRYVKLSLF"
FT   gene            470919..472424
FT                   /locus_tag="Glov_0496"
FT   CDS_pept        470919..472424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0496"
FT                   /product="peptidase M16 domain protein"
FT                   /note="PFAM: peptidase M16 domain protein; KEGG:
FT                   gme:Gmet_2530 peptidase M16-like"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94224"
FT                   /db_xref="GOA:B3E2H1"
FT                   /db_xref="InterPro:IPR001431"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:B3E2H1"
FT                   /protein_id="ACD94224.1"
FT                   /translation="MMQRVVKTIAGLFLLLFIAAQAGAANLEDKVVEHTFKNGLKLLMV
FT                   ERHSSPTVSAWIRFKVGSVHERSDERGIAHLLEHMLFKGTRTLGTRDYAAEAPLLEKIE
FT                   ETAQRMLAEEAKGSGADKATLASLRAELARLEKQAEQYVIKDEFFDLYARNGGSGYNAF
FT                   TSRDGTTYLISLPANKLELWAAIESDRMKNPVLREFYTERSVVMEERRRSYDAEPSSKL
FT                   WETFVAAAYQTHPYGQPTIGWSSDIRQLSRTKAESFLKRYYAPNNAIVAVVGDIRPADT
FT                   IALVERYFGDIPPGTPVPEVAAQEEQQQGERRVEVLGDAEPELIIGFHKTALGAPDDEV
FT                   FDLVASVLGQGRTSRLYRSLVLEKQLATQVSVFDAPGNRYPNLFVLYASPRAPHTAAEV
FT                   EQALLAELERLKKEPVSQQELQQVLNQLEFEEARRMGTNGGLARNLTEYEAIAGSWRYL
FT                   TTYRAKLTKITPADIQRVARQYFTRENRIVGTLVTKKPGGAQK"
FT   sig_peptide     470919..470993
FT                   /locus_tag="Glov_0496"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.906 at
FT                   residue 25"
FT   gene            472421..473836
FT                   /locus_tag="Glov_0497"
FT   CDS_pept        472421..473836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0497"
FT                   /product="peptidase M16 domain protein"
FT                   /note="PFAM: peptidase M16 domain protein; KEGG:
FT                   ppd:Ppro_3216 peptidase M16 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94225"
FT                   /db_xref="GOA:B3E2H2"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:B3E2H2"
FT                   /protein_id="ACD94225.1"
FT                   /translation="MKLRVLLVGLISIFCLSAASAAELANPRNMTFPALSFSIPKAERV
FT                   LLQNGMPVYLLQDHELPMVTISALIHTGSVYDPTGKSGLAALTGSQLRGGGTKDLAPAA
FT                   LDAELEFMASSVESSFGSDLGTVSLTSLTKNLDRTLQLFSDVLFRPRFDEKRLEVARRQ
FT                   ALEMIRRQNDDPKELGDRELQKALYAGHPLGVIPAAATVAAVKRSDLQAFHQRFVRPDN
FT                   MILTVAGDFDRSRMLAALNRLIGQIKPEGRLQLPDIPQVKLRFEPAVLYAPKQVNQSVI
FT                   RLGHLGITKDDPDLYAIRVLDFILGGSFTSRLMMEIRTNQGLAYNVGSHFDVGRHFIGS
FT                   FTAETETKAEATAKTIGLMSSIIAAIRTEPVSEQELKLAKDSIINSFLFGFTTPASIVV
FT                   QQARLEFYGYQPDYLERYRERIAAVTREDLLQAAKKHLHPEAFKLVVVGDQKRFDKPLS
FT                   SFGTVTTLDLKSE"
FT   sig_peptide     472421..472486
FT                   /locus_tag="Glov_0497"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.772 at
FT                   residue 22"
FT   gene            473944..474225
FT                   /locus_tag="Glov_0498"
FT   CDS_pept        473944..474225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0498"
FT                   /product="anti-sigma-28 factor, FlgM"
FT                   /note="KEGG: ppd:Ppro_3217 anti-sigma-28 factor, FlgM"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94226"
FT                   /db_xref="InterPro:IPR031316"
FT                   /db_xref="InterPro:IPR035890"
FT                   /db_xref="UniProtKB/TrEMBL:B3E2H3"
FT                   /protein_id="ACD94226.1"
FT                   /translation="MRIDSATTAIFGAQPVMKTAKSEASRSVQSTAAVQSPFSVQLTNM
FT                   VEKLSSVQPSSGEIRPEKVQDISQQLASGSYNISGQDVAEKMLMALTS"
FT   gene            474287..475618
FT                   /locus_tag="Glov_0499"
FT   CDS_pept        474287..475618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0499"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bps:BPSS1439 membrane-anchored cell surface
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94227"
FT                   /db_xref="GOA:B3E2H4"
FT                   /db_xref="UniProtKB/TrEMBL:B3E2H4"
FT                   /protein_id="ACD94227.1"
FT                   /translation="MFRHPRTDSAFRVLLRTGILQLPFDSKHAGYCYRINEGLTKNRRR
FT                   SINIYKYINIWVVPMLKLILSCIVTLSLAVATVPAEAALTTSLQDLVVQGNALRSSLTT
FT                   IQVSNGGVCGQLGTLNTSIEDYLSVVQGVYNQLAAPLTLTSADLTSLEDLSGIARDLAA
FT                   DSIRLSLELRTVEGVADLFEYRSALSAMLRLSDDIGTMADRILEMADRILAMADNIGLM
FT                   ADRILATQRIQAANIALTQNAILSTQTNMIALSKSLSTIGYNLTLGLLLADTQFQVAEM
FT                   GQLTLDTSNAAATLSYLETKTAALSARVLVVYDLITKDSQQASHYVDGSTLTYLGDLTV
FT                   AQKQFAAVLETYAATISQIAPLMQTPLLSDATRSMLRLTADINTMSKRIVEMGDKIIVM
FT                   ADNIGIMSGRIVETQVIQRENVALTLSSAQAAQSTMLALIKNMN"
FT   gene            475651..476823
FT                   /locus_tag="Glov_0500"
FT   CDS_pept        475651..476823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0500"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bps:BPSS1439 membrane-anchored cell surface
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94228"
FT                   /db_xref="UniProtKB/TrEMBL:B3E2H5"
FT                   /protein_id="ACD94228.1"
FT                   /translation="MKNYLKNSIHLILLATVGLFIGAVPAQADLAEDLQGLIVQSQNLE
FT                   VQLKNITLNPDSVCGPLVEANKQARALSNSAAALNSSLAAPLQTDAALLTAMDTLSMTV
FT                   LNISNESLRLSLDLKALSTVSRAITLKDGMTATLQLSDDIGAMADRIGEMSDKILVMSD
FT                   NIGVMADRILVSQQLQSQNLALTQQGLLQTQTNALTLVGVLETATNDLALSSLIAEGTV
FT                   LTAKLSALVLNPFTMKTQMQYAAASIRTYLDKVKALHTTMLFQAGTGTSYLSTTTLLNQ
FT                   QNMTIMLSSLANVLDGYTIAIGGLQAITSKPTLTDSMKSMLQMSADIGLMANRVLEMGD
FT                   VILAMADNIGMVADQILVAQQLQNANMVVTQASVLGAQEFAIGVLKRLVN"
FT   sig_peptide     475651..475737
FT                   /locus_tag="Glov_0500"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.988 at
FT                   residue 29"
FT   gene            complement(476820..477650)
FT                   /locus_tag="Glov_0501"
FT   CDS_pept        complement(476820..477650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0501"
FT                   /product="Uroporphyrinogen-III synthase"
FT                   /EC_number="4.2.1.75"
FT                   /note="PFAM: Uroporphyrinogen III synthase HEM4; KEGG:
FT                   ppd:Ppro_3374 uroporphyrin-III C-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94229"
FT                   /db_xref="GOA:B3E2H6"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="InterPro:IPR039793"
FT                   /db_xref="UniProtKB/TrEMBL:B3E2H6"
FT                   /protein_id="ACD94229.1"
FT                   /translation="MSTSGKLPTSPLRGCRILVTRAAEQAAGFSRQLQQRGAVVVECPT
FT                   IQLVPPEAWTAVDAAIQALSGFDWLILTSANGVRFFFGRLQELGLAPAGLQSCKVCAVG
FT                   PKTAEALTQLGITPDLIPEQFTGEGVVAAFHGHDLQGRRVLFPKADGARDLIPQQLRSR
FT                   GAVVIDPVLYRNIIPQGLPDSARLALEQHQLDAVVFSSPSTVRNLAQLTGGITRLQALL
FT                   ADLAVVSIGPVTTRACQELGLSVAVEPEQSTLDALIRALEQHTLCCPSATPPIT"
FT   gene            complement(477622..478560)
FT                   /locus_tag="Glov_0502"
FT   CDS_pept        complement(477622..478560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0502"
FT                   /product="porphobilinogen deaminase"
FT                   /EC_number="2.5.1.61"
FT                   /note="KEGG: gsu:GSU3285 porphobilinogen deaminase;
FT                   TIGRFAM: porphobilinogen deaminase; PFAM: Porphobilinogen
FT                   deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94230"
FT                   /db_xref="GOA:B3E2H7"
FT                   /db_xref="InterPro:IPR000860"
FT                   /db_xref="InterPro:IPR022417"
FT                   /db_xref="InterPro:IPR022418"
FT                   /db_xref="InterPro:IPR022419"
FT                   /db_xref="InterPro:IPR036803"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3E2H7"
FT                   /protein_id="ACD94230.1"
FT                   /translation="MAPKRLRIGTRASQLALWQANWTKSELEARYPGIQVELVKIKTMG
FT                   DKILDVPLAQVGGKGLFVKEIEEAMLRGEIDLAVHSMKDVPTEFPEGLGLVVTTKREDP
FT                   RDAFISDKVTFSELRQGARIGTSALRRQAQLLKARPDLEMVIIRGNVETRIRKLKEDNL
FT                   DAVILAAAGLNRLGFTDVVTELLDTDFSIPAIGQGALGLECRLDDNATIEALAFLNHAD
FT                   TAAAVAAERALLKRCEGGCQVPIAAHGTVSGDTLTLVGFIASVDGKQTVRDRISGSTAD
FT                   AVKLGTELADRLLAAGGKAILEDVYQREIAH"
FT   gene            complement(478585..479889)
FT                   /locus_tag="Glov_0503"
FT   CDS_pept        complement(478585..479889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0503"
FT                   /product="glutamyl-tRNA reductase"
FT                   /EC_number="1.2.1.70"
FT                   /note="KEGG: gur:Gura_0360 glutamyl-tRNA reductase;
FT                   TIGRFAM: glutamyl-tRNA reductase; PFAM: Shikimate/quinate
FT                   5-dehydrogenase; Tetrapyrrole biosynthesis, glutamyl-tRNA
FT                   reductase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94231"
FT                   /db_xref="GOA:B3E2H8"
FT                   /db_xref="InterPro:IPR000343"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR015895"
FT                   /db_xref="InterPro:IPR015896"
FT                   /db_xref="InterPro:IPR018214"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036343"
FT                   /db_xref="InterPro:IPR036453"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3E2H8"
FT                   /protein_id="ACD94231.1"
FT                   /translation="MNIIVVGLSHKTASVDIREKVAFSPNSIEKPLHELVNLDGIVEGI
FT                   IVSTCNRVEIYATTRDIAGGIARIRRFMAEYHHLAHDLLEPHLYSYHGEEAIRHVFRVA
FT                   SSLDSMVVGEPQILGQIKTSYGYAAEYKSSGIILNRFLHKAFSVAKRVRTETRIASSAV
FT                   SVSFAAVELARKIFGNLTDKTVLLIGAGEMCELAARHFLTNGAKGVMVTNRTFERAQRL
FT                   AEEFGGEAIPFDELFLHLHKADIVLTSTGAPHAIITPPDLEEVIKRRRMRPMFLIDIAV
FT                   PRDIDPAVNEMDAVYLYDMDDLQQVVAANLEGRKQEADKAEAIIAEEIIQFYKWVATLE
FT                   VTPTIVALRNRFEELRKAELERTLAGWKDAPPDAEKRLEALTSAFMNKLLHQPTTVLKK
FT                   AGQGNRTDLYLDALRALFDLELGGTDTNESLELEE"
FT   gene            complement(479901..480716)
FT                   /locus_tag="Glov_0504"
FT   CDS_pept        complement(479901..480716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0504"
FT                   /product="cytochrome c-type biogenesis protein CcsB"
FT                   /note="TIGRFAM: cytochrome c-type biogenesis protein CcsB;
FT                   PFAM: cytochrome c assembly protein; KEGG: gur:Gura_0361
FT                   cytochrome c assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94232"
FT                   /db_xref="GOA:B3E2H9"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="InterPro:IPR003557"
FT                   /db_xref="InterPro:IPR017562"
FT                   /db_xref="UniProtKB/TrEMBL:B3E2H9"
FT                   /protein_id="ACD94232.1"
FT                   /translation="MTQISFYLTLSLYAVATLLYLSCLLRNSSCQSILGSRVLLAGFLA
FT                   HCLATIHRFIAAGHLPITNMHESLSFFALTIAGVYLFFEQRYKVRILGSFVVPFTLLLT
FT                   LGAGIAPTAIKPLNPALQSLWIYSHTILAFGAYAFFTISGGVALLYLIQSHFLKKKHLG
FT                   PLFLKLPSLDVLDEIGYRCLAFGFPMLTVAIITGAIWASRAWGSYWSWDPKESWSLITW
FT                   FIYAALLHGRLTTGWRGRRAAILTVIGFLVMLFTFLGVNLWLPGLHSYT"
FT   gene            480930..481259
FT                   /locus_tag="Glov_0505"
FT   CDS_pept        480930..481259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0505"
FT                   /product="thioredoxin"
FT                   /note="TIGRFAM: thioredoxin; PFAM: Redoxin domain protein;
FT                   Thioredoxin domain; KEGG: ppd:Ppro_3380 thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94233"
FT                   /db_xref="GOA:B3E2I0"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B3E2I0"
FT                   /protein_id="ACD94233.1"
FT                   /translation="MASDAVLTLSDANFDRDVLQSDLPVLVDFWATWCAPCKAIAPLID
FT                   AVAADYAGKVKVGKVNVDDNPATPGKYGVRGIPTLILFKGGKVVDQVVGAVPKSQLDAL
FT                   IAKAL"
FT   gene            481261..481788
FT                   /locus_tag="Glov_0506"
FT   CDS_pept        481261..481788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0506"
FT                   /product="alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; electron transport protein
FT                   SCO1/SenC; Redoxin domain protein; Thioredoxin domain;
FT                   KEGG: gsu:GSU3280 thioredoxin-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94234"
FT                   /db_xref="GOA:B3E2I1"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B3E2I1"
FT                   /protein_id="ACD94234.1"
FT                   /translation="MPFVSLQGCFRAVTLIVTALLLGLCPYNAEAAPRRGQPAPPFKTF
FT                   SIKGQPVSTEGLKGSVVLLDFWATWCPPCRESIPHLAELHRKYSKQGLVIIGMSVDEGG
FT                   ERTVKEYAENHAIPYQIVMASGRISSDYGVRALPVLYVIDKNGLVREQIMGFSDQAGKV
FT                   IENLVKKLLNEK"
FT   sig_peptide     481261..481350
FT                   /locus_tag="Glov_0506"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.727) with cleavage site probability 0.487 at
FT                   residue 30"
FT   gene            complement(481819..482694)
FT                   /locus_tag="Glov_0507"
FT   CDS_pept        complement(481819..482694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0507"
FT                   /product="UTP-glucose-1-phosphate uridylyltransferase"
FT                   /note="TIGRFAM: UTP-glucose-1-phosphate
FT                   uridylyltransferase; PFAM: Nucleotidyl transferase; KEGG:
FT                   ppd:Ppro_0481 UTP-glucose-1-phosphate uridylyltransferase
FT                   GalU"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94235"
FT                   /db_xref="GOA:B3E2I2"
FT                   /db_xref="InterPro:IPR005771"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B3E2I2"
FT                   /protein_id="ACD94235.1"
FT                   /translation="MKVRKAIFPVAGLGTRFLPATKSSPKEMLPLIDKPLVQYVVEEAV
FT                   AAGIEQIIFVTGRTKRSIEDHFDSSPELENHLEEKGKDETLQAVRCIADLVDIFYVRQK
FT                   KALGLGHAILCARDFIGNEPFAVLLGDDIIDTPGSAPCLRQLLDVYEHYKGSVLALEQV
FT                   PMEQISSYGCVAVNRITDHVMEVTDMVEKPPQAEAPSNLAIIGRYVLTPAIFPLLEQQQ
FT                   PGRGGEIQLTDAIKRLSQDEAVYGCLFEGLRHDCGDKLGFLKATVDLALKRDEFKEDFT
FT                   AYLKQRLGCL"
FT   gene            complement(482698..483552)
FT                   /locus_tag="Glov_0508"
FT   CDS_pept        complement(482698..483552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0508"
FT                   /product="Methenyltetrahydrofolate cyclohydrolase"
FT                   /EC_number="3.5.4.9"
FT                   /note="PFAM: tetrahydrofolate dehydrogenase/cyclohydrolase;
FT                   KEGG: ppd:Ppro_0480 methenyltetrahydrofolate
FT                   cyclohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94236"
FT                   /db_xref="GOA:B3E2I3"
FT                   /db_xref="InterPro:IPR000672"
FT                   /db_xref="InterPro:IPR020630"
FT                   /db_xref="InterPro:IPR020631"
FT                   /db_xref="InterPro:IPR020867"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B3E2I3"
FT                   /protein_id="ACD94236.1"
FT                   /translation="MAAQIIDGKAIAAKVRERIGSTVSTLKQQGITPGLAVVLVGDDPA
FT                   SRVYVGMKKKMCVELGMYSADHELPASTSEAELLTLIGQLNADPRVHGILVQLPLPDHI
FT                   DTDKVLEAISPDKDADGFHPYNVGRLAIGKPTFQPCTPYGVMVMLDEIGYDLKGKEVVV
FT                   VGRSNIVGKPVALMCLSRHATVTICHSRTKDLADVVRRADVVIAAVGKAEMVKGDWIKP
FT                   GAVVIDVGINRVGEKKLVGDVEYAAAAERASAITPVPGGVGPMTIAMLLQNTLESAQRA
FT                   ATR"
FT   gene            complement(483781..484002)
FT                   /locus_tag="Glov_0509"
FT   CDS_pept        complement(483781..484002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0509"
FT                   /product="regulatory protein, FmdB family"
FT                   /note="TIGRFAM: regulatory protein, FmdB family; PFAM:
FT                   Putative regulatory protein FmdB; KEGG: gur:Gura_1168
FT                   putative regulatory protein, FmdB family"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94237"
FT                   /db_xref="InterPro:IPR013429"
FT                   /db_xref="UniProtKB/TrEMBL:B3E2I4"
FT                   /protein_id="ACD94237.1"
FT                   /translation="MPMYEYRCQSCDNQFELRQKFSDAPATECPKCGGAVEKMISQTAF
FT                   SLKGDGWFNSGYCPSSGGPKPAACSAGG"
FT   gene            complement(484055..484777)
FT                   /locus_tag="Glov_0510"
FT   CDS_pept        complement(484055..484777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0510"
FT                   /product="Smr protein/MutS2"
FT                   /note="PFAM: Smr protein/MutS2; KEGG: ppd:Ppro_3354 Smr
FT                   protein/MutS2"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94238"
FT                   /db_xref="InterPro:IPR002625"
FT                   /db_xref="InterPro:IPR036063"
FT                   /db_xref="UniProtKB/TrEMBL:B3E2I5"
FT                   /protein_id="ACD94238.1"
FT                   /translation="MAPRKQKEQKPTTPPPFRHTPFAALKGIAVETAPPPEPVKKAVAP
FT                   KAEPAGDELFRQAMSGVRRLDDEDSRTSTPAPVSPGKRGAPPKAPARSVAKPLPREEAA
FT                   ARKAFLQEVEKLQLDVRFKDQLPEEEELRPLTGNRLRQLKRGIIQLDRQLDLHGLTREE
FT                   AVASLGPFLQAARNAGEKGVLVITGKGNHSLEGPVLQQVVAAWLRDQGRELITEYAPAP
FT                   AEMGGSGAFVIFLRPLDK"
FT   gene            complement(484788..486005)
FT                   /locus_tag="Glov_0511"
FT   CDS_pept        complement(484788..486005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0511"
FT                   /product="protein of unknown function DUF401"
FT                   /note="PFAM: Citrate transporter; protein of unknown
FT                   function DUF401; KEGG: gsu:GSU1012 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94239"
FT                   /db_xref="GOA:B3E2I6"
FT                   /db_xref="InterPro:IPR007294"
FT                   /db_xref="UniProtKB/TrEMBL:B3E2I6"
FT                   /protein_id="ACD94239.1"
FT                   /translation="MRHLFLTGLVLVFIIWLLRRKVSMAAVMPIGAALLALLYLLPLPD
FT                   LGRAVWLGLASPKSLEMTATLALTMVMENLLRTTGMLKRMVSSLSAALPDRRMVMAALP
FT                   AMIGMLPSPGGAVFSAPMVAEAAKGIAASPEQKAFINYWYRHIWEYVSPLYPGIILAAG
FT                   LSGLSTRQLFLAHLPFALTVILAGAWFCFRGIDSSPSAADQRQNDRAAQFGTFLLMSAP
FT                   ILISLALVVFFKISAVLALSGGVAVLFAAHRYSPPQILKTLHESLSIRALLLVAGIMVF
FT                   QEVLRATGALAGISGFFVTSQLPIPLLVALIPFIAGVMTGLTVGYVGITFPLLLPLMGS
FT                   GQPNLWLEALAFASGFAGVMLSPVHLCLVLTREYFEADTTLVYHRLMVPSVVVLAAVLV
FT                   PYLIYH"
FT   sig_peptide     complement(485928..486005)
FT                   /locus_tag="Glov_0511"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.691) with cleavage site probability 0.447 at
FT                   residue 26"
FT   gene            complement(486012..486401)
FT                   /locus_tag="Glov_0512"
FT   CDS_pept        complement(486012..486401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0512"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   gur:Gura_2288 response regulator receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94240"
FT                   /db_xref="GOA:B3E2I7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B3E2I7"
FT                   /protein_id="ACD94240.1"
FT                   /translation="MGKILLIDDDPAFTRLLGEYIAEQYPLLSVDVCNNPLEALTAIRR
FT                   APYDLILIDFEMPTLDGRKLMNFAVQSGIEKNRIVILSSRDADFLHEQCPMGSCLAVLN
FT                   KHEVRQKAVLDMIFSSLSKKAVQGN"
FT   gene            complement(486417..486872)
FT                   /locus_tag="Glov_0513"
FT   CDS_pept        complement(486417..486872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0513"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gme:Gmet_1742 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94241"
FT                   /db_xref="GOA:B3E2I8"
FT                   /db_xref="UniProtKB/TrEMBL:B3E2I8"
FT                   /protein_id="ACD94241.1"
FT                   /translation="MIEDLPEDTEEAQPRSQAMIMLTGLYLFLLVMTVMSYGQPVPFFG
FT                   RILEGRAAQIFIGLDSLVCLHLFLGLLKRQRLTWYLLLSYNSYEVLNTLVNLWLVPRKE
FT                   LERILERTIDPGGMLFSNLCTVGIILWISWVIRRQREQFTNHSPYLF"
FT   gene            complement(486869..486970)
FT                   /locus_tag="Glov_0514"
FT   CDS_pept        complement(486869..486970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0514"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94242"
FT                   /db_xref="GOA:B3E2I9"
FT                   /db_xref="UniProtKB/TrEMBL:B3E2I9"
FT                   /protein_id="ACD94242.1"
FT                   /translation="MFGFSTADWLFIGFILLVIAFCVGISDMRKKKS"
FT   gene            complement(486971..487867)
FT                   /locus_tag="Glov_0515"
FT   CDS_pept        complement(486971..487867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0515"
FT                   /product="TPR repeat-containing protein"
FT                   /note="KEGG: gur:Gura_2295 TPR repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94243"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:B3E2J0"
FT                   /protein_id="ACD94243.1"
FT                   /translation="MQNCIAPTPLDGISYFQPPVDFHITGRDGRVNIPWEFPIPLVEES
FT                   YRAALEHGAPDYDQVGQGMFFALRQNPDCTYAVDYARVLQTGYPHIIAEIGGEAIMLDA
FT                   KEVDSPYLDRKVNLLKIMALLEQDNAGLWREIGRTLMEKGSRMEAAHLAVQSWYGAEKY
FT                   LSRSVELAPDDLHTCYQLGETHYVLGHYDQALALWQPLVERLQAGERLSLEARIAAIQR
FT                   GELPKVPAVDYLTALSVAFEQHQDDQFYEAAAIVEDVLLDTVFCAQFPMAGVYRFLEQC
FT                   YRAVNMTDKADALKGRC"
FT   gene            complement(487867..488712)
FT                   /locus_tag="Glov_0516"
FT   CDS_pept        complement(487867..488712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0516"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gme:Gmet_1740 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94244"
FT                   /db_xref="UniProtKB/TrEMBL:B3E2J1"
FT                   /protein_id="ACD94244.1"
FT                   /translation="MPKLPGNSPMLGRHGHALTSLAAINRLDTPEKEAIYAGLLPGRLL
FT                   QLLQLDPGTLCTPAEERLVEIIAPDGLSFARIEVRARPEDTDVVFFAELSDTQFHQMEL
FT                   AFCIICDPSAPRFAVDVNEAGAVNYFSSNGRNLPEELRAMQAGLFPHQTRRGLRMFGEF
FT                   FALAERFTDRLGMEMIVAEPLSYDNAIRYERYGFDYLTGKRLMLEIDREFQPGGRLHRR
FT                   LDGSSPFRMPGMELTVRGRSWAIHDGILDEPWDEIRIYKMIGVDAGLNTFPGRQSEEHH
FT                   "
FT   gene            complement(488712..489863)
FT                   /locus_tag="Glov_0517"
FT   CDS_pept        complement(488712..489863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0517"
FT                   /product="histone deacetylase superfamily"
FT                   /note="PFAM: histone deacetylase superfamily; KEGG:
FT                   gsu:GSU1222 histone deacetylase/AcuC/AphA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94245"
FT                   /db_xref="GOA:B3E2J2"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR003084"
FT                   /db_xref="InterPro:IPR003085"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="InterPro:IPR023801"
FT                   /db_xref="InterPro:IPR037138"
FT                   /db_xref="UniProtKB/TrEMBL:B3E2J2"
FT                   /protein_id="ACD94245.1"
FT                   /translation="MPRTALVYSSRFEQFSYGSQHPFQLHRYGLALELLEAYGLLDLPG
FT                   MERRDCTPVTDKQILSFHTPAYLQRLKEFSASDDPRADFMFGLGDADCPVFKGLYDYAA
FT                   LGAGATLEACRLIEEERFDSVLSLAGGWHHGHPARASGFCYLNDAVIAINWLRERGRRV
FT                   AYLDLDAHHGDGVQEGFYADDQVLTISLHESGVYFFPGTGFEDETGIERGQGYSVNLPL
FT                   LAHTDDPLYMRAFDEVVYPLLAAFNPDIIVAQIGADAFRTDPLTRLEITTHSYAYIMRK
FT                   LQALQIPWVALGGGGYDLMNTARAWTIAWGAMNKVALPPRLPAAFVKKIRQQGYPHTML
FT                   LDALHWADEHDRGLALDALERSINVIKKQIFPVIIGGELAVLL"
FT   gene            complement(489871..490761)
FT                   /locus_tag="Glov_0518"
FT   CDS_pept        complement(489871..490761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0518"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cvi:CV_1155 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94246"
FT                   /db_xref="InterPro:IPR021973"
FT                   /db_xref="UniProtKB/TrEMBL:B3E334"
FT                   /protein_id="ACD94246.1"
FT                   /translation="MDPLGIINSGAGYTSSVPATGARSTESGQSETAAGRSGTSVRAED
FT                   IRLPEDQVTLSGRSSETEASQPRATEQNGTKKQPKPGEKTTADGKSIDDPQVQQQISRL
FT                   KQTEEKVKAHEAAHKAVGGNLASSASYSYTQGPDGRSYITGGEVQIDMSSGRTPEETIS
FT                   RMQQVIRAALAPADPSGQDRAVAAQASSQMAEAQQQKLQSESPTAKPDPTQPVEPAQEA
FT                   AAEAADPTAAKDDKTAPNAPNGTDTRIQQAYGNPAVQGSDRTTDKNSNPTQPAATRSGS
FT                   SSSQTRADLLISAFA"
FT   gene            complement(490885..491781)
FT                   /locus_tag="Glov_0519"
FT   CDS_pept        complement(490885..491781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0519"
FT                   /product="chaperone DnaJ domain protein"
FT                   /note="PFAM: heat shock protein DnaJ domain protein;
FT                   chaperone DnaJ domain protein; KEGG: ppd:Ppro_0013
FT                   chaperone DnaJ domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94247"
FT                   /db_xref="GOA:B3E335"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:B3E335"
FT                   /protein_id="ACD94247.1"
FT                   /translation="MAQKDYYEALGVAKDASADDIKKAFRKLAVKYHPDRNQGDTAAEE
FT                   KFKEINEAYAVLSDPDKRKKYDTFGSSDFHQQYSQEDIFRNFDFSGTFKDMGMGGGEDI
FT                   FSRLFGGAFGRGGGRGFGKGPRQGGDLSLTVDVGFRDAATGGERLVAFRRNGQREELKV
FT                   KIPAGVDNGSRIRIAGKGSDGENGGPNGDLYLDIRVANDPVFTRDGGDLFVERTIRFSE
FT                   ACLGVSLEVPTLEEPKRIKVPAGIQPGTKIRLKGCGIKSLGSNAKGDLYVKISVHVPEG
FT                   LNSSQKKLVEELARAGL"
FT   gene            complement(491825..493078)
FT                   /locus_tag="Glov_0520"
FT   CDS_pept        complement(491825..493078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0520"
FT                   /product="transposase IS204/IS1001/IS1096/IS1165 family
FT                   protein"
FT                   /note="PFAM: transposase IS204/IS1001/IS1096/IS1165 family
FT                   protein; KEGG: gme:Gmet_3003 IS204/IS1001/IS1096/IS1165
FT                   transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94248"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="UniProtKB/TrEMBL:B3E336"
FT                   /protein_id="ACD94248.1"
FT                   /translation="MQLKSILNFVQPHQGFVYGAVHQRNKGQRTVLDIEIRPRKNRQPV
FT                   CSRCGKPGPGYDTLPVRRFEFVPLWGIAVFFLYAMRRVSCPSCGVKVEQVPWATGKNHL
FT                   TTTYAWFLARWARRLSWKEVGQVFQTSWDNVFRSVKMAVAWGLAHRDLDTITAIGIDEI
FT                   AWKKGHKYLTLVYQIDAGCKRLLWVGKERTQKTLRQFFKEFGKERTAHLRFICSDMWKP
FT                   YLRIVAEVAGQAMHILDRFHVMTHFGKAVDKVRATEARELKAKGQEPVLTGSRWCLLKR
FT                   PEHLTEKQSIKLNELLAINLKTVRAYLLKEEFQFFWRYATAGWAARFLDAWCKRTMRSR
FT                   IIPMKKIAKMLRSHRELLLNWFRTKGQVALGAVEGFNNKAKVTSRKAYGFRNFEVMKIA
FT                   LYHTLGNLPEPEATHRFC"
FT   gene            493318..494721
FT                   /locus_tag="Glov_0521"
FT   CDS_pept        493318..494721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0521"
FT                   /product="protoporphyrinogen oxidase"
FT                   /EC_number="1.3.3.4"
FT                   /note="KEGG: gme:Gmet_3551 protoporphyrinogen oxidase;
FT                   TIGRFAM: protoporphyrinogen oxidase; PFAM: amine oxidase;
FT                   FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94249"
FT                   /db_xref="GOA:B3E337"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR004572"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B3E337"
FT                   /protein_id="ACD94249.1"
FT                   /translation="MKKVLVIGGGISGLSTAWLLNKRAGEAGISLDLCLLEQEQQPGGK
FT                   IKSVREDGFLCEWGPNGFLDSKPQTLELCATLGITDRLHRSNDNARKRYIFTGGELHRL
FT                   PENGPSFLKSRLLSWPGKLRLLGEPFAANPPGSDESLAAFGRRRLGAEALQKLIAPMAS
FT                   GIFAGDPETMSLVSCFPRIAELEREYGGLFVAMLALAKKKKQERKEGKISSSAAGPGGT
FT                   LTSFKEGIQFLTDTLAAQLGEQVRTGVAVASVTRSGDGWEVRTTGGETLQADLVISAAP
FT                   AFAAAGMLEGVDTALVDTLRQILYSTLNVVCCGFKTEGLGHPLDGFGYLVPKEEGRTVL
FT                   GTLWDSSMFEERAPDGMALLRSMAGGACRPELMELPESELLQRVRDDLQAAMGISQPPC
FT                   FSRIIRHQQAIPQYTIGHGKRLEAIEGRLSSLPGLLLTGNAFKGVGLNDCVAASQATVE
FT                   RAMAYLERV"
FT   gene            494724..494837
FT                   /locus_tag="Glov_0522"
FT   CDS_pept        494724..494837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0522"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gsu:GSU3128 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94250"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:B3E338"
FT                   /protein_id="ACD94250.1"
FT                   /translation="MKIRKKLFADFEYEEVLDTKTRELIRVGCAVAVGCPT"
FT   gene            complement(494994..495686)
FT                   /locus_tag="Glov_0523"
FT   CDS_pept        complement(494994..495686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0523"
FT                   /product="DNA repair protein RadC"
FT                   /note="PFAM: DNA repair protein RadC; KEGG: ppd:Ppro_3582
FT                   DNA repair protein RadC"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94251"
FT                   /db_xref="GOA:B3E339"
FT                   /db_xref="InterPro:IPR001405"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR020891"
FT                   /db_xref="InterPro:IPR025657"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3E339"
FT                   /protein_id="ACD94251.1"
FT                   /translation="MSNNAIKDWPEDERPREKLLKRGAAALSDAELLALVLRTGDAAAG
FT                   KSAIDLGRELLERFDGNLRELAQAELNELQQIKGLGLAKAASIKAAFTLGKRFQARRLE
FT                   TLERFTSPAQVFDFFHHELRDNRKELFLTLLLDGKNRITRKVQVSEGSLNQSIVHPREV
FT                   FAPAVRESAAAVIFIHNHPSGDPAPSREDHEITRRLNEAGEILGIKVLDHIIIGDGAYF
FT                   SFVESGLL"
FT   gene            complement(495683..496501)
FT                   /locus_tag="Glov_0524"
FT   CDS_pept        complement(495683..496501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0524"
FT                   /product="undecaprenol kinase"
FT                   /EC_number="3.6.1.27"
FT                   /note="KEGG: ppd:Ppro_3583 putative undecaprenol kinase;
FT                   TIGRFAM: undecaprenol kinase; PFAM: Bacitracin resistance
FT                   protein BacA"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94252"
FT                   /db_xref="GOA:B3E340"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3E340"
FT                   /protein_id="ACD94252.1"
FT                   /translation="MDLLHAALLGLIQGATEVLPISSSGHLILIPRLLGWPDSGLTFDV
FT                   ALHFGTFLAIFVYFRKDVVSLVQDGLTGFFQPEAPRRLRLPWMIVLASIPAAIAGKTLE
FT                   QPIEELFRSSPLMIALMLILFGLGLGLTDRYGKKLHDVASITLGTAMLVGCFQCLALVP
FT                   GVSRSGITITAGLLLGLARTDAARFSFLLSLPIVFGAALLKGLHLLKHGIEPGMAMPML
FT                   VGVAVSAVVGYISVAFLLKFVQSRTLWPFVWYRVAAGIGVMALLGVGLLS"
FT   gene            complement(496509..497198)
FT                   /locus_tag="Glov_0525"
FT   CDS_pept        complement(496509..497198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0525"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: drm:Dred_0988 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94253"
FT                   /db_xref="InterPro:IPR024498"
FT                   /db_xref="UniProtKB/TrEMBL:B3E341"
FT                   /protein_id="ACD94253.1"
FT                   /translation="MTRERIIERVRKLLALSNSSNEHEAALAAAHAQRLLAEHNLAMSE
FT                   LEMQEEGAGEVELKVAKTVPKWLSSLFATVANAFDCFPIVTTNQEHSRLRFIGVGEDPG
FT                   VAACTLQFLIKELRRLASGYLSSLELRDNKLPPADRQRIRTSYLLGGVHGIRQALQAQK
FT                   AQTPTTSKALVPVKDALIRQYREEHVGELRTRRSRSSTVVSEAFHQGRQDGASLRLHPT
FT                   MKHLPKE"
FT   gene            complement(497195..497692)
FT                   /locus_tag="Glov_0526"
FT   CDS_pept        complement(497195..497692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0526"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gsu:GSU0390 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94254"
FT                   /db_xref="GOA:B3E342"
FT                   /db_xref="InterPro:IPR018639"
FT                   /db_xref="UniProtKB/TrEMBL:B3E342"
FT                   /protein_id="ACD94254.1"
FT                   /translation="MNKEQIKQRMKAILALDSHPGHIAAGFAVGVFISITPFFGIHTPL
FT                   AIAAAFLFRLNKLTTITGAWVNTPLTVVPVLAASYKLGEWLMGAKARPFCLSELSWTAL
FT                   KPYAKSVFLGSSLIGLGAAIISYFLCYWLVVRFRRKDPGLAELTRESILTGEDLEQEQE
FT                   KP"
FT   gene            497819..498376
FT                   /locus_tag="Glov_0527"
FT   CDS_pept        497819..498376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0527"
FT                   /product="amino acid-binding ACT domain protein"
FT                   /note="PFAM: amino acid-binding ACT domain protein; KEGG:
FT                   ppd:Ppro_3514 amino acid-binding ACT domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94255"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="UniProtKB/TrEMBL:B3E343"
FT                   /protein_id="ACD94255.1"
FT                   /translation="MPHRELTHYAVSVVGADRPGIVAGVTEALYKLGCNIADSSCAMLA
FT                   GEFAMILIVSHRKPFTKANLVEELKPVCERMAMTLSVRHLPQGEEDRKETAGEICQVTV
FT                   YGADQPGIVYRVTSTLAARQINIMDLQTKLAGTEQEPVYIMLLEATLPDDCAPEEVEKL
FT                   LNGLKQELQVEISVRIVTPVEL"
FT   gene            498376..498885
FT                   /locus_tag="Glov_0528"
FT   CDS_pept        498376..498885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0528"
FT                   /product="peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /note="KEGG: gsu:GSU3456 polypeptide deformylase; TIGRFAM:
FT                   peptide deformylase; PFAM: formylmethionine deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94256"
FT                   /db_xref="GOA:B3E344"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:B3E344"
FT                   /protein_id="ACD94256.1"
FT                   /translation="MAVQPILKYPHPLLKKMAHRVAALDEPIHTLVQDLIDTMQAGPGS
FT                   VGVAAPQIGVGLRVCVVDVSNSRHGKDNNHGLLCMVNPEIISRSGLAVMREGCMSVPDY
FT                   TGDVERATEITVRFLDSRSGQQREVAASGFEAVAIQHEMDHLDGLLFLDRIISVSTGLF
FT                   RRKQYR"
FT   gene            498894..499439
FT                   /locus_tag="Glov_0529"
FT   CDS_pept        498894..499439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0529"
FT                   /product="AMMECR1 domain protein"
FT                   /note="PFAM: AMMECR1 domain protein; KEGG: ppd:Ppro_3512
FT                   AMMECR1 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94257"
FT                   /db_xref="InterPro:IPR002733"
FT                   /db_xref="InterPro:IPR023473"
FT                   /db_xref="InterPro:IPR027485"
FT                   /db_xref="InterPro:IPR027623"
FT                   /db_xref="InterPro:IPR036071"
FT                   /db_xref="UniProtKB/TrEMBL:B3E345"
FT                   /protein_id="ACD94257.1"
FT                   /translation="MKKTEQKVLLQLARATIVAQVHGQSLPVLEKPSETLLSHSGCFVT
FT                   IKQQGQLRGCIGSFVAQQPLWETVREMAVSAATRDPRFYPMRPADLADFQLEISVLSPL
FT                   QLVQSIEEIQVGRHGLYLIKGHAHGVLLPQVATEYGWDRETFLRHTCLKAGLPETAWKK
FT                   DCEIYIFSAEVFGEERPA"
FT   sig_peptide     498894..498965
FT                   /locus_tag="Glov_0529"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.627) with cleavage site probability 0.624 at
FT                   residue 24"
FT   gene            499595..500101
FT                   /locus_tag="Glov_0530"
FT   CDS_pept        499595..500101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0530"
FT                   /product="alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; Redoxin domain protein; KEGG:
FT                   mpt:Mpe_A1221 peroxiredoxin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94258"
FT                   /db_xref="GOA:B3E346"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B3E346"
FT                   /protein_id="ACD94258.1"
FT                   /translation="MRCALVFLLFVLNLLTLSVTPCLAVKLNTPAPDFTLKDLQGGRQT
FT                   LSGYRGKLVLLNFWSTTCPPCVQELPSLNDLYKDQKQAGLLVLGIALDPAEKPVHELAG
FT                   KLRLEFPVVLDSNKDVYFDSYGLFGQPVSVIIDRTGLVREKMIGAVDWNSPQIRAKITS
FT                   YLKGR"
FT   sig_peptide     499595..499669
FT                   /locus_tag="Glov_0530"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.962) with cleavage site probability 0.944 at
FT                   residue 25"
FT   gene            500107..500457
FT                   /locus_tag="Glov_0531"
FT   CDS_pept        500107..500457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0531"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94259"
FT                   /db_xref="UniProtKB/TrEMBL:B3E347"
FT                   /protein_id="ACD94259.1"
FT                   /translation="MHSWLKFGVVAVAAFGIIGCSSGNFLVYKDSKHFYVTSTGPELRR
FT                   ILCDSGDMAKIAKDSQLPDALQKDLKDGICNSNKVKERLLATLEGMTKEQRTALKTAFQ
FT                   QNGYDINVVANC"
FT   gene            500643..501755
FT                   /locus_tag="Glov_0532"
FT   CDS_pept        500643..501755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0532"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   ppd:Ppro_1970 extracellular ligand-binding receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94260"
FT                   /db_xref="GOA:B3E348"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B3E348"
FT                   /protein_id="ACD94260.1"
FT                   /translation="MQLFRKVIGFWCLLGLLAACTPKEPVRIGFIGGMSGRVADLGVAG
FT                   RNGAMLAIEQRNAAGGIHGRTVELVVKDDGQNPEIAQKAVAELLNCRLELIIGPMTSSI
FT                   AMAVLEQINASRCVLLSPTVTTTALTGKDDNFLRVIGDTRSYASKAAVYQAVKLGRRNV
FT                   AVIYDLNNRSYTESWLNDFKAEFERHGGSVMTVQTYQSSPATSFNQLATVLLKSKPQLV
FT                   MIIGNAIDAALICQQIRKLDPVVAIGLAEWASTERFVELAGGAAEGVVVSQFLDRNDRS
FT                   ERYQAFLKQYHERFGGQEPGFAGLAGYDAALAAMEAYGARREGEMLKQTLIRLNSYQGV
FT                   QQKYQIDRFGDANRATLMTVIRNGSYQTLE"
FT   gene            501765..503747
FT                   /locus_tag="Glov_0533"
FT   CDS_pept        501765..503747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0533"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; KEGG: ppd:Ppro_1972 signal
FT                   transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94261"
FT                   /db_xref="GOA:B3E349"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B3E349"
FT                   /protein_id="ACD94261.1"
FT                   /translation="MVARPLRHMLVRFAALITLLPLGLTALLGSLWLLPEAEQEIASYH
FT                   RQLALTIAGQVDSYFKASRVSAVSVAAVTGQTDLAVVQKAIATNLQLLKRLRAMYLVDA
FT                   TGRVRAVGVSNMSKALQGDLLGLDLSRNELFQKARASGTEQWSDSFLSVVGGGLSVAVA
FT                   MPAGSNVVIEEFDLAHLSEFLHQTTPGSEQLIMLIDRHGQVVADQAGTWTAQQLNLNNI
FT                   PLIHERLTSTKEVRGSLVLNGIEMVGSLHKINTVDWWILVARPRHAAYRQLWTSLGIMA
FT                   VTLAATTLAAFGVAMVLTRRMSQRFESLAEHAQLVTRGGEATDWPHSTIVEFNALADSL
FT                   QQMSESLHERARLLEDEIAERQHAQEELHEKALLLEQEIGERVLAEHNLQVKQTQLEAL
FT                   NLTLEARVLEELAKNREKDALMIQQGRLAAMGEMLSNIAHQWRQPLNELGIMIQTLRLE
FT                   YDDKLLDGSRIDEFSDDCMRTILHMSKTIDTFRDFFKKDRSLQQFDPSVCIVATVELLK
FT                   ASLQAAGISLRLDLQPECLLQGQPNDFSQVILNILNNARDILLARAVATPVITVTSQQA
FT                   QGVLVIVVEDNGGGIAADIVDKVFDPYFTTKHKAQGTGLGLYISKKIIEGNFNGTITVE
FT                   HCPGGTRFRIAVPVRIAETVHGESD"
FT   sig_peptide     501765..501851
FT                   /locus_tag="Glov_0533"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.769) with cleavage site probability 0.396 at
FT                   residue 29"
FT   gene            complement(504063..504638)
FT                   /locus_tag="Glov_0534"
FT   CDS_pept        complement(504063..504638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0534"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gur:Gura_3359 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94262"
FT                   /db_xref="UniProtKB/TrEMBL:B3E350"
FT                   /protein_id="ACD94262.1"
FT                   /translation="MKKIYMLFATAALLSGCASTATINRLETQNGQGVFHVVEQRRSQS
FT                   PAGFGDLQVTLNLKTRNPGSVLIDTTGYGTEKYQLLIGVNGQTQRVTGAMKQEVGEYRG
FT                   SMDPEAGNGTRYRFATTLRLPIGPHQVTFALPVDGVVLEHEVIVGQGANAIELKPVYRA
FT                   KGNHRLLGFHGDRTFYGGVKTLIAAKQC"
FT   sig_peptide     complement(504576..504638)
FT                   /locus_tag="Glov_0534"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.918 at
FT                   residue 21"
FT   gene            complement(504671..505012)
FT                   /locus_tag="Glov_0535"
FT   CDS_pept        complement(504671..505012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0535"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /note="PFAM: nitrogen regulatory protein P-II; KEGG:
FT                   gsu:GSU0831 nitrogen regulatory protein P-II, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94263"
FT                   /db_xref="GOA:B3E351"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:B3E351"
FT                   /protein_id="ACD94263.1"
FT                   /translation="MKEIKAIIRPAKLLDVTTELHQIEGLPGVTVFEIKGFGKGRAKNA
FT                   KDKVSYEMVEFMPRIQLEVVVDDAMVERVVTIIQKYAHTGNTGDGKIFVSTIDDVVKIR
FT                   TNERGIAAI"
FT   gene            complement(505044..508148)
FT                   /locus_tag="Glov_0536"
FT   CDS_pept        complement(505044..508148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0536"
FT                   /product="heavy metal efflux pump, CzcA family"
FT                   /note="TIGRFAM: heavy metal efflux pump, CzcA family; PFAM:
FT                   acriflavin resistance protein; KEGG: gsu:GSU0830 heavy
FT                   metal efflux pump, CzcA family"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94264"
FT                   /db_xref="GOA:B3E352"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004763"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:B3E352"
FT                   /protein_id="ACD94264.1"
FT                   /translation="MLEKLIAYTLRQKGMVIFLALLIITFGLYSYSRLPIDAFPDVTNI
FT                   QVEVVSQADGLSAAEIERNVTYPIEMAMRGLPGIEQMRSVTKFGLSIVTIVFKDNVDIY
FT                   FARQLVFERLAEAREKLPKGVEVAMGPIGTAMGEIYQYTLEGTIPTDPQQKIAYLTNLR
FT                   TIQEWIVTPQLKSVAGVNEINSFGGYFKQYQVLVSPEKLVKYGLTVDDVYTAIGNNNEN
FT                   VGGNLLERGSDQYIVRGVGLIKDVSDIGNIVLKSVGGTPTYIRDVAEVKVGEAVRMGAA
FT                   MKNGKDECVGGIVMMLRGENSREVVRRVADKVKEINKNNILPEGIKIVPYYDRSDIVKA
FT                   SVGTVNKALIEGSILVLIVLYLLLNSIRGSIVVLIALPLSLLATFIIMRLTGITANLMS
FT                   LGGLAISIGMIIDTTIIQVENVQRHLSEAGEHHPKLTTVLKAVMEVRKPSIFGELIIAI
FT                   TFIPILALEGIEGKMFGPLAITVTVALLASLLLSIFIIPVLCNLILKPQPEQESFIMRH
FT                   ANRLYLPLLNYAMNQKRVVLGVAGALLVISLVLVTRLGTEFIPIMDEGSFDMDVAMLPG
FT                   VSLTKAMEVNQRVAEKLKQFPELDTVISRTGQTGVALDTRGADKTGYVGIFKPKDQWKR
FT                   DLNKDELTNRMRQALESIAGITVGFSQPIQCRIDELVAGTRAQLIVKLFGEDIAVLSEK
FT                   SQEIARVLASVKGGTDLNAEKVSGQPYLTVTIDRAKIARYGLNINDVQKVIEIAVAGKA
FT                   ASQLYEENRSFPITVRLPEEKRNSLDAVKNLLITTKSGVNVPLEQLADVAMREGPVQIS
FT                   RQDGVRRIGIEMNVTGRDIGSFVAEAKQQIRQKVKLPPGYYLTWGGQFENQQRAMQRLM
FT                   IIGPVAVGMILLLLYVTFRSLRLALLVISNLPFALIGGVFSLFISGQYLSVPASVGFVV
FT                   LFGVAVLNGLVLVSRIAQLRDEGLGLEEAIRQGATDRLRPVLMTASIAIFSLIPMLLAS
FT                   GTGSEIQKPLATVVVGGLVTSTVLTLLIIPSVYSWFEKRKADEEM"
FT   gene            complement(508185..509387)
FT                   /locus_tag="Glov_0537"
FT   CDS_pept        complement(508185..509387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0537"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   gme:Gmet_3508 secretion protein HlyD"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94265"
FT                   /db_xref="GOA:B3E353"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:B3E353"
FT                   /protein_id="ACD94265.1"
FT                   /translation="MKKRTLLVSLLLLAAIGSGLYYRITTQGDAEKAEPKEAGSKDTKA
FT                   EKHEEDGKVKMTAELQQQNGVAVGTAATQRLAGVISATGKVDVNSDRIAHVSPRISGKI
FT                   VSVRSSLGDQVSAGQVLVTLDSVELGEALNRYHQSKTKLALAQSSMDRIKLLVDKKIAA
FT                   RKDILLAETEFKTAQTELHTDEERLALYGVSLADLTNTRHRSPLLPVRSPISGIITEKH
FT                   AIVGELADPSKNLFTIADLSSVWIMVDINEKDLAKIHRGQIASVSVSAFPDLKLQGRIT
FT                   YIADLVDQNTRTVKARIEVANLQRKLKPEMFASVELKLAADAPPVLAVPEESLQDLDGK
FT                   KVVFVVEGKDTFVPRPVQAGRMANGKIEILSGLQEGELYAVKGAFILKSELKKAEMKDE
FT                   H"
FT   sig_peptide     complement(509334..509387)
FT                   /locus_tag="Glov_0537"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.981) with cleavage site probability 0.410 at
FT                   residue 18"
FT   gene            complement(509384..510682)
FT                   /locus_tag="Glov_0538"
FT   CDS_pept        complement(509384..510682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0538"
FT                   /product="outer membrane efflux protein"
FT                   /note="PFAM: outer membrane efflux protein; KEGG:
FT                   gsu:GSU2137 metal ion efflux outer membrane protein family
FT                   protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94266"
FT                   /db_xref="GOA:B3E354"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:B3E354"
FT                   /protein_id="ACD94266.1"
FT                   /translation="MSRTLRAQGALSLLTVIFVMALSSTAWAVESTLSLSHVIALSMQH
FT                   NAELRALREELGVRDAGVTRAGLLPNPTLDLEAGTGALTGSKNENSLALGLSQEIPLVG
FT                   KRGKRLSVAEQERDLYRWQLLDKERRLREEVKTAFYDALLAKERVALADRSIALNRQLL
FT                   DVTKERLSAGDIPELEMNLVKVELARSEGARIESAKTMLQNQARLWTLMGLASGSRPEI
FT                   TGTLDIGTLVAGTLADLQQRANANRPDLRALKAEKKRGEADITLAQAEKIPNLTAGLVL
FT                   RRDTTSMEIAGQEGKDTAYTVGIRLSIPIPLFDRNRAGVQEATARKNSTESRLNGTFMA
FT                   VEREVATAYATFEHAVSVLSLYRIDIIPQLEENLKLTQEAYRLGETGIIAVIQEQKKFF
FT                   EVSEGHLTALRDRQVALVRLESATATELTGGEK"
FT   sig_peptide     complement(510596..510682)
FT                   /locus_tag="Glov_0538"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 29"
FT   gene            complement(510803..511135)
FT                   /locus_tag="Glov_0539"
FT   CDS_pept        complement(510803..511135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0539"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gur:Gura_3363 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94267"
FT                   /db_xref="UniProtKB/TrEMBL:B3E355"
FT                   /protein_id="ACD94267.1"
FT                   /translation="MLLVMLAITLHGVAESAHALQGCSAVPNASAYIHHPPCANDHCPC
FT                   STPSSEHKDSDGCDSCVNCICHAPLPMQQLALHYSPVVRDLIFSEPYQFLPEVFLSKFI
FT                   PPQNQA"
FT   gene            complement(511363..513711)
FT                   /locus_tag="Glov_0540"
FT   CDS_pept        complement(511363..513711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0540"
FT                   /product="Spermine synthase"
FT                   /note="PFAM: Spermine synthase; KEGG: ade:Adeh_3062
FT                   spermine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94268"
FT                   /db_xref="GOA:B3E356"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B3E356"
FT                   /protein_id="ACD94268.1"
FT                   /translation="MTRQFRLLLLSLLFLSGFTGLCYEICWIRAAGRIFGATAFAVSSV
FT                   VALFFAGMALGAHYFGNCVQRWKQPLRVYALLEIGIGTGAMLSLPLLTLLEQPYQLLYQ
FT                   AGFQNDSTLALTRLLLIGLIIIPPTFLMGGTLPLFTQFYDTAGKELGFLYALNSLGAAA
FT                   GCLLCGFILLPMLGISSTLLLIGLMAQGTGLLLLYLLKYDPHSVAIPAAVTAFPDRSFN
FT                   STGQALLYPVIFGTGFCALSYEIIWTRFLSLITHNTVYTYTISLLVTLLGISAGSILAR
FT                   LHRPALRHPTALAAAYILNSLFVLLSLLLPTAAWDWAGSSESPVMVLLICLALMFIPAL
FT                   CSGLTFPLLFDLIRQARYSSGKRVGRLLAVNTAGCVAGSLLTGFILLPLLGMHATLLVT
FT                   TGLCLLLGILVMLFFERGRPWRVRGLIACVSLAAWLCLISTTTVHLPQSYLAKGKKLVD
FT                   YVEGKNSFISVVQKNGDLTMELDRLWQGKKGTGHQIMAAHLPMLLHPAAQEILVVGIGA
FT                   GQAPSRFLYYDITRLDCVDIESSLPQVLKKHFQGSWLNDPRVSFIAEDGRTVARYGKRR
FT                   YDLISVEVGQIFRPQASAFYTLEFYRNAREKLAQDGIIAQFLPVGFFNQDQLKSVIRTF
FT                   LAVFPHSTLWYNQHAELLLIGSPDRDLAIRAEGVRVLKQNSRVRAELFFGYPGTEEHFL
FT                   NLPEVLAASFLMGPKTLANISTDAPLLSNDRPVLEYGTARTTYAPQRFKKLFTEQYDSP
FT                   RSIIKFTDPEAILPKSTRIQEYYLTNGFN"
FT   sig_peptide     complement(513646..513711)
FT                   /locus_tag="Glov_0540"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.693) with cleavage site probability 0.369 at
FT                   residue 22"
FT   gene            complement(513720..514763)
FT                   /locus_tag="Glov_0541"
FT   CDS_pept        complement(513720..514763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0541"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: gme:Gmet_3456 protein of unknown
FT                   function DUF6, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94269"
FT                   /db_xref="GOA:B3E357"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B3E357"
FT                   /protein_id="ACD94269.1"
FT                   /translation="MGKQGIHTALLSAILFGISPVACKAMTGEMPPALLAGLLYLGSGL
FT                   GLAGVVLRQRTPVFTALHSLSGRQWLHLGGAIVSGGVLAPLFLAYGIRFGSATEVSLLL
FT                   NFEAVATTLLAWLVFHEYVGMRVWAGKLLIVGASVLIVLSGSGGTTLSLPGLAVLAACC
FT                   LWGIDNNLTRELESLPATLLACLKGLSAGLFNILLARLLSSESGSALQVTAALGIGALS
FT                   YGVSLVLFIHALREIGAARTSTWFATGPFIGTLLSVLLLGERPPEAYWLAALIMLSGIL
FT                   FLYGERHRHPHTHNPLEHNHQHTHDKHHRHAHDERDISGPHEHHHCHEPLTHTHVHWPD
FT                   IHHRHSH"
FT   sig_peptide     complement(514686..514763)
FT                   /locus_tag="Glov_0541"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.949) with cleavage site probability 0.417 at
FT                   residue 26"
FT   gene            complement(515139..515450)
FT                   /locus_tag="Glov_0542"
FT   CDS_pept        complement(515139..515450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0542"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94270"
FT                   /db_xref="GOA:B3E358"
FT                   /db_xref="UniProtKB/TrEMBL:B3E358"
FT                   /protein_id="ACD94270.1"
FT                   /translation="MRIARYAPAFYLFACICAIPVPAPGAEPPLSAEAAVIVVTLAIAV
FT                   VPRCFCANRKPMSYWKQLDKQVWVKKRKCQQGPILKTALFSTPNLQGPVGFISLEIFN"
FT   gene            complement(515503..515838)
FT                   /locus_tag="Glov_0543"
FT   CDS_pept        complement(515503..515838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0543"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94271"
FT                   /db_xref="UniProtKB/TrEMBL:B3E359"
FT                   /protein_id="ACD94271.1"
FT                   /translation="MLRYCGVIVMIICLLGGSLHAGHDQAVADAHETGGCLISSGCASS
FT                   TSPCHDDTHNPDGDHCCDTHTQLQAVTSQLPAVLVPPQTKQFTAVVPHLVPKEFSRIPF
FT                   KPPRSNA"
FT   sig_peptide     complement(515773..515838)
FT                   /locus_tag="Glov_0543"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.972) with cleavage site probability 0.936 at
FT                   residue 22"
FT   gene            complement(515896..516555)
FT                   /locus_tag="Glov_0544"
FT   CDS_pept        complement(515896..516555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0544"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: gme:Gmet_1552 ABC transporter-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94272"
FT                   /db_xref="GOA:B3E360"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3E360"
FT                   /protein_id="ACD94272.1"
FT                   /translation="MITAHHITKEYPSGEGAVAALRGVDLTVETGEFVCIMGQSGSGKS
FT                   TLLTILGGMCHPGSGSVEVDGTAIYRLDDNGLADFRARHFGFIFQSFHLVPYLTAQENV
FT                   MLPLAPLAMAAAEKRRLANDALARMGLAGCTGRLPGRLSGGEQERVAIARAVVNRPAIL
FT                   FADEPTGNLDSATSDQVMGLFTELHQAGQTIVMVTHNPDNGHYAQRTIRLKDGLLL"
FT   gene            complement(516646..517806)
FT                   /locus_tag="Glov_0545"
FT   CDS_pept        complement(516646..517806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0545"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   gme:Gmet_1553 protein of unknown function DUF214"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94273"
FT                   /db_xref="GOA:B3E361"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:B3E361"
FT                   /protein_id="ACD94273.1"
FT                   /translation="MRPYQIALKNLIRRPARMFFLTVALAVGLAAVVALVTLSNSMTAD
FT                   IEHTMDQFGANILITPKSNDLALSYGGISLGRVSFDQRELDPSVLERIRTIKNHQNIAA
FT                   VAPKVLGTVTVQGRELLLVGVDFAAELRMKPWWRLTGAEPSAADDALLGNSAARVLGVK
FT                   PGDRLTVGGRSFKVAALLQETGSQDDGLLFVPLAAAQAITGKQGKITLIEVAALCSGCP
FT                   IGEMVEQIAGVLPDARVSAIKQVVEGRLQTIGQLKRFSLGMGGVIALIGLLVVFITMMG
FT                   NVNERKVEIGIFRAIGYRTGHVMGIILLEAGLVGLVAGLTGYLLGVGAAAVTLPLLAQS
FT                   GHPHLLLQWQVALAAIAAVGLVSLLAAVYPARRAGRMDPADALRSL"
FT   sig_peptide     complement(517675..517806)
FT                   /locus_tag="Glov_0545"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.727 at
FT                   residue 44"
FT   gene            complement(517803..518240)
FT                   /locus_tag="Glov_0546"
FT   CDS_pept        complement(517803..518240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0546"
FT                   /product="membrane protein-like protein"
FT                   /note="KEGG: gur:Gura_0081 membrane protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94274"
FT                   /db_xref="InterPro:IPR018758"
FT                   /db_xref="UniProtKB/TrEMBL:B3E362"
FT                   /protein_id="ACD94274.1"
FT                   /translation="MKKLLILTILALVGMLAACSSGSHKSVQADGSVVKIPLTDLQPMQ
FT                   ASFYRINLDGKEIRFFAVKGSDGRIRTALDACDVCYKERKGYQQQGDLMLCRNCNLTFP
FT                   IDRIGPSSVGGCNPHFLPSQVTGDQLLLPVAELQQGARFFP"
FT   sig_peptide     complement(518163..518240)
FT                   /locus_tag="Glov_0546"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.478 at
FT                   residue 26"
FT   gene            complement(518243..519091)
FT                   /locus_tag="Glov_0547"
FT   CDS_pept        complement(518243..519091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0547"
FT                   /product="cytochrome c-type biogenesis protein CcsB"
FT                   /note="TIGRFAM: cytochrome c-type biogenesis protein CcsB;
FT                   PFAM: cytochrome c assembly protein; KEGG: gsu:GSU0614
FT                   cytochrome c biogenesis protein, CcmF/CcyK/CcsA family"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94275"
FT                   /db_xref="GOA:B3E363"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="InterPro:IPR003557"
FT                   /db_xref="InterPro:IPR017562"
FT                   /db_xref="UniProtKB/TrEMBL:B3E363"
FT                   /protein_id="ACD94275.1"
FT                   /translation="MNSGSLMNGTTIFYMLSTLAFFIYLAGRNKQIGLAGSVLAWTGFA
FT                   LQTVALGLRWKESYDMGVGHAPMSNLYESVVFFAWSIVLIFGIIDAKYHYRVIGAFVMP
FT                   FALLGMTWGQLYLPSDISPLMPALQSNWLTYHVISCFLGYAAFAVACGVSIMYLIKAKS
FT                   EASSTEPADGILSVFPPTRVLDDLNYKAIMVGFPLLTLGIITGAAWANYAWGTYWSWDP
FT                   KETWSLIVWFVYAAFLHARFTKGWVGKRAAWLSIIGFAATIFCYLGVNLLLSGLHSYGG
FT                   M"
FT   gene            complement(519088..520473)
FT                   /locus_tag="Glov_0548"
FT   CDS_pept        complement(519088..520473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0548"
FT                   /product="ResB family protein"
FT                   /note="PFAM: ResB family protein; KEGG: ppd:Ppro_2588 ResB
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94276"
FT                   /db_xref="GOA:B3E364"
FT                   /db_xref="InterPro:IPR007816"
FT                   /db_xref="UniProtKB/TrEMBL:B3E364"
FT                   /protein_id="ACD94276.1"
FT                   /translation="MTTEHRSVSDKVMQTLASLRLTMAVLILLALVSIIGTVIPQGQLP
FT                   PEYVASIGGEQGNRFRLYALLGFFDMYHAWWFQGLLALLSINLLACTIKRLPHVWRIAT
FT                   RPDITLSSAQEAAATCSAVLTVPESVDRARLTAAIAAVAGKPVLTEKDHELHLFVQQRP
FT                   WARLAVYGVHASVILIFIGAIIGNIFGFKGFVAIPEGSTVSSFTDRKGQQRPLGFELRC
FT                   DQFTVSFYDAPGGGPSQMPKEFKSILTLTENGKEIPGYKHARLIVNDPLTYKGITFYQS
FT                   SYGTTGNHTFTVGTTRLTVGSEETAHLPDGSSMHLIEAVQDVSPFLPGKTGPAARIDVH
FT                   PANGGAAVTLLSLANYPEENRREAAKHNLPVITYQGGTERPYTGLQVNKDPGVWVVWIG
FT                   SLLMCVGLYVAFFLPHQRIWFRFGQGRLVIAGHTTKSQAAFRQRIERIEQQLKATLQQE
FT                   ETR"
FT   gene            complement(520565..520957)
FT                   /locus_tag="Glov_0549"
FT   CDS_pept        complement(520565..520957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0549"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gme:Gmet_3506 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94277"
FT                   /db_xref="GOA:B3E365"
FT                   /db_xref="UniProtKB/TrEMBL:B3E365"
FT                   /protein_id="ACD94277.1"
FT                   /translation="MTNSTPIPYCNGMLQTRIRIISTTLLSILALATILMAPVAALSHQ
FT                   DLPDTRSTAASSADCDGCHGETPADTHQDDGCATTACACACHAPLTLAPVTVPLPVAIA
FT                   SSFNLSTPQTPPQVYLSIFVPPQNLS"
FT   sig_peptide     complement(520826..520957)
FT                   /locus_tag="Glov_0549"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.863 at
FT                   residue 44"
FT   gene            complement(520954..521892)
FT                   /locus_tag="Glov_0550"
FT   CDS_pept        complement(520954..521892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0550"
FT                   /product="Integral membrane protein TerC"
FT                   /note="PFAM: Integral membrane protein TerC; KEGG:
FT                   gsu:GSU1570 membrane protein, TerC family"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94278"
FT                   /db_xref="GOA:B3E366"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="InterPro:IPR022369"
FT                   /db_xref="UniProtKB/TrEMBL:B3E366"
FT                   /protein_id="ACD94278.1"
FT                   /translation="MSPTTIMWIVFAALISFMLVIDLSLNRKSGRVSFKKAATWTVVWM
FT                   LLALLFGGGIWYTMGQQKALEFLTGYLIEQSLSVDNLFVFIMIFTVFGVRGELQAKVLK
FT                   WGILGAIVMRLVFIFIGAALLKEFQWLFYIFGALLVYTAWKMAFSGDDEIEPDKNPLVK
FT                   LARRFLPMTKRIRGDWFITRRMQLWIASPLFMVLLVVESSDLVFAMDSIPAIFAITLDP
FT                   FIVLTSNVFAIMGLRSLFFLLSNLMGMFAYLKFGIALILAFVGVKMILMMLGFHIPISL
FT                   SLAVIVVTLAIAVVASLLLRKPETDELLETA"
FT   gene            complement(521916..522503)
FT                   /locus_tag="Glov_0551"
FT   CDS_pept        complement(521916..522503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0551"
FT                   /product="protein of unknown function UPF0016"
FT                   /note="PFAM: protein of unknown function UPF0016; KEGG:
FT                   ppd:Ppro_0782 protein of unknown function UPF0016"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94279"
FT                   /db_xref="GOA:B3E367"
FT                   /db_xref="InterPro:IPR001727"
FT                   /db_xref="UniProtKB/TrEMBL:B3E367"
FT                   /protein_id="ACD94279.1"
FT                   /translation="MELSTFISSFGLIFLAELGDKTQLTAMALALRYPWKRIFIGIAAA
FT                   FTVLNLAAVLVGKILFLVLPIFWVTLVSALLFLYFGYSTLKNACDAGDDDTPPPTAADA
FT                   VRTAFLMIFMAELGDKTQLVTASQAAQHSGSLSGIVTVFVASTLALWLVSLIGIFAGKQ
FT                   LVKYIPVCWIHRTAGFMFLVFGVAMGWRLFSL"
FT   gene            complement(522504..523088)
FT                   /locus_tag="Glov_0552"
FT   CDS_pept        complement(522504..523088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0552"
FT                   /product="LemA family protein"
FT                   /note="PFAM: LemA family protein; KEGG: gur:Gura_2032 LemA
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94280"
FT                   /db_xref="InterPro:IPR007156"
FT                   /db_xref="InterPro:IPR023353"
FT                   /db_xref="UniProtKB/TrEMBL:B3E368"
FT                   /protein_id="ACD94280.1"
FT                   /translation="MKRIMLLIMGTLLMGMLSGCGYNTMQANEEAVIAAWGDVESAYQR
FT                   RNDLIPNLVEVVKGYAKHEADTLKAVTEARASVGGMKVGKEIINDPAAIAKFQQMQGQM
FT                   SGALSRLMVVAEKYPDLKANQNFLDLQKQLEGTENRINVARERYNKQVQAFNTSIRTFP
FT                   NSLTNSMLLHLQRKEPFKAEEGAKVAPKVKF"
FT   sig_peptide     complement(523029..523088)
FT                   /locus_tag="Glov_0552"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.543 at
FT                   residue 20"
FT   gene            complement(523085..523321)
FT                   /locus_tag="Glov_0553"
FT   CDS_pept        complement(523085..523321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0553"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: noc:Noc_2152 integral membrane protein TerC"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94281"
FT                   /db_xref="GOA:B3E369"
FT                   /db_xref="InterPro:IPR019099"
FT                   /db_xref="UniProtKB/TrEMBL:B3E369"
FT                   /protein_id="ACD94281.1"
FT                   /translation="MLHWTLRKARQLVVAVIGITVVIIGIIMIFTPGPAIVVIPLGLGI
FT                   LATEFVWARDLLHKVKTYIEKKVKKPEKAEESQ"
FT   gene            complement(523321..524178)
FT                   /locus_tag="Glov_0554"
FT   CDS_pept        complement(523321..524178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0554"
FT                   /product="peptidase M48 Ste24p"
FT                   /note="PFAM: peptidase M48 Ste24p; KEGG: gsu:GSU1567
FT                   peptidase, M48 family"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94282"
FT                   /db_xref="GOA:B3E370"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR022919"
FT                   /db_xref="UniProtKB/TrEMBL:B3E370"
FT                   /protein_id="ACD94282.1"
FT                   /translation="MLNQFKTTLLLSLLTVLLVAMGGAIGGSGGMLIAFVMAAVMNFGS
FT                   YWFSDKIVLRMYGAQEITRSENPAFYGMVERLAQRAGLPMPKVYIIPDQSPNAFATGRN
FT                   PSHAAVAATEGILRILSPEELEGVMAHELGHVKNRDILISTIAATFAGAISMIGSMLQW
FT                   GAMLGAGRDDEEGGGLGGLVGSLAMAILAPFMAMLIQMAVSRSREYLADATGAEICGKP
FT                   RALASALGRLQNASHQIPMHDATPATAHMFIVNPLTGGGMMSLFSTHPPMEERIARLQA
FT                   MAQR"
FT   sig_peptide     complement(524062..524178)
FT                   /locus_tag="Glov_0554"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.835 at
FT                   residue 39"
FT   gene            complement(524458..525090)
FT                   /locus_tag="Glov_0555"
FT   CDS_pept        complement(524458..525090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0555"
FT                   /product="Carbonate dehydratase"
FT                   /EC_number="4.2.1.1"
FT                   /note="PFAM: carbonic anhydrase; KEGG: pca:Pcar_1988
FT                   carbonic anhydrase"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94283"
FT                   /db_xref="GOA:B3E371"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR015892"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:B3E371"
FT                   /protein_id="ACD94283.1"
FT                   /translation="MQEIQKFIHGFRNFQEEYFHEDRELFDCLKQGQRPKVVLIGCSDS
FT                   RVDPSMMVRSEPGDLFIVRNVANLVPPCEHDQAYHGVSAALEYAVCHLEVEHVIVLGHS
FT                   NCGGIRSLMEGIPSDKNGEYISKWVSIAERAKQQVLETFSDASAERQAKACEHASILVS
FT                   LENLLTFPWIKERVDAGKLDLHGWYFDIESGNLYSYHPASGEFTLLV"
FT   gene            complement(525104..525607)
FT                   /locus_tag="Glov_0556"
FT   CDS_pept        complement(525104..525607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0556"
FT                   /product="phosphoribosylaminoimidazole carboxylase,
FT                   catalytic subunit"
FT                   /EC_number="4.1.1.21"
FT                   /note="KEGG: hmo:HM1_3114 phosphoribosylaminoimidazole
FT                   carboxylase, catalytic subunit; TIGRFAM:
FT                   phosphoribosylaminoimidazole carboxylase, catalytic
FT                   subunit; PFAM:
FT                   1-(5-phosphoribosyl)-5-amino-4-imidazole-carboxylate (AIR)
FT                   carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94284"
FT                   /db_xref="GOA:B3E372"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:B3E372"
FT                   /protein_id="ACD94284.1"
FT                   /translation="MSKPLVGILMGSDSDLPVMEKAAEVLTQLGIGWEMDISSAHRLPD
FT                   KTAVYARTARERGIEVLICGAGMAAHLAGVVASHTTLPVIGVPLKSGALAGVDALYATV
FT                   QMPPGIPVATVAVDGGKNAGYLAASILSIKRPELADRLEQFRAATRQELEEKSSELQTR
FT                   LKQA"
FT   gene            525747..526994
FT                   /locus_tag="Glov_0557"
FT   CDS_pept        525747..526994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0557"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: protein of unknown function DUF1228; major
FT                   facilitator superfamily MFS_1; KEGG: ppd:Ppro_2332 major
FT                   facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94285"
FT                   /db_xref="GOA:B3E373"
FT                   /db_xref="InterPro:IPR010645"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B3E373"
FT                   /protein_id="ACD94285.1"
FT                   /translation="MSNSTSHQSRFLHYGWVIVAVGVLVLFSCLGLARYAYTMLLPAMQ
FT                   TGLQLSYDRMGLIGTANFSGYLVAVVLSPWLLRRFRPRAVISAGLLLIALCMAGISQSR
FT                   GFLTAALLYAFTGLGGGLANIPLMALVPCWFRSRVRGRAAGLIIGGNGLAIICAGYLIP
FT                   LLNRQYAAAGWRLAWLLLAAITLLTALIAALWLRNTPAEKGLEPLGPLQPEQHGSLPVH
FT                   HEQQGDGVLLLRLGLLYLAFGATFMVFGTFIVTSMVRESGFSEAQAGHYWSWVGFFSVF
FT                   SGVGFGSLSDRIGRKQGLALVFLVQSTAYLLAGLKLGAIGLMLAIVLYGSAVFAIPAIM
FT                   AAAVGDYLGTARAAASFATITIFFAVGQTIGPAVAGLLARSYGSFAPAYLCAAAITCSA
FT                   ALFSLVLPTPHRRDPA"
FT   sig_peptide     525747..525857
FT                   /locus_tag="Glov_0557"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.711) with cleavage site probability 0.466 at
FT                   residue 37"
FT   gene            527083..529764
FT                   /locus_tag="Glov_0558"
FT   CDS_pept        527083..529764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0558"
FT                   /product="PAS/PAC sensor hybrid histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="KEGG: gsu:GSU2314 sensory box histidine
FT                   kinase/response regulator; TIGRFAM: PAS sensor protein;
FT                   PFAM: response regulator receiver; ATP-binding region
FT                   ATPase domain protein; histidine kinase A domain protein;
FT                   PAS fold-3 domain protein; PAS fold-4 domain protein; PAS
FT                   fold domain protein; SMART: PAS domain containing protein;
FT                   PAC repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94286"
FT                   /db_xref="GOA:B3E374"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR021796"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B3E374"
FT                   /protein_id="ACD94286.1"
FT                   /translation="MKKYRTIWMALLQWGLLWSLIVGCSLLWNERLIRQQVYEYSRHEA
FT                   TTIINKDLAFRRWATMHGGVYVHPTEQTPPNPWLTIPKRDVVTTDGDKLTLMNPAYMTR
FT                   QVMGLFGEQFGVKGHITSLIVKNPANAPDAWERDALLRFEKGATSVSELTIINGAPYYR
FT                   LILPMKMEQGCLKCHADTRIPVGGIRGGISAAVPLAPHLQAGESGLRGVRLAHGGIWLA
FT                   GMIGITIASAIYLRQQRLSQQAEDDLRAQEALYASLTTASPTGVFQADLHGAYCYVNDR
FT                   WSAIAGLPFEQALGEGWLQALHPEDRVRVSEEWQHSVAGDCPFSLEFRFVRPDGTVAWV
FT                   YGQSAEIFDSKGGIVGYVGTITDISIRKKAEATLAEQALFLRESQSIAHLAGWKSNPDS
FT                   DLLSWTDEMYHMLDHPQDEPISHVACFRYFDPQDLPMVEKALQEAMRNGTPFKLSCRMV
FT                   SARGRRFWADFRCIGRMDGPDGGYIGGTLQDISEHKQIEELLISAKEMAEATSRAKTEL
FT                   LATLSHELRTPLNGVMGGVQLLEMTDLSADQEEYLQMVRTSATNELALVNDLLDLAGLE
FT                   ASGLKVESTPFNLLESIKLAITLHRSALETRGLPLVTSLPESLAQLVIGDGRRLTQIVS
FT                   NLLGNAIKFTEQGGISLAADCTPCGGSELRLQVRVSDTGIGIAEKDLQRIFEPFVQADM
FT                   SSTRRFGGTGLGLAICHRLAERMGGSIRVDSIPGEGSSFTLELPFLAAAADLAETDGHD
FT                   AALQPLWHGSRLTVVIAEDNPVNLKAAAGLAGKLGLRVLCAEDGKQALAHWMSGGVDVI
FT                   LMDIQMPVMDGSEATRFIRQREQGSGAHTPIIALTAHAMAGDRERLLAEGFDGYVAKPF
FT                   LINELAAELERVTTAVAAVSSV"
FT   gene            529772..531886
FT                   /locus_tag="Glov_0559"
FT   CDS_pept        529772..531886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0559"
FT                   /product="multi-sensor hybrid histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="KEGG: ppd:Ppro_2061 PAS/PAC sensor hybrid histidine
FT                   kinase; TIGRFAM: PAS sensor protein; PFAM: response
FT                   regulator receiver; ATP-binding region ATPase domain
FT                   protein; histidine kinase A domain protein; 5TM Receptors
FT                   of the LytS-YhcK type transmembrane region; PAS fold-4
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94287"
FT                   /db_xref="GOA:B3E375"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011620"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B3E375"
FT                   /protein_id="ACD94287.1"
FT                   /translation="MIYLALIQNIALLVALTFAHGLLIRHIRQRGHAYALLSGLLFGSV
FT                   ALVGMMTPMILQPGLIFDGRSIVIAVAGLFGGPVTAAVAAAMAAGYRYWLGGVGAPMGV
FT                   AVIIGSGAIGVAGYYLRRSWPRVVSPVGFYLFGLLVHLWMIGCMSFLPAAVAQVVLANI
FT                   TLPVLLVYPVATLLVCQLFLQMEHHISVEQELEQERNKLDSLIQAVPDLLFEVGLDGRY
FT                   YACYARHSEQLAAPAEQLVGRTVREMLPPRAAEVCLEALQEAEATGHSHGRQFFLPLPS
FT                   GEIWFELSVARKTGPVEDQPRFVVLSRDISDRKQHEKELLEARYAAEAASRAKSEFLAN
FT                   MSHEIRTPMNGVIGMAHLLGTTELSPEQEQYLENIENSANSLITLIGDILDLSRIEAGR
FT                   MLLENVDFSLRRCIQELLGSQQFQINQKKISIHTEIAEDVPDLLRGDQLRTRQILLNLL
FT                   GNAIKFTEHGGVTITAQLVTSEENRVLIHLAVSDTGIGMPPDLLERIFAPFEQADNSTT
FT                   RRYGGSGLGLAICRRLAELMGGRIWAESGAEGGSTFHVELPFLLPEQTDRQQERNCEQA
FT                   DDVYQDRPLELLLAEDNLVSAQFVHKVLSRMGHQVTVVGDGRQALDCLADRSFDCILMD
FT                   IQMPVMGGDAAVRIIREQENQRGGHIPIIALTAHDMDEERERLLRQGFDAHVAKPVDIA
FT                   LLNAALRRLL"
FT   gene            531883..534705
FT                   /locus_tag="Glov_0560"
FT   CDS_pept        531883..534705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0560"
FT                   /product="PAS/PAC sensor hybrid histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="KEGG: ppd:Ppro_2061 PAS/PAC sensor hybrid histidine
FT                   kinase; TIGRFAM: PAS sensor protein; PFAM: extracellular
FT                   solute-binding protein family 3; response regulator
FT                   receiver; ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; PAS fold-3 domain
FT                   protein; PAS fold-4 domain protein; PAS fold domain
FT                   protein; SMART: PAS domain containing protein; PAC
FT                   repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94288"
FT                   /db_xref="GOA:B3E376"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B3E376"
FT                   /protein_id="ACD94288.1"
FT                   /translation="MKNRIRSLALPLLTVLLVLLLVCAAEKPAGAVPAGLALSDAEKSW
FT                   LARHPIIHVGVMQDWPPMNYLDRNGTVQGIGADYLKTINRMLGGMLVPVPGPFRDNYEW
FT                   LQKGQIDALMDITRTPERDALFDFTRPYISIPHVLVGRKSGGFYRQESDLTGKRIALEK
FT                   GFNNVTYFRNNFPAVTVREYGSTAEALKAVARGEADAYAGNRAVVQHLLEKLELNGLMP
FT                   MGTLIAPRSVLQFGVAKGQTELLGILDKALAAIPAGERSAIADRWIPNPYETRIDYRKL
FT                   LLAALLVITLLAGLVLVTRRLNKRLQQQQDYWQALFEHNGTGNLIVSSERLMLKVNQQF
FT                   CDLFGYREEELIGQSVRLLHLDQQHYEGWAPTFMSVRDGKTHLSAEYPMRHKDGSLFWC
FT                   LFTGVRLQLPDGQRGVVWSAIDITERKQAEQTMALLNFALDTIHEAAYLVDETTRFIFV
FT                   NQEACRSTGYSREELLTMKIGDVDAEFPEDQWPVFWQELIRRRAITFEGMHKDCSGRTY
FT                   PVEITANYFEFDGQGYNLGLARDISERKKTEAVLQEAKERAEAASRAKTEFLANMSHEI
FT                   RTPMNGIISMAHLLRMTELTSEQQEYLASLQISSKNLLALISDILDISKIEAGKLELEY
FT                   ADFSVRATIEEVVASQMPRITQKRLDICTELSDGLPEILLGDSLRFKQILLNLLGNAIK
FT                   FTEQGGISIVAKPSARHDNQLIMRIMIADTGIGMSPEVLERVFSPFEQADSSTTRKYGG
FT                   TGLGLSICRRLVELMGGRIWAASRPGSGSTFFVELPFVVREAPAGTALRLECRPEPVPE
FT                   GRPLVVLLAEDNQINARSMSAILTRSGHRVVTVDDGQKAFEQWHSNRWDCILMDVQMPV
FT                   MDGVEATRLIRQAEQASGSHTPVIALTAHAMQGDREWLMAEGFDGYVAKPVDVEQLFRE
FT                   IEQVTGGGRS"
FT   sig_peptide     531883..531957
FT                   /locus_tag="Glov_0560"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.950 at
FT                   residue 25"
FT   gene            534702..535808
FT                   /locus_tag="Glov_0561"
FT   CDS_pept        534702..535808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0561"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   dvu:DVU0738 substrate-binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94289"
FT                   /db_xref="GOA:B3E377"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B3E377"
FT                   /protein_id="ACD94289.1"
FT                   /translation="MNYSVLVALLFCWLLAGCTPKSEPILIGLAVNLTGTGGTAGEYIR
FT                   EGAMLAVEEVNRRGGVNGRPLKLLVRDDKNSAEGIRQADQELMQEGVVAIIGHSYSDST
FT                   LQAYPQVMANGKTLLITGYTATDKLTGRDDLFFRTSVSSSSYSAATVRLLNRRGIRSIT
FT                   LLQDRVNFSFSEEITAGVRQRFDGAVSVVTTDSRGEVNWDSVVRQIQRQKPGAVFLLTE
FT                   VATSGIAAQKLRSAGYQGDLLATLWAQTPDLIRFGGAAVEGLTILTFIEPDNPRPAYRA
FT                   FAATIEKRFNKAATARTDRAYELITILAEALGRAPAHTAAELKAALLREPFETLMGTVR
FT                   FDRFGDVERPVFEVRVADGRFANGGEIK"
FT   gene            535805..538036
FT                   /locus_tag="Glov_0562"
FT   CDS_pept        535805..538036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0562"
FT                   /product="integral membrane sensor hybrid histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="PFAM: response regulator receiver; ATP-binding
FT                   region ATPase domain protein; histidine kinase A domain
FT                   protein; KEGG: ppd:Ppro_2061 PAS/PAC sensor hybrid
FT                   histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94290"
FT                   /db_xref="GOA:B3E378"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B3E378"
FT                   /protein_id="ACD94290.1"
FT                   /translation="MKRLISLNSKLSRSLIIFGLFAFLLASVIRLTLRLAEEKKYYATT
FT                   MMNTLKTCKGVLEDYLHTYDRDVEEVKRRHLHAGSTDAEVVQYLKTHLSLRSRDLWYLL
FT                   DQHNRVLYAPSRYRSFTGLDFSHLAHVKNRHSVSEVHQSLFSQRSVVSRSYPLCPTHTL
FT                   IIEQDLESIIPLFSHVSTMNVYGQGILFALTADGTVVYHPDSRLITSRHNLGFELQGWT
FT                   QPDKWGLRKCRYNGQTWLVYTEKTSYPQGWAIYYAVPYASLLKAMVKQTGIQLVIVAAL
FT                   FALLVYLLKRLIETNLAGPVRNIAASIAGIRPLEAESDIPLEQAGNITELHGIISEVNH
FT                   LMSQVRQSHHQLTAARDAAESANRTKSEFLANMSHELRTPMNGVIGTAQLLRMTELNAE
FT                   QAEYLASIEHSADSLMALLNDILDLSRIEAGRLELENRPFGLQEVIGNVVDSLSAQARL
FT                   KWLQLSVEFDRNLPQLVLGDSLRFRQILLNLTGNAIKFTDQGAVLVTAALSSADEDSVT
FT                   LHLCVQDTGIGITAEAMQRIFAPFTQADSSNTRKYGGSGLGLTISRHLTGLMGGRLWAE
FT                   SEPGIGTTFHLELPFLICAAVPAVPVAEAVPAPVAALWDGPALSILLAEDQQVNIVFVR
FT                   RILDKLGHRLTVAENGEQALNCWQSERFDLILMDVQMPVMDGRSATGRIREQEQAGGAR
FT                   IPIIALTAHAMEGDRERLLSEGFDGYVAKPVDIKLLCAEMARVIAKERG"
FT   sig_peptide     535805..535915
FT                   /locus_tag="Glov_0562"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.993) with cleavage site probability 0.596 at
FT                   residue 37"
FT   gene            538033..538794
FT                   /locus_tag="Glov_0563"
FT   CDS_pept        538033..538794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0563"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: gsu:GSU2792 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94291"
FT                   /db_xref="GOA:B3E379"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B3E379"
FT                   /protein_id="ACD94291.1"
FT                   /translation="MTNSTFTDHFAQVAAHYASHRPTYPPALFSWLAEQAPARRLAWDC
FT                   ATGTGQAALGLAEYFEQVWATDASRSQIEAAAPCPGVQYHTAPSDCSGLPDHAADLVTV
FT                   AQALHWFDLDRFYAEVRRVMQPGGLLAVWTYGVFRVEEGGTAAGIQTLLDRFYYETVGD
FT                   CWPPERRHVENGYADLVFPFRELAPPPCAMAVDWNLEDLAGYLRSWSAVSRYRERYGSD
FT                   PVPLLTAQLAPLWGEDRRRVVWPLSIKAGRL"
FT   gene            538871..540754
FT                   /locus_tag="Glov_0564"
FT   CDS_pept        538871..540754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0564"
FT                   /product="PAS/PAC sensor hybrid histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="PFAM: response regulator receiver; ATP-binding
FT                   region ATPase domain protein; histidine kinase A domain
FT                   protein; PAS fold-4 domain protein; KEGG: bra:BRADO1833
FT                   conserved hypothetical protein; putative sensor histidine
FT                   kinase with a response regulator receiver domain"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94292"
FT                   /db_xref="GOA:B3E380"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B3E380"
FT                   /protein_id="ACD94292.1"
FT                   /translation="MTLRTRLTISYTLLALLLIAVKVGCSSLVALTLLQELLLTLGLLA
FT                   LGAAGIYSLAGRFSQQLDASLAHAVQLLGDGETEALARLPLRGDELALLQSTLLQISSK
FT                   LQDSMQRLTSSEERFHALFDAMVEGCALHRIQYSPDGTPVNYVIEEANQAFEQLLGLKR
FT                   EQVVGKPATEAYQTDSPLYLQEYATVVATGQPSRFESCCAPLDRHFRISACRVGPERFA
FT                   TLFEDITEQKSHVETLRSTMQQLKSANEAKSRFLAVMSHEIRTPLNGITGMVQLLRDME
FT                   MPPAQREYLNFIDSSAESLLNVINDILDFSKIEAERLELELVPFQPLKLLHDTLRVMRL
FT                   RTQAKGLLLSLVCPPDLAEVLVGDPHRLTQILNNLVGNAIKFTAGGEIVVRASSRSRGD
FT                   GTVLFAVEVQDSGIGMDQATQQTIFEPFIQADSSTSRRFGGTGLGLAICKQLVELMHGT
FT                   ITVASSPGNGSTFCFAVPLKPGVLPAAAPEPVAVTGLDQPLQILVAEDQPINQRFVAEI
FT                   LRKQGHLPLLANNGKEAVDIWNSTAVDMVLMDIQMPVMDGLKALAAIRAAEDGTKRHTP
FT                   IVALTAHAIVGDQERLLNAGFDGYLAKPLQVANLFEEMARVLEQISKERRL"
FT   sig_peptide     538871..538963
FT                   /locus_tag="Glov_0564"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.974) with cleavage site probability 0.894 at
FT                   residue 31"
FT   gene            540751..543594
FT                   /locus_tag="Glov_0565"
FT   CDS_pept        540751..543594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0565"
FT                   /product="multi-sensor hybrid histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="KEGG: ppd:Ppro_2061 PAS/PAC sensor hybrid histidine
FT                   kinase; TIGRFAM: PAS sensor protein; PFAM: response
FT                   regulator receiver; ATP-binding region ATPase domain
FT                   protein; histidine kinase A domain protein; PAS fold-3
FT                   domain protein; PAS fold-4 domain protein; PAS fold domain
FT                   protein; SMART: PAS domain containing protein; PAC
FT                   repeat-containing protein; GAF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94293"
FT                   /db_xref="GOA:B3E381"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B3E381"
FT                   /protein_id="ACD94293.1"
FT                   /translation="MTTAADRHAVDELVRIGPLLEEALEGTATTVGDAFLAALVTTLAR
FT                   VLNVRYAVVGRLLPQHAAIQTLKVCVDGELVENIVYPLSGTPCEHVVGLAPRYFAAGAA
FT                   DLFPKDELLRQLQVECYLGVPLYSSRHEPLGNLLLMDSKPLPEALVPPALKLMELFALR
FT                   TAGEIERAEREQQLAIQDIHLGIILNNSRDGLLTASADARILAVNRAYCTLLGYEEQEL
FT                   LGRSIHEIEANETMEEVDAHTRKIVEQGFDRFISRHRCKDGTTRDLELSISYIAEVGQF
FT                   LTIARDVTERLLLERQLLDSEQRYQAFTELSSDFCHVCSRTAGGPYRVQWIGGQFERIT
FT                   GYGNDELLALGCWLPLVHPDDRERVAAGLLRLSAGDELRSEFRLVRKDLVVRWISEHSR
FT                   CVQDPVNPDLLRLYGSARDITTVHDNTLALQTAENAYRTIFNATNDVIFIMDAQQGMII
FT                   DCNKQAVQLFGRPRVDLIGSNPVQLSPPDHPDFGFEQAAAHIRSAIEEGAQLFEWLCAR
FT                   PDGSTFWAEVSLRAAEINGRQRLLAVVRDISERKQSMQELQQARDAALQATTAKNEFLA
FT                   NMSHEVRTPLNGIMGLSQLLRTTSLTEEQAGYMDMLDSSARNLLVLINDILDISRIEAG
FT                   SLTIRQTAFSPAKLLREVAGMYEKAAAEKGIGLDILPCDELPAALIGDPLRLRQVLINL
FT                   VGNAIKFTSHGGVTLRVDCLEESATGIRLGFEVSDSGIGMSAETLQKIFHPFTQADAST
FT                   SRVHGGSGLGLAICRRLSELMGGSIRAESSLGQGSRFIVELPFGRYLGTQDTEETETAA
FT                   PALRLEPLRILLVEDQEVNRTFVQRLLERQGHRIAAAADGLMALDLLEREQYDLMLLDI
FT                   QMPGMGGEEVLLQLRRNERKNGRHLPVVALTAHALAGDREKLLASGFDGYVSKPVQMDQ
FT                   LLAEMGRARAMKGQPQQ"
FT   gene            543591..547172
FT                   /locus_tag="Glov_0566"
FT   CDS_pept        543591..547172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0566"
FT                   /product="MCP methyltransferase, CheR-type with PAS/PAC
FT                   sensor"
FT                   /EC_number="2.1.1.80"
FT                   /EC_number="2.7.13.3"
FT                   /note="KEGG: ppd:Ppro_3165 signal transduction histidine
FT                   kinase with CheB and CheR activity; TIGRFAM: PAS sensor
FT                   protein; PFAM: MCP methyltransferase CheR-type; response
FT                   regulator receiver; ATP-binding region ATPase domain
FT                   protein; histidine kinase A domain protein; PAS fold-3
FT                   domain protein; PAS fold-4 domain protein; PAS fold domain
FT                   protein; SMART: PAS domain containing protein; PAC
FT                   repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94294"
FT                   /db_xref="GOA:B3E382"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR000780"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR022641"
FT                   /db_xref="InterPro:IPR022642"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B3E382"
FT                   /protein_id="ACD94294.1"
FT                   /translation="MSEQATQLPPEEDLPESAAEDADNTDWQPITDLLRRGLGIDFGCY
FT                   RAGTVGRRIMRRMELLQLDDVADYATLLAASQEELEALGRDLLIGVTEFFRDPAVFRRL
FT                   ADLLRELLRGRSATEGFRIWSAGCASGEEAYSLAVLLHDVAQEVGFSGDLKVFATDVHK
FT                   GALEIASRGGYCGELLAGLPGQYLDRYFRSESDGCFRIDPMIRRMLVFAHHNLLSDPPF
FT                   TRIDLAVCRNLLIYLQAEAQQRVLTALQFSLVPGGHLLLGPSEGVSHLANAFSVLDSGC
FT                   KLFRKNATPRDGIVAPGIPWVARNPLLASLNQGTRTTVTLDRHLLRDYDLILDRYAPPG
FT                   MLLNSQRQVLHIFGDLSEYLRPLTGRLTGDMFSNLRDELRPALSTALLRAEQHGEATVV
FT                   DRVPLLQEESCRYVDVAVACLTDERSDGLHFHVTLRPSDWQPEAGDCSNSNHHEVDSAL
FT                   HRRVADMEQELHSTRHSLQLTIEELQSSNEKLDLANEELISSNEELQSTNEELKSVNED
FT                   LYAVNSELEHRNEELQRLNRDHDNLLASTEVGTVFLDQQLRIRKFSSAISAFLKLLPQD
FT                   LGRPIDHIAYELGSPQEFRERLQQVLESGLRHEQEIHTGADQWVLQRILPFRTDNGSID
FT                   GVVLTFTDISAVKQAQAAVAEMNIQLEQKVIERTCELSASEARIRAFIENSGQGFWQLG
FT                   PDRLTIDLNPALCSMLGYRREEMLGRSPLEFVDAENRSIFLYQMGRIDGTEHRNYEITL
FT                   LHKDGHPVPVMFSATTHRTVEGKVDSAFAFITDLSEQKRVEQEIRAAKEAAESANRAKT
FT                   QFLANISHEVRTPLNGIMGMSHLLHMTPLADEQQDYLRHLDDSAQSLLSVINDLLDLTR
FT                   IESGGFGTEQADFQLDQLARDILRIHQPVAQRKGVLLQLELADGMPGLLRGVPLRLKQV
FT                   LHNLVGNAVKFTDQGRVVLSISPIIVPGQSLRVRFAVCDSGIGMEPETIKRIFDPFSQA
FT                   DESISRRYGGTGLGLTICRRLTELMGGTIEVESTPGQGSCFTVILPMKTPLGAVVPADA
FT                   PVRQDSFERNALQVLLAEDQPVGRLYATRLLERLGHRVTAVEDGKQAIEAWEQNCFDLI
FT                   LMDVQMPGIDGTMATASIRQREQEGGVRTPIIALTAHALTGDRSKLMECGFDGYVPKPI
FT                   DVEGLLAEVNRLITPATVLCSRRGEQP"
FT   gene            547169..547996
FT                   /pseudo
FT                   /locus_tag="Glov_0567"
FT   gene            548001..549512
FT                   /locus_tag="Glov_0568"
FT   CDS_pept        548001..549512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0568"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   KEGG: ppd:Ppro_1991 multi-sensor signal transduction
FT                   histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94295"
FT                   /db_xref="GOA:B3E383"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B3E383"
FT                   /protein_id="ACD94295.1"
FT                   /translation="MQFLPRRLHTRLLLAITLAMAFGILGLSFWTATSQSRQLLAARQQ
FT                   QAELLTRNLAEGSAHSYVLEDYAALDHFLRHSMGLPGVRRVVASDENGVILTDFTRVSD
FT                   SAEPQLNVGGGERINVPAEPSASLVHAGTMLVVWQPVLAGDLLGWLQVSYGLEEVAALQ
FT                   RQIWCNGIIFALAEVVGGIVLIAWLLRRPIRSISRLSGFARDLPQHKGMTLPVERFVTE
FT                   VQDLGESLNYASTELCRIEQELLELNRTLEARVEDELAKSREKDALLLQQARYQTLGEL
FT                   LVNIAHHWRQPLNNIGARVQENAWLLANGEIPPENAMAAADLIMQDLKQLSRSIETFTL
FT                   LCRPALPDQVVLPSDAVKRAILMVQDSYQQAGISFELKLNAEQELQGSLQDLVQCILNL
FT                   FSNARDAVVAGHDAAGLIRVEIDVEEQKRLTIAVSDTGGGIPPQLLHSLFDPYVTSKFR
FT                   TQGVGLGLFVVRQIIEQRFNGTVIAANQDRGAVITIAIPLKQETV"
FT   sig_peptide     548001..548126
FT                   /locus_tag="Glov_0568"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.575 at
FT                   residue 42"
FT   gene            549512..549901
FT                   /locus_tag="Glov_0569"
FT   CDS_pept        549512..549901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0569"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   mgm:Mmc1_1399 response regulator receiver modulated
FT                   diguanylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94296"
FT                   /db_xref="GOA:B3E384"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B3E384"
FT                   /protein_id="ACD94296.1"
FT                   /translation="MTPTTAEELQQLCLLYVEDEDIARLSIGSFLRRQVGELLLASQGE
FT                   EGLRLYQEKRPAVVITDLEMPVMNGMEMIRRIRALDHDIPIIITTAYDDDAHYCPEADM
FT                   TILKPISFMELLQAVKDCLAARGKG"
FT   gene            complement(550038..552005)
FT                   /locus_tag="Glov_0570"
FT   CDS_pept        complement(550038..552005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0570"
FT                   /product="protein of unknown function DUF224 cysteine-rich
FT                   region domain protein"
FT                   /note="PFAM: protein of unknown function DUF224
FT                   cysteine-rich region domain protein; KEGG: gme:Gmet_2255
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94297"
FT                   /db_xref="GOA:B3E385"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR036197"
FT                   /db_xref="UniProtKB/TrEMBL:B3E385"
FT                   /protein_id="ACD94297.1"
FT                   /translation="MTPTPTIFAPLFIAATALFVWSCWKRLSLTALGRPEERLDNIGQR
FT                   IGDTLSYAFAQKRVLAKPSGLIHVAIFWCFLVLMIANTEFLLHGLFPAVNFTRLPDGIF
FT                   MPLMQMIDVVSLITLLAVTAAAIRRLVAPPYPEARTFEAFFILFLIATLMLANFGVNAA
FT                   KISRMQGSTLVLAESIMPISSWFAPYVPSGAGKLVHDLSWWTHALVLLLFMNLLPLSKH
FT                   FHIITAIPNVFLRRREHPPLPEREEFSAGNSFGINRVDGYTWKELLDAFSCTECGRCQM
FT                   ACPADQTGKPLNPRRVIAQLKHNLMANGPLLKQGQPAGTPLIGEGDASISEEAIWACTT
FT                   CGACLQSCPVFIEQMPKLIPLRRHLVEMESKFPEELLNLFENMEGRSNPWGIAPTERGK
FT                   WASQLGDRPYEPGKSEYLFYVGCAGSFDARAKQITVATALLLDKAGVSWGMLGKDEKCC
FT                   GDSLRRLGNEYVFDKLAKENVALFKERGIRKVIVQCPHCLTTLKNDYRQYGIELEVIHH
FT                   SQLLLYLVQDGRLKLPKQADLGKLVYHDSCYLGRHNNIYDEPREALALATGAEPLEMPR
FT                   NREDGFCCGAGGGRMWMEEFTGDRINLVRAAEALEQQPDTICTACPYCLTMLDDGIKDL
FT                   KAEKVQVKDIAEVMAEAVLR"
FT   sig_peptide     complement(551937..552005)
FT                   /locus_tag="Glov_0570"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.899) with cleavage site probability 0.872 at
FT                   residue 23"
FT   gene            complement(552002..553333)
FT                   /locus_tag="Glov_0571"
FT   CDS_pept        complement(552002..553333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0571"
FT                   /product="Electron transfer flavoprotein alpha subunit"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; Electron transfer flavoprotein alpha/beta-subunit
FT                   ; Electron transfer flavoprotein alpha subunit; KEGG:
FT                   gme:Gmet_2257 electron transfer flavoprotein, alpha
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94298"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR014731"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR018206"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR033947"
FT                   /db_xref="UniProtKB/TrEMBL:B3E386"
FT                   /protein_id="ACD94298.1"
FT                   /translation="MSENTPKIKKPRGRARLLEGKCIACGARCESSCPVNCISMNEAGE
FT                   PVVDTEKCIGCLKCVKVCPAQALEMFFTPEEQKILEQLAAAGSAPIAEEEDPEAAAIAR
FT                   MQAQYRGVWVFIEQTDGEAAKVSWELLGKGKELAAKLGVELCAVVIGHKVEPLCHEAFK
FT                   YGAEKAYLLDAPLYGDYRTQSYLEAMCHLIEQHKPEVILMGATGMGRDLAGAVATRVGT
FT                   GLTADCTGLDIDDKRNLMQTRPAFGGNIMATIMCDKYRPQMSTVRPHVMQMPEPLPEAT
FT                   GQIIRDAFTTPEDQVLAKVLEIIRDGDSKHKVDIGGAEFIISGGRGMMGPENFAMLEEL
FT                   AKELNGVVGASRSAVDAGWMPHDRQVGQTGKTVRPKIYIACGISGAIQHLVGMQDADLI
FT                   IAINRDKDAPIFEVAHYGIVGDLFQIVPVLTRKIRELKTRGKKP"
FT   gene            complement(553330..554145)
FT                   /locus_tag="Glov_0572"
FT   CDS_pept        complement(553330..554145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0572"
FT                   /product="Electron transfer flavoprotein
FT                   alpha/beta-subunit"
FT                   /note="PFAM: Electron transfer flavoprotein
FT                   alpha/beta-subunit; KEGG: gur:Gura_1211 electron transfer
FT                   flavoprotein beta-subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94299"
FT                   /db_xref="GOA:B3E387"
FT                   /db_xref="InterPro:IPR012255"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR033948"
FT                   /db_xref="UniProtKB/TrEMBL:B3E387"
FT                   /protein_id="ACD94299.1"
FT                   /translation="MLIVACIKQVPDTTQVKIDPVTNTLIREGIPFIMNPYDTHAMEAA
FT                   LQLKDQFGCRVAVLSMGPPNAEATLRKALSAGVDRAILLSDRVFGGADTLATSKVLAAA
FT                   IAKLNAEVEPVGLVICGKQTIDGDTAQVGPGIAVRLGYQQLTLVDKVEELDLTNKKLVV
FT                   SRKLEGRHERVQAPLPAMLTVVRELNRPRYPTVPMRLAAATAEVEVWNNEVLQLDPQTI
FT                   GLKGSPTWVSKIFSPERDKGEIVGDGYADPEGTVDLLLGKLMEKDLLPL"
FT   gene            554530..555876
FT                   /locus_tag="Glov_0573"
FT   CDS_pept        554530..555876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0573"
FT                   /product="Glutamate dehydrogenase (NADP(+))"
FT                   /EC_number="1.4.1.4"
FT                   /note="PFAM: Glu/Leu/Phe/Val dehydrogenase ;
FT                   Glu/Leu/Phe/Val dehydrogenase dimerisation region; KEGG:
FT                   gsu:GSU1305 glutamate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94300"
FT                   /db_xref="GOA:B3E388"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR014362"
FT                   /db_xref="InterPro:IPR033524"
FT                   /db_xref="InterPro:IPR033922"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B3E388"
FT                   /protein_id="ACD94300.1"
FT                   /translation="MAKLDEKIESIYNDVLKRNPGEIEFHQAVLEVLESLGPVVVKHPE
FT                   YLERKIIERICEPERQIIFRVPWQDDKGQVHINRGFRVEFNSSLGPYKGGLRFHPSVYL
FT                   GIIKFLGFEQIFKNSLTGLPIGGGKGGSDFDPKGKSDDEVMRFCQSFMTELYRHLGEHT
FT                   DVPAGDIGVGGREIGYMFGQYKRITNRYEPGVLTGKGLTWGGSLVRTEATGYGATYFIN
FT                   EALKVRKDTFEGKTCLVSGSGNVAIYTIEKIHQLGGKCVACSDSNGVIYHEKGLDLDLI
FT                   KQLKEVERRRISDYALAHKDAKYIPNGNIWDIPCQVAMPSATQNEINGKDAAKLVKNGC
FT                   IAVGEGANMPTTPEGVKVFLDAKIAYGPGKAANAGGVATSALEMQQNAQRDSWTFEDTE
FT                   AKLENIMKNIHANCYETAEEYGAPGNYVLGANICGFIKVANAMVAHGLV"
FT   gene            555975..557198
FT                   /locus_tag="Glov_0574"
FT   CDS_pept        555975..557198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0574"
FT                   /product="aspartate kinase"
FT                   /EC_number="2.7.2.4"
FT                   /note="KEGG: ppd:Ppro_2262 aspartate kinase; TIGRFAM:
FT                   aspartate kinase; PFAM: aspartate/glutamate/uridylate
FT                   kinase; amino acid-binding ACT domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94301"
FT                   /db_xref="GOA:B3E389"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005260"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041740"
FT                   /db_xref="UniProtKB/TrEMBL:B3E389"
FT                   /protein_id="ACD94301.1"
FT                   /translation="MASVVQKYGGSAVTSPEQIRKIAERIIQSYNDRNDVVVVISARAG
FT                   ETNRLIEMAQEMCPRQTGSEYDLLISAGEQVSIGLLALCISSLGYKVRTYLGWQVPIIT
FT                   DSLHTRASIEYIDPAKIRADLNHGAIVLVAGFQGIDRSGTITTLGRGGGDTSAVALAHA
FT                   LGAEVCELYSDVDGIFTADPAICDDARKIEKISYDEMLELASQGARGVQIRAIEYAKKH
FT                   NVTIHVRSAFTAERGTLVVKEHMPMEGVVVTGIVADKNEAKIAVLGVPDKPGSAAKILT
FT                   GLADKDISVDMIVQNVGQDGLADITFSISKTDLEKAHQITTQIAKEVNAREVLADRNIS
FT                   KVSIVGLGMKNHAGVAARMFTALAYNNINIQMISTSEIKVSVAIEEKYTELAVRVLHEA
FT                   FKVDQCSE"
FT   gene            complement(557490..558794)
FT                   /locus_tag="Glov_0575"
FT   CDS_pept        complement(557490..558794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0575"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG:
FT                   gur:Gura_1961 radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94302"
FT                   /db_xref="GOA:B3E390"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="InterPro:IPR026322"
FT                   /db_xref="UniProtKB/TrEMBL:B3E390"
FT                   /protein_id="ACD94302.1"
FT                   /translation="MPFSRYVITFPDPQRPGFVILYSTRKGSVVRVPEQLLTSIANNTL
FT                   SPEERATLQQLQLWTDDLEAERSKMAAIIDHTNAHTPLFSATVVLTLACNLACPYCFEE
FT                   PFRDGQEMSEETGRILVDYLIREQLDQGRNVELRFYGGEPLMATTRLKGIATPLLAAAA
FT                   NRGRTFSFSLVTNATLLTRAVVEELLPLGLKSAVITLDGPPETHDRQRPFVSGKGSFKT
FT                   IIDNLTAVYDLVTIKPGGNFTRDNYRRFPEMLDLLLEAGLDPAQLGPVQFSPIHPKSGL
FT                   FDPHAAACVLANEPWLIEANLFLREEILRRGFTVEKLQMGICMIDLEQTLVVNYDGSLY
FT                   KCPSLMGWPEFCVGTLADGLGDYHASHRLDIWKNDECLDCAYLPLCFGGCRLLTLQKNG
FT                   AIDTVDCHRAMLDASLERLVLQDLGVRMSDLQPAC"
FT   gene            559096..560961
FT                   /locus_tag="Glov_0576"
FT   CDS_pept        559096..560961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0576"
FT                   /product="TonB-dependent receptor plug"
FT                   /note="PFAM: TonB-dependent receptor plug; KEGG:
FT                   gur:Gura_1964 TonB-dependent receptor, plug"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94303"
FT                   /db_xref="GOA:B3E391"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:B3E391"
FT                   /protein_id="ACD94303.1"
FT                   /translation="MNRICSNKVLLILPILVCLTAMPLFAADDALEDLGIIEAQAESVV
FT                   SASRSPRPASRIAENITVITADDIERLNAHTLAEVLQTVPGIQLDFLRTPGTFSFFNVQ
FT                   GALNTTVLVLVDGIRQNDFDQNMAIVGLIPVQQIERIEIIKGAASAAWGPALGGVINII
FT                   TKSPDAERKFSGMVSGSTGSQFTADSRAEVSGTLDRFGYYLTVANLRSDGLTPNTGTNQ
FT                   NNLFTKLSYQLPHNGSLTFGLSYLTASPGLDEGETVSWGFVHDNNQYRRTNAYLKLNQP
FT                   LTDRLTLELDSFLTNRDDHTKFGGLDGSGNLTFFNDYVVRDTNQGINARLRWGDYQKSL
FT                   LLGLDYSHAWAINRDALSSDPPVYDRSWDRWGIYANGAYTVGQLTILPGARYDITGTSG
FT                   DVTSLTLGATYQLAEHTLLRAYAAQGYTLPTPRADNKLQKIKTIQAGIESEALPFLWLK
FT                   GTFFFNALRDSQSIGTVTTTNQQRQGIELEARTAPLYGLSLTSGYTYLDAWDSDTGQRL
FT                   HTNYNQAVPPHTVKLALNYDNRELGLRGTVTGNYVWWNRDESTAARDTGMIWDLHLNWR
FT                   LKSFYKLTPELFFSAHNLFNGVQTTDTELYTNAKRWFEGGLRVKF"
FT   sig_peptide     559096..559176
FT                   /locus_tag="Glov_0576"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 27"
FT   gene            560961..561818
FT                   /locus_tag="Glov_0577"
FT   CDS_pept        560961..561818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0577"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ppd:Ppro_1359 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94304"
FT                   /db_xref="InterPro:IPR007487"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B3E392"
FT                   /protein_id="ACD94304.1"
FT                   /translation="MRRLVLCIVALALLVPSLARAYDLLVLQSKRNPAYDEMLKGFSER
FT                   RNVSRRVIVLSDYAEVDVARIAREDRPTLILAVGDTALAAARKVRTIPVVALMSLDLRR
FT                   LQAVQPNLTGIDMFVAPENYCNLLRQMKARRVGILYNPARNGWYLRQARQAAEKAGITL
FT                   VAREVTDPRDTLTKLASLAGKVDALWMLPDVTAVTRETAEAYFHFSQQQAVPVVSFAAN
FT                   YLGLGAAAVFEIDRAALGRQANEMVTSLLDGDAVDSTSLRFPRGVVLKTNAGILRRLGA
FT                   SLEE"
FT   sig_peptide     560961..561026
FT                   /locus_tag="Glov_0577"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.988 at
FT                   residue 22"
FT   gene            561815..563818
FT                   /locus_tag="Glov_0578"
FT   CDS_pept        561815..563818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0578"
FT                   /product="integral membrane sensor hybrid histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="PFAM: response regulator receiver; ATP-binding
FT                   region ATPase domain protein; histidine kinase HAMP region
FT                   domain protein; histidine kinase A domain protein; KEGG:
FT                   ppd:Ppro_2061 PAS/PAC sensor hybrid histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94305"
FT                   /db_xref="GOA:B3E393"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B3E393"
FT                   /protein_id="ACD94305.1"
FT                   /translation="MNRTKQPQPCRCHRSGVAMTAFKELTVLRCAKWSNIRTRFQCKLF
FT                   IIFTLLTFLIVSTLSTLFIIHEIKKSKKSAAAHLRLQVEYLAESIRLPLFAENAELLRQ
FT                   MAEQAARLPEVRAVVIRAPDGRVLAAVYPASATGSREEVLSQSIEVCSNPQAGSPIASL
FT                   TDGLDTPSLLGSVRIERGTADMDRAVRKLIAWSVALALLFWLAVSLLSHLVLRQVTRSF
FT                   NNLVSGIAALQDGDYGTLIEVDSDDEPGRAAAAVNGLARSLQQRSEENRQAREELLQAK
FT                   SEAEAANTAKSEFLANMSHEIRTPMSGLIGNAQLLRLTQLNAEQTGYLTNIETDAKNLM
FT                   SLINDVLDISKIEAGKLELESAPFSLRSCVAQLLKSQEARIAAKAIVLTHEIAADLPDS
FT                   LFGDQLRLKQILYNLVGNAIKFTAKGEIRVKVELLERHDDKARFCFSVTDTGIGIRPEA
FT                   REKIFAPFIQADASVTRRFGGTGLGLSICSRLVQQMGGGITVESEEGKGSTFSVTLPFL
FT                   INSQPLPQQETLPQDRKLMWEGAPLRILLADDSETNCTMLSILLSRFGHSVTPAGDGAE
FT                   VLQQWQKGGFDVVLMDIQMPVMDGMETTRVIREHERKNGGHLPIIALTAHALKETREHM
FT                   LSAGFDGYVSKPIDLKLLHDEMRQVIVQDGKM"
FT   gene            complement(563833..565647)
FT                   /locus_tag="Glov_0579"
FT   CDS_pept        complement(563833..565647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0579"
FT                   /product="excinuclease ABC, C subunit"
FT                   /note="TIGRFAM: excinuclease ABC, C subunit; PFAM:
FT                   Excinuclease ABC C subunit domain protein; excinuclease ABC
FT                   C subunit domain protein; UvrB/UvrC protein; KEGG:
FT                   ppd:Ppro_3248 excinuclease ABC, C subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94306"
FT                   /db_xref="GOA:B3E394"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR001162"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR004791"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR038476"
FT                   /db_xref="InterPro:IPR041663"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3E394"
FT                   /protein_id="ACD94306.1"
FT                   /translation="MELRDSIRSFPTAPGVYLMRDATGTILYVGKARNLRQRVSNYFGA
FT                   TDGRPQVRFLMARVTSIEFTITDTEKEALLLENTLIKQHQPRYNLNLKDDKTFFSLRID
FT                   LTERFPRFTVVRKVSRDGARYFGPYASASAAREVLRQLQRMFPLRHYPLKTCLNRSRPC
FT                   LYHQIGQCSAPCHNLITAEEYNLLVEGAVLFLEGKNKDLVSGFRQRMKEAAEGLHYEEA
FT                   ARWRDLLKAIDTTLEHQKMVSQGGDSDILGLAGNEDSLAIAVLFVRGGSLSGSTVLHGS
FT                   GGLDTSDTLATFIQYYYGNERFIPDELLLPLSLDAGQSLEEWLSELKGKKVRLQQPKRG
FT                   DKLNLVNLATRNAQAALAEKSATRQGIERTLAELQQKLALPRLPRRIECYDISTLQGRH
FT                   SVGSGVAFLDGLPDKERYRRYRIRESQGQDDFGMLQEVFARRFSPERIEQWGLPDLVVV
FT                   DGGIGQLNSTLSVLAELGLSERPAVVSLAKSRVKGDGKDIHVERTEERVFLPGRRNPVR
FT                   LRQDSAPLKLLAAIRDEAHRFAIGYHRRLRDRETLRSALREIPGVGPKLERLLLTRFGS
FT                   LEGIQNATVEELATVAGVSQELARLIKA"
FT   gene            565875..567092
FT                   /locus_tag="Glov_0580"
FT   CDS_pept        565875..567092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0580"
FT                   /product="Rh family protein/ammonium transporter"
FT                   /note="PFAM: Rh family protein/ammonium transporter; KEGG:
FT                   ppd:Ppro_3249 Rh family protein/ammonium transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94307"
FT                   /db_xref="GOA:B3E395"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:B3E395"
FT                   /protein_id="ACD94307.1"
FT                   /translation="MELSPLTPLKQSGDVLFLMLGAVMVFAMHAGFAFLEVGSVRKKSQ
FT                   VNAFVKILTDWSVSTVVYFLIGFPLAYGISFLKPADQLMQGAMGYDLVHYFFLLCFAAC
FT                   IPAIISGGIAERAKFWPQVIAGAIFAGLCYPLFESLIWGKNAALLQGVFKSIGGLEFHD
FT                   YAGSVVVHSIGGWIALPAVILLGARKGRYQHGKSHPLPISNIPFLALGSWILAVGWFGF
FT                   NVMSAGNLEKISGLVAVNSLMAMVGGVLAALVAGRNDPGFVHNGALAGLIAVCAGSDLM
FT                   HPLGALVTGAIAAVIFVYGFQFEQEKLKIDDVLGVWPLHGVIGTWGGIAAGIFGQKIFG
FT                   GMGNVSFVSQLAGSLTAVLFAVASGLVVYGALAKTVGIRMHEEDEYNGPDLAIHKIGAY
FT                   PEDHIR"
FT   gene            567366..570008
FT                   /locus_tag="Glov_0581"
FT   CDS_pept        567366..570008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0581"
FT                   /product="conserved repeat domain protein"
FT                   /note="TIGRFAM: conserved repeat domain protein; KEGG:
FT                   gsu:GSU3278 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94308"
FT                   /db_xref="InterPro:IPR001434"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:B3E396"
FT                   /protein_id="ACD94308.1"
FT                   /translation="MLRYCRRLTAFLTCLLIATLLCAATVVAQETEDSQLFLSGFNAYQ
FT                   QKEYPAAVARLGEVLKKYPETPLRDMTLFWLARAHYKVGNRSDAARYMAQFTREYPDNP
FT                   LKNTVEDELLALAAQHEKGQGSAVQVAAAAQLEAEQQRAAEAAAQVAREKAEADRLAAE
FT                   RVAQEKAAREAAEKARILKAKAEADRIAREKAEAERLAAIKLEQEKQQAVAEAERIARE
FT                   KAEADRLAAARQEAERLAQETAAREAAEKARILKAKADADRIAREKAEADRLAAVKAEE
FT                   ERRAREQAAAEQLAAQKAAEERRAAEKAAIAAAEQNERELAAARKAEEAKLAADRLRQE
FT                   RLGLKEKAIAEYKGILERFPNTPAARTAATRLKELGVAVVVPPAAAPAQPVESTATAQV
FT                   LTLEVAQYAAFEFEVQPPQTPVEVARKNMIPFEIQNRGNGQDSFYLASSFPAEFGARFA
FT                   AAATPEQSINQTPQLAPGEKFKGLLLLSVPAASIDGLRIAHPVKAASQFMPEASQSRTV
FT                   SLTAAAPLLRAVVKTDKPQLLPGETVQYRITVLNVGSTPAEDVTLRLSFPPQYQAVDFA
FT                   AAGFRQEMGAALVLDGLALKSGESRELVATFQLKGEALAKEELIVRADLLNNPLQTRGT
FT                   FLSNATFVLPVSELALKMATERVKAVPGQVVTIPVRLVNKGNQRERFSLVAGSAPFQKV
FT                   IVYHDLNRDGLRQPGESEVTTIGPLGPKEEAALLLEVTTSKTAQDGTLEKVSLSAAPES
FT                   LQGKSVMVEAEVGYSRPVLQLAMKGREGRMVPGDLLTIDLDVLNRGSNLAKQVELEVTW
FT                   PEQIELVAADQAAGKTGAGASLWRFSELGAGEKRVVKASFRIKSGTGVGTGVQLKSILT
FT                   YQDQVGNRY"
FT   sig_peptide     567366..567452
FT                   /locus_tag="Glov_0581"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.986 at
FT                   residue 29"
FT   gene            570010..570591
FT                   /locus_tag="Glov_0582"
FT   CDS_pept        570010..570591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0582"
FT                   /product="Peptidoglycan-binding LysM"
FT                   /note="PFAM: Peptidoglycan-binding LysM; KEGG:
FT                   gur:Gura_0367 peptidoglycan-binding LysM"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94309"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="InterPro:IPR039565"
FT                   /db_xref="UniProtKB/TrEMBL:B3E397"
FT                   /protein_id="ACD94309.1"
FT                   /translation="MHLPGVKIPLLALLLCGATASWGGDYLYAPRPVDGTEPGEGVLVR
FT                   EITVKKGDTLSHLSKRYSGRGYYYPQILLFNEIRNPHRIQVGQVVRVPLSHKAGRQAQN
FT                   SPVVAQDQSQVQSAEPSKQAAERPKAVQQPSLRQGEKNAYNHAMENFKKGDCEAAIKQF
FT                   DRFISRYPSSSLLPEATLNRAECYLKLSTK"
FT   sig_peptide     570010..570081
FT                   /locus_tag="Glov_0582"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.986 at
FT                   residue 24"
FT   gene            complement(570777..572063)
FT                   /locus_tag="Glov_0583"
FT   CDS_pept        complement(570777..572063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0583"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ppd:Ppro_3252 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94310"
FT                   /db_xref="UniProtKB/TrEMBL:B3E398"
FT                   /protein_id="ACD94310.1"
FT                   /translation="MDILAITDIPRMTALFERLARQIPGLTVVSEIHRGIEELESRKPE
FT                   LVFIQNHLAGLSADILHKHLKSRLGQRTARFGLISAPSAIDSDSSAVFEIILDPALSDE
FT                   ELEQALLSLLQQQDQPAKPIATQEQTTVPQPGSPEQEPPGLLTRPPVFPPQNVQQQLSL
FT                   MPDPPVPVESDQTPAAPLTYELPRRPGISIISDFSKQLDTRSDTLQPDPAPFNRHEHEL
FT                   RIRDLHQEPHLISDFEPSQPWYRKTAFLLVSGTLLVVVAVSLFQHRSSRTAPASKATSE
FT                   QKAPAAAPTPPAVAPQPEKKPAFSSHGSGRPRSLPSFIPKEGLDPGYGKDNPGWENYRG
FT                   QTNEYRVFREKDGAIKAIQVIDRSGAGIQESFYTSTLKELAGATAMRSTSSEIKEGYEI
FT                   RRGDLAGLQLVQYRDAQGGRMRGFVITWP"
FT   gene            complement(572101..573501)
FT                   /locus_tag="Glov_0584"
FT   CDS_pept        complement(572101..573501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0584"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /note="TIGRFAM: glutamyl-tRNA synthetase; PFAM:
FT                   glutamyl-tRNA synthetase class Ic; KEGG: ppd:Ppro_3484
FT                   glutamyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94311"
FT                   /db_xref="GOA:B3E399"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR020752"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3E399"
FT                   /protein_id="ACD94311.1"
FT                   /translation="MSDLRVRFAPSPTGYLHVGGARTALFNWLYARHFGGTFILRIEDT
FT                   DTERSTQQSVDAILQGMEWLGLDWDEGPFYQTDNFPLYKQHVQKLLDEGKAYRCWCRPE
FT                   ELEAKREAAMAEGRKPKYDGTCRHRQDQPLDQPHVIRFKAPEEGETAFDDLIKGRIAFP
FT                   NAELDDLIISRTDGTPTYNFCVVIDDALMRISHVIRGDDHVNNTPRQIQLYEALGYPVP
FT                   IFAHVPMILGSDKARLSKRHGATSVIAYRDMGYLPEALNNYLVRLGWSNGDDEIFSREE
FT                   MVQKFDIANVGRSPSVFNPDKLNWLNAHYIKTGNPARLAELLQPHLAGRGVADCSTPDL
FT                   AGVISTLQERAQTLEEMAERALFYYQAPQQYDEAALSKFDKPHLAAVFSAVAARLSATT
FT                   AAAAPEFDTLLKEICAEGGWKMPHVGQPLRIALSGSTQAPGIGEIITALGVNETIARIE
FT                   RAREFLAH"
FT   gene            573745..575346
FT                   /locus_tag="Glov_0585"
FT   CDS_pept        573745..575346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0585"
FT                   /product="hybrid cluster protein"
FT                   /note="TIGRFAM: hybrid cluster protein; PFAM: Prismane;
FT                   KEGG: ppd:Ppro_3702 hydroxylamine reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94312"
FT                   /db_xref="GOA:B3E3A0"
FT                   /db_xref="InterPro:IPR004137"
FT                   /db_xref="InterPro:IPR010048"
FT                   /db_xref="InterPro:IPR011254"
FT                   /db_xref="InterPro:IPR016099"
FT                   /db_xref="InterPro:IPR016100"
FT                   /db_xref="UniProtKB/TrEMBL:B3E3A0"
FT                   /protein_id="ACD94312.1"
FT                   /translation="MSMFCNQCEQAANGTGCNISGVCGKKPDVAALQDHLLYGLKSLAL
FT                   YADKLGRDAEIDRFTIEALFSTVTNVDFDPEDIAKLIQKCYQLKEKAKAASGAAISGPV
FT                   ADWKPAADLATMVAQGEQHGINTQHVNEDIRSTIEILMYGLKGMSAYMDHAMILGRSND
FT                   EVMAFFQKALAATTDANLGLMDFVGLCMECGKQNLTVMGLLDTAHNETYGAPVPTPVNL
FT                   GTKAGKGILVTGHDLKMLEELLKQTEGKGINIYTHGEMLPAHGYPGLKKYPHLVGNFGG
FT                   AWQDQAREFPNFPGAIIFNTNCIQRPADSYKDRLYTWGLVQWPGVTHINGWDFSEVINK
FT                   ALECPSLPENPGQEILTGFGHNAVLGVADKVIAAVKAGQIKHFFLVGGCDGAKSGRNYY
FT                   TEFAEKAPQDTVILTLACGKYRFNKLEFGDIGGIPRLLDIGQCNDAYSAIQIAVALAGA
FT                   FECGVNDLPLSMILSWYEQKAVVILLTLLSLGIKNIRLGPSLPAFITPNVLAFLVENFN
FT                   IMPITTAEEDLKAILG"
FT   gene            575638..576255
FT                   /locus_tag="Glov_0586"
FT   CDS_pept        575638..576255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0586"
FT                   /product="protein of unknown function DUF47"
FT                   /note="PFAM: protein of unknown function DUF47; KEGG:
FT                   gme:Gmet_3132 protein of unknown function DUF47"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94313"
FT                   /db_xref="InterPro:IPR018445"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:B3E3A1"
FT                   /protein_id="ACD94313.1"
FT                   /translation="MFGLIPKEEKFFKMFQDMGVIITEGAQQLKVMLDDYVDPLASQRQ
FT                   IKDTEHKGDNQTHLIIKTLNKTFITPLDREDIYSLASKLDDIIDLIDASAQRFVMYNVE
FT                   KPTPEAQQLAFIILKCCQTVERALKHLGGKFEDINNCCVEINALENEADRVCREAISRL
FT                   FDEEKDPINLIKWKEIYETLEKATDKCEDAANILESVVVKNA"
FT   gene            576248..577246
FT                   /locus_tag="Glov_0587"
FT   CDS_pept        576248..577246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0587"
FT                   /product="phosphate transporter"
FT                   /note="PFAM: phosphate transporter; KEGG: gsu:GSU0389
FT                   phosphate transporter, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94314"
FT                   /db_xref="GOA:B3E3A2"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:B3E3A2"
FT                   /protein_id="ACD94314.1"
FT                   /translation="MPDIALIMLVLVIVAALAFDYINGFHDTANAIATCVSTRALSVKA
FT                   AIFMAAFLNFAGAMVSTKVASTIGKGIVDANHVTQLVVLAGILGAIIWNLITWYYGMPS
FT                   SSSHAIIGGIMGAVIAHSGAATLHWKGLQKIVMALVISPIIGVAIGFLFMVIVMRLFHD
FT                   SNPGPLNKNFRKLQVASAAFMAFSHGTADAQKSMGVITMALLSYGLIPAFDVPTWVKVS
FT                   CAVAMGLGTAAGGWRIIKTIGKDFVKLQPVHGFCVETAAAGVILGASSIGMPVSTTHVI
FT                   TSTILGVGVSKRLTAVNWNVAKRIVWAWVLTIPAAALVAFMTYQVLLPLLG"
FT   sig_peptide     576248..576304
FT                   /locus_tag="Glov_0587"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.970) with cleavage site probability 0.969 at
FT                   residue 19"
FT   gene            577424..578104
FT                   /locus_tag="Glov_0588"
FT   CDS_pept        577424..578104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0588"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: gur:Gura_1572 two component
FT                   transcriptional regulator, winged helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94315"
FT                   /db_xref="GOA:B3E3A3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B3E3A3"
FT                   /protein_id="ACD94315.1"
FT                   /translation="MKKVLIVEDERDLAELLAYNLEKEGYQALVTGTGVEGLETARREL
FT                   PDLILLDLMLPGMMGTEVCSALRHSDKTRGIPVLMLTARGDEIDRVVGFEMGADDYIVK
FT                   PFSMRELMLRIRAILRRSSQEPDTTERQITMGTIVIDCASHRVTVAGSEIELTSTEYKL
FT                   LLYLAEHGGRVMKRELLLQDVWGYNFVGDTRTVDTHVTRLRNKLGDAGEMIKTVRGFGY
FT                   KLEE"
FT   gene            578107..579852
FT                   /locus_tag="Glov_0589"
FT   CDS_pept        578107..579852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0589"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="KEGG: ppd:Ppro_3156 multi-sensor signal transduction
FT                   histidine kinase; TIGRFAM: PAS sensor protein; phosphate
FT                   regulon sensor kinase PhoR; PFAM: ATP-binding region ATPase
FT                   domain protein; histidine kinase HAMP region domain
FT                   protein; histidine kinase A domain protein; PAS fold domain
FT                   protein; SMART: PAS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94316"
FT                   /db_xref="GOA:B3E3A4"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR014310"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B3E3A4"
FT                   /protein_id="ACD94316.1"
FT                   /translation="MSFRWKLFLSYIALSLLIAGGGFGYVNHLLEQRLVEESRSNLQQQ
FT                   AQLARLLAEQQRALPPQALAHKLGAAIKARVTLIAADGRVVGDSDVRDDQVGSLENHQG
FT                   RPEVQQALKTGSGWSIRYSDTLRTTMLYVALPLPAGDASVIRLALPLEYFDAAKRALHN
FT                   LLGGAVTLLLFSSLLLSIFLSRITAKPLREIADAAARIGVGERGVRIAMGKGEEIDYLA
FT                   RVLNEMAARIEEQMHKLTSEQQRLAAILRGMGEGVMVTDTKGNIILVNPAFRKQFGLPG
FT                   EVEGRPLVEVCRHPDLLQAFEEQRESGDEVSCEITIPITNLVLMAHWVPLTRDSGNRGT
FT                   VAVFHDISDLKRVETMRRDFVANVSHELRTPVAVIKGYGETLLDGALEESPERSRRFVE
FT                   IIVSHAERLTNLINDILTLSKLEARDAALTLHPLDLCGTIRKAQMLMEDHARSKGIRIA
FT                   AECPDGMPKVLADQGQLEQVLLNLLDNAIKYTPDGGDVTVAARLEQERVVVAVSDTGIG
FT                   IPARDLPRIFERFYRVDEGRSREQGGTGLGLAIVKHIVQLHGGEVQVASEAGKGSTFTV
FT                   TLPTV"
FT   sig_peptide     578107..578181
FT                   /locus_tag="Glov_0589"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.979) with cleavage site probability 0.944 at
FT                   residue 25"
FT   gene            579908..580420
FT                   /locus_tag="Glov_0590"
FT   CDS_pept        579908..580420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0590"
FT                   /product="phosphohistidine phosphatase, SixA"
FT                   /note="TIGRFAM: phosphohistidine phosphatase SixA; PFAM:
FT                   Phosphoglycerate mutase; KEGG: gme:Gmet_0878
FT                   phosphohistidine phosphatase, SixA"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94317"
FT                   /db_xref="GOA:B3E3A5"
FT                   /db_xref="InterPro:IPR004449"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:B3E3A5"
FT                   /protein_id="ACD94317.1"
FT                   /translation="MVIYLVRHAEAVERSEGLDDGVRWLTRKGRKATQKAGSRLHRKRV
FT                   RPDLVITSPLTRAVQTAELLMAALGERTELIADSGLAPDATLEQLIALITSRRKLGSIM
FT                   LVGHEPLLGQAAALLLGREEVAGLAKGGCLCLELRDKPDKPARFLWYAPVSGKLISSAK
FT                   KALVPKP"
FT   gene            580404..581282
FT                   /locus_tag="Glov_0591"
FT   CDS_pept        580404..581282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0591"
FT                   /product="CHAD domain containing protein"
FT                   /note="PFAM: CHAD domain containing protein; KEGG:
FT                   gur:Gura_2640 CHAD domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94318"
FT                   /db_xref="InterPro:IPR007899"
FT                   /db_xref="InterPro:IPR038186"
FT                   /db_xref="UniProtKB/TrEMBL:B3E3A6"
FT                   /protein_id="ACD94318.1"
FT                   /translation="MSPNRNRHSGESCPLPGSRQLLEAYAGCLTARWDGLLQLRYRTLN
FT                   CFDVEHIHDLRVASRRLRGAIEQLAPFVGTERMDRLRRPIRNLTRELGRVRNLDEALLY
FT                   LSQTGLNGLEPLLKSLEQQRKQEAAQTRRSLELLDCIKLERRIRAAAAALVTPDNVASQ
FT                   GLLALLSERNLTLYRPIHALLPLVAAPEMVEERHALRIAVKKWRYFNELLHDLLKRPQS
FT                   DLLELLRQYQTLLGDMNDRVVIAALLREAVDLAETVRETALGGIAREQRKLLKKLSALL
FT                   DEKPILYHFEL"
FT   gene            581304..582863
FT                   /locus_tag="Glov_0592"
FT   CDS_pept        581304..582863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0592"
FT                   /product="Ppx/GppA phosphatase"
FT                   /note="PFAM: Ppx/GppA phosphatase; metal-dependent
FT                   phosphohydrolase HD sub domain; KEGG: gur:Gura_2570
FT                   Ppx/GppA phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94319"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR030673"
FT                   /db_xref="UniProtKB/TrEMBL:B3E3A7"
FT                   /protein_id="ACD94319.1"
FT                   /translation="MTKDRLAAIDIGTNSIRCIVVECNKDGSFRILDDEKDTVRLGEGI
FT                   AETGEISAAAVARAEAALTRMHKLVTGLKVKAIDAVATSAMRKSANGPRLVKRFSELLG
FT                   SEIRVISGDEEAALAAQSALRNFDTHGKRFGVIDVGGGSVELITAQGVHVEEFYSFELG
FT                   AVVMTEQFFRVDPARDSDYRRFQKHVREIIKKQLDGDKLVLPTLIGSGGTINAIAQMAL
FT                   QLRRNPVESVHGLEVLRSEVVHLLAMLQRRDIKGRREVAGLSPDRADIIVAGVGLVDTM
FT                   MELFNANTLLVNAHGVREGMILEAIKRRGMAPEAASPRSWRESVISFGQSCQMDDMHSQ
FT                   QVATLSLALFDQLADHFGLKKRERVLLEAAALLHDIGYYISYHSHHKHSCHLIRHAELF
FT                   GITPREREMVAVIARYHRKSLPKKKHDEFQRLTVKEQATVGRLAGILRMADGLDRRRCF
FT                   AVSGLQCRVEGNLVQLVLSGAEDLAVELFGASAKRDLFEKSFGVQVLFVTQAACAVTEK
FT                   EL"
FT   gene            582866..583063
FT                   /locus_tag="Glov_0593"
FT   CDS_pept        582866..583063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0593"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94320"
FT                   /db_xref="UniProtKB/TrEMBL:B3E3A8"
FT                   /protein_id="ACD94320.1"
FT                   /translation="MATREQRYAAIAAKMRCQQIPDLPLKHEWLELLTRLSRQDDDQLR
FT                   ELGITELRICADRATRNCHD"
FT   gene            583056..583892
FT                   /locus_tag="Glov_0594"
FT   CDS_pept        583056..583892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0594"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ppd:Ppro_3149 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94321"
FT                   /db_xref="GOA:B3E3A9"
FT                   /db_xref="InterPro:IPR003734"
FT                   /db_xref="UniProtKB/TrEMBL:B3E3A9"
FT                   /protein_id="ACD94321.1"
FT                   /translation="MTEAAAGLYSFTAFAVGGDLDLNRLAVRLGIDRKYRWEEPMRLNP
FT                   VTFTPSAGSDAVWVYLFYFGGIVFLNCSDDIIARCIEGLKQHLEQLREQPQLRFREDYR
FT                   LEITPDGEPSITNDCAVMPVFKQELLEIICFVIAKSVALERIEEHVDAVFDEVGVMISR
FT                   LGQGVLELPDKRLAKLASVVLGFKYTSIAHIMVLDKPESTWDNEEADRFYLTISNLFEL
FT                   RPRYQEIKHKAETLLDVTDVFSSLSHARRSARLEWIIIILIAFEIIMALWQKFWGG"
FT   gene            583941..585362
FT                   /locus_tag="Glov_0595"
FT   CDS_pept        583941..585362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0595"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /note="KEGG: ppd:Ppro_3595 PAS/PAC sensor signal
FT                   transduction histidine kinase; TIGRFAM: PAS sensor protein;
FT                   PFAM: ATP-binding region ATPase domain protein; histidine
FT                   kinase A domain protein; PAS fold-4 domain protein; PAS
FT                   fold domain protein; SMART: PAS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94322"
FT                   /db_xref="GOA:B3E3B0"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B3E3B0"
FT                   /protein_id="ACD94322.1"
FT                   /translation="MMLMVPAQVRNASLRIVAIYAFFGAMWILVSDTVVGWLVSDPAIL
FT                   TRVALFKGWLFILLTSLLLYKLISSDNQKLARATALLQGSEERFHTIYDSLNDAIFIHD
FT                   AETGRILDVNETACRLYGYGREELLNKGLQQLGTGEPPYSGAEALAWIQRCAEGTPQTF
FT                   EWITATRYSSRLWVEVSMRRATLDGENRIVVMVRDISERKQAEEQLSLQQAQLEELNRT
FT                   LERRVNEAIAELRQKDELLLQQSRHAAMGEMLNNIAHQWRQPLNNIAIYVQSMQLLKAS
FT                   HELTDEQIQSDVQNIMAIINYMSKTIDDFRTFFRNEKQKHPFSVSEAAGKAISFVSAQM
FT                   DHYGISCRLVVHDELTVNGYQAEYIQVVLNILNNAIDALNHSGSRDKRILVSISAEHNR
FT                   AVLAIQDNGGGIPPEALPHIFEPYFTTKGPGEGTGIGLYMAKSIIEKHMAGSLSARNRS
FT                   EGAEFRICLPSADVA"
FT   gene            585489..588326
FT                   /locus_tag="Glov_0596"
FT   CDS_pept        585489..588326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0596"
FT                   /product="Alkaline phosphatase"
FT                   /note="PFAM: Alkaline phosphatase; KEGG: cch:Cag_0406
FT                   alkaline phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94323"
FT                   /db_xref="GOA:B3E3B1"
FT                   /db_xref="InterPro:IPR001952"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR027372"
FT                   /db_xref="UniProtKB/TrEMBL:B3E3B1"
FT                   /protein_id="ACD94323.1"
FT                   /translation="MFFERRHLRTVAAVLALTMASSLTGCGTTGSSTTPATAVKNVILV
FT                   IGDGMQLEHERAANNYLFGNYTEGLAFWKFPYQGQASTWDVTTYNRFATAAGKSVWSAS
FT                   TSTADDSTTFDALLGYDPAKGGKQPWPLDSTGDKTYLLTGATDSASAGTALATGYKTDD
FT                   GNVAWKTGDPEDGRLLTIAEMYRYQKKAAIGVVSTVPFTHATPATFVSHNKSRNNYKDI
FT                   GYEIINSVKPEVVIGGGHPNYTTSYMDTRDYNILKASTEYVLAERQTGVDGNSTIAAKA
FT                   TEAVANSKKLFGLFGNSGGQFDYPVPSNTPGTPSVVRGNIENPSLAEASKAALKVLAQN
FT                   KNGFFLMIEQGDIDWANHANDFKSMVGGVYDLNETVKAIESYVDQPGDDIDWNNTLVIV
FT                   TSDHGNSYMRLNSAKPLQKGALPQQDANSTSNGSYTPSYVYPNGEVTYGTGGHTNELVR
FT                   VYAKGGKTSLLNSFEGIWYAGTKIIDNTQLYKVMMSALGLTDQNKQSSLLDKIIAMLPD
FT                   SLLSILNPKLTTTQLNNAITNGARTVTKPGIGSALVPDPKAAGYYYMMTDRGINGDYSY
FT                   TDPVSGVTTEGKYFPLPAFTPTIVRVKLDGATIIIDKVIPIVDKDGNYVTGIPNDANDG
FT                   LAYDSPTAAVGSPLAYNENGLDTEDMQVLPNGDFLVVDEHSPSIVVVEGTTGKVKVRYT
FT                   PAGKKLTGANYTVKDILPVVMLQRRANRGFENLALSSDGKTAYAVMQSPMGQKSDPNYS
FT                   TAYKNSRVVRIARLDVTDPVNATVTGHYVVMQSAVADYAKNSAGLTVSNKQTDMKYSAA
FT                   SWLAKDKILLLERANGKAKVFVVDLNFATNMLGKSYENTLGPEDIATAGLGLGGLGIVP
FT                   ASVYEAFSTDELPALTLDAADATGTSPSYEVKFEGMALVGDQLLLANDNDFGIADVTLP
FT                   TKIWKVSLKRALGSF"
FT   sig_peptide     585489..585605
FT                   /locus_tag="Glov_0596"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.522 at
FT                   residue 39"
FT   gene            588447..588875
FT                   /locus_tag="Glov_0597"
FT   CDS_pept        588447..588875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0597"
FT                   /product="protein tyrosine phosphatase"
FT                   /note="PFAM: low molecular weight phosphotyrosine protein
FT                   phosphatase; KEGG: wsu:WS0760 putative arsenate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94324"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:B3E3B2"
FT                   /protein_id="ACD94324.1"
FT                   /translation="MKKDKVLFVCIHNSARSQMAEAFLNHLAGDRFEARSAGLEPGVLN
FT                   PLVVEVMQELGIDISAHQTKDVFEMFKRGEMYSYVITVCDGASAERCPIFPGIVSRLHW
FT                   SFSDPAALQGTRQDVRAAVREIRDEIRTAVEGFVAEYA"
FT   gene            complement(588940..589146)
FT                   /locus_tag="Glov_0598"
FT   CDS_pept        complement(588940..589146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0598"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94325"
FT                   /db_xref="UniProtKB/TrEMBL:B3E3B3"
FT                   /protein_id="ACD94325.1"
FT                   /translation="MKNLKEFCLECGSRAVSKTIDNVLPKFKMEIINYACGAELKSIYS
FT                   SNGNTGRLCLSGCSQLEEQVSPI"
FT   gene            complement(589223..592096)
FT                   /locus_tag="Glov_0599"
FT   CDS_pept        complement(589223..592096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0599"
FT                   /product="PAS/PAC sensor hybrid histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="KEGG: dar:Daro_3872 PAS; TIGRFAM: PAS sensor
FT                   protein; PFAM: response regulator receiver; ATP-binding
FT                   region ATPase domain protein; histidine kinase A domain
FT                   protein; PAS fold-3 domain protein; PAS fold-4 domain
FT                   protein; PAS fold domain protein; SMART: PAS domain
FT                   containing protein; PAC repeat-containing protein;
FT                   extracellular solute-binding protein family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94326"
FT                   /db_xref="GOA:B3E3B4"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B3E3B4"
FT                   /protein_id="ACD94326.1"
FT                   /translation="MKRSICTIAFLLLLFCLQTASPALAVPPSPVNRPLIAVIPTDLAP
FT                   YYFREPVTAKPAGLAVDITDALARRAGLQVEYRFAKAWEEIDELVLNRQADLIPLRVIN
FT                   QTTKDQFLFSEVLDVAPISYLVRASDTRTKGVAPGQRVGVMQNSTAYSLLKDRSDITLT
FT                   TYESLQQLLMDLVTGQLDLVMTFRNTIVQLAEKAGLENQIRVIEPPALESRRGIALHPA
FT                   NTALAQQLNAAIKTFHGSREYQKIYQHWMGTPKPWWTVQRTVLLMGGGTVLLLAGSLLW
FT                   RFLGIRRLNRQLQEANQRLETEISEHNQAVRLLKKNEQFQKTLIETLPDLVWLKDPDGV
FT                   YLGCNPRFEELYGAKQSEIIGKTDYDFVERELADFFRENDRKAAAAGKPTVNEEWLTFT
FT                   ESGYRGLFETIKTPMFDTDGTLLGVLGVARDISERARAYELLRLSEEKFATAFRVSPDS
FT                   VNLNRLSDGTYLEVNEGFTAIAGYQPEEVLGKSSLELNIWANPADRLQLVQELQQHGFV
FT                   RNLEAQFRCKDGSLITGQMSARIITVNGEQCLLNITRDISERKRYEEELQQARQAAEAA
FT                   NRAKSEFLANMSHEIRTPMNGVIGMVQLLQFTRLNSEQQEYLQCLETSAQNLLSLLNDI
FT                   LDLSKIEAGKISLEYADFSLRHSIQEVVTTQISQIHQKRLKLTTSLADDIPEILHGDPL
FT                   RLKQILLNLLGNAIKFTAAGSITIAARITDQQNGTLTICLSVSDTGIGMTPEALQRIFA
FT                   PFEQADNSTTRRFGGTGLGLTICRRLAELMGGRIWAESSDGHGSSFFVELPFAVRMQTA
FT                   PAAAPAVLQSATGSTRSLQLLLAEDNAPNAATITAMLKRMGHQVEVVNDGKQALDRWRC
FT                   NRYDALLLDVSMPVMGGSEATRLIREEEQQTGQHIPIIAVTAHALRGDRDLFLQNGFDG
FT                   YVAKPVDMQHLARELERLTTRRSSPNI"
FT   sig_peptide     complement(592019..592096)
FT                   /locus_tag="Glov_0599"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 26"
FT   gene            complement(592165..594174)
FT                   /locus_tag="Glov_0600"
FT   CDS_pept        complement(592165..594174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0600"
FT                   /product="diguanylate cyclase with GAF sensor"
FT                   /note="KEGG: rfr:Rfer_3606 diguanylate cyclase with PAS/PAC
FT                   sensor; TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; SMART: GAF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94327"
FT                   /db_xref="GOA:B3E3B5"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:B3E3B5"
FT                   /protein_id="ACD94327.1"
FT                   /translation="MTPGSSVDRQLSQRTGQHWLALIVALALIGSIIAYNLATMRHRTI
FT                   SQENQRLMTQARVIGQNIQRQLEATSRALKGVISDLPGLQGSQNLAQANKRLSVLADAM
FT                   PGIRTLFFTDTKGNILAANRPELIGRNVAGRQYFSEPQQHPNPDTLYISPPFKSVLNAY
FT                   VFDITRMIPGPDGRFAGIVTAGVDPDYFEVILQSTLYAPDMWNTINHGDGIRFMTMPYR
FT                   EGQAGKNLAVPGSLFTRHKESGQPENIFTDTAYATGEYRKVALLTLQPKELQMDKPLVV
FT                   IISRNPDAIMKNWKNEAIFQGLLFLMTCIGSSAALSLLHRRQALFEQKAQRAEAMVQIR
FT                   YQLLEYATMHTVDELLQYALDEVCRISDSPVGFYHFVDPDQQALTLQAWSTRTLQEFCK
FT                   AEGHGMHYGVDQAGVWAECVQTRAPAIHNDYAALPNKKGLPPGHAPVIRELVVPVIRDE
FT                   RIVAVLGVGNKGNNYTTRDAEEVAYLADVTWEIIDSRRAQQELKHANELLATEARIDFL
FT                   TGIYNRRMFDGLLVAETARACRYNSPLSLIMLDLDHFKQINDTQGHAAGDHVLQKVAEL
FT                   ISGRIRSHDIFSRWGGEEFVILTPKNDTAQAAVLAEILRDMIEQYDFGNGLRLTCSFGV
FT                   TRHICGEPAEVFIERADTALYQAKHNGRNRVETA"
FT   gene            complement(594171..595640)
FT                   /locus_tag="Glov_0601"
FT   CDS_pept        complement(594171..595640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0601"
FT                   /product="diguanylate cyclase with PAS/PAC sensor"
FT                   /note="KEGG: pca:Pcar_2558 signal transduction protein;
FT                   TIGRFAM: PAS sensor protein; diguanylate cyclase; PFAM:
FT                   GGDEF domain containing protein; Helix-turn-helix type 11
FT                   domain protein; PAS fold-3 domain protein; PAS fold-4
FT                   domain protein; PAS fold domain protein; SMART: PAS domain
FT                   containing protein; PAC repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94328"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B3E3B6"
FT                   /protein_id="ACD94328.1"
FT                   /translation="MYKYSNKIDALTAILKRLDTGEKLTPELLAGDFHVGVRTIYRYLN
FT                   HLQAAGYPIYFDKADRSYRFLNNFRLNQLKSGGGDEAFSLHPINQMNGVAIATFRTSGE
FT                   CIHKNTAMTRLTGCASWNCCSGNFRQLDWWQDSGLLAMADEAIETGREVCRDITLTVNK
FT                   RERWIQAHMTLVKQEKTAYLVFLAQDLSPRMHKEIQVARFFAAMNQSPNLILVTDTRGT
FT                   IEYVSERVEELTGYTAEELIGANPRILKSGQTPPEVYQNLWSTISRGYAWSGELYNRKK
FT                   NGDYYWQHLLIAPIRNHHNGISRYVAVIEDISRQKLLEEEIYAYAVSDRVTGLYNRKIL
FT                   LELGNRDITAAQRYGRAMTLLIVDIDQFKEINDQFGYPAGNQFMQQLAALCRASLRTTD
FT                   LIGRTGKDSFGILLAESALADALLVAERIREKAAQIRITTAEGELACTVSVGGVALNNR
FT                   HQTMEQLVIECEGLLQGSQSQRTVNQCIGFA"
FT   gene            595924..598374
FT                   /locus_tag="Glov_0602"
FT   CDS_pept        595924..598374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0602"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ppd:Ppro_2684 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94329"
FT                   /db_xref="UniProtKB/TrEMBL:B3E3B7"
FT                   /protein_id="ACD94329.1"
FT                   /translation="MPELPSPRHRTTSGEPGQEPARLRLALTLAGVCLERPETIATSLP
FT                   FSVGDVTAGAESELQAVVAGDRRQVDLPLIIEQSNYFANMMKRAASGETSRRAVADLER
FT                   FLADNSSNVWENSWVRFPLKRLSAYARQVLERDLLADKNNPATGQRADAARFFFHAADG
FT                   TVMLRLPISYLIKLALADLVGSQQILPDLIRQTGIRLLGHYLNDNTSPETFSFNVVSLT
FT                   PRNGMGAAIARETAIRFLMTQLLILYANQAFGITEHGQQAMAYFAPHPPVRQKELNDHI
FT                   PDSFYRELFMSPCLSGWDKGEDKFRYMQLCHQVLSRSQLNAVAKLKDAGIILNNLVVLP
FT                   NVSNVSLANNGTHISIGSRRLTAALQDSGSGFKAAHEKLLGDLTIKISEHFLPLFVGSY
FT                   TAAPFRLAYSDFHPEKALGFLPHELDYTHLRMLWRRWRKKADISIFGQSVTPFGPPALD
FT                   SFISRAFGLKGDFVPDYRLVDYLVCLLSTDRSPALNGQPGNTDLLRRDLADMGVFDEQM
FT                   SVYLLYKQREYAKMGFSGFEGRHYSLFQTFQGDMGRAADLQTLITALAYKYMAEGVDHR
FT                   SIPDDPSLESERRQIFFATAIGLPTFFVRKDTANSFLHRIITRTQGVRPSKRYPGYLRV
FT                   QIHEYRLALLRVLREDAPDLIEQMGLHDTIADLAQRIREPEQYAAGGRLTGGILAHLGS
FT                   SSALKTEARDFNTGAEEYYRITLRRQQTAEAFDLLQSECCTLDQQAAELDEPLRKALLL
FT                   ILQGQSADQFLAAVRQDILQEQADIPTLQRLMNLLLVKVHHDQQQTMTGRSEPDAAAPV
FT                   YRAG"
FT   gene            598343..599332
FT                   /locus_tag="Glov_0603"
FT   CDS_pept        598343..599332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0603"
FT                   /product="phosphatidylserine decarboxylase-related"
FT                   /note="PFAM: phosphatidylserine decarboxylase-related;
FT                   KEGG: ppd:Ppro_2685 phosphatidylserine
FT                   decarboxylase-related"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94330"
FT                   /db_xref="GOA:B3E3B8"
FT                   /db_xref="InterPro:IPR003817"
FT                   /db_xref="UniProtKB/TrEMBL:B3E3B8"
FT                   /protein_id="ACD94330.1"
FT                   /translation="MLQHQYIERDSGAVVTEQLLGDRMVQLLYHQVRENSSGLFRLLTS
FT                   SWSSQLLGAVNFDRPLLNRQGFAARCGIDLEECLDPPHTLDTARKVFERRIRYEQCRPL
FT                   PDEPAAVVSPADARVIVGSLQETDLFFLKDKFFSFEELIGPERSFWRHRFANGDFALFR
FT                   LTPDKYHYNHTPVAGKVVDFYSIDGAYHCCNPAAVVSMVTPYSKNKRVVTLIDTDVAGG
FT                   SRVGLVAMVEVVALMIGDIVQAYSDQGYDDPRQVRVGMFLKKGQPKSLYRPGSSTDILF
FT                   FQPGRVRFAADLLENQLRSGVVSRFTQGFEKPLVETDIKVRSLLALNN"
FT   gene            599342..601801
FT                   /locus_tag="Glov_0604"
FT   CDS_pept        599342..601801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0604"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; SMART:
FT                   phosphoesterase PHP domain protein; KEGG: gur:Gura_2602
FT                   glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94331"
FT                   /db_xref="GOA:B3E3B9"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:B3E3B9"
FT                   /protein_id="ACD94331.1"
FT                   /translation="MIMKTYKADLHVHSSYSNKPTYWAMRKFNCPESYTSPRQLYQTAL
FT                   ARGMHYVTITDHNAIGGALEIAHLPNTFISAEITTHFPENGCKAHLVVLHISEAQYAEI
FT                   MVLRKNVYELVAYLNQERIAHFLAHPLYAQNDKLTIEIIEKSLLLFTTFEVQNGCRARR
FT                   FNDVTARLAGALTPAIVERLAEQHRITPTGPTPWQKGMVGGSDDHGGLFIARAHTCSHR
FT                   GEDLDAFLDAVRQGSTWAEGEHGGPLTMAHSLYGVAHSFYRERFGERRRSATPFVSALL
FT                   DRFFNLGTDKGSFVEKIRLFVLKNLPEKRSSRELGFEELLDSEARQLLNDAPFLEGLKG
FT                   ADLNRKIFMVTSRLANRILYQYTNRFMSLSMQAGFFDYLNTAGTIGLVHLLISPYYLAF
FT                   HHQHKGKELIREIAERLPEIPFSPAEEKIALFTDTLDEINGVAMTIRRLIRTAQERGIS
FT                   LTVITSGDDSQAAPAGVKQFQAVGDFVLPEYPELKLSFPPILDVLNYIEKEGITRIHIS
FT                   TPGTVGLLGLLIARLMNIPVAGTYHTDIPQYVRSLTNDEFLEQAAWSYMIWFYNQMEEV
FT                   LVPSSGTREQLLSHGLPPEKMKPLPRWVDTEQFSPDKRVERFWLERGLSGRITLLYVGR
FT                   VSREKGLDLLVESFCRLIDEGAELCLSVVGDGPYRGEMEQALAGYPVLFTGYLQGEELQ
FT                   QAYASADLFVFPSATDTFGNVVLEAQASGLPVIVSDAGGPCELMIGGETGMVFSAGSQD
FT                   ELTGAIRSMTANRLMLSLMGESARSFALAKAPHASDTYSTILQPGPRPDAGYSTFGESP
FT                   CLQSCSC"
FT   gene            601777..602829
FT                   /locus_tag="Glov_0605"
FT   CDS_pept        601777..602829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0605"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gur:Gura_1506 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94332"
FT                   /db_xref="GOA:B3E3C0"
FT                   /db_xref="InterPro:IPR001640"
FT                   /db_xref="UniProtKB/TrEMBL:B3E3C0"
FT                   /protein_id="ACD94332.1"
FT                   /translation="MSAVLFLLIATFLLAAYLWWGFRFLPAERWQIFATVPGRKNGPGS
FT                   WQGINFTWYGLLTANAYLVAVAVLLVLLGSVGVPPLGTALLAAALLCCCVPASRLVARI
FT                   VEKKAHTFTVGGAVFVGIIITPFLISLLNRLVGPQLGFQIPVMAAYAAIAIAYAFGEGL
FT                   GRLACISFGCCYGKPVPQDSGLLNRLFNGRGFVFQGSTKKVAYAGDMEGVEVIPVQAIT
FT                   AVLYTVCGLLATALFLGAHNAAAFLLATTVTQGWRSFSETMRADYRGAGRISAYQVMGL
FT                   VGLLYAFAMVWLLGGEVSAPAQLAAGLTSIWSPALILFLQGIWCVIFFYTGRSTVTGAT
FT                   LSFHLHHDRI"
FT   gene            602836..603795
FT                   /locus_tag="Glov_0606"
FT   CDS_pept        602836..603795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0606"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gme:Gmet_0764 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94333"
FT                   /db_xref="InterPro:IPR031040"
FT                   /db_xref="UniProtKB/TrEMBL:B3E3C1"
FT                   /protein_id="ACD94333.1"
FT                   /translation="MPTTTRHPNQLDTEEALALLKQLVLLDGPGSANLSRLQVMQLLCA
FT                   RKRALAAADHSFDTLLFELGKQLDEQIRDGAPLAIKKRFTLLTDYFHKLELASGHLNHL
FT                   AFMGSYQLDVELLVELKHDMEWFEEIEAGLFSRLMVDDLLKSQLLDSFGRRRVKLLVDG
FT                   LAQIQTVRTQKNDMKFFDLQAVQGIISRLQQLEKEERLFMLLAEIVAEQSRLNQAAMST
FT                   PQGREVIRRVTTIELRQRHGVEGDIPDELFQKAFELVKLEAIYSNAILPQVVRGNSALR
FT                   QDFIKKSGLDLFYIEDLEDQYCRRNGIDPALIRELREQ"
FT   gene            603894..604175
FT                   /locus_tag="Glov_0607"
FT   CDS_pept        603894..604175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0607"
FT                   /product="plasmid maintenance system killer"
FT                   /note="PFAM: plasmid maintenance system killer; KEGG:
FT                   lpf:lpl1092 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94334"
FT                   /db_xref="InterPro:IPR007711"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:B3E3C2"
FT                   /protein_id="ACD94334.1"
FT                   /translation="MIVSFHDSETSKVWEGQFSRKLPHDIQQVARRKLRMLNNAGRVDD
FT                   LRIPPQNRLEKLSGDREGQWSIRINDQWRVCFLWNEGTASRVEICDYH"
FT   gene            604186..604482
FT                   /locus_tag="Glov_0608"
FT   CDS_pept        604186..604482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0608"
FT                   /product="plasmid maintenance system antidote protein, XRE
FT                   family"
FT                   /note="TIGRFAM: addiction module antidote protein, HigA
FT                   family; PFAM: helix-turn-helix domain protein; KEGG:
FT                   chu:CHU_0642 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94335"
FT                   /db_xref="GOA:B3E3C3"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR013430"
FT                   /db_xref="UniProtKB/TrEMBL:B3E3C3"
FT                   /protein_id="ACD94335.1"
FT                   /translation="MAQLANVHPGEVLKEEFLVPMGISQYRLAKEIGVTESRISAICQG
FT                   KRAVGADTAARLARFFGTTAAFWLGLQADYDTEEVERNLSAELEKIHPWKMAA"
FT   gene            604842..605387
FT                   /pseudo
FT                   /locus_tag="Glov_0609"
FT   gene            complement(605956..606741)
FT                   /locus_tag="Glov_0610"
FT   CDS_pept        complement(605956..606741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0610"
FT                   /product="FRG domain protein"
FT                   /note="PFAM: FRG domain protein; KEGG: ppd:Ppro_2571
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94336"
FT                   /db_xref="InterPro:IPR014966"
FT                   /db_xref="UniProtKB/TrEMBL:B3E3C4"
FT                   /protein_id="ACD94336.1"
FT                   /translation="MLATITVHSWDELQQALFADSWNEDLGRYRSRFAFRGLSDVSYRL
FT                   ETTLMRLGGPYAELEHHLLRNFKKYAHQRVVERDSIWHWLSVAQHYGLPTRLLDWTYSP
FT                   FIAMHFATANIEKSDIDGVVWAVNYVKAHQLLPDVLRHKLEQEGANVLTVEMLTEVISS
FT                   LSELDGIARDDVALFFEPPSIDDRIVNQFAFCSVMTSPGMALDSWLANHPETGRKIIIP
FT                   AALKWEIRDKLDQANITERVLFPGLDGLSRWLKRHYSPR"
FT   gene            complement(606746..607213)
FT                   /locus_tag="Glov_0611"
FT   CDS_pept        complement(606746..607213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0611"
FT                   /product="methylglyoxal synthase"
FT                   /EC_number="4.2.3.3"
FT                   /note="KEGG: ade:Adeh_1240 methylglyoxal synthase; TIGRFAM:
FT                   methylglyoxal synthase; PFAM: MGS domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94337"
FT                   /db_xref="GOA:B3E3C5"
FT                   /db_xref="InterPro:IPR004363"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR018148"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:B3E3C5"
FT                   /protein_id="ACD94337.1"
FT                   /translation="MPSYNIIEMGSRKRIALVAHDNKKRDLIEWARYNRAILVEHDLYA
FT                   TGTTGALLAESLDLQVTRLQSGPLGGDQQIGAMISQGEIDFVIFFWDPLEPQPHDPDVK
FT                   ALLRIAVVWNIPVACNRSTADFLISSSLMHDPYERLMQDYEEYKQRLKNKA"
FT   gene            complement(607310..609514)
FT                   /locus_tag="Glov_0612"
FT   CDS_pept        complement(607310..609514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0612"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: OmpA/MotB domain protein; Serine/threonine
FT                   protein kinase-related; SMART: tyrosine protein kinase;
FT                   serine/threonine protein kinase; KEGG: lch:Lcho_4359
FT                   OmpA/MotB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94338"
FT                   /db_xref="GOA:B3E3S4"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:B3E3S4"
FT                   /protein_id="ACD94338.1"
FT                   /translation="MEKGTMLYHYRIEGAAPYGKGALLMAEHILLGKRFLLKSLTPKLP
FT                   GTESYRERFYNEAKLLAGMVHPNILQATDFFEHNSGFWLVMEYYNGAALDRMIEHNGPF
FT                   PQQIALHYAVRLLQGLRFAHDKGVIHRGLTTAIILLDRNGGLKISDFGVALLKYGEDLQ
FT                   EVGQGGEAAFMSPEQILNPFTVTPQSDIYAVGLILYNMLAGRLPFSEESAVDTLMNQFD
FT                   STIPDIRSFAPDTHEELAAIVHKALEKDPANRYQSCVEFLAALEAHRVALLPKAPAEGI
FT                   ADSWLRRRRGLVMSSLVSALLLATGGGYYYHWINSYDIILKLQGSNTIGAELAPALAEE
FT                   FLKKQGAVRIRRVPGKNHEEQLVEGIMEGRRNRAVEIKAHGSTTAFEGLQANACDIGMS
FT                   SRRIKDDEVKRLSLLGNMTSRANEHVLALDGVAVIVNSTNPVATLTMADTQGLFTGKIP
FT                   EWKQLNSAAKAAPVHVYARDDKSGTFDTFKSLVLHKEKLVKEAKRFEDSVKLSRDVSSD
FT                   PNGIGFIGLPYVKSSKAVAISGGAQPILPTPFTVATEDYGLARRLYLYTPGQPKNQKIR
FT                   DFVEFALSPEGQAIVEKNGFVPLSVRMGNSSIPANAPERYRMLASSAERLSLNVKFTAD
FT                   GQLDNKAYRDLDRLVRALSTKELQGRQLLLFSFTDASSDPHSSLALSHQRVGQVAQELR
FT                   SRGIMVAAAEGFGSSLPVADNSTKEGRQRNNRVEIWLAKR"
FT   gene            complement(609544..612654)
FT                   /locus_tag="Glov_0613"
FT   CDS_pept        complement(609544..612654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0613"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC sensor(s)"
FT                   /note="KEGG: ppd:Ppro_2675 diguanylate
FT                   cyclase/phosphodiesterase with PAS/PAC and GAF sensor(s);
FT                   TIGRFAM: PAS sensor protein; diguanylate cyclase; PFAM:
FT                   GGDEF domain containing protein; CBS domain containing
FT                   protein; EAL domain protein; PAS fold-4 domain protein; PAS
FT                   fold domain protein; SMART: PAS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94339"
FT                   /db_xref="GOA:B3E3S5"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B3E3S5"
FT                   /protein_id="ACD94339.1"
FT                   /translation="MHTVTQHPIAGRQWLPDDAIKPANIPGRQAKLLLFGRVLPLTARS
FT                   ITLTFLLFGGIWTISAGLLERQLNLPEGLSYLTHIAAGAGLLLITAAMLYLLIRRFTRN
FT                   DSSSHELIIRAFHASPNGIAVVRDQDRRILSVNQRFAAMTGYAVASIVGHSDSDLKLWE
FT                   HSSERLDLIRQIRSNGAVQGLEVTLRRQDGSLLTGSISAHRILFEGDSCTIIFLEDITL
FT                   LKQAARKVEELTRYDAITGLPNHKLLSDRLAQLLAISSREEQALSVLKLVLGRCPGAIS
FT                   ARGGDDCDELLRSVADRLQDVLRETDTLAVLQKGEFGILLPKSGSERDILPVITKLLDA
FT                   INEPFSLHDAEFQLNAHIGIAIFPGDGRSGEVLLQHAHLAQLQAQSKSIAGESGFKFYA
FT                   EEMNQAVREQMQIESSILRGLRAGEFFACYQPLFSQDGKKLVGMEALARWQHPTLGLVG
FT                   PDKFIPVAEANGAIVQLGDRMLELALQNCKQWREQGYPHLTVAVNVSTRQLKDRQFAER
FT                   VARQLQMVGLPPDALCCELTESLLMEHSNENTEQIFRLKELGVKLAIDDFGTGYSSLTY
FT                   LKHLPVDRIKIDRSFVNELDSNPDDRAIVVAIIAMARSLHLKVTAEGVETPSQHQLLQE
FT                   LGCDTMQGYYFGKPMQREAFELFLLNGAQLLAGEPSDPQPEQIGQELTPPAAMPVPQEE
FT                   DDRSLQTVADITLHIEPLRPADRLNTALERFQTDKRLQVLPVVDQHRVAGVLNRSEFIE
FT                   EQIVGRIGYAFHINHSKKVRDLMQPVPLVIESDASIEEAAQALHGNFGTMRLENICVAR
FT                   RGVYRGILDVRTLVEAITALNLKLAKGANPLTGLPGNESIQRETTRRLESGMPFDIAYI
FT                   DIDHFKPYNDFYGFERGDMVIQVVGDILKFHADELLQGKQARNFCGHIGGDDFIIITGP
FT                   GYAAALSRQVIAEFDARLPLLHGSSDYAKGCYTSFNRKGELETFSLLSLSVAVISTGQL
FT                   QISSYAQLASMASEVKKTAKKVRGSSVAVKDSYEAPRVVLGTLPAEA"
FT   gene            complement(612710..614953)
FT                   /locus_tag="Glov_0614"
FT   CDS_pept        complement(612710..614953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0614"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: histidine kinase HAMP region domain protein;
FT                   chemotaxis sensory transducer; KEGG: gur:Gura_2845
FT                   methyl-accepting chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94340"
FT                   /db_xref="GOA:B3E3S6"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:B3E3S6"
FT                   /protein_id="ACD94340.1"
FT                   /translation="MTIRRKLLINSLITFVGFAAVVLLGYYTIAGFQGTIRELTTRSTP
FT                   LQVKMLQFQQTVERLSGDLLQTGMLEDPRELQKQTAVMEERRKRLDQLSKEIQELKGVQ
FT                   LDVSAFATLEQQVAAALQDKFTSLEIFKAEATNLSGSIRAAEKSLEGIRDVISGLRSTA
FT                   ARRAQSSSRDIEQALKGGSVTGLAENASLAEKVQNYRNGVENDMEINKRVMAAVEAVDS
FT                   IHIDLRLLDAKARMIMLSSSAAELDRLAGEIGTVQARIGKSLKQAEAEVMSVKSGGVVR
FT                   DAIEQIGSGAGRAGAAIRRIAAAQRNVLASMGQVEATVAQIRQVTLEQARQSEAQVTAT
FT                   TSEQQNFVEAMDATSHRRTAIMLGGALLIGILVLALNWLVAMIIRKPLGQLQSTIGEIA
FT                   ESRDLRRSVTVLNNDEIGQSINAFNSLISSFRRIVGAIAGTAGTLAGTSQELSGTVNLI
FT                   TCQVQEQSERVSQVATAGSQLSQTVADVAQHTARIAGSAGMARQTAQNGAAVVNRTIAE
FT                   VQAIAESVGESQTTIASLHERSQQIGEILETIRDITDQTGLLALNAAIEAARAGEHGLG
FT                   FAVVANEVRNLSRRAEQATVEIAGKLSAIQGDTGKAVEAMQQSLTRVTRGVEFSEEAGC
FT                   ALASIVESVDGLQGMTQQIATATEELSATSSQISNDILAIDTTLRETLQAAAAISDESI
FT                   HLAAISQELQAELNQFRYDDPLPAAAAPTAPEQYRSPVFDALHSIPIRTAAAA"
FT   sig_peptide     complement(614894..614953)
FT                   /locus_tag="Glov_0614"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.909) with cleavage site probability 0.592 at
FT                   residue 20"
FT   gene            615182..615373
FT                   /locus_tag="Glov_0615"
FT   CDS_pept        615182..615373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0615"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94341"
FT                   /db_xref="GOA:B3E3S7"
FT                   /db_xref="InterPro:IPR000679"
FT                   /db_xref="UniProtKB/TrEMBL:B3E3S7"
FT                   /protein_id="ACD94341.1"
FT                   /translation="MRTRTHDDYYAWTCDWCDSENRTLWVRVAHGDVACGACHRTTSFP
FT                   TSSVALTAGQQPMLSGQC"
FT   gene            615498..616580
FT                   /locus_tag="Glov_0616"
FT   CDS_pept        615498..616580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0616"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gur:Gura_2572 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94342"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B3E3S8"
FT                   /protein_id="ACD94342.1"
FT                   /translation="MKQLLSRHLQPLTERHPALMNMATATAGFLRSIAIKPYRQRHRPR
FT                   ELALWERYHSLHAVRCQVYREKSAGGRPTIVVAGFVPDATEVVEFQRPLLRSHGSIYYL
FT                   NYPRNGFSHELFEAQLADLIDELSLKGERPVLMGVSFGAGLVVDFLRRASEQLHDRLRG
FT                   LLLVSPVLCTADLIRPDNQRNGGVRMLESNLRKILKADPNDESDLNRQLERARRCFQAL
FT                   FEAGAENRSLTTRHLAIRQRIFGVLEHTSNLGGYQRVLALRSFAEPAAGRTIFGGPTLI
FT                   MLAEDEQSILVPGSPTLQLCADHAALRSVFPEARACLIASNNDADPVAHASLIFHQHCY
FT                   NPRMEQWLQKLHNQPLLAVV"
FT   gene            616816..618402
FT                   /locus_tag="Glov_0617"
FT   CDS_pept        616816..618402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0617"
FT                   /product="GH3 auxin-responsive promoter"
FT                   /note="PFAM: GH3 auxin-responsive promoter; KEGG:
FT                   gsu:GSU1092 GH3 auxin-responsive promoter family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94343"
FT                   /db_xref="InterPro:IPR004993"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B3E3S9"
FT                   /protein_id="ACD94343.1"
FT                   /translation="MKFPVSLLSLPLRAAADIRARRFLRKDPLGSQRELLPRLLQRAAK
FT                   TRFGREYGFNSLASLPFEVCYQQFQQQVPIRTYRQFWDDWFAACLTTTPQGQQLRLQDQ
FT                   SWPGLIPWFCETSGTTAPTKFIPFTHEMFRMNQRAALDMLCCYLAAEPGSRVPEGKILY
FT                   MAGSTRLKQMGPGVLAGDMSAITLQQRPAWLNPFVEPQEPLTSAPWDQRLDGMARLLLA
FT                   DRKIRIISGVPPWILLLLKQVESLAGRPVREALPSLELIIHGGTSMAPYAAEYQRLLPS
FT                   GGPRFLELLPSSEAFMGFQVQGEATMRLTPFYGSFFEFVPIEQLDESGAPLSDAQAVPL
FT                   AGVVTGQRYAVILSTCSGLWRYHIGDTLRFLDADRFHFEFTGRDKFLDRFEEKVTQTEV
FT                   EQAVAMLNKRHDGLVREFMVGADIGGRCHHWVLACRGSALLPDQASRLLDDQLRSANAD
FT                   YDTFRQQGRINSPRVLLVSEQQIYDWSAEVRGKLGGQSKIPHIDPTLTGELVKSLSGYA
FT                   CNNSFQSFASP"
FT   sig_peptide     616816..616866
FT                   /locus_tag="Glov_0617"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.711) with cleavage site probability 0.662 at
FT                   residue 17"
FT   gene            618486..619451
FT                   /locus_tag="Glov_0618"
FT   CDS_pept        618486..619451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0618"
FT                   /product="phosphate binding protein"
FT                   /note="TIGRFAM: phosphate binding protein; PFAM:
FT                   extracellular solute-binding protein family 1; KEGG:
FT                   ppd:Ppro_3157 phosphate binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94344"
FT                   /db_xref="GOA:B3E3T0"
FT                   /db_xref="InterPro:IPR011862"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:B3E3T0"
FT                   /protein_id="ACD94344.1"
FT                   /translation="MLKKSVLALCATLCIATAAHAEKVKVDAKLPSYKATSGVSGNLNS
FT                   IGSDTLNNLMTYWAEGFKKKYPNVNIQIEGKGSSTAPPALIAGTAQLGPMSRMMKGKEI
FT                   EDFEKKYGYKPTKVGVALDSLAVFVNKDNPIKSLSLDEVDAIFSKTRKRGLPEITTWGQ
FT                   AGVHGALAAKPISLFGRNSASGTYGYFKEHTLKNGDYKNTVKEQPGSASVVEGVAKDIS
FT                   AIGYSGIGYATSGVKAVPLSDKKGGQVFEANYANVLSGKYPLARMLYIYVAKKPGEPMP
FT                   KVVEEFLKFALSKEGQQIVVKDGYDPLPASAAAEQLKALK"
FT   sig_peptide     618486..618551
FT                   /locus_tag="Glov_0618"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 22"
FT   gene            619592..621517
FT                   /locus_tag="Glov_0619"
FT   CDS_pept        619592..621517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0619"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ppd:Ppro_3158
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94345"
FT                   /db_xref="GOA:B3E3T1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:B3E3T1"
FT                   /protein_id="ACD94345.1"
FT                   /translation="MASSIVDKSRRNDRLAAWLIKAGGLFVIVAVIGILMLIARVALPL
FT                   FYAPSADRLPEVSAELQALLATDGSGTSQTRELGESGSLTITLLPGNRFAVQRRNVEKD
FT                   LLGNEKTTEQSYKLSDPLPGTISTFWLGRKGQNLYAGTDNGWLVRWDLSGDGEGRLIET
FT                   VEAFKDHRRITALATVLGDNSLAVGDARGEITTWMPIAKPGSGEDKQLALIHHLPGFAQ
FT                   PVSRLLASPRDKSLAAFDAGGTIRLVHMTSERLLLELQAGLPVTAAAFADRGRQLVVAG
FT                   ADGRSVAWKLDIPHPEISFSTLFGKVWYEGYNKPEYVWQSSAATDDFEPKISLMPLIFG
FT                   TFKATLFAMLFAVPLALLGAIYTSQFMAPSLKGRIKPAVEIMAAVPSVVVGFLAGLWLA
FT                   PLMDKHLLALFLATIMVPAMLLAAILVWRPLAEKTEIGRNLKGYEFLGLLPVVVLALWL
FT                   SGQLAVPLEATFFGADLKQWLYSALGVRYDQRNSIIIAIALGFAVIPIIFTIAEDALSN
FT                   VPRNLSAASLALGASRWQTAWRVVLPSALPGVFSAIMIGFGRAVGETMIVLMATGNTPI
FT                   MSWSLFNGLRSLSANIAVEIPEAPLNGTLYRTLFLSAVLLFVLTFIINTAAELLRQRFR
FT                   KKYGRY"
FT   gene            621691..623283
FT                   /locus_tag="Glov_0620"
FT   CDS_pept        621691..623283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0620"
FT                   /product="phosphate ABC transporter, inner membrane subunit
FT                   PstA"
FT                   /note="TIGRFAM: phosphate ABC transporter, inner membrane
FT                   subunit PstA; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: ppd:Ppro_3159
FT                   phosphate ABC transporter, inner membrane subunit PstA"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94346"
FT                   /db_xref="GOA:B3E3T2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005672"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B3E3T2"
FT                   /protein_id="ACD94346.1"
FT                   /translation="MKNYWKRGEPMVLTAGATLAVILFMTLTLMAVILGNSLGYFWVKG
FT                   LVRYKLTDGSYLMGQLTAKERHALTNVKRVQLKVGNRDLYSQDFRWVDESEVAERDIPK
FT                   DAYLLERREHGNFFGFLKELRGSDGVAVAADPVSLKRLHEATVQRQQGLKDIKDRMSSL
FT                   NQASERLRLKVQKLEFRGAEAHAAEITALNEKKAKLTEEFDGLNEQLNQKQGELNKAVA
FT                   VFSDAAGTAKELPLLEIVRIYQPNSMSVFAKAWAYLGKIRELLFDDPRESNTEGGLFPA
FT                   IFGTVMMVLLMSVFSLPFGVIAAIYLREYAKEGRLVQLVRIAVNNLAGVPSIVYGVFGL
FT                   GFFVYGIGGSLDKLFFPERLPTPVFGTGGILWASLTLALLTVPVVIVATEESLASIPKG
FT                   IREGSLALGATKFQTLTKVLLPMATPGIMTGLVLSMARAVGEVAPLMMVGVVKLAPTLP
FT                   FDGQFPFFHMDRKFMHLGFHIFDVGFQSPNVEAAKPMVYVTTLLLLLIVVVATSLAIRF
FT                   RNQMRRKYTTSHF"
FT   sig_peptide     621691..621786
FT                   /locus_tag="Glov_0620"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.992 at
FT                   residue 32"
FT   gene            623307..624092
FT                   /locus_tag="Glov_0621"
FT   CDS_pept        623307..624092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0621"
FT                   /product="phosphate ABC transporter, ATPase subunit"
FT                   /note="KEGG: ppd:Ppro_3160 phosphate ABC transporter,
FT                   ATPase subunit; TIGRFAM: phosphate ABC transporter, ATPase
FT                   subunit; PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Glov_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ACD94347"
FT                   /db_xref="GOA:B3E3T3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR015850"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3E3T3"
FT                   /protein_id="ACD94347.1"
FT                   /translation="MSPESVDLSKHPAIIEVENVNLYYGASQALKDISLTMRRNQVTAF
FT                   IGPSGCGKSTLLRCLNRMNDLIDSVRIEGSIRLDGDEITGNRTDVISLRRRVGMVFQQS
FT                   NPFPKSIYENIVYGLRIAGINDKATLDETVERSLKGAAIWNEVKDRLHDSALGLSGGQA
FT                   QRICIARAIATNPEVILMDEPCSALDPLSTLKIEELIDELKEQYTIVIVTHNMQQAARV
FT                   SDATAFFYLGELIEMGDTKKIFTNPEKQQTEDYITGRFG"
FT   gene            624252..624920
FT                   /locus_tag="Glov_0622"
FT   CDS_pept        624252..624920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Glov_0622"
FT                   /product="phosphate uptake regulator, PhoU"
FT                   /note="TIGRFAM: phosphate transport system regulatory
FT                   protein PhoU; PFAM: PhoU family protein; KEGG: gsu:GSU1095
FT                   phosphate tr