(data stored in ACNUC7421 zone)

EMBL: CP001091

ID   CP001091; SV 1; circular; genomic DNA; STD; PRO; 2331981 BP.
XX
AC   CP001091;
XX
PR   Project:PRJNA29909;
XX
DT   12-JUN-2008 (Rel. 96, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 7)
XX
DE   Actinobacillus pleuropneumoniae serovar 7 str. AP76, complete genome.
XX
KW   .
XX
OS   Actinobacillus pleuropneumoniae serovar 7 str. AP76
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Pasteurellales;
OC   Pasteurellaceae; Actinobacillus.
XX
RN   [1]
RP   1-2331981
RA   Buettner F., Martinez-Arias R., Goesmann A., Baltes N., Tegetmeyer H.,
RA   Singh M., Gerlach G.F.;
RT   "Genome and proteome analysis of A. pleuropneumoniae serotype 7";
RL   Unpublished.
XX
RN   [2]
RP   1-2331981
RA   Linke B.;
RT   ;
RL   Submitted (21-MAY-2008) to the INSDC.
RL   Centrum fuer Biotechnologie, Universitaet Bielefeld, Universitaetsstrasse
RL   27, Bielefeld 33615, Germany
XX
DR   MD5; d1a2cc9214bf5e670560fe27e5c494cb.
DR   BioSample; SAMN02603888.
DR   EnsemblGenomes-Gn; APP7_r0001.
DR   EnsemblGenomes-Gn; APP7_r0002.
DR   EnsemblGenomes-Gn; APP7_r0003.
DR   EnsemblGenomes-Gn; APP7_r0004.
DR   EnsemblGenomes-Gn; APP7_r0005.
DR   EnsemblGenomes-Gn; APP7_r0006.
DR   EnsemblGenomes-Gn; APP7_r0007.
DR   EnsemblGenomes-Gn; APP7_r0008.
DR   EnsemblGenomes-Gn; APP7_r0009.
DR   EnsemblGenomes-Gn; APP7_r0010.
DR   EnsemblGenomes-Gn; APP7_r0011.
DR   EnsemblGenomes-Gn; APP7_r0012.
DR   EnsemblGenomes-Gn; APP7_r0013.
DR   EnsemblGenomes-Gn; APP7_r0014.
DR   EnsemblGenomes-Gn; APP7_r0015.
DR   EnsemblGenomes-Gn; APP7_r0016.
DR   EnsemblGenomes-Gn; APP7_tRNA01.
DR   EnsemblGenomes-Gn; APP7_tRNA02.
DR   EnsemblGenomes-Gn; APP7_tRNA03.
DR   EnsemblGenomes-Gn; APP7_tRNA04.
DR   EnsemblGenomes-Gn; APP7_tRNA05.
DR   EnsemblGenomes-Gn; APP7_tRNA06.
DR   EnsemblGenomes-Gn; APP7_tRNA07.
DR   EnsemblGenomes-Gn; APP7_tRNA08.
DR   EnsemblGenomes-Gn; APP7_tRNA09.
DR   EnsemblGenomes-Gn; APP7_tRNA10.
DR   EnsemblGenomes-Gn; APP7_tRNA11.
DR   EnsemblGenomes-Gn; APP7_tRNA12.
DR   EnsemblGenomes-Gn; APP7_tRNA13.
DR   EnsemblGenomes-Gn; APP7_tRNA14.
DR   EnsemblGenomes-Gn; APP7_tRNA15.
DR   EnsemblGenomes-Gn; APP7_tRNA16.
DR   EnsemblGenomes-Gn; APP7_tRNA17.
DR   EnsemblGenomes-Gn; APP7_tRNA18.
DR   EnsemblGenomes-Gn; APP7_tRNA19.
DR   EnsemblGenomes-Gn; APP7_tRNA20.
DR   EnsemblGenomes-Gn; APP7_tRNA21.
DR   EnsemblGenomes-Gn; APP7_tRNA22.
DR   EnsemblGenomes-Gn; APP7_tRNA23.
DR   EnsemblGenomes-Gn; APP7_tRNA24.
DR   EnsemblGenomes-Gn; APP7_tRNA25.
DR   EnsemblGenomes-Gn; APP7_tRNA26.
DR   EnsemblGenomes-Gn; APP7_tRNA27.
DR   EnsemblGenomes-Gn; APP7_tRNA28.
DR   EnsemblGenomes-Gn; APP7_tRNA29.
DR   EnsemblGenomes-Gn; APP7_tRNA30.
DR   EnsemblGenomes-Gn; APP7_tRNA31.
DR   EnsemblGenomes-Gn; APP7_tRNA32.
DR   EnsemblGenomes-Gn; APP7_tRNA33.
DR   EnsemblGenomes-Gn; APP7_tRNA34.
DR   EnsemblGenomes-Gn; APP7_tRNA35.
DR   EnsemblGenomes-Gn; APP7_tRNA36.
DR   EnsemblGenomes-Gn; APP7_tRNA37.
DR   EnsemblGenomes-Gn; APP7_tRNA38.
DR   EnsemblGenomes-Gn; APP7_tRNA39.
DR   EnsemblGenomes-Gn; APP7_tRNA40.
DR   EnsemblGenomes-Gn; APP7_tRNA41.
DR   EnsemblGenomes-Gn; APP7_tRNA42.
DR   EnsemblGenomes-Gn; APP7_tRNA43.
DR   EnsemblGenomes-Gn; APP7_tRNA44.
DR   EnsemblGenomes-Gn; APP7_tRNA45.
DR   EnsemblGenomes-Gn; APP7_tRNA46.
DR   EnsemblGenomes-Gn; APP7_tRNA47.
DR   EnsemblGenomes-Gn; APP7_tRNA48.
DR   EnsemblGenomes-Gn; APP7_tRNA49.
DR   EnsemblGenomes-Gn; APP7_tRNA50.
DR   EnsemblGenomes-Gn; APP7_tRNA51.
DR   EnsemblGenomes-Gn; APP7_tRNA52.
DR   EnsemblGenomes-Gn; APP7_tRNA53.
DR   EnsemblGenomes-Gn; APP7_tRNA54.
DR   EnsemblGenomes-Gn; APP7_tRNA55.
DR   EnsemblGenomes-Gn; APP7_tRNA56.
DR   EnsemblGenomes-Gn; APP7_tRNA57.
DR   EnsemblGenomes-Gn; APP7_tRNA58.
DR   EnsemblGenomes-Gn; APP7_tRNA59.
DR   EnsemblGenomes-Gn; APP7_tRNA60.
DR   EnsemblGenomes-Gn; APP7_tRNA61.
DR   EnsemblGenomes-Gn; APP7_tRNA62.
DR   EnsemblGenomes-Gn; EBG00001192757.
DR   EnsemblGenomes-Gn; EBG00001192758.
DR   EnsemblGenomes-Gn; EBG00001192759.
DR   EnsemblGenomes-Gn; EBG00001192760.
DR   EnsemblGenomes-Gn; EBG00001192761.
DR   EnsemblGenomes-Gn; EBG00001192762.
DR   EnsemblGenomes-Gn; EBG00001192763.
DR   EnsemblGenomes-Gn; EBG00001192764.
DR   EnsemblGenomes-Gn; EBG00001192765.
DR   EnsemblGenomes-Gn; EBG00001192766.
DR   EnsemblGenomes-Gn; EBG00001192767.
DR   EnsemblGenomes-Gn; EBG00001192768.
DR   EnsemblGenomes-Gn; EBG00001192769.
DR   EnsemblGenomes-Gn; EBG00001192770.
DR   EnsemblGenomes-Gn; EBG00001192771.
DR   EnsemblGenomes-Gn; EBG00001192772.
DR   EnsemblGenomes-Gn; EBG00001192773.
DR   EnsemblGenomes-Gn; EBG00001192774.
DR   EnsemblGenomes-Gn; EBG00001192775.
DR   EnsemblGenomes-Gn; EBG00001192776.
DR   EnsemblGenomes-Gn; EBG00001192777.
DR   EnsemblGenomes-Gn; EBG00001192778.
DR   EnsemblGenomes-Gn; EBG00001192779.
DR   EnsemblGenomes-Gn; EBG00001192780.
DR   EnsemblGenomes-Gn; EBG00001192781.
DR   EnsemblGenomes-Gn; EBG00001192782.
DR   EnsemblGenomes-Gn; EBG00001192783.
DR   EnsemblGenomes-Gn; EBG00001192784.
DR   EnsemblGenomes-Gn; EBG00001192785.
DR   EnsemblGenomes-Gn; EBG00001192786.
DR   EnsemblGenomes-Gn; EBG00001192787.
DR   EnsemblGenomes-Gn; EBG00001192788.
DR   EnsemblGenomes-Gn; EBG00001192789.
DR   EnsemblGenomes-Gn; EBG00001192790.
DR   EnsemblGenomes-Gn; EBG00001192791.
DR   EnsemblGenomes-Gn; EBG00001192792.
DR   EnsemblGenomes-Gn; EBG00001192793.
DR   EnsemblGenomes-Gn; EBG00001192794.
DR   EnsemblGenomes-Gn; EBG00001192795.
DR   EnsemblGenomes-Gn; EBG00001192796.
DR   EnsemblGenomes-Gn; EBG00001192797.
DR   EnsemblGenomes-Gn; EBG00001192798.
DR   EnsemblGenomes-Gn; EBG00001192799.
DR   EnsemblGenomes-Gn; EBG00001192800.
DR   EnsemblGenomes-Gn; EBG00001192801.
DR   EnsemblGenomes-Gn; EBG00001192802.
DR   EnsemblGenomes-Gn; EBG00001192803.
DR   EnsemblGenomes-Gn; EBG00001192804.
DR   EnsemblGenomes-Gn; EBG00001192805.
DR   EnsemblGenomes-Gn; EBG00001192806.
DR   EnsemblGenomes-Gn; EBG00001192807.
DR   EnsemblGenomes-Gn; EBG00001192808.
DR   EnsemblGenomes-Gn; EBG00001192809.
DR   EnsemblGenomes-Gn; EBG00001192810.
DR   EnsemblGenomes-Gn; EBG00001192811.
DR   EnsemblGenomes-Gn; EBG00001192812.
DR   EnsemblGenomes-Gn; EBG00001192813.
DR   EnsemblGenomes-Gn; EBG00001192814.
DR   EnsemblGenomes-Gn; EBG00001192815.
DR   EnsemblGenomes-Gn; EBG00001192816.
DR   EnsemblGenomes-Gn; EBG00001192817.
DR   EnsemblGenomes-Gn; EBG00001192818.
DR   EnsemblGenomes-Gn; EBG00001192819.
DR   EnsemblGenomes-Gn; EBG00001192820.
DR   EnsemblGenomes-Gn; EBG00001192821.
DR   EnsemblGenomes-Gn; EBG00001192822.
DR   EnsemblGenomes-Gn; EBG00001192823.
DR   EnsemblGenomes-Gn; EBG00001192824.
DR   EnsemblGenomes-Gn; EBG00001192825.
DR   EnsemblGenomes-Gn; EBG00001192826.
DR   EnsemblGenomes-Gn; EBG00001192827.
DR   EnsemblGenomes-Gn; EBG00001192828.
DR   EnsemblGenomes-Gn; EBG00001192829.
DR   EnsemblGenomes-Gn; EBG00001192830.
DR   EnsemblGenomes-Gn; EBG00001192831.
DR   EnsemblGenomes-Gn; EBG00001192832.
DR   EnsemblGenomes-Gn; EBG00001192833.
DR   EnsemblGenomes-Gn; EBG00001192834.
DR   EnsemblGenomes-Gn; EBG00001192835.
DR   EnsemblGenomes-Gn; EBG00001192836.
DR   EnsemblGenomes-Gn; EBG00001192837.
DR   EnsemblGenomes-Gn; EBG00001192838.
DR   EnsemblGenomes-Gn; EBG00001192839.
DR   EnsemblGenomes-Gn; EBG00001192840.
DR   EnsemblGenomes-Gn; EBG00001192841.
DR   EnsemblGenomes-Gn; EBG00001192842.
DR   EnsemblGenomes-Gn; EBG00001192843.
DR   EnsemblGenomes-Gn; EBG00001192844.
DR   EnsemblGenomes-Gn; EBG00001192845.
DR   EnsemblGenomes-Gn; EBG00001192846.
DR   EnsemblGenomes-Gn; EBG00001192847.
DR   EnsemblGenomes-Gn; EBG00001192848.
DR   EnsemblGenomes-Gn; EBG00001192849.
DR   EnsemblGenomes-Gn; EBG00001192850.
DR   EnsemblGenomes-Gn; EBG00001192851.
DR   EnsemblGenomes-Gn; EBG00001192852.
DR   EnsemblGenomes-Gn; EBG00001192853.
DR   EnsemblGenomes-Gn; EBG00001192854.
DR   EnsemblGenomes-Gn; EBG00001192855.
DR   EnsemblGenomes-Gn; EBG00001192856.
DR   EnsemblGenomes-Gn; EBG00001192857.
DR   EnsemblGenomes-Gn; EBG00001192858.
DR   EnsemblGenomes-Gn; EBG00001192859.
DR   EnsemblGenomes-Gn; EBG00001192860.
DR   EnsemblGenomes-Gn; EBG00001192861.
DR   EnsemblGenomes-Gn; EBG00001192862.
DR   EnsemblGenomes-Gn; EBG00001192863.
DR   EnsemblGenomes-Gn; EBG00001192864.
DR   EnsemblGenomes-Gn; EBG00001192865.
DR   EnsemblGenomes-Gn; EBG00001192866.
DR   EnsemblGenomes-Gn; EBG00001192867.
DR   EnsemblGenomes-Gn; EBG00001192868.
DR   EnsemblGenomes-Gn; EBG00001192869.
DR   EnsemblGenomes-Gn; EBG00001192870.
DR   EnsemblGenomes-Gn; EBG00001192871.
DR   EnsemblGenomes-Gn; EBG00001192872.
DR   EnsemblGenomes-Gn; EBG00001192873.
DR   EnsemblGenomes-Gn; EBG00001192874.
DR   EnsemblGenomes-Gn; EBG00001192875.
DR   EnsemblGenomes-Gn; EBG00001192876.
DR   EnsemblGenomes-Gn; EBG00001192877.
DR   EnsemblGenomes-Gn; EBG00001192878.
DR   EnsemblGenomes-Gn; EBG00001192879.
DR   EnsemblGenomes-Gn; EBG00001192880.
DR   EnsemblGenomes-Gn; EBG00001192881.
DR   EnsemblGenomes-Gn; EBG00001192882.
DR   EnsemblGenomes-Gn; EBG00001192883.
DR   EnsemblGenomes-Tr; APP7_r0001-1.
DR   EnsemblGenomes-Tr; APP7_r0002-1.
DR   EnsemblGenomes-Tr; APP7_r0003-1.
DR   EnsemblGenomes-Tr; APP7_r0004-1.
DR   EnsemblGenomes-Tr; APP7_r0005-1.
DR   EnsemblGenomes-Tr; APP7_r0006-1.
DR   EnsemblGenomes-Tr; APP7_r0007-1.
DR   EnsemblGenomes-Tr; APP7_r0008-1.
DR   EnsemblGenomes-Tr; APP7_r0009-1.
DR   EnsemblGenomes-Tr; APP7_r0010-1.
DR   EnsemblGenomes-Tr; APP7_r0011-1.
DR   EnsemblGenomes-Tr; APP7_r0012-1.
DR   EnsemblGenomes-Tr; APP7_r0013-1.
DR   EnsemblGenomes-Tr; APP7_r0014-1.
DR   EnsemblGenomes-Tr; APP7_r0015-1.
DR   EnsemblGenomes-Tr; APP7_r0016-1.
DR   EnsemblGenomes-Tr; APP7_tRNA01-1.
DR   EnsemblGenomes-Tr; APP7_tRNA02-1.
DR   EnsemblGenomes-Tr; APP7_tRNA03-1.
DR   EnsemblGenomes-Tr; APP7_tRNA04-1.
DR   EnsemblGenomes-Tr; APP7_tRNA05-1.
DR   EnsemblGenomes-Tr; APP7_tRNA06-1.
DR   EnsemblGenomes-Tr; APP7_tRNA07-1.
DR   EnsemblGenomes-Tr; APP7_tRNA08-1.
DR   EnsemblGenomes-Tr; APP7_tRNA09-1.
DR   EnsemblGenomes-Tr; APP7_tRNA10-1.
DR   EnsemblGenomes-Tr; APP7_tRNA11-1.
DR   EnsemblGenomes-Tr; APP7_tRNA12-1.
DR   EnsemblGenomes-Tr; APP7_tRNA13-1.
DR   EnsemblGenomes-Tr; APP7_tRNA14-1.
DR   EnsemblGenomes-Tr; APP7_tRNA15-1.
DR   EnsemblGenomes-Tr; APP7_tRNA16-1.
DR   EnsemblGenomes-Tr; APP7_tRNA17-1.
DR   EnsemblGenomes-Tr; APP7_tRNA18-1.
DR   EnsemblGenomes-Tr; APP7_tRNA19-1.
DR   EnsemblGenomes-Tr; APP7_tRNA20-1.
DR   EnsemblGenomes-Tr; APP7_tRNA21-1.
DR   EnsemblGenomes-Tr; APP7_tRNA22-1.
DR   EnsemblGenomes-Tr; APP7_tRNA23-1.
DR   EnsemblGenomes-Tr; APP7_tRNA24-1.
DR   EnsemblGenomes-Tr; APP7_tRNA25-1.
DR   EnsemblGenomes-Tr; APP7_tRNA26-1.
DR   EnsemblGenomes-Tr; APP7_tRNA27-1.
DR   EnsemblGenomes-Tr; APP7_tRNA28-1.
DR   EnsemblGenomes-Tr; APP7_tRNA29-1.
DR   EnsemblGenomes-Tr; APP7_tRNA30-1.
DR   EnsemblGenomes-Tr; APP7_tRNA31-1.
DR   EnsemblGenomes-Tr; APP7_tRNA32-1.
DR   EnsemblGenomes-Tr; APP7_tRNA33-1.
DR   EnsemblGenomes-Tr; APP7_tRNA34-1.
DR   EnsemblGenomes-Tr; APP7_tRNA35-1.
DR   EnsemblGenomes-Tr; APP7_tRNA36-1.
DR   EnsemblGenomes-Tr; APP7_tRNA37-1.
DR   EnsemblGenomes-Tr; APP7_tRNA38-1.
DR   EnsemblGenomes-Tr; APP7_tRNA39-1.
DR   EnsemblGenomes-Tr; APP7_tRNA40-1.
DR   EnsemblGenomes-Tr; APP7_tRNA41-1.
DR   EnsemblGenomes-Tr; APP7_tRNA42-1.
DR   EnsemblGenomes-Tr; APP7_tRNA43-1.
DR   EnsemblGenomes-Tr; APP7_tRNA44-1.
DR   EnsemblGenomes-Tr; APP7_tRNA45-1.
DR   EnsemblGenomes-Tr; APP7_tRNA46-1.
DR   EnsemblGenomes-Tr; APP7_tRNA47-1.
DR   EnsemblGenomes-Tr; APP7_tRNA48-1.
DR   EnsemblGenomes-Tr; APP7_tRNA49-1.
DR   EnsemblGenomes-Tr; APP7_tRNA50-1.
DR   EnsemblGenomes-Tr; APP7_tRNA51-1.
DR   EnsemblGenomes-Tr; APP7_tRNA52-1.
DR   EnsemblGenomes-Tr; APP7_tRNA53-1.
DR   EnsemblGenomes-Tr; APP7_tRNA54-1.
DR   EnsemblGenomes-Tr; APP7_tRNA55-1.
DR   EnsemblGenomes-Tr; APP7_tRNA56-1.
DR   EnsemblGenomes-Tr; APP7_tRNA57-1.
DR   EnsemblGenomes-Tr; APP7_tRNA58-1.
DR   EnsemblGenomes-Tr; APP7_tRNA59-1.
DR   EnsemblGenomes-Tr; APP7_tRNA60-1.
DR   EnsemblGenomes-Tr; APP7_tRNA61-1.
DR   EnsemblGenomes-Tr; APP7_tRNA62-1.
DR   EnsemblGenomes-Tr; EBT00001770671.
DR   EnsemblGenomes-Tr; EBT00001770672.
DR   EnsemblGenomes-Tr; EBT00001770673.
DR   EnsemblGenomes-Tr; EBT00001770674.
DR   EnsemblGenomes-Tr; EBT00001770675.
DR   EnsemblGenomes-Tr; EBT00001770676.
DR   EnsemblGenomes-Tr; EBT00001770677.
DR   EnsemblGenomes-Tr; EBT00001770678.
DR   EnsemblGenomes-Tr; EBT00001770679.
DR   EnsemblGenomes-Tr; EBT00001770680.
DR   EnsemblGenomes-Tr; EBT00001770681.
DR   EnsemblGenomes-Tr; EBT00001770682.
DR   EnsemblGenomes-Tr; EBT00001770683.
DR   EnsemblGenomes-Tr; EBT00001770684.
DR   EnsemblGenomes-Tr; EBT00001770685.
DR   EnsemblGenomes-Tr; EBT00001770686.
DR   EnsemblGenomes-Tr; EBT00001770687.
DR   EnsemblGenomes-Tr; EBT00001770688.
DR   EnsemblGenomes-Tr; EBT00001770689.
DR   EnsemblGenomes-Tr; EBT00001770690.
DR   EnsemblGenomes-Tr; EBT00001770691.
DR   EnsemblGenomes-Tr; EBT00001770692.
DR   EnsemblGenomes-Tr; EBT00001770693.
DR   EnsemblGenomes-Tr; EBT00001770694.
DR   EnsemblGenomes-Tr; EBT00001770695.
DR   EnsemblGenomes-Tr; EBT00001770696.
DR   EnsemblGenomes-Tr; EBT00001770697.
DR   EnsemblGenomes-Tr; EBT00001770698.
DR   EnsemblGenomes-Tr; EBT00001770699.
DR   EnsemblGenomes-Tr; EBT00001770700.
DR   EnsemblGenomes-Tr; EBT00001770701.
DR   EnsemblGenomes-Tr; EBT00001770702.
DR   EnsemblGenomes-Tr; EBT00001770703.
DR   EnsemblGenomes-Tr; EBT00001770704.
DR   EnsemblGenomes-Tr; EBT00001770705.
DR   EnsemblGenomes-Tr; EBT00001770706.
DR   EnsemblGenomes-Tr; EBT00001770707.
DR   EnsemblGenomes-Tr; EBT00001770708.
DR   EnsemblGenomes-Tr; EBT00001770709.
DR   EnsemblGenomes-Tr; EBT00001770710.
DR   EnsemblGenomes-Tr; EBT00001770711.
DR   EnsemblGenomes-Tr; EBT00001770712.
DR   EnsemblGenomes-Tr; EBT00001770713.
DR   EnsemblGenomes-Tr; EBT00001770714.
DR   EnsemblGenomes-Tr; EBT00001770715.
DR   EnsemblGenomes-Tr; EBT00001770716.
DR   EnsemblGenomes-Tr; EBT00001770717.
DR   EnsemblGenomes-Tr; EBT00001770718.
DR   EnsemblGenomes-Tr; EBT00001770719.
DR   EnsemblGenomes-Tr; EBT00001770720.
DR   EnsemblGenomes-Tr; EBT00001770721.
DR   EnsemblGenomes-Tr; EBT00001770722.
DR   EnsemblGenomes-Tr; EBT00001770723.
DR   EnsemblGenomes-Tr; EBT00001770724.
DR   EnsemblGenomes-Tr; EBT00001770725.
DR   EnsemblGenomes-Tr; EBT00001770726.
DR   EnsemblGenomes-Tr; EBT00001770727.
DR   EnsemblGenomes-Tr; EBT00001770728.
DR   EnsemblGenomes-Tr; EBT00001770729.
DR   EnsemblGenomes-Tr; EBT00001770730.
DR   EnsemblGenomes-Tr; EBT00001770731.
DR   EnsemblGenomes-Tr; EBT00001770732.
DR   EnsemblGenomes-Tr; EBT00001770733.
DR   EnsemblGenomes-Tr; EBT00001770734.
DR   EnsemblGenomes-Tr; EBT00001770735.
DR   EnsemblGenomes-Tr; EBT00001770736.
DR   EnsemblGenomes-Tr; EBT00001770737.
DR   EnsemblGenomes-Tr; EBT00001770738.
DR   EnsemblGenomes-Tr; EBT00001770739.
DR   EnsemblGenomes-Tr; EBT00001770740.
DR   EnsemblGenomes-Tr; EBT00001770741.
DR   EnsemblGenomes-Tr; EBT00001770742.
DR   EnsemblGenomes-Tr; EBT00001770743.
DR   EnsemblGenomes-Tr; EBT00001770744.
DR   EnsemblGenomes-Tr; EBT00001770745.
DR   EnsemblGenomes-Tr; EBT00001770746.
DR   EnsemblGenomes-Tr; EBT00001770747.
DR   EnsemblGenomes-Tr; EBT00001770748.
DR   EnsemblGenomes-Tr; EBT00001770749.
DR   EnsemblGenomes-Tr; EBT00001770750.
DR   EnsemblGenomes-Tr; EBT00001770751.
DR   EnsemblGenomes-Tr; EBT00001770752.
DR   EnsemblGenomes-Tr; EBT00001770753.
DR   EnsemblGenomes-Tr; EBT00001770754.
DR   EnsemblGenomes-Tr; EBT00001770755.
DR   EnsemblGenomes-Tr; EBT00001770756.
DR   EnsemblGenomes-Tr; EBT00001770757.
DR   EnsemblGenomes-Tr; EBT00001770758.
DR   EnsemblGenomes-Tr; EBT00001770759.
DR   EnsemblGenomes-Tr; EBT00001770760.
DR   EnsemblGenomes-Tr; EBT00001770761.
DR   EnsemblGenomes-Tr; EBT00001770762.
DR   EnsemblGenomes-Tr; EBT00001770763.
DR   EnsemblGenomes-Tr; EBT00001770764.
DR   EnsemblGenomes-Tr; EBT00001770765.
DR   EnsemblGenomes-Tr; EBT00001770766.
DR   EnsemblGenomes-Tr; EBT00001770767.
DR   EnsemblGenomes-Tr; EBT00001770768.
DR   EnsemblGenomes-Tr; EBT00001770769.
DR   EnsemblGenomes-Tr; EBT00001770770.
DR   EnsemblGenomes-Tr; EBT00001770771.
DR   EnsemblGenomes-Tr; EBT00001770772.
DR   EnsemblGenomes-Tr; EBT00001770773.
DR   EnsemblGenomes-Tr; EBT00001770774.
DR   EnsemblGenomes-Tr; EBT00001770775.
DR   EnsemblGenomes-Tr; EBT00001770776.
DR   EnsemblGenomes-Tr; EBT00001770777.
DR   EnsemblGenomes-Tr; EBT00001770778.
DR   EnsemblGenomes-Tr; EBT00001770779.
DR   EnsemblGenomes-Tr; EBT00001770780.
DR   EnsemblGenomes-Tr; EBT00001770781.
DR   EnsemblGenomes-Tr; EBT00001770782.
DR   EnsemblGenomes-Tr; EBT00001770783.
DR   EnsemblGenomes-Tr; EBT00001770784.
DR   EnsemblGenomes-Tr; EBT00001770785.
DR   EnsemblGenomes-Tr; EBT00001770786.
DR   EnsemblGenomes-Tr; EBT00001770787.
DR   EnsemblGenomes-Tr; EBT00001770788.
DR   EnsemblGenomes-Tr; EBT00001770789.
DR   EnsemblGenomes-Tr; EBT00001770790.
DR   EnsemblGenomes-Tr; EBT00001770791.
DR   EnsemblGenomes-Tr; EBT00001770792.
DR   EnsemblGenomes-Tr; EBT00001770793.
DR   EnsemblGenomes-Tr; EBT00001770794.
DR   EnsemblGenomes-Tr; EBT00001770795.
DR   EnsemblGenomes-Tr; EBT00001770796.
DR   EnsemblGenomes-Tr; EBT00001770797.
DR   EuropePMC; PMC2653537; 19239696.
DR   EuropePMC; PMC2849579; 20107095.
DR   EuropePMC; PMC2953695; 20802045.
DR   EuropePMC; PMC3146884; 21749728.
DR   EuropePMC; PMC3276438; 22240397.
DR   EuropePMC; PMC3497496; 23144372.
DR   EuropePMC; PMC3543445; 23326465.
DR   EuropePMC; PMC4064151; 24369182.
DR   EuropePMC; PMC4097740; 24759717.
DR   EuropePMC; PMC4624843; 26509499.
DR   EuropePMC; PMC5679336; 29122004.
DR   EuropePMC; PMC5901230; 29615241.
DR   EuropePMC; PMC6008488; 29885806.
DR   EuropePMC; PMC6202450; 30074474.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00022; GcvB.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00114; S15.
DR   RFAM; RF00127; t44.
DR   RFAM; RF00140; Alpha_RBS.
DR   RFAM; RF00168; Lysine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00240; RNA-OUT.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00514; His_leader.
DR   RFAM; RF01055; MOCO_RNA_motif.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01317; CRISPR-DR4.
DR   RFAM; RF01695; C4.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01989; SECIS_3.
DR   SILVA-LSU; CP001091.
DR   SILVA-SSU; CP001091.
XX
CC   Source DNA and bacteria are available from Gerald-F. Gerlach,
CC   email: gfgerlach@gmx.de.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2331981
FT                   /organism="Actinobacillus pleuropneumoniae serovar 7 str.
FT                   AP76"
FT                   /strain="AP76"
FT                   /mol_type="genomic DNA"
FT                   /serovar="7"
FT                   /db_xref="taxon:537457"
FT   gene            2..1486
FT                   /gene="dnaA"
FT                   /locus_tag="APP7_0001"
FT   CDS_pept        2..1486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="APP7_0001"
FT                   /product="chromosomal replication initiator protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60653"
FT                   /db_xref="GOA:B3GZJ1"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:B3GZJ1"
FT                   /protein_id="ACE60653.1"
FT                   /translation="MTDFLAEIFGSVNRTSGKFFRKIYKISTGFSGIITNLFHSFYSLE
FT                   QIVSSLWSDCLNHLQTKVSPTDYSTWLRPLQASFANGELTLYAQNQFVENWVKDKFLAE
FT                   IVDLARFLSKNNDLAVSIRVGIKPAEHRPVSPSTTSSNSKEEVPETNKNFRTGLNESLT
FT                   FENFVQGKSNQLAKAVAQQVADNPGESHCNPFSLYGGTGLGKTHLLHAVGNEILKRNPQ
FT                   ARVVYIHSERFVQDMVKALKGNTIENFKKFYRSLDVLMIDDIQFFANKEASQEEFFHTF
FT                   NSLFERNKQIILASDNFPKNIENIEERIKSRLSWGVSTAIEPPELETRVAILMKKAEER
FT                   GVELPEEVAFFIGQKLRTNVRELEGALNRVIAWRNFTKRQITIDAVREALKDLIASYDH
FT                   LITIENIQKTVAEYYNIKMSDLKSKSRTRSVARPRQMAMALAKELTNHSLPEIGREFGG
FT                   RDHTTVMHACKTINELRDTDSGIQEDYTNLTRKLSS"
FT   gene            1503..2606
FT                   /gene="dnaN"
FT                   /locus_tag="APP7_0002"
FT   CDS_pept        1503..2606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="APP7_0002"
FT                   /product="DNA polymerase III subunit beta"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60654"
FT                   /db_xref="GOA:B3GZJ2"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:B3GZJ2"
FT                   /protein_id="ACE60654.1"
FT                   /translation="MQFTITREQLLKPLQQVCGVLSSRPTLPVINNILLEIEGDRLSLT
FT                   GTDLEVELTTVATLEQAVDFAGKFTIPAKKFLDICRSLPEDSSISVQFEEDRALVRAAR
FT                   SKFNLATLPASDYPNLMDWKPEVDFSIEQSTLARLIDATQFSMANQDARYFLNGMKFET
FT                   EGNLLRTVATDGHRLAVCTMALNQELLTHSVIVPRKAVLELSRLVAVSDETVRLEIGTS
FT                   NLRVSMNGVVFTSKLIDGRFPDYRRVLPRNADRILEAETEVLKRALMRAAILSNEKFRG
FT                   VRLALSENLLKITANNPEQEEAEEIIDVAYQSPEMEVGFNVSYLLDVLNTLKCERVRFN
FT                   LVDASSSCLIEDCDNSTAEYVIMPMRL"
FT   gene            2940..4022
FT                   /gene="recF"
FT                   /locus_tag="APP7_0003"
FT   CDS_pept        2940..4022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="APP7_0003"
FT                   /product="DNA replication and repair protein RecF"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60655"
FT                   /db_xref="GOA:B3GZJ3"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3GZJ3"
FT                   /protein_id="ACE60655.1"
FT                   /translation="MPLSRLIINNFRNLQSLDLELSPNFNFIVGHNGSGKTSLLEAIFY
FT                   LGHGRSFKSHISNRIIHYQAEDFVLHARIDEGQHQWSVGIQKKRSGDTLLKINGEDGNK
FT                   ISDLAHLLPMQVITPEGLTLLNGGPTFRRAFLDWGLFHQYTEFYSCWANLKRLLKQRNA
FT                   ALHQVRSYAELKPWDIELAKLAEIVSQMRASYAEALRPEIEKTCQFFLPELEIGVSFHQ
FT                   GWEKGTDYAEILAQGFERDKAMGYTMIGPQKADFRFRANGLPVEDVLSRGQLKLLMCVL
FT                   RLAQGEYLVAQKERQCLFLIDDFASELDPIKRELLAHRLRESGSQVFVTAITKDQLNQM
FT                   QWQESEQDSLFQVQQGMLTK"
FT   gene            complement(4078..4650)
FT                   /gene="sodC"
FT                   /locus_tag="APP7_0004"
FT   CDS_pept        complement(4078..4650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sodC"
FT                   /locus_tag="APP7_0004"
FT                   /product="superoxide dismutase [Cu-Zn] precursor"
FT                   /EC_number="1.15.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60656"
FT                   /db_xref="GOA:B3GZJ4"
FT                   /db_xref="InterPro:IPR001424"
FT                   /db_xref="InterPro:IPR018152"
FT                   /db_xref="InterPro:IPR024134"
FT                   /db_xref="InterPro:IPR036423"
FT                   /db_xref="UniProtKB/TrEMBL:B3GZJ4"
FT                   /protein_id="ACE60656.1"
FT                   /translation="MKLTNLALAFTLFGASAVAFAHADHDHKKADNSAVEKLVVQVQQL
FT                   DPVKGNKDVGTVEITESAYGLVFTPHLHGLAQGLHGFHIHQNPSCEPKEKDGKLVAGLG
FT                   AGGHWDPKETKQHGYPWSDNAHLGDLPALFVEHDGSATNPVLAPRLKKLDEVKGHSLMI
FT                   HEGGDNHSDHPAPLGGGGPRMACGVIK"
FT   gene            4833..5945
FT                   /gene="asd"
FT                   /locus_tag="APP7_0005"
FT   CDS_pept        4833..5945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="asd"
FT                   /locus_tag="APP7_0005"
FT                   /product="Aspartate-semialdehyde dehydrogenase Asd"
FT                   /EC_number="1.2.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60657"
FT                   /db_xref="GOA:B3GZJ5"
FT                   /db_xref="InterPro:IPR000319"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR011534"
FT                   /db_xref="InterPro:IPR012080"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B3GZJ5"
FT                   /protein_id="ACE60657.1"
FT                   /translation="MQNVGFIGWRGMVGSVLMDRMVQENDFANINPIFFTTSQAGQKAP
FT                   VFAGKDAGELKNAFDIEELKKLDIIVTCQGGDYTNEVYPKLKATGWNGYWIDAASTLRM
FT                   EKDAIIVLDPVNQHVISEGLKNGIKTFVGGNCTVSLMLMAIGGLFEKDLVEWVSVATYQ
FT                   AASGAGAKNMRELLSQMGELEASVKAELANPASSILEIERKVTAKMREDSFPTDNFGAP
FT                   LAGSLIPWIDKLLESGQTKEEWKGYAETNKILGLSDNPIPVDGLCVRIGALRCHSQAFT
FT                   IKLKKDLPLAEIEQIIAAHNEWVKVIPNDKETTLRELTPAKVTGTLSVPVGRLRKLAMG
FT                   PEYLAAFTVGDQLLWGAAEPVRRILVQLTK"
FT   gene            complement(6072..7202)
FT                   /gene="ompP2A"
FT                   /locus_tag="APP7_0006"
FT   CDS_pept        complement(6072..7202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ompP2A"
FT                   /locus_tag="APP7_0006"
FT                   /product="outer membrane protein P2"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60658"
FT                   /db_xref="GOA:B3GZJ6"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:B3GZJ6"
FT                   /protein_id="ACE60658.1"
FT                   /translation="MKKTALALLASAFVASSASAVELFNLDSTGTKAEFIGSARLKWTS
FT                   TSTKDTYQNGAAIRNHVNKPVQNNGSRFGFRLTQQLGSGFYALGRAEWRLRGADERGVS
FT                   SSQHDLDHIYAHQLYAGLGHKQYGEVTYGNQTVITDEVKQTDIPNTLSLSDGLLVSGAR
FT                   RSVQYVYKGIEGLKVGAYYGGHSQRSNTNMDLSQDRKDVWGFGSIYNHKFDDVQSVQVA
FT                   TGFSRERFERIGSAPAYDRNAYSVGAAYTYDKTTFGVDLERRKTEDQSVQGNERTEKEV
FT                   RTLVYHRLTDDWRAYGMYAYKTNRLERAIGRDNNERKHQFMVGTEYYLPKVVDQLKTKL
FT                   FVEWQATRTKHPEAKVARGVNKSRDYTTVVGFRAYW"
FT   gene            7347..8528
FT                   /gene="lpxB"
FT                   /locus_tag="APP7_0007"
FT   CDS_pept        7347..8528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxB"
FT                   /locus_tag="APP7_0007"
FT                   /product="Lipid-A-disaccharide synthase"
FT                   /EC_number="2.4.1.182"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60659"
FT                   /db_xref="GOA:B3GZJ7"
FT                   /db_xref="InterPro:IPR003835"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3GZJ7"
FT                   /protein_id="ACE60659.1"
FT                   /translation="MIKKEAPLIALVAGEISGDILGAGLINALKLHYPNARFIGVAGPR
FT                   MIQAGCETLFDMEELAVMGLAEVVKHLPRLLKRRKQVIETMLAEKPDIFIGIDAPDFNL
FT                   TVEEKLKASGIKTIHYVSPSVWAWRQNRVQKIARATNLVLAFLPFEKAFYDRFNVPCRF
FT                   IGHTMADAIALKPNRSEACATLNLDETQRYLAILVGSRASEVRFLAEPFLKAAKILKQQ
FT                   YPDLQFLVPLVNDKRIAQFEQIKAQVAPELSVHILKGNARQAMIAAEASLLASGTAALE
FT                   GMLCKSPMVVGYKMKAMTYWLAKRLVKTKYISLPNLLADEMLVPELIQDECNPENLAWY
FT                   LGNYLADDADHRKQRNELKQRFTELHKLIQCDADAQAAQAVVDVLEANTSDQN"
FT   gene            8558..9613
FT                   /gene="sohB"
FT                   /locus_tag="APP7_0008"
FT   CDS_pept        8558..9613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sohB"
FT                   /locus_tag="APP7_0008"
FT                   /product="putative protease SohB"
FT                   /EC_number="3.4.21.-"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60660"
FT                   /db_xref="GOA:B3GZJ8"
FT                   /db_xref="InterPro:IPR002142"
FT                   /db_xref="InterPro:IPR013703"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:B3GZJ8"
FT                   /protein_id="ACE60660.1"
FT                   /translation="MWKEILLNYGIFLLELLTLFGIVAVVVMLILEARKQPESGAISIT
FT                   NLTEKYQEQQKSLANFFLSEEAQKQAEKAEKKAAKEKAKAEKKRLKELGEQGEEAPKSR
FT                   LFVLNFTGDVQAHAVSSLRREIDAVISLANKEDEVLLRLESPGGVVHGYGLAASQLQRL
FT                   RTHNIPLTVAVDKVAASGGYMMACVANKIVAAPFAIIGSVGVVAQVPNIHRLLKKHEID
FT                   VDVMTAGEYKRTVTLVGENTEKGKQKFQQELEETHQLFKQFVAQNRPQLDIEKIATGEH
FT                   WFGKQALALDLVDEINTSDDLLLNAIKEKEVIELKFKQKKNLTQRLGEQVELSVENVIA
FT                   KLLHKQRSNMM"
FT   gene            9849..10307
FT                   /locus_tag="APP7_0009"
FT   CDS_pept        9849..10307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0009"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60661"
FT                   /db_xref="GOA:B3GZJ9"
FT                   /db_xref="InterPro:IPR003444"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR020603"
FT                   /db_xref="InterPro:IPR035642"
FT                   /db_xref="InterPro:IPR035644"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR038619"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3GZJ9"
FT                   /protein_id="ACE60661.1"
FT                   /translation="MFRGVTSISIDNKGRIAIPTRYRAELREQHEGVLVCTVDIRQPCL
FT                   LLYPLHEWETVEQKLLALSNFEPMQRRIQRVMQGFATECEMDAAGRILLSPTLRQHAQL
FT                   EQQIMLVGQLNKFEIWQDKQWQSQIAEDLALGGSAEMLNCEALKNLSL"
FT   gene            10333..11274
FT                   /gene="mraW"
FT                   /locus_tag="APP7_0010"
FT   CDS_pept        10333..11274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mraW"
FT                   /locus_tag="APP7_0010"
FT                   /product="S-adenosyl-methyltransferase MraW"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60662"
FT                   /db_xref="GOA:B3GZK0"
FT                   /db_xref="InterPro:IPR002903"
FT                   /db_xref="InterPro:IPR023397"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3GZK0"
FT                   /protein_id="ACE60662.1"
FT                   /translation="MNDTVHKHITVLLHEAVDGLAIKPSGIYIDGTFGRGGHSRLILSK
FT                   LSEQGRLIATDRDPRAIAEANTIDDTRFQIVHTAFSAIPDVCEQLGLTGKIDGILLDLG
FT                   VSSPQLDDAERGFSFMRDGPLDMRMDTTKGLSAAEWLAQVSADDLAWVLKTFGEERFAK
FT                   RIAQAVVSYNKSATDKISRTLQLAQIIADAVPFKDKHKHPATRSFQAIRIFINSELDEL
FT                   EKALQSALSVLAPEGRLSIISFHSLEDRMVKQFMKKNSKGMDVPKGLPILESELNKNIP
FT                   LKIIGKAIMPSEAEIEANPRSRSAVLRIAEKR"
FT   gene            11287..11601
FT                   /gene="ftsL"
FT                   /locus_tag="APP7_0011"
FT   CDS_pept        11287..11601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsL"
FT                   /locus_tag="APP7_0011"
FT                   /product="cell division protein FtsL"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60663"
FT                   /db_xref="GOA:B3GZK1"
FT                   /db_xref="InterPro:IPR011922"
FT                   /db_xref="UniProtKB/TrEMBL:B3GZK1"
FT                   /protein_id="ACE60663.1"
FT                   /translation="MASNERYPLHQIILDDLTAHNKVALILIIAVVATAIGTIWITHQT
FT                   RLLTAEQGKLVQAQRKLENQYIHLQLEENAKSQKSRVEAAAASFGLQSIKKEQEVILVE
FT                   "
FT   gene            11605..13665
FT                   /gene="ftsI"
FT                   /locus_tag="APP7_0012"
FT   CDS_pept        11605..13665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsI"
FT                   /locus_tag="APP7_0012"
FT                   /product="peptidoglycan synthetase FtsI"
FT                   /EC_number="2.4.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60664"
FT                   /db_xref="GOA:B3GZK2"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="InterPro:IPR037532"
FT                   /db_xref="UniProtKB/TrEMBL:B3GZK2"
FT                   /protein_id="ACE60664.1"
FT                   /translation="MAKSVKLKRKPVAIEPNTEVKKQTNTKNEPSYLPIRFGVVGFFIL
FT                   VMAGMLIAKAAHIQLFDSERLINEANNRSLRTKELPFTRGRILDRNGRFLSISVPMYSL
FT                   TLDPREYFDSKLRRSPERWKLLAMEMGASKSKIEKNVNDFIEKKNTSKEKVAFDPRSIL
FT                   NTKSEDYWTLLAQSTGLDYNTLIQSVRNNPSSAFLMQEISASQLERSKLEAIAKATGEK
FT                   YNDLMARLYKASRQRFIYIARHEPESIANYAQELKIDGMVLKAESRRFYPLAEEASQLI
FT                   GFTDIDDVHGTEGLERSFDSLLIGKNGRQVIRKDARGNVIENIRDEKQYDPQDVMLSID
FT                   EELQSEVYKKIKEAVIANNAESGTAVLVDVQTGEILAMANAPSFNPNKRDSFKPELMRN
FT                   RAITDTFEPGSTVKPLVVLTALQNGATYRDEVINTRPFVVNGHTIKDVAPRESLSLTGI
FT                   LQKSSNIGVSRLALRMPSTALVDTYSKVGFGKDTGLGLGEQKGTNGDRKRWSDIERATM
FT                   AYGYGLNITPLQLARAYATLGSFGIYRPLSITKVDPPVIGERVLPEKITRDVVHMMESV
FT                   AQKGEGGQKAMVEGYRVAVKTGTARKLEKGQYVEKYIAYTAGVVPASDPRFALVVLINE
FT                   PKAGQYYGGSVSAPLFSSIMGYTLKTRNIKPDNLTDTESAVREIKLEQKVN"
FT   gene            13689..15191
FT                   /gene="murE"
FT                   /locus_tag="APP7_0013"
FT   CDS_pept        13689..15191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murE"
FT                   /locus_tag="APP7_0013"
FT                   /product="UDP-N-acetylmuramyl-tripeptide synthetase"
FT                   /EC_number="6.3.2.13"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60665"
FT                   /db_xref="GOA:B3GZK3"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005761"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:B3GZK3"
FT                   /protein_id="ACE60665.1"
FT                   /translation="MKRLLPFLTELDAWVTELKPLKQMTLDSRQVDEGDLFVALKGHQV
FT                   DGRRFIQKAIEQGAALVLAEADEGQDEIELDAKFAKYNLDRTACKVVLVPNLARILSEI
FT                   AGAFYANPSEKLTLVGVTGTNGKTTSAQLLAQWHNLLGGKSAVMGTIGNGLYGKVQEAA
FT                   NTTGSAIEVQRNLADFVEMGADFCAMEVSSHGLAQYRAEALSYDLAVFTNLSRDHLDYH
FT                   KTMEEYAQAKFRLFSELDTKAQVLNADDEVGREWLAKLPDAVAVSTDASFSSEHKFVKA
FT                   TDVSFSLQGVKIAFESSWGNGELNSRLIGAFNVNNLLTALAGLLVLGHDLPKLIETAPL
FT                   LQGVAGRMECVVSQKNPQNRPLVLVDYAHTPDALEKALQAARLHTEGELYCIFGCGGDR
FT                   DAGKRPMMAAIAEELADKVIATDDNPRTEDNAKIMADILNGFVQVEKVQVIHDREQAIK
FT                   TAIEQANEKDVILIAGKGHEDYQIIGTTKHHFSDQETAAKYL"
FT   gene            15406..16800
FT                   /gene="murF"
FT                   /locus_tag="APP7_0014"
FT   CDS_pept        15406..16800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murF"
FT                   /locus_tag="APP7_0014"
FT                   /product="UDP-MurNAc-pentapeptide synthetase"
FT                   /EC_number="6.3.2.10"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60666"
FT                   /db_xref="GOA:B3GZK4"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005863"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:B3GZK4"
FT                   /protein_id="ACE60666.1"
FT                   /translation="MIKLTTNEIAGILNAQLIGDGNVLVETTSTDTRQAVENGLFFALK
FT                   GENFDAHHYLANAVEQGSVAVVVERECEISVPQIVVKDTRLALGELAKWLKAKLNPKTV
FT                   AMTGSSGKTTVKEMTAKILQKMTACEDEVLYTFGNLNNDLGVPMTLLRLTPQHKFAVVE
FT                   LGANHIGEIAYTTEITQPDACLVNNVAAAHLEGFGSLEGVAQAKGEIYRGLKAGGKAIV
FT                   NQAFYYPQWQKEIGEHELQSFSYIGSDQDSYADFWAENVELGLAGSRFTLHSPQGEIEI
FT                   NLPYLGAHNISNALAATSLSMAVGADLQAVKSGLEQRSQVKGRLYPVEVNDHCLFIDDT
FT                   YNANVDSMKSAVSVLKNYPAFRIFAVGDMAELGGESEACHQQVADFVREANLDLVVSFG
FT                   KQSAVISHDTAHHFTDKQAMHDFLLPIISQKIAEKQPLVLLAKGSRSQKMETLISALCL
FT                   SLGVSF"
FT   gene            16897..17979
FT                   /gene="mraY"
FT                   /locus_tag="APP7_0015"
FT   CDS_pept        16897..17979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mraY"
FT                   /locus_tag="APP7_0015"
FT                   /product="phospho-N-acetylmuramoyl-pentapeptide-transferase"
FT                   /EC_number="2.7.8.13"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60667"
FT                   /db_xref="GOA:B3GZK5"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR003524"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3GZK5"
FT                   /protein_id="ACE60667.1"
FT                   /translation="MLVWLAEYLVQYNTAFNVVSYITFRAIMALLTAMGIGLWIGPEVI
FT                   RRLQLLKFGQEVRNDGPESHFKKRGTPTMGGIMILIAIGVSTLLWADLRNSYVWFVLFV
FT                   LFGYGAVGFVDDYWKIKRKNTDGLIARWKYFWLSVIALIAVFGIYAVGKDTAATQLVVP
FT                   FFKEFMPQLGIFFIILSYFVIVGTSNAVNLTDGLDGLAIVPTIMVASAFALIAWATGNF
FT                   NFAQYLHIPFVPNAGELVILCTAIVGAGLGFLWYNTYPAQVFMGDVGSLSLGGALGTIA
FT                   VLVRQELLLVIMGGVFVVEALSVILQVGSYKLRQKRIFRMAPIHHHFELKGWPEPRVIV
FT                   CFWIITLMLVLIGLVTLKLR"
FT   gene            18063..19373
FT                   /gene="murD"
FT                   /locus_tag="APP7_0016"
FT   CDS_pept        18063..19373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murD"
FT                   /locus_tag="APP7_0016"
FT                   /product="UDP-N-acetylmuramoyl-L-alanyl-D-glutamatesynthetase"
FT                   /EC_number="6.3.2.9"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60668"
FT                   /db_xref="GOA:B3GZK6"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005762"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:B3GZK6"
FT                   /protein_id="ACE60668.1"
FT                   /translation="MQNQYKDKVITVIGLGKTGLSCVEFLADKQAKVQVIDTRETPAGA
FT                   DQLPADVPLHTGGLNSEWLLASDLIVISPGLALATPEIQQAINAGMEVVGDIELFVREA
FT                   KAPIIAITGANGKSTVTTLVTEMAKQAGIKVGMGGNIGVPVLSLLNDEYELFVLELSSF
FT                   QLETTSSLNAVAATILNISEDHMDRYNNSLEEYRLAKLRIYDNAENVIVNGEDRLTYPL
FT                   ETQAVKKLIRFAEHNAEYTMRNGILYSGDDAIIPTKEMLISGRHNEMNSLAAMALAEAA
FT                   GIPREGIVKALQMYGGLNHRFQAVKTNDGVRWVNDSKATNVGSTVAALNGLQVAGTLYL
FT                   LLGGDGKAADFSELKPLINKPNIVCYCFGQDGAQLAALSSQSVLVETMQQAIEQIRPQL
FT                   KKGDMVLLSPACASLDQFKNFEERGQVFVKLAQEVTA"
FT   gene            19375..20553
FT                   /gene="ftsW"
FT                   /locus_tag="APP7_0017"
FT   CDS_pept        19375..20553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsW"
FT                   /locus_tag="APP7_0017"
FT                   /product="cell division protein FtsW"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60669"
FT                   /db_xref="GOA:B3GZK7"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR013437"
FT                   /db_xref="InterPro:IPR018365"
FT                   /db_xref="UniProtKB/TrEMBL:B3GZK7"
FT                   /protein_id="ACE60669.1"
FT                   /translation="MLERLKTEWDKWVRLTPANSLYDRTLLWLFFGLLVIGFIMVTSAS
FT                   IPVSTRLNNDPFYFAVRDGVYLAAALFAFVTIVQIPTESWEKRNVLFFLVSLAFLVIVL
FT                   IFGRSINGAVRWIPLGPVNFQPAELAKLAIICYFSSFYVRKYDEMRTKRLSFIRPMVIL
FT                   SIFGFLLLLQPDLGSTFVLFMLTFAMLFIMGARVMQFLFLGVTGILLFAFLVLTSEYRL
FT                   KRVTSFMDPFADAYGDGFQLSNSQMAFGQGEFWGQGLGNSIQKLEYLPEAHTDFVMAVV
FT                   GEEFGFIGIVAIVILLSVLSLRALKISRDALKLEARFRGFFAFGIAIWIFIQGFVNLGV
FT                   ASGLLPTKGLTFPLVSYGGSSLVIMSIAIAVLLRIDYENRLELVGHAQIKES"
FT   gene            20708..21763
FT                   /gene="murG"
FT                   /locus_tag="APP7_0018"
FT   CDS_pept        20708..21763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murG"
FT                   /locus_tag="APP7_0018"
FT                   /product="UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide)
FT                   pyrophosphoryl-undecaprenol N-acetylglucosamine
FT                   transferase"
FT                   /EC_number="2.4.1.227"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60670"
FT                   /db_xref="GOA:B3GZK8"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="InterPro:IPR006009"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3GZK8"
FT                   /protein_id="ACE60670.1"
FT                   /translation="MAKKLLVMAGGTGGHVFPAIAVARELQKQGWEIRWLGTKDRMEAD
FT                   LVPKHGIPIEFIQISGLKGKGIGALLKAPFAIFKAVMQARKIIKNYQPDAVLGMGGYVS
FT                   GPGGIAAKLCGVPVILHEQNAVAGLTNVWLSKIACRVLQAFPTAFPNAEVVGNPVREDL
FT                   AQLEAPEIRFAERGYPINILVMGGSQGARVINQTVPEVAKQLGNNVFISHQVGKGNLGG
FT                   VEEIYQATGNGIAAEFIDDMAQAYSWADLVICRSGALTVCEIAAAGLPAIFVPYQHKDR
FT                   QQYLNATYLADGGAAIIIEQQDFTPQTLLNVLQPLIADRRKLTEMAVKARAKATPTAAQ
FT                   RVAEVIIEQAK"
FT   gene            21815..23242
FT                   /gene="murC"
FT                   /locus_tag="APP7_0019"
FT   CDS_pept        21815..23242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murC"
FT                   /locus_tag="APP7_0019"
FT                   /product="UDP-N-acetylmuramate--L-alanine ligase"
FT                   /EC_number="6.3.2.8"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60671"
FT                   /db_xref="GOA:B3GZK9"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005758"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3GZK9"
FT                   /protein_id="ACE60671.1"
FT                   /translation="MKNFQDKIKKLVPEMRRVNQIHFIGIGGAGMSGIAEVLLNEGYQI
FT                   SGSDIAEGPVTKRLAEAGAKVFIGHQAENVAGASVVVASSAIDDSNPEVRAAKEARIPV
FT                   IQRAQMLAEIMRFRHGIAVAGTHGKTTTTAMISMIYTEAKLDPTFVNGGLVKSAGKNAH
FT                   LGASRYLIAEADESDASFLHLQPMVSVVTNIEPDHMDTYGGDFEQMKATYVKFLRNLPF
FT                   YGLAVMCADDETVMEIAPQVGRQVLTYGFSEKADYRIEDYQQTGFQGHYTVVCPNGERI
FT                   DVLLNVPGKHNALNATAALAVAKEEGIANEAILAALADFQGAGRRFDQLGSFIRPNGKV
FT                   MLVDDYGHHPTEVDVTIKAARSGWENKRVVMIFQPHRYSRTRDLFDDFVQVLSQVDALI
FT                   MLEVYAAGEAPIVGADSKALCRSIRNLGKVDPILVSDTDQLGEVLDQIIQDGDLILAQG
FT                   AGSVSRISRGLAESWKA"
FT   gene            23350..24261
FT                   /gene="ddlB"
FT                   /locus_tag="APP7_0020"
FT   CDS_pept        23350..24261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ddlB"
FT                   /locus_tag="APP7_0020"
FT                   /product="D-alanine--D-alanine ligase"
FT                   /EC_number="6.3.2.4"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60672"
FT                   /db_xref="GOA:B3GZL0"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3GZL0"
FT                   /protein_id="ACE60672.1"
FT                   /translation="MSIKDEKIAVLFGGVSQEREVSLNSGAAVTEALKSLGYNVEGIDT
FT                   KDFPIEKLKEKGIQRVFNILHGGIGENGVLQGALEQMGIPYTGCGVMASAVTLDKFRTK
FT                   LMWQAVGLPTADMVVVRRGEAVDSEQIIAKLGLPVFVKPSSEGSSVGVTKVKTVEQLLP
FT                   AVEEALKFDSIVLVEAFLAGKEYSVPVLDGQVLPAVQIIPEGEFYDYHAKYISDNTQYL
FT                   VPALSDDRQAEVAELVKAAYEVVGCRGWSRIDVMEDANGHFNLVEVNTCPGMTSHSIFP
FT                   KSAATVGIPFEKLVERVLELSA"
FT   gene            24261..25055
FT                   /gene="ftsQ"
FT                   /locus_tag="APP7_0021"
FT   CDS_pept        24261..25055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsQ"
FT                   /locus_tag="APP7_0021"
FT                   /product="cell division protein FtsQ"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60673"
FT                   /db_xref="GOA:B3GZL1"
FT                   /db_xref="InterPro:IPR005548"
FT                   /db_xref="InterPro:IPR013685"
FT                   /db_xref="InterPro:IPR026579"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="UniProtKB/TrEMBL:B3GZL1"
FT                   /protein_id="ACE60673.1"
FT                   /translation="MVSVLRKKTAQSVRFKPLKVRSSLNPFNRIVLIKPLIVLLCVIFA
FT                   FLVYSNWHTWLESLDRSPIRAYALTHKTRFTTNADIRETLSQKPALKGYFGQDIQDVKA
FT                   KLLAISWVRDVVVRKVYPDRLSITLIEHNPVAVWNDVNFLSEQGIVFSLPPDRIDKTGF
FT                   PMLYGPDTEGKVVLEAWSKIKADLKARNLDLSSVSVDNRGSWTITLSNNVELRLGRGEW
FT                   TPKIDRFVTIFPEIDVPEGKKLAYVDLRYEHGAAVGFSPLPK"
FT   gene            25081..26355
FT                   /gene="ftsA"
FT                   /locus_tag="APP7_0022"
FT   CDS_pept        25081..26355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsA"
FT                   /locus_tag="APP7_0022"
FT                   /product="cell division protein FtsA"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60674"
FT                   /db_xref="GOA:B3GZL2"
FT                   /db_xref="InterPro:IPR003494"
FT                   /db_xref="InterPro:IPR020823"
FT                   /db_xref="UniProtKB/TrEMBL:B3GZL2"
FT                   /protein_id="ACE60674.1"
FT                   /translation="MTKIAESKIIVGLDIGTSKVVAVVGEVLPDGVINVIGSGSCPAKG
FT                   VDRGGVIDLDAAVNSIQRAIEQAESVSDCQIIGVTLAISGQHITALNESGTVPLSGTVT
FT                   NEDIDAAIHIARSIKLPDGLETLHIIPQEYKVDRLPATKNPVGLSGMRLQAQAHIIACH
FT                   QDWLRNLKNAVERAKLKVDQVVFSGLASSYSVLTEDEKELGVCLIDIGGGTMDILVYTD
FT                   GALRFSKVIPFAGNNVTDYIAQVFTTSRNEAESIKINYGSAVNPPTHNADKKIEVAGLG
FT                   GRMPRTFTKAQVATVTSQCYSDLLKVVENELVQLRHELLQKGIKQELIAGFVLTGGGSQ
FT                   IEDIVECAREIFGSQVRVGYPLNITGLTDYVNKPQYATVLGLLQYSHYNSDEKGNGEIS
FT                   EKVDSILDILSRGLKKVVNVARSNF"
FT   gene            26394..27605
FT                   /gene="ftsZ"
FT                   /locus_tag="APP7_0023"
FT   CDS_pept        26394..27605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsZ"
FT                   /locus_tag="APP7_0023"
FT                   /product="cell division protein FtsZ"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60675"
FT                   /db_xref="GOA:B3GZL3"
FT                   /db_xref="InterPro:IPR000158"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR018316"
FT                   /db_xref="InterPro:IPR020805"
FT                   /db_xref="InterPro:IPR024757"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="UniProtKB/TrEMBL:B3GZL3"
FT                   /protein_id="ACE60675.1"
FT                   /translation="MFEPIYETTQDAVIKVVGVGGGGGNALNHMVDGNLNNEGVGGVEF
FT                   FSVNTDAQVLRTSSVRQTIQIGANITKGLGAGANPNVGRQAAEEDREALSNMLAGADMV
FT                   FISAGMGGGTGTGAAPVIADIAKSQGSLTVAIVTKPFRFEGNKRMNYAEQGIQELSKHV
FT                   DSLIIIPNDKLLKVLPKNTKMMDAFKAANDILRNAVLGITDMITSPGLINVDFADVKTV
FT                   MSEMGRAMMGTGIAEGEDRAEHAAHDAVASPLLEDVDLSGAKGILVSISSGLDIELNEV
FT                   DVIMDYIHSFAAPDATIVFGTSVYPEMEGKLRVTLVATGIGQAEELTLPRATVVPQQMQ
FT                   QPMQQQSYQQQAQQPQQPAFAQQGYAQPAQFAQPQQAAPKPQQVDSSQVWSPNSIPGFM
FT                   RNGQ"
FT   gene            27639..28559
FT                   /gene="lpxC"
FT                   /locus_tag="APP7_0024"
FT   CDS_pept        27639..28559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxC"
FT                   /locus_tag="APP7_0024"
FT                   /product="UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine
FT                   deacetylase"
FT                   /EC_number="3.5.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60676"
FT                   /db_xref="GOA:B3GZL4"
FT                   /db_xref="InterPro:IPR004463"
FT                   /db_xref="InterPro:IPR011334"
FT                   /db_xref="InterPro:IPR015870"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3GZL4"
FT                   /protein_id="ACE60676.1"
FT                   /translation="MIKQRTLKQATKVTGIGLHSGKKVTLTLRPAPANTGIVYARTDLE
FT                   PAVYFPASAESIRDTQLCTCMINDDGVRISTVEHLNAAMASLGLDNLIVEVDAPEIPIM
FT                   DGSASPFIYLLLDAGIEEQDAPKKFIRIRETVRVEEGDKWAEMKPYSKGLKLDFTIDFS
FT                   HPMISKDVRNFKMELSAENFIHKISRARTFTFMKDVEYLQSIGLALGGSLDNAIVLDKY
FT                   RILNEEGLRYKDELVKHKMLDSIGDLFMCGYNILGDFSAYKSGHGLNNKLLRAILANEN
FT                   AWEFVTFEDKEQAPEGYRIGEQVFI"
FT   gene            28721..30394
FT                   /gene="recN"
FT                   /locus_tag="APP7_0025"
FT   CDS_pept        28721..30394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recN"
FT                   /locus_tag="APP7_0025"
FT                   /product="DNA repair protein RecN"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60677"
FT                   /db_xref="GOA:B3GZL5"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR004604"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3GZL5"
FT                   /protein_id="ACE60677.1"
FT                   /translation="MLTHLTVNNFAIVRHLTLELNEGMSVITGETGAGKSIAIDALSLC
FT                   LGYRSESSMIRHGADKADITATFSMQATSPAYLWLKQHELLDEDNPQECILRRMINQEG
FT                   RSKAFVNNRPLPISQLRELGQYLIHLNGQHAPQLLLKSEYQLEVLDNYAGIHNLLNEMS
FT                   SQYQRWKKLHQQVKNFRQQCQENEAREQLLQYQVDELDEFAIKQGEFEEMEETHSRLSN
FT                   SEALTALSQEVTDLLSESELNVDSMLYKAIRHLEDLVEVDSRYQSALNMLNESLIQVQE
FT                   ASSDVSDLAGKIEQDPDLLNELDIRISKTLQLARKHHVLPENLWQHHEFIQQELQKLVD
FT                   FAGNEEQLIADEQAAHQQSIQLAEQIYQKRLEAGKKLAEQVTAQIKRLSMENGEFFIDV
FT                   QHDAKRLSSNGADVVEFNLRSNLGQQAQPLAKIASGGELSRISLAVQVLTANELSTPTI
FT                   IFDEVDVGISGLTATTVGKLLRQLGKKCQVLCVTHLPQVASYGHHHFNVQKYVENNQTE
FT                   TQMSLLTQAERVQALARLLGGSKITDTVLANAQEMLDLVE"
FT   gene            complement(30536..31939)
FT                   /locus_tag="APP7_0026"
FT   CDS_pept        complement(30536..31939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0026"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60678"
FT                   /db_xref="GOA:B3GZL6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3GZL6"
FT                   /protein_id="ACE60678.1"
FT                   /translation="MALLRIENVGVKTTTGLTLVEPISLSLEQGKNITILGETGSGKSL
FT                   LIQAIMGALPEGLEASGQIFVENSKTENMQLESLWGRTLVMLPQEPRRSLDPIMTIGKQ
FT                   LWESFTFVAKKDKQAAKNEGKKALEHLGLKAWETAYPHQLSGGMAQRASFAVATAAGGK
FT                   ILLADEPTKGLDPKSKANVIQLLKQAYQQQGGLLTITHDIDVAEQLGGEILVMKKGQLL
FT                   EKGAAETLLADPQHPYTKALIAADPIHWQAVENSQNFAKNQPLVSVKNLSVARGKRTLF
FT                   SGLSFGLHQGEILGVVGHSGIGKSTLADVLCGLLKPKSGEVIWHSRQHKKHQVLKLYQD
FT                   PPEAFAPTVSLQTLLDDVINKHKLDRSQIPTLLQQLALAPEILARNAENVSGGELQRVA
FT                   ILRALLLEPVLLFADEVTSRLDPITQKETIELLINQCRQRKCALVIVSHDPYLIEKSCD
FT                   KVIDLTQFV"
FT   gene            complement(31939..32724)
FT                   /locus_tag="APP7_0027"
FT   CDS_pept        complement(31939..32724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0027"
FT                   /product="nickel transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60679"
FT                   /db_xref="GOA:B3GZL7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B3GZL7"
FT                   /protein_id="ACE60679.1"
FT                   /translation="MNKMTFSQKIGAIILTILLAFAFLQPYFYPMDIGFQDLGNMLAKP
FT                   DEFAWLGTDHLGRDMLARLASAIRLSFGLSLFSVFCALVAGLLFGILAGFFGGWLDRLF
FT                   SFICDLVMALPGLLLILLFASLSPGSFWTLYLGIALVMWVEFFRVIRAVSQTLASSAEI
FT                   ESSRLMGMGLFYSFKRHLLPRLLPLIVTLSAFSLGNAILALATLGFVNVGLRPPTAELG
FT                   LMMTELFPYYYEAPWIFMQPVVAVFFMVLSLQLLSGRVK"
FT   gene            complement(32727..33674)
FT                   /locus_tag="APP7_0028"
FT   CDS_pept        complement(32727..33674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0028"
FT                   /product="ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60680"
FT                   /db_xref="GOA:B3GZL8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B3GZL8"
FT                   /protein_id="ACE60680.1"
FT                   /translation="MLKIIFRRLLQIILVIWSVGTLTFILTRQLSGDMAYRIAASRYGY
FT                   DQVDSAAADLVRTELGLDQPWWQSYGNWLLDLLQLNLGKSLVTGDSVWSEIAHQFGHTL
FT                   SLALVALVMAIMIGPILGVLAARKENGFFDRFTLVFSTLFRSVPAFIIAIGLITLFSAT
FT                   LRWLPAGGYGKWQHFVLPAFTLALGLSAVSVRVTRAAMLQVKQSEYYQFARLKGLSKWQ
FT                   TFTRHGIRNIAIPVIAYHAVQLVYLIEGVVVVESLFAWPGSGHALVHAIIARDVPMIQG
FT                   TSLVMGGLFVLLNMCADMLSAWIDPRITHKRHGE"
FT   gene            complement(33768..35342)
FT                   /locus_tag="APP7_0029"
FT   CDS_pept        complement(33768..35342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0029"
FT                   /product="ABC transporter periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60681"
FT                   /db_xref="GOA:B3GZL9"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:B3GZL9"
FT                   /protein_id="ACE60681.1"
FT                   /translation="MKKWLLPLLATTLFTVGCEDKSVTQNNPQNNKESEVKNLKNNELT
FT                   QVTVIAPWELNSLHPTQSGVIFQRMNLAETLVEANEKGELIPGLATEWQSNEDATEWTF
FT                   TLRDATFHNGEKVNAQTVAKNLNLLMAQPSILQKAFIQEISALGDNQVKFKLTKSFVPF
FT                   PSFLTHYSTIILADEAFNEKNEVVKLIGTGAFKATKVEAPQKIEAVRFEQYWGEKPKVL
FT                   HANYLASSRSETRVLMAQSDVSSLVFNLDTASVARLKTDPNLTVTSGSIARTIQMKMDA
FT                   AKPFFKDLTIRQALSQAINRKAIAEQVLKIKDGAADQILPKAFADWRVENKDESVDIAK
FT                   IKQNLTSAGYQFNSEGKLTDKEGKPFSFTLRTFSDRPELPIIATILQAQWREIGIDVNV
FT                   SVGNSSEIPAGHKDGSLEMALYALNYGKTIDPFGVIVQDYAKGGSDWGVMNWSNEQLAQ
FT                   TLEKIETERDPQKAKQLKQTVSRIIHDELPIIPIVYYQQNVATHNEMKGVTLDTFERRF
FT                   FLEKLTK"
FT   gene            complement(35537..37117)
FT                   /gene="prfC"
FT                   /locus_tag="APP7_0030"
FT   CDS_pept        complement(35537..37117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prfC"
FT                   /locus_tag="APP7_0030"
FT                   /product="peptide chain release factor 3"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60682"
FT                   /db_xref="GOA:B3GZM0"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004548"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR032090"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR038467"
FT                   /db_xref="InterPro:IPR041732"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3GZM0"
FT                   /protein_id="ACE60682.1"
FT                   /translation="MSYPQEVNKRRTFAIISHPDAGKTTITEKVLLYGNAIQTAGSVKG
FT                   KGSSAHAKSDWMEMEKQRGISITTSVMQFPYNNCLVNLLDTPGHEDFSEDTYRTLTAVD
FT                   SCLMVIDSAKGVEERTIKLMEVTRLRDTPILTFMNKLDRDIRDPMELLDEVESVLKIRC
FT                   APITWPIGCGKLFKGVYHIAKDETYLYQSGQGSTIQEVRIVKGLSSPELDAAVGDDLAN
FT                   QLREELELVQGASNEFDHEAFINGELTPVFFGTALGNFGVDHFLDGLTEWAPKPQARQT
FT                   DVRTVESSEEKFSGFVFKIQANMDPKHRDRVAFMRVVSGKYEKGMKLKHVRIGKDVVIS
FT                   DALTFMAGDRSHAEEAYAGDIIGLHNHGTIQIGDTFTQGEVMKFTGIPNFAPELFRRIR
FT                   LKDPLKQKQLLKGLVQLSEEGAVQVFRPLMNNDLIVGAVGVLQFDVVVSRLKTEYNVEA
FT                   IYEAVNVATARWVECCDAKKFEEFKRKNEQNLALDGGDNLTYIAPTMVNLNLAQERYPD
FT                   INFFKTREH"
FT   gene            37300..37767
FT                   /locus_tag="APP7_0031"
FT   CDS_pept        37300..37767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0031"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60683"
FT                   /db_xref="GOA:B3GZM1"
FT                   /db_xref="InterPro:IPR008523"
FT                   /db_xref="UniProtKB/TrEMBL:B3GZM1"
FT                   /protein_id="ACE60683.1"
FT                   /translation="MEWFIYALRNTFNYQGRAKRAEFIWFILIYELSDWAIVLIAKLAF
FT                   ALRLIHLSDDLHILNSLLDILLLLPMSSVTVRRLHDLGYSGWWQSYLLTMNIVAMILTY
FT                   LIPKHSLNAMLDTKFGTFWSLLLVIYFIQIFFLIFKRGQPFINRYGKQPDS"
FT   gene            37814..38329
FT                   /gene="yhaH"
FT                   /locus_tag="APP7_0032"
FT   CDS_pept        37814..38329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yhaH"
FT                   /locus_tag="APP7_0032"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60684"
FT                   /db_xref="GOA:B3GZM2"
FT                   /db_xref="InterPro:IPR008523"
FT                   /db_xref="UniProtKB/TrEMBL:B3GZM2"
FT                   /protein_id="ACE60684.1"
FT                   /translation="MNWFLLVLKKTFNFKDRARRREYGWFYLINILIVITFNILVSVCV
FT                   AIGLEELGIGLNSLSYLYQLLTAVTAISLTARRLHDLGWSGWWQLLPYAVAVMFGIATI
FT                   FSLEKELGGAITGTEYALYGSTVFGGIAVIVFSLLLLFKDGQRFSNKYGEDPKAVKNSN
FT                   EVTNSLTV"
FT   gene            38456..39040
FT                   /gene="pth"
FT                   /locus_tag="APP7_0033"
FT   CDS_pept        38456..39040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pth"
FT                   /locus_tag="APP7_0033"
FT                   /product="peptidyl-tRNA hydrolase"
FT                   /EC_number="3.1.1.29"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60685"
FT                   /db_xref="GOA:B3GZM3"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3GZM3"
FT                   /protein_id="ACE60685.1"
FT                   /translation="MSQIKLIVGLANSGTKYEDTRHNAGEWLINEIARQFNVSLKEEAK
FT                   FFGKVAKINAAGGEVRLLVPTTFMNLSGKAVGALANFYRIKPEEILVAHDELDLPPGVA
FT                   KIKQGGGHGGHNGLKDIIASLGNSNNFYRVRIGIGHPGSKELVAGYVLGKPSPQDQEKI
FT                   NAAVDEAGRCVDLLLKDGITKATNRLNAFKA"
FT   gene            39149..40240
FT                   /gene="engD"
FT                   /locus_tag="APP7_0034"
FT   CDS_pept        39149..40240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="engD"
FT                   /locus_tag="APP7_0034"
FT                   /product="GTP-dependent nucleic acid-binding protein EngD"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60686"
FT                   /db_xref="GOA:B3GZM4"
FT                   /db_xref="InterPro:IPR004396"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR013029"
FT                   /db_xref="InterPro:IPR023192"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR041706"
FT                   /db_xref="UniProtKB/TrEMBL:B3GZM4"
FT                   /protein_id="ACE60686.1"
FT                   /translation="MGFKCGIVGLPNVGKSTLFNALTKAGIEAANYPFCTIEPNTGVVP
FT                   MPDPRLDALAEIVKPERVLPTTMEFVDIAGLVAGASKGEGLGNKFLANIRETDAIGHVV
FT                   RCFENDDIVHVAGKIDPADDIEIINTELALADLDSCERAIQRLQKRAKGGDKDAKFELS
FT                   IMEKILPVLENAGMIRSVDLDKDELHAIKGYNFLTLKPTMYIANVNEDGFENNPYLDRV
FT                   REIAEKEGAVVVPVCAAIESEIAELDDEEKVEFLQDLGIEEPGLNRVIRAGYRLLNLQT
FT                   YFTAGVKEVRAWTVSVGATAPKAAAVIHTDFEKGFIRAEVIAYDDFIQFKGENGAKDAG
FT                   KWRLEGKDYIVQDGDVMHFRFNV"
FT   gene            40312..40749
FT                   /locus_tag="APP7_0035"
FT   CDS_pept        40312..40749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0035"
FT                   /product="putative protein-S-isoprenylcysteine
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60687"
FT                   /db_xref="GOA:B3GZM5"
FT                   /db_xref="InterPro:IPR007318"
FT                   /db_xref="UniProtKB/TrEMBL:B3GZM5"
FT                   /protein_id="ACE60687.1"
FT                   /translation="MELKLPPPLLFILSAILIYFLPQAEVYFIPKAFGYLFLLLSAIVG
FT                   LMSVYAFFKEKTAFTPRDPTQTNKLVVQGIYRVSRNPMYLSLVLALIAWGIWLNSYFAI
FT                   LVIAGFMWYVDRFQIIPEERVLVQKFGKDFTDYQTKVRKWL"
FT   gene            complement(40799..41074)
FT                   /locus_tag="APP7_0036"
FT   CDS_pept        complement(40799..41074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0036"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60688"
FT                   /db_xref="UniProtKB/TrEMBL:B3GZM6"
FT                   /protein_id="ACE60688.1"
FT                   /translation="MKKFSLALLAAVTLAACTQDFYADKGNATVLNSKNLSQDAVELTV
FT                   QKDSGEIVTLTRKNDPHAAVGARVNLSEKTEQKDSDLTTIRRYEFK"
FT   gene            complement(41105..41569)
FT                   /gene="slyB"
FT                   /locus_tag="APP7_0037"
FT   CDS_pept        complement(41105..41569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="slyB"
FT                   /locus_tag="APP7_0037"
FT                   /product="outer membrane lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60689"
FT                   /db_xref="GOA:B3GZM7"
FT                   /db_xref="InterPro:IPR008816"
FT                   /db_xref="UniProtKB/TrEMBL:B3GZM7"
FT                   /protein_id="ACE60689.1"
FT                   /translation="MKKFSLAAALFTSLTLVGCANTDIYSGSVYNSSQAKEARSISYGT
FT                   IVSVRDVKIQADNQGVLGTLGGGALGGITGSTIGGGSGRAVATAVGAIAGAVIGSTIEE
FT                   KVSQVSSLEMVIRKDDGKEIVVVQKKEDGFVPGKRVRIVGSNSDLNVSVL"
FT   gene            complement(41596..42192)
FT                   /locus_tag="APP7_0038"
FT   CDS_pept        complement(41596..42192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0038"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60690"
FT                   /db_xref="InterPro:IPR010393"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:B3GZM8"
FT                   /protein_id="ACE60690.1"
FT                   /translation="MIQENAKFYEKMTACFGDFSEFQQKIQQIAHLAMLDLSQFEIDHL
FT                   AVRMNEWQTAERWRSILLENSELLKESEVNGRPIALIKLNQPLSFLGQSVSIIELPFPK
FT                   DKVYPQQGWEHIEIVYPMKPNETIEQWVQRTLKQFHLTINANLDLKISQPKVAGERLPN
FT                   PSIAISLKNKTYCNPCCLKLHPYGITEIIHSGSNF"
FT   gene            42290..44017
FT                   /gene="argS"
FT                   /locus_tag="APP7_0039"
FT   CDS_pept        42290..44017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argS"
FT                   /locus_tag="APP7_0039"
FT                   /product="arginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.19"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60691"
FT                   /db_xref="GOA:B3GZM9"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/TrEMBL:B3GZM9"
FT                   /protein_id="ACE60691.1"
FT                   /translation="MNIQQILSDKIKQAMIAAGADSNVEPLVRQSGKPEFGDYQANGAM
FT                   GAAKKLGMNPREFAQKILDNADLNGIADKLEIAGPGFINIFLNQAWLANQASEALQAVN
FT                   FGIKTANPQTIVIDYSSPNVAKEMHVGHLRSTIIGDAVVRTLEFLGNKVIRANHVGDWG
FT                   TQFGMLIAYLEKMENEHASQMELSDLEAFYRAAKEHYDSDEVFAEKARNYVVKLQSGDE
FT                   YCRTMWKKLVDITMHHNQENYDRLNVTLSEKDVMGESLYNPMLPEIVADLKAKGLAVED
FT                   DGALVVFLEEFKNKDGDPMGVIVQKKDGGFLYTTTDIAAAKYRYETLNADRVLVFSDSR
FT                   QAQHMQQAWLITRKAGYVPESFSLEHPFFGMMLGKDGKPFKTRSGGTVKLKDLLDEAVE
FT                   RADKLISERSTDLTAEEKAAVVEAVAIGSVKYSDLSKNRTTDYVFDWDNMLTFEGNTAP
FT                   YMQYAYTRIRSIFNRAGIDVNGLNGEINLTEDKERALAVKLLQFEEALNGVAKDGMPNI
FT                   LCQYLYELAGAFSSFYEACPMLNAEENVKNSRLSLAALTAKTLKQGLDLLGIKTIEKM"
FT   gene            44161..45336
FT                   /gene="yhbZ"
FT                   /locus_tag="APP7_0040"
FT   CDS_pept        44161..45336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yhbZ"
FT                   /locus_tag="APP7_0040"
FT                   /product="hypothetical GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60692"
FT                   /db_xref="GOA:B3GZN0"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006074"
FT                   /db_xref="InterPro:IPR006169"
FT                   /db_xref="InterPro:IPR014100"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR035101"
FT                   /db_xref="InterPro:IPR036726"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3GZN0"
FT                   /protein_id="ACE60692.1"
FT                   /translation="MKFIDEALIRVEAGDGGNGCVSFRREKYIPKGGPDGGDGGDGGDV
FT                   YLIADENLNTLIDYRFEKRYAAGRGENGRSAGCTGHRGNDITLRVPVGTRAIDNDTQEV
FT                   IGDLTKHGMKMLVAKGGYHGLGNTRFKSSVNRAPRQKTNGTPGEKRDLLLELMLLADVG
FT                   MLGLPNAGKSTFIRAVSAAKPKVADYPFTTLVPSLGVARVGADRSFVVADIPGLIEGAA
FT                   DGAGLGIRFLKHLERCRVLIHLVDIMPIDESDPAQNISVIESELYQYSEKLSEKPTWLV
FT                   FNKIDTIGEEEAQARAQEIAEQIGWEGDYYLISAATGQNVQNLTRDIMDFIEANPREVA
FT                   EENTEADEVKFKWDDYHQQAMQNPIEEDWDDFDDDWSEEDEEGVEFVYTRS"
FT   gene            45411..46022
FT                   /locus_tag="APP7_0041"
FT   CDS_pept        45411..46022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0041"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60693"
FT                   /db_xref="InterPro:IPR019722"
FT                   /db_xref="UniProtKB/TrEMBL:B3GZN1"
FT                   /protein_id="ACE60693.1"
FT                   /translation="MLNAKSCELFEIPFFQFAQMKKYCPEDIPLIKANYKSEWQKWKAL
FT                   HLEVARQLGMPFAEPHIEKWCNGWQVRAHFFAYYKYEFNRNSAAILSVILNRRRLQVCL
FT                   DWHCYRADRSQISLAQYNQWLEKLDRLQYQDFEVWHGAESEYADFKTLKETDSLSLEND
FT                   EDFWCIGRNIEKADLDQIDMAEFIYQTVRQLLPLYEACHQ"
FT   gene            complement(46127..46870)
FT                   /gene="rlmB"
FT                   /locus_tag="APP7_0042"
FT   CDS_pept        complement(46127..46870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rlmB"
FT                   /locus_tag="APP7_0042"
FT                   /product="23S rRNA (guanosine-2'-O-)-methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60694"
FT                   /db_xref="GOA:B3GZN2"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR024915"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:B3GZN2"
FT                   /protein_id="ACE60694.1"
FT                   /translation="MSEQIYGIHAVKAFLDNAPERLIEVLVLKGREDKRLTPLLNELQR
FT                   LGISVQQVNRQTLDNKAQGEVHQGIIAKVVPQKELNEHDLDAILAQKQNPFLLILDGVT
FT                   DPHNLGACLRTADAAGVDAVIVPKDKSAQLTSTARKVACGAAETVPLIRVTNLARTMRE
FT                   LQEQHNIWIVGTAGEATSGIYQAKLTGAIALVMGAEGDGMRRLTREHCDQLISIPMAGS
FT                   VSSLNVSVATGVCLFEIVRQKLAAQ"
FT   gene            complement(46949..48313)
FT                   /gene="pssA"
FT                   /locus_tag="APP7_0043"
FT   CDS_pept        complement(46949..48313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pssA"
FT                   /locus_tag="APP7_0043"
FT                   /product="phosphatidylserine synthase"
FT                   /EC_number="2.7.8.8"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60695"
FT                   /db_xref="GOA:B3GZN3"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR016270"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:B3GZN3"
FT                   /protein_id="ACE60695.1"
FT                   /translation="MLILNKPNHAKKQLEALRFIPQTADKVEFLSDSREFKERILTLIK
FT                   NAKKRIYLTALYFEQDEAGQEVLTALYQAKRDNPTLDIKVLVDWHRAQRGRIGEETTSS
FT                   NADWYVKIKQQYNLPTDQEIQFWGVPVNRKELFGVLHLKGFIFDDTLLYSGASINNVYL
FT                   QQFERYRYDRYHVIENKALTDAIVEFADTHILQHDAVNRLDNANRPKTHEIRPLIKAFR
FT                   KYLSAQSYIFNGQPQSDQLSLSPLVGLGRKNALNKTIEALFYQVEDKLTICTPYFNFPL
FT                   SLYKRLNWLLDHGKKAEIIVGDKTANDFYTPPEEKFTMASALPYLYEKNLRAFAKRFDR
FT                   YIQNGQLTVRLWKHGDNSYHLKGVWIDSRYILLTGNNLNPRAWALDAENAVLIYDPKAE
FT                   LSAKAETELTQIRTHTTVLKHYSDLEQINDYPEAVRKLLKRFGRVKLDKVVKMLL"
FT   gene            complement(48465..51281)
FT                   /gene="ileS"
FT                   /locus_tag="APP7_0044"
FT   CDS_pept        complement(48465..51281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ileS"
FT                   /locus_tag="APP7_0044"
FT                   /product="isoleucyl-tRNA synthetase"
FT                   /EC_number="6.1.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60696"
FT                   /db_xref="GOA:B3GZN4"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002301"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023585"
FT                   /db_xref="InterPro:IPR033708"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3GZN4"
FT                   /protein_id="ACE60696.1"
FT                   /translation="MIDYKNTLNLPETGFPMRGDLAKREPDMLKNWYDKNLYQKVRESS
FT                   KGKKSFILHDGPPYANGNIHIGHAVNKILKDIIMKSKTALGFDTPYVPGWDCHGLPIEL
FT                   KVEGIVGKPNEKISAAEFRQACRDYAKEQVEGQKADFIRMGILGDWDNPYLTMNFDTEA
FT                   HIIRTLGKVIANGHLYKGSKPVHWCLDCGSSLAEAEVEYEDKVSPSIYVRFKAVDSVAV
FT                   EAKFNAVGKGSGQISAVIWTTTPWTLPSNKAISINPEFDYQLVQFGGERVVLVKDLVES
FT                   VQKAVGIESVEVLGEVKGDALELMQFQHPFYDYSVPLILGDHVTTDGGTGLVHTAPDHG
FT                   QDDFVVSKKYNIEMAGLVANDGKFISSTPFFAGLGVFESNEKVLEKLKEVGALLKLERI
FT                   KHSYPHCWRHKTPIIFRATPQWFIGMETQGLREQALGEIKSVRWIPSWGEARIDTMVAN
FT                   RPDWCISRQRTWGVPMTMFVHNETEELHPRTLEILESVAKRVEEKGIQAWWDLDPVEVL
FT                   GEEDAKNYRKVPDTLDVWFDSGSTYASVVEARPEFNGNSTDMYLEGSDQHRGWFMSSLM
FT                   LSTATNGKAPYKQVLTHGFVVDEKGRKMSKSLGNVIVPSEVWNKNGADILRLWVASTDY
FT                   TGEIAVSHNILNSAGESYRRIRNTARFLLANLNGFDPKRDLVKPEEMIALDRWAVSCAL
FT                   EAQNDIKEAYDNYQFHTVVQRLMRFCSIEMGSFYLDIIKDRQYTTKADSLARRSCQTAL
FT                   WHIAEALVRWMAPILSFTADEIWSYLPQVEGRSEFVFTEEFYEGLFGLTEADKLDDAYW
FT                   QQILKVRAESNRVLEQARKDKVIGSGLEAKVTLYANNEIRAMLEQLGNELRFVLITSQA
FT                   IIKPLSEADVAEGEMAGLAVKVERAEGEKCPRCWHFATDIGTHTEHSSVCGRCVENVAG
FT                   EGEKRSFA"
FT   gene            complement(51341..52303)
FT                   /gene="ribF"
FT                   /locus_tag="APP7_0045"
FT   CDS_pept        complement(51341..52303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribF"
FT                   /locus_tag="APP7_0045"
FT                   /product="riboflavin biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60697"
FT                   /db_xref="GOA:B3GZN5"
FT                   /db_xref="InterPro:IPR002606"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015864"
FT                   /db_xref="InterPro:IPR015865"
FT                   /db_xref="InterPro:IPR023465"
FT                   /db_xref="InterPro:IPR023468"
FT                   /db_xref="UniProtKB/TrEMBL:B3GZN5"
FT                   /protein_id="ACE60697.1"
FT                   /translation="MQLIRGLYNLANHKDLAKGSVVSIGNFDGVHLGHQNILARLCDQA
FT                   LERNLPSVVMLFEPQPREFFANKQANSTACIAPARLMRLRDKLKYLEQAGVDFVLCVRF
FT                   NERFANLSADTFISELLVKQLQVRYLSVGDDFRFGANRTGDFALLRNAGLKYRFAVEDS
FT                   QTLSHAEQRVSSSLIRMALQLDDLVLAEKLLGKPYSICGRVAHGNKLGRTIGFPTANIM
FT                   LNRLVTPLQGVFAVQIQTQTGRHNGIANVGNRPTINGTKPLLEVHIFDFNRSIYGEAIE
FT                   VFFIRKIRNEVKFPDFEALKAQIEKDREQAVEFFKHFAN"
FT   gene            52636..53916
FT                   /gene="nadR"
FT                   /locus_tag="APP7_0046"
FT   CDS_pept        52636..53916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadR"
FT                   /locus_tag="APP7_0046"
FT                   /product="transcriptional regulator NadR"
FT                   /EC_number="2.7.7.1"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60698"
FT                   /db_xref="GOA:B3GZN6"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR006417"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR016429"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038727"
FT                   /db_xref="UniProtKB/TrEMBL:B3GZN6"
FT                   /protein_id="ACE60698.1"
FT                   /translation="MTNFAYLQQKRKQLKMKVNDVCEQAGVTRAYFNQLVSGKIKNPSA
FT                   NKLKALHQVLNIVEDMNQRVGVIFGKFYPVHTGHIHMIYEAFSKVDILHVVVCTDAERD
FT                   LQLFKDSKMKRMPTNEDRLRWMQQIFKYQQKQIFIHHLKEDGIPSYPNGWQGWADRVKE
FT                   LFNEKNIRPSLVFSSEVQDKEPYEKYLDLEVHLVDPKRESFNVSATKIRNNPFQYWRFI
FT                   PKEVRPFFVKTIAILGGESSGKSVLVSKLANVFNTTSAWEYGREFVFERLGGNEQAMQY
FT                   SDYPLMALGHQRYIDYAMKHAHKVALIDTDYITTQAFCIQYEGKSHPFLDSMIKEYPFD
FT                   VTILLSNNTKWVDDGMRSLGSVKQRQRFQQLLKKLLEKYNVPYIEIESPSYLDRYNQAK
FT                   EVVEAILKEEEIPLQFKQYNHTTEDKE"
FT   gene            53913..54611
FT                   /locus_tag="APP7_0047"
FT   CDS_pept        53913..54611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0047"
FT                   /product="hypothetical diadenosine tetraphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60699"
FT                   /db_xref="GOA:B3GZN7"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR017056"
FT                   /db_xref="UniProtKB/TrEMBL:B3GZN7"
FT                   /protein_id="ACE60699.1"
FT                   /translation="MILFAGDPHGSYRHLYPVLQEYKGEEIALVILGDLQLTTPDELDK
FT                   LSQYCDVWFIHGNHDSKTVAAFDSIWNSEWKTRSLHGKVVDIQGVKIAGLGGVFRGHIW
FT                   MPPNRPMFFDPIHYCQYCPQERIWRGGLPLRHRTSIFPSDVEILEGLQADILITHEAPR
FT                   PHPQGFAVINQLAKKMGVNKIFHGHHHDNFDYRPINRNKHCDIFNIGFRSLADINGNYL
FT                   IVGVDDRENR"
FT   gene            54784..55500
FT                   /gene="arcA"
FT                   /locus_tag="APP7_0048"
FT   CDS_pept        54784..55500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arcA"
FT                   /locus_tag="APP7_0048"
FT                   /product="aerobic respiration control protein ArcA"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60700"
FT                   /db_xref="GOA:B3GZN8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B3GZN8"
FT                   /protein_id="ACE60700.1"
FT                   /translation="MQNPQILIVEDELVTRNTLKSIFEAEGYEVFEATDGTEMNAILAQ
FT                   QEINLVIMDINLPGKNGLMLARELRENTKIALMFLTGRDNEVDKILGLEIGADDYITKP
FT                   FNPRELTIRARNLLHRTMNEKEKTTKDIVQTDSYRFNGWELDVNSRSLITPEGVVNKLP
FT                   RSEFRALLHFCENPGKIQTREDLLLKMTGRELKPHDRTVDVTIRRIRKHFEDHPNTPEI
FT                   IVTIHGEGYRFCGELE"
FT   gene            55552..56070
FT                   /locus_tag="APP7_0049"
FT   CDS_pept        55552..56070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0049"
FT                   /product="protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60701"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="UniProtKB/TrEMBL:B3GZN9"
FT                   /protein_id="ACE60701.1"
FT                   /translation="MKNLTVLALAGLFSASAFAAPVGNTFTGVGVGVDLTTVKYKVDGV
FT                   KGKQSTGPALVVDYGMDYGDNFVGVVQGKVKVGSTKVFSDVKQKTKYTVAYQQGYRVAS
FT                   DLLPYVKVDVAQSKVGDTNFRGYGYGAGAKYAVSSNVEVGAEYTRSNLRKSGAKLKGNE
FT                   FTANLGYRF"
FT   gene            complement(56153..56689)
FT                   /locus_tag="APP7_0050"
FT   CDS_pept        complement(56153..56689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0050"
FT                   /product="3-deoxy-D-manno-octulosonate 8-phosphate
FT                   phosphatase"
FT                   /EC_number="3.1.3.45"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60702"
FT                   /db_xref="GOA:B3GZP0"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR010023"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B3GZP0"
FT                   /protein_id="ACE60702.1"
FT                   /translation="MDLTQIKLVITDVDGVLTDGGMYYTAEGEVMKRFHVHDGLGMKML
FT                   RTCGVQVAILSGGDSALLRKRIDVLKVPLFKLGKMEKRSACFELMKEAGVTAEQTAFIG
FT                   DDTLDLPAFEVCGLAIATRNAHDYVKAKADWILEKAGGEGAFREVSDRILQAQGFEEIY
FT                   ATADGFLTVAEKMAQ"
FT   gene            56744..57427
FT                   /locus_tag="APP7_0051"
FT   CDS_pept        56744..57427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0051"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60703"
FT                   /db_xref="GOA:B3GZP1"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR011078"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:B3GZP1"
FT                   /protein_id="ACE60703.1"
FT                   /translation="MSISQNLSEIKQQIQQISQQCGRDNVRLLAVSKTKPVEAIEEAIA
FT                   AGQTAFGENYVQEGVEKIAYFAQQPNLEWHFIGPLQSNKTRLVAENFDWIQTVDRLKIA
FT                   ERLSVQRSANKAPLNVLIQINISDEASKSGIQPEELDELAKAISQLPNLRLRGLMAIPK
FT                   PESEPEQQKIALRKMQQLFDRLQDEFEGIDTLSMGMSDDMAAAIECGSTMVRIGTAIFG
FT                   TRYYS"
FT   gene            57469..58311
FT                   /locus_tag="APP7_0052"
FT   CDS_pept        57469..58311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0052"
FT                   /product="hypothetical protein"
FT                   /function="Glycosyltransferases, probably involved in cell
FT                   wall biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60704"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B3GZP2"
FT                   /protein_id="ACE60704.1"
FT                   /translation="MQAHMQASEPIAAVVTATVGKPSLEQAILSVKNQTIPCKHYVFVD
FT                   GKQYWKAAKEILDKYPDVIATYLPMNTGQLSFKNSAIFSLAPFTVKEEFIGFLDDDNWF
FT                   ELQHMEEAVRSIQDNEVDYAYSLRNKIFVYGDRHFICQDTVESIGHFKRALPNEIRVDF
FT                   QDTGVQLVNRMAKGAPLVDASCYVMRKNIAIRVASAWYEGAIVNDRNVLKRLTDINAKS
FT                   VCVGKYNVNYRTMLDKELITSLMNNLNEDEVLSTLYVFYEEINNQHRRMFGGKFPWEA"
FT   gene            58389..60350
FT                   /gene="typA"
FT                   /locus_tag="APP7_0053"
FT   CDS_pept        58389..60350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="typA"
FT                   /locus_tag="APP7_0053"
FT                   /product="GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60705"
FT                   /db_xref="GOA:B3GZP3"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006298"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035651"
FT                   /db_xref="InterPro:IPR042116"
FT                   /db_xref="UniProtKB/TrEMBL:B3GZP3"
FT                   /protein_id="ACE60705.1"
FT                   /translation="MNCDLDHIRSRVKGRFPSIKISTVCINAPYIQLNKDISMQNLDIN
FT                   KLRNIAIIAHVDHGKTTLVDKLLQQSGTLGETRGDADERVMDSNDLEKERGITILAKNT
FT                   AINWNDYRINIVDTPGHADFGGEVERVLSMVDSVLLVVDAFDGPMPQTRFVTQKAFAHG
FT                   LKPIVVINKVDRPGARPDWVVDQVFDLFVNLGATDEQLDFPIIYASALMGVAGLEHEDL
FT                   AEDMTPLFQAIVDHVEPPKVELNAPFQMQISQLDYNNYVGVIGIGRIKRGSIKPNQTVT
FT                   VIDSEGKTRNGKIGQVLGHLGLQRYEASEAFAGDIIAITGLGELNISDTICDINNVEAL
FT                   PALSVDEPTVSMFFCVNTSPFCGQEGKYVTSRQILERLNKELVHNVALRVEETPNPDEF
FT                   RVSGRGELHLSVLIENMRREGYELAVSRPKVIYREENGKKQEPFEQVTIDIEEQHQGAV
FT                   MEALGIRKGEVKDMIPDGKGRTRLEYVIPSRGLIGFRNEFMTMTSGTGLLYSSFSHYDD
FT                   VKPGEIGQRKNGVLISNATGKALAYALFGLQERGKLMIDHGVDVYEGQIIGIHSRGNDL
FT                   TVNCLQGKKLTNMRASGKDDAIVLTTPVKMTLEQALEFIDDDELVEVTPQSIRVRKRLL
FT                   TENDRKRAGRTTTSTSTK"
FT   gene            60509..60772
FT                   /gene="grxA"
FT                   /locus_tag="APP7_0054"
FT   CDS_pept        60509..60772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="grxA"
FT                   /locus_tag="APP7_0054"
FT                   /product="glutaredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60706"
FT                   /db_xref="GOA:B3GZP4"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011767"
FT                   /db_xref="InterPro:IPR011902"
FT                   /db_xref="InterPro:IPR014025"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B3GZP4"
FT                   /protein_id="ACE60706.1"
FT                   /translation="MFVEIYGRMTCPYCTRAKALAEKMKGELADFDFKFIDMIAEGISK
FT                   EDLEPRVGKPVATVPQIFLDNVHVGGCTDFQALVKEKFGIEV"
FT   gene            complement(60831..61547)
FT                   /gene="rph"
FT                   /locus_tag="APP7_0055"
FT   CDS_pept        complement(60831..61547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rph"
FT                   /locus_tag="APP7_0055"
FT                   /product="ribonuclease PH"
FT                   /EC_number="2.7.7.56"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60707"
FT                   /db_xref="GOA:B3GZP5"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR002381"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR018336"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3GZP5"
FT                   /protein_id="ACE60707.1"
FT                   /translation="MRPNNRELNQVRPVKITRHYTRYAEGSVLVEFGETKVLCNATVEE
FT                   TVPRFLKGQQQGWVTAEYGMLPRSTHSRMQREAAKGKQGGRTMEIQRLIARSLRAVVDL
FT                   KALGERTVTVDCDVIQADGGTRTAAITGACVALHDAMSKLVADGVLKENPMKGLVAAIS
FT                   VGIVDGNAVCDLEYVEDSNAETDMNVVMVEDGRLVEVQGTAEGEPFSHMELLQLLDLAH
FT                   QGINQLLDAQRKALGL"
FT   gene            61751..62614
FT                   /gene="yicC"
FT                   /locus_tag="APP7_0056"
FT   CDS_pept        61751..62614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yicC"
FT                   /locus_tag="APP7_0056"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60708"
FT                   /db_xref="InterPro:IPR005229"
FT                   /db_xref="InterPro:IPR013527"
FT                   /db_xref="InterPro:IPR013551"
FT                   /db_xref="UniProtKB/TrEMBL:B3GZP6"
FT                   /protein_id="ACE60708.1"
FT                   /translation="MIYSMTAFAHLEIKKEWGNAVWEIRSVNQRFLETYFRLPEQFRNL
FT                   EMTLRERLRASLTRGKVECSLRIELSNNQNSELALNKEYAEKVISSLQTLRGIAGEGEI
FT                   NLVDILRYPGVVDAQTQDLDQIGQDLLAGFEQILADFIAMRGREGANLQALIQQRLDTI
FT                   AEIATKVQAQMPEILQWQKDKLQQRFDELNLQLDPQRLEQEMVLTAQRVDVAEELDRLQ
FT                   LHVKETTNVLKKGGAVGRKLDFMMQELNRESNTLASKSINADVTNSAVELKVLIEQMRE
FT                   QIQNLE"
FT   gene            62623..63510
FT                   /locus_tag="APP7_0057"
FT   CDS_pept        62623..63510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0057"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60709"
FT                   /db_xref="GOA:B3GZP7"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR017703"
FT                   /db_xref="InterPro:IPR028896"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="UniProtKB/TrEMBL:B3GZP7"
FT                   /protein_id="ACE60709.1"
FT                   /translation="MTCECSKISNSHPNLCVQLSQYRLIEIAGVDAEKYLQGQLTCDVA
FT                   KLAEGEHTLTCHCDPKGKMSALIRLYRQAADKFIAMIHADLLPEALNQLKKYAVFSKVT
FT                   FTELDTPIYGVTSGEILAKLCENTTALVIPQGQKRAIVWGETLETNADSQLWDLIDIQD
FT                   GIPMLLKANQFELIPQATNLQAVENAISFSKGCYIGQETVARAKYRGANKRAMFTLVGK
FT                   FDGEVSLPEIGGSVEMQFGENWRATGTILNSVAYQNKLWLQVVMNNDVEADSAFRINGV
FT                   PLAICDLPYSFKDA"
FT   gene            complement(63560..63820)
FT                   /gene="yfhL"
FT                   /locus_tag="APP7_0058"
FT   CDS_pept        complement(63560..63820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfhL"
FT                   /locus_tag="APP7_0058"
FT                   /product="putative ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60710"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B3GZP8"
FT                   /protein_id="ACE60710.1"
FT                   /translation="MALLITHKCTNCDMCLPECPNEAISIGDDVYVIDPVLCTECVGHY
FT                   EKPTCQKVCPITNCIIPDSEHQETQEELWERFVMIHHPDKI"
FT   gene            complement(63967..64596)
FT                   /gene="narP"
FT                   /locus_tag="APP7_0059"
FT   CDS_pept        complement(63967..64596)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="narP"
FT                   /locus_tag="APP7_0059"
FT                   /product="nitrate/nitrite response regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60711"
FT                   /db_xref="GOA:B3GZP9"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:B3GZP9"
FT                   /protein_id="ACE60711.1"
FT                   /translation="MTEAYKILLIDDHPLMRQGIRQILELEDNFVIVGEASNGTDGISI
FT                   ALDTNPDLIILDLNMKGISGLDTLRALRKHGIDSRIVVLTVSDEQSDVFALMDAGVDGY
FT                   LLKDSDTAELVENIRKAAQGETVLSESVKQHLLERRPENDPLSVLTDRERDVLQWIATG
FT                   MSNKQIASQLFISEETVKVHIRNLLRKLNVHSRVAATVLYLEQQKG"
FT   gene            64800..66938
FT                   /locus_tag="APP7_0060"
FT   CDS_pept        64800..66938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0060"
FT                   /product="putative N6-adenine-specific DNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60712"
FT                   /db_xref="GOA:B3GZQ0"
FT                   /db_xref="InterPro:IPR000241"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="InterPro:IPR017244"
FT                   /db_xref="InterPro:IPR019614"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3GZQ0"
FT                   /protein_id="ACE60712.1"
FT                   /translation="MTTQITYFATAARGFEEMLKTELEQICQAECKVAQGGVHFTTTQR
FT                   GAYQALLHSRLASRILLPLVTTKIFSDLDLYATIVGINWAEIFDPRDTFFVDFNGTNRE
FT                   IRNTQFGAMRVKDGVVDYFERKGFARPTVDKDHADIRIHVYLDRENMVVSLDLSGDALH
FT                   MRGYREDTGKAPLRETLAAAIILRSGWQKGTPLVDPMCGSGTLLIEAAQMQAGIAPQLH
FT                   RKHWGFNAWKGHQQAVWKEVLEQAYLQQNEEIQPLFFGFDLDHRVLAKAKQNARNAGVA
FT                   HLIQWQQGDVAALKNPCPEQVGTVICNPPYGERLGTTPALIALYSVFGQRLKHQFSGWN
FT                   ASIFSGEPELLNCLRLRSHRQFKAKNGPLDCLQKNYQISERAVAEQQADELKFEQNAQV
FT                   APDFANRLTKNIKKIEKWAKQQGINAYRLYDADLPEYNLAVDRYDDHIVVQEYAAPKNI
FT                   DEQKARQRLLDAVSATLYVTGVETNKLVLKVRQKQKGTNQYEKLANKGDYFYVTEYGAK
FT                   LWVNLTDYLDTGLFLDHRLTRKMVGQMAKGKTFLNLFAYTGSATIHAALNGAKSTTTID
FT                   MSNTYLNWAEQNLELNNLPLRNNRLFQADCLQWLAECRERFELIFVDPPTFSNSKRMED
FT                   SWDVQRDHIKLMTQLKRILTADGIIVFSNNKRGFKMDFEGLAELGLQAENISHKTLPLD
FT                   FERNPQIHNCWIIRHIEN"
FT   gene            66996..67475
FT                   /gene="yibK"
FT                   /locus_tag="APP7_0061"
FT   CDS_pept        66996..67475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yibK"
FT                   /locus_tag="APP7_0061"
FT                   /product="putative tRNA/rRNA methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60713"
FT                   /db_xref="GOA:B3GZQ1"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR016914"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:B3GZQ1"
FT                   /protein_id="ACE60713.1"
FT                   /translation="MLDIVLYEPEIPQNSGNIIRLCANCGFRLHMIEPLGFAWDDKKLR
FT                   RSGLDYHEFVDIQKYKNFEDFLERAKPKRLFALTTKGEPNHSEVSYELGDFLMFGPESR
FT                   GIPMTILDNLPMSQKIRVPMCKDSRSMNLSNTVAVVVYEAWRQFGYQGSVPRQPI"
FT   gene            complement(67615..68562)
FT                   /gene="mipB"
FT                   /locus_tag="APP7_0062"
FT   CDS_pept        complement(67615..68562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mipB"
FT                   /locus_tag="APP7_0062"
FT                   /product="transaldolase"
FT                   /EC_number="2.2.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60714"
FT                   /db_xref="GOA:B3GZQ2"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR004730"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018225"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3GZQ2"
FT                   /protein_id="ACE60714.1"
FT                   /translation="MSQLDALREMTVVVADTGDIEAIKQYQPQDATTNPSLILSASALP
FT                   QYASLIDDAVAYAKARSDDKAQQLIDAEDKLAVNIGLEILKIVPGRISTEVDARLSYDT
FT                   KATIEKARQIMKLYNDAGISNDRILIKIASTWQGIRAAEVLEKEGINCNLTLLFSQAQA
FT                   RACAEAGVYLISPFVGRILDWYKAAEKKEYAPAEDPGVISVTNIYNYYKQYGYQTVVMG
FT                   ASFRNVGEITEIAGCDRLTIAPPLLKELAESNAPLVRKLEYKGEVKTRPAPLTEAEFYW
FT                   QHNQDPMAIEKLAEGIRKFAVDIEKLEAMLAAKL"
FT   gene            69061..70602
FT                   /locus_tag="APP7_r0001"
FT   rRNA            69061..70602
FT                   /locus_tag="APP7_r0001"
FT                   /product="16S ribosomal RNA"
FT   gene            70685..70758
FT                   /locus_tag="APP7_tRNA01"
FT   tRNA            70685..70758
FT                   /locus_tag="APP7_tRNA01"
FT                   /product="tRNA-Ile"
FT   gene            70813..70885
FT                   /locus_tag="APP7_tRNA02"
FT   tRNA            70813..70885
FT                   /locus_tag="APP7_tRNA02"
FT                   /product="tRNA-Ala"
FT   gene            71137..74059
FT                   /locus_tag="APP7_r0002"
FT   rRNA            71137..74059
FT                   /locus_tag="APP7_r0002"
FT                   /product="23S ribosomal RNA"
FT   gene            74197..74316
FT                   /locus_tag="APP7_r0003"
FT   rRNA            74197..74316
FT                   /locus_tag="APP7_r0003"
FT                   /product="5S ribosomal RNA"
FT   gene            74701..76299
FT                   /gene="dppA1"
FT                   /locus_tag="APP7_0063"
FT   CDS_pept        74701..76299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dppA1"
FT                   /locus_tag="APP7_0063"
FT                   /product="periplasmic dipeptide transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60715"
FT                   /db_xref="GOA:B3GZQ3"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR023765"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:B3GZQ3"
FT                   /protein_id="ACE60715.1"
FT                   /translation="MQKYFSLSALALVLFSNTVFASPKTFTYCIESSPAFLNPQIGTDG
FT                   ATLDVAQALYNRLIDFEPGTTNLVPSLAEKWDISADGKTYTFYLRKGVKFHKNKEFTPS
FT                   RNFNADDVLFVFNRQLNKYNYFHNVSGGNYEFFLGMDMPNIIEKVEKVDTYVVKFHLKV
FT                   PNAPFLANLAMDFASISSSEYADQMLKAGTPEKVDTAPIGTGPFEFAGLQKDAYVRFKA
FT                   FDDYWQGRSKLDRLVFSVTPDATVRYAKLQKNECQAMPYPNPADIAQMKADTNLQVLEK
FT                   SGLNIGYITFNLDKKPLDNQKVRQALNYAVNKQAILESVYQGTGSAAKNPMPPTIWGYN
FT                   DEVQDYEYNPEKAKALLKEAGLENGFDTELWAMPVSRPYNPNARRMAEMVQEDWKQIGV
FT                   NAKIVSFEWGEYLKRMEQGEHSTGMMGWTGDNGDPDNFLNTLLSCNAVKQGSNYAHFCD
FT                   QSYNDLVTQAAQESDKAKREALYKQAQVIFKQQAPWLPIAHSTTYFPIRKEVKGYTVSP
FT                   FLSHNFYRVELENIQ"
FT   gene            76464..78065
FT                   /gene="dppA2"
FT                   /locus_tag="APP7_0064"
FT   CDS_pept        76464..78065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dppA2"
FT                   /locus_tag="APP7_0064"
FT                   /product="periplasmic dipeptide transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60716"
FT                   /db_xref="GOA:B3GZQ4"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR023765"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:B3GZQ4"
FT                   /protein_id="ACE60716.1"
FT                   /translation="MKKLTKLSLLSLAIAASSSAFAAPKTFVYCLEASPTYLNPQFATD
FT                   GGTLDATSQAIFNRLVDFAKGETTIVPSLAEKWEVSEDGKSYTFYLRKGVKFHSTKDFK
FT                   PSRDFNADDVVFSFNRQLDTNHPYHKVSGGNYEYFIGMDMGNIIQNVEKVDDYTVKINL
FT                   KVPNAPFLANIAMDFASIFSAEYADKLLKAGMPEKLDQNPIGTGPFQFVDYQKDAQIRY
FT                   KGFDQYWAGKPAIDRLVFAITPDASVRMAKLQKGECHAAPYPNPADLDALKKDPNINLM
FT                   TKPGLNIGYLHFNTQKKPFDDVKVRQALNHAINKDAIIQSVYQGSGEKAKNPIPPTMWS
FT                   YNDAVKDYDYNPEKAKALLKEAGLEKGFDTEVWAMPVSRPYNPNARRMAELIQEDWKKV
FT                   GVNAKIVSYEWGEYLNRMRDGEHTTGMMGWNGDNGDPDNFLNTLLSCAAVKQGSNYAKF
FT                   CHKDFDKLMTDAVQTTDKAKRIELYKQAQVLFKEQAPWVTIAHSTTYFPVRKEVKGYVI
FT                   SPFSLHNFYGVDLEAK"
FT   gene            78193..79197
FT                   /gene="dppB"
FT                   /locus_tag="APP7_0065"
FT   CDS_pept        78193..79197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dppB"
FT                   /locus_tag="APP7_0065"
FT                   /product="dipeptide transport system permease protein DppB"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60717"
FT                   /db_xref="GOA:B3GZQ5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B3GZQ5"
FT                   /protein_id="ACE60717.1"
FT                   /translation="MFSFILKRLLMVIPTFLAITLITFALVHLIPGDPIEIRMGERGLD
FT                   PAVHAQMMAQLGLDLPLPEQYFNYIKGIFQGDLGNSFRNNEPVLKEFFTLFPATVELAF
FT                   FALLWSLVFGIFLGVIAAVKKDSWISHTVTTLSLTGYSMPIFWWGLILILYFSTPLGLP
FT                   ASGRLPSEYWIEAETGFMLYDTWVSDEPGAFIAAIKSLILPSIVLGTIPLAVVTRMTRS
FT                   SMLEVLGEDYIRTAKAKGLNTTRIVIVHALRNALIPVVTVVGLIVGQLLSGAVLTENIF
FT                   SWPGIGKWIIDAINARDYPVLQGSVLIIATIIILVNLTVDLIYGVVNPRIRHH"
FT   gene            79275..80165
FT                   /gene="dppC"
FT                   /locus_tag="APP7_0066"
FT   CDS_pept        79275..80165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dppC"
FT                   /locus_tag="APP7_0066"
FT                   /product="dipeptide transport system permease protein DppC"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60718"
FT                   /db_xref="GOA:B3GZQ6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B3GZQ6"
FT                   /protein_id="ACE60718.1"
FT                   /translation="MSSTTLSAPAPKTPLQEFWYYFCQNRGAVIGLAFITLVFFAAVFA
FT                   GWVAPFDPIEQNRSALLLPPAWMEGGNSTYLLGTDDIGRDILSRIIYGARLSVFIGLVI
FT                   VILSCVFGVILGLLAGYYGGVIDIVIMRFVDIMLAIPSLLLTIGVVTILGPSLINAAIA
FT                   IAIVSIPSYVRLTRASVMSEKNRDYVVASRVAGAGVLRLMFIVILPNCLAPLIVQMTMG
FT                   ISNAILELAALGFLGIGAQPPTPELGTMLAESRGFMQSANWLVTIPGLAILSLVLAFNL
FT                   MGDGLRDALDPKLKQ"
FT   gene            80176..81162
FT                   /gene="dppD"
FT                   /locus_tag="APP7_0067"
FT   CDS_pept        80176..81162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dppD"
FT                   /locus_tag="APP7_0067"
FT                   /product="dipeptide transport ATP-binding protein DppD"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60719"
FT                   /db_xref="GOA:B3GZQ7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3GZQ7"
FT                   /protein_id="ACE60719.1"
FT                   /translation="MALLTVDQLSVHFGDEKAPFKAVDRISYTINEGEVLGIVGESGSG
FT                   KSVSSLAIMGLIDFPGRVTANSLEFNNNNLLALKPKEKQKIVGADVSMIFQDAMTSLNP
FT                   SYTVGFQIMEALKVHQGGSKAARRERAIELLTMVGIPDPQSRLEVYPHQLSGGMSQRVM
FT                   IAMAIACNPKLLIADEPTTALDVTIQAQIIDLLLELQRKENMALILITHDLALVAESAH
FT                   RIIVMYAGQVVEEGKAELIFKAPLHPYTQALLKALPEFAEGKSRLQSLPGVVPGKYDRP
FT                   QGCLLNPRCPYATDKCRTSEPELRVLNGRQVKCHFPLDENGVPTTQQ"
FT   gene            81175..82164
FT                   /gene="dppF"
FT                   /locus_tag="APP7_0068"
FT   CDS_pept        81175..82164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dppF"
FT                   /locus_tag="APP7_0068"
FT                   /product="dipeptide transport ATP-binding protein DppF"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60720"
FT                   /db_xref="GOA:B3GZQ8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3GZQ8"
FT                   /protein_id="ACE60720.1"
FT                   /translation="MTDLQKNEQNAPLLDAKNLKKYYPVKQGMFAKPKTVKAVDGVSFQ
FT                   LERGKTLAVVGESGCGKSTLGRMLTMIESPTEGELFYKGQNFLVNDKETAALRRKKIQI
FT                   VFQNPYSSLNPRKKVGSILEEPLLINTDLLAAERKAKVLEMMSKVGLKPEFYDRYPHMF
FT                   SGGQRQRIAIARGLMLNPDVVVADEPVSALDVSVRAQVLNLMMDLQEDMGLSYVFISHD
FT                   LSVVEHIADEVMVMYLGRVVEQGETKAIFSNPRHPYTQALLSATPRLNPEQRRERIKLT
FT                   GELPSPLNPPKGCAFHARCRLATEKCKAEQPQLKNYENGTKIACFMVE"
FT   gene            complement(82237..82647)
FT                   /gene="psiE"
FT                   /locus_tag="APP7_0069"
FT   CDS_pept        complement(82237..82647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psiE"
FT                   /locus_tag="APP7_0069"
FT                   /product="phosphate-starvation-inducible protein PsiE"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60721"
FT                   /db_xref="GOA:B3GZQ9"
FT                   /db_xref="InterPro:IPR009315"
FT                   /db_xref="InterPro:IPR020948"
FT                   /db_xref="UniProtKB/TrEMBL:B3GZQ9"
FT                   /protein_id="ACE60721.1"
FT                   /translation="MNISEKFPETITKLLRNILSVLLIILAIVLIIALVKVTYGLCVMI
FT                   ITSGATVPYALAEQIVMFFLYFGFLGLISQYFKSGYHFPLRYFIYAGITAMLRLIIVDH
FT                   ESATNTILFAGAILLMVIALCLVLYSDKLRNI"
FT   gene            complement(82725..83357)
FT                   /locus_tag="APP7_0070"
FT   CDS_pept        complement(82725..83357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60722"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B3GZR0"
FT                   /protein_id="ACE60722.1"
FT                   /translation="MKVFHRHAHIFFIGGAADLEPYYFVGPLHNITIAQKKLARQVKKY
FT                   LAHHANIHFHSLSYNRVYYLSDIELNVLVKIQPQDLIYIIGHSLGGWNATHLARILKDK
FT                   GYRVRILATLDPVGEGTLVWMGSNIFKNPEPKPLADFWINIQAENDDLDLSDIVAQIGR
FT                   QWLLSDEPDINEKLYIHHSDAQRMLRHKLHTGKSIMDYIIENIRQLL"
FT   gene            complement(83412..83756)
FT                   /locus_tag="APP7_0071"
FT   CDS_pept        complement(83412..83756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0071"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60723"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR019897"
FT                   /db_xref="InterPro:IPR035709"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:B3GZR1"
FT                   /protein_id="ACE60723.1"
FT                   /translation="MIQRIDVSKRFSEVAIYNGVAYLAGQVPTDDSQDAYQQTKQVLAE
FT                   IDKCLAKANTDKSKILIATVYLANMAYYDEMNRAWDEWVAENNAPPRAAVEARLANPNW
FT                   KVEIVVTAAI"
FT   gene            complement(83843..84880)
FT                   /gene="ilvE"
FT                   /locus_tag="APP7_0072"
FT   CDS_pept        complement(83843..84880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvE"
FT                   /locus_tag="APP7_0072"
FT                   /product="branched-chain-amino-acid aminotransferase"
FT                   /EC_number="2.6.1.42"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60724"
FT                   /db_xref="GOA:B3GZR2"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005786"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR033939"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:B3GZR2"
FT                   /protein_id="ACE60724.1"
FT                   /translation="MALKDLDWANLGFSYIKTDYRFIAHWKDGKWDEGQLTTDNTLHIH
FT                   EGSTALHYGQQCFEGLKAYRCKDGSINLFRPEENAKRMQGTARRLLMAEVPTELFVRAC
FT                   KEVVKANQDWLGPYGSGATLYLRPFLIGVGDNIGVKAAPEYIFSVFCCPVGAYFKGGLA
FT                   PSNFITTDYDRAAPVGTGGVKVGGNYAASLLPHELAVQQGTATRKFADAIYLDPKTHTK
FT                   IEEVGAANFFGITKGNKFITPASESILPSITKYSLLHIAKERLGMETIEGDVYIDQLDQ
FT                   FAEAGACGTAAVITPVGGIQHKDNFHVFYSETEVGPVTKRLYAELTGIQFGDVEAPEGW
FT                   IVKVE"
FT   gene            complement(85022..85354)
FT                   /gene="ydhD"
FT                   /locus_tag="APP7_0073"
FT   CDS_pept        complement(85022..85354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydhD"
FT                   /locus_tag="APP7_0073"
FT                   /product="monothiol glutaredoxin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60725"
FT                   /db_xref="GOA:B3GZR3"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR004480"
FT                   /db_xref="InterPro:IPR014434"
FT                   /db_xref="InterPro:IPR033658"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B3GZR3"
FT                   /protein_id="ACE60725.1"
FT                   /translation="METIDTIEKIKKQIGENPILLYMKGSPKFPSCGFSARAVEAVINC
FT                   QVPFGYVDILTNPDIRAELPKFANWPTFPQLWVEGELVGGCDIVLEMFQKGELQTLLKE
FT                   VAAKHA"
FT   gene            complement(85426..86091)
FT                   /gene="recR"
FT                   /locus_tag="APP7_0074"
FT   CDS_pept        complement(85426..86091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recR"
FT                   /locus_tag="APP7_0074"
FT                   /product="recombination protein RecR"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60726"
FT                   /db_xref="GOA:B3GZR4"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/TrEMBL:B3GZR4"
FT                   /protein_id="ACE60726.1"
FT                   /translation="MDSSLYCGYPLLIFNYPFLFMQISPLLENLIEALRALPGVGPKSA
FT                   QRMAYHLLQRNRSGGINLSKALNEAMTHIGHCRSCRTFTEEDECNICKNPRRQMSGQLC
FT                   VVEMPEDIQAIEQTGQFSGRYFVLMGHLSPLDGIGPREIGLDLLQSRLENESFHEVILA
FT                   TNPTIEGDATANYIAEMCRIHNVKVTRIAHGIPVGGSLEMVDGTTLSHSFAGRRDISL"
FT   gene            complement(86102..86431)
FT                   /gene="ybaB"
FT                   /locus_tag="APP7_0075"
FT   CDS_pept        complement(86102..86431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaB"
FT                   /locus_tag="APP7_0075"
FT                   /product="uncharacterized protein YbaB"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60727"
FT                   /db_xref="GOA:B3GZR5"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3GZR5"
FT                   /protein_id="ACE60727.1"
FT                   /translation="MFGKGGLGGLMKQAQQMQERMQKMQEEIAQLEVTGESGAGLVKVT
FT                   INGAHNCRRIEIDPSLMEDDKEMVEDLVAAAFNDAVRRAEEMQKEKMASVTAGMQLPPG
FT                   MKFPF"
FT   gene            complement(86600..87457)
FT                   /gene="tonB2"
FT                   /locus_tag="APP7_0076"
FT   CDS_pept        complement(86600..87457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tonB2"
FT                   /locus_tag="APP7_0076"
FT                   /product="protein TonB2"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60728"
FT                   /db_xref="GOA:B3GZR6"
FT                   /db_xref="InterPro:IPR003538"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:B3GZR6"
FT                   /protein_id="ACE60728.1"
FT                   /translation="MKKKHSRIGLTGSILIHTAIFGGLASMVTHSHSDDLPQEETMSME
FT                   LVAALLEQPQVAVAQEEPAPPEPEKVEVEPEPEPEAEAIPELKPQPKPKEKPKEKPKEK
FT                   PKPKEPPKPKEKEKPKKEKVKDKPIKALEKGPEAKQGIVAKAIPNAVQGTQLRAGIPNG
FT                   KPEGNPNGLSANGSQNGAVGGSGSGASGSEIGAYKAALQRALQRRANNAYPTREKMMRK
FT                   TGVVTIGFTVSSSGELINVKVLNSSGNGNLDNAAVKAAQSTKVSPPPAGFPSNVTVPVK
FT                   FSIE"
FT   gene            complement(87467..87856)
FT                   /gene="exbD2"
FT                   /locus_tag="APP7_0077"
FT   CDS_pept        complement(87467..87856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="exbD2"
FT                   /locus_tag="APP7_0077"
FT                   /product="biopolymer transport protein ExbD2"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60729"
FT                   /db_xref="GOA:B3GZR7"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="InterPro:IPR014171"
FT                   /db_xref="UniProtKB/TrEMBL:B3GZR7"
FT                   /protein_id="ACE60729.1"
FT                   /translation="MKKFDEINIIPFIDIMLVLLAIVLVTASFISQGKIPVNIPKATTT
FT                   QAMKADELAKLLTITENNEFYFNDQPITKEALTSEIATWDKTQKVTLKVDGAVAFEKFV
FT                   ELTDVLSANEIKNVAIVTKKDTSKK"
FT   gene            complement(87901..88353)
FT                   /gene="exbB2"
FT                   /locus_tag="APP7_0078"
FT   CDS_pept        complement(87901..88353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="exbB2"
FT                   /locus_tag="APP7_0078"
FT                   /product="biopolymer transport protein ExbB2"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60730"
FT                   /db_xref="GOA:B3GZR8"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="InterPro:IPR014172"
FT                   /db_xref="UniProtKB/TrEMBL:B3GZR8"
FT                   /protein_id="ACE60730.1"
FT                   /translation="MEQMLELLQGHVDYIILGLLLLMSVVLVWKIIERVLFYKQLDVTK
FT                   YDTLQDLEIDTTRNLTTISTIGANAPYIGLLGTVLGILLTFYHLGHSGGDIDAASIMVH
FT                   LSLALKATAAGILVAIPAMMFYSGFNRKVDESKLKWQAIQARKANQ"
FT   gene            88541..88867
FT                   /gene="glpE"
FT                   /locus_tag="APP7_0079"
FT   CDS_pept        88541..88867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpE"
FT                   /locus_tag="APP7_0079"
FT                   /product="thiosulfate sulfurtransferase GlpE"
FT                   /EC_number="2.8.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60731"
FT                   /db_xref="GOA:B3GZR9"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR023695"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3GZR9"
FT                   /protein_id="ACE60731.1"
FT                   /translation="MSETFTEISPHQAWELIENEGATLADIRDGHRYAYSHPQDAFHLT
FT                   NESYGRFLDEVDYEEPVIVMCYHGVSSRNTAQFLVEQGFDRVYSVKGGFDGWERSGLPI
FT                   ETAY"
FT   gene            88911..89756
FT                   /locus_tag="APP7_0080"
FT   CDS_pept        88911..89756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0080"
FT                   /product="putative thioredoxin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60732"
FT                   /db_xref="GOA:B3GZS0"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B3GZS0"
FT                   /protein_id="ACE60732.1"
FT                   /translation="MNYFVNVTESNFSEVWNAATQVPVVFNFISPREVASLEMDSLLRR
FT                   LADENPAQFLLATVNCDEQQALAAQFRIQTIPTMYLFSGGQPVDMIQGAISEQEMRVRL
FT                   ANILPKEEELKFNQALELLQDQCYEEALPLLKSAWEMTDKKNSDFALLYAETFIVMKKV
FT                   EEAREILKQIPIQDRDSRWNGLQAQIELLEQANESPELQQLQADYANNKTPEIAIRLAN
FT                   QLHQAHKNEEALALLFDWLKADLNSANGEVKSQFLAILSALGNDPVVPKFRRQLYSLLY
FT                   "
FT   gene            complement(89830..90237)
FT                   /gene="dhaM"
FT                   /locus_tag="APP7_0081"
FT   CDS_pept        complement(89830..90237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dhaM"
FT                   /locus_tag="APP7_0081"
FT                   /product="PTS-dependent dihydroxyacetone kinase,
FT                   phosphotransferase subunit DhaM"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60733"
FT                   /db_xref="GOA:B3GZS1"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR012844"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="InterPro:IPR039643"
FT                   /db_xref="UniProtKB/TrEMBL:B3GZS1"
FT                   /protein_id="ACE60733.1"
FT                   /translation="MVNLVIVSHSKQLGEGVAEITRQMAQGSCKIAVAAGIDDPDNPIG
FT                   TDAVKIMNAIEDVFSEDGVLIFVDLGSAILSAETAIDLLEPEKAEKVVISYAPLVEGAF
FT                   AAAVAAAGGDDLASVLQEANEAAALKQQQAV"
FT   gene            complement(90246..90872)
FT                   /gene="dhaL"
FT                   /locus_tag="APP7_0082"
FT   CDS_pept        complement(90246..90872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dhaL"
FT                   /locus_tag="APP7_0082"
FT                   /product="PTS-dependent dihydroxyacetone kinase,
FT                   ADP-binding subunit DhaL"
FT                   /EC_number="2.7.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60734"
FT                   /db_xref="GOA:B3GZS2"
FT                   /db_xref="InterPro:IPR004007"
FT                   /db_xref="InterPro:IPR012737"
FT                   /db_xref="InterPro:IPR036117"
FT                   /db_xref="UniProtKB/TrEMBL:B3GZS2"
FT                   /protein_id="ACE60734.1"
FT                   /translation="MAISKQQILQWLENCNQVMTEQRDFLTQLDTEIGDGDHGLNMQRG
FT                   FSKALEKIATVSDKDIGTILKTVGMTLLSQVGGASGPLYGTLFIKGSQVANGKEQLTFE
FT                   ELVSIFKAGVEGIIARGRAEPGDKTLCDVWLPLLDELAQADHSQPEAVLLNQAVEKAEN
FT                   FAKATVPMTAKKGRASYLGERSVGHADPGATSSYYLIKALADAVK"
FT   gene            complement(90874..91944)
FT                   /gene="dhaK"
FT                   /locus_tag="APP7_0083"
FT   CDS_pept        complement(90874..91944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dhaK"
FT                   /locus_tag="APP7_0083"
FT                   /product="PTS-dependent dihydroxyacetone kinase,
FT                   dihydroxyacetone-binding subunit DhaK"
FT                   /EC_number="2.7.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60735"
FT                   /db_xref="GOA:B3GZS3"
FT                   /db_xref="InterPro:IPR004006"
FT                   /db_xref="InterPro:IPR012736"
FT                   /db_xref="UniProtKB/TrEMBL:B3GZS3"
FT                   /protein_id="ACE60735.1"
FT                   /translation="MKKLINSIETVLQEQLTGFAKAHPTITLNTEPTYVRRADAPVAGK
FT                   VALISGGGSGHEPMHAGFVGKGMLDGACPGAIFTSPTPDQMFECGLNVDSGEGVLLLIK
FT                   NYTGDVLNFETATELLADSGVKVATVLIDDDVAVKDSLYTAGRRGVANTVLLEKLLGAA
FT                   ADKGYNLSQLAELGYKLNNAGHSIGVALGACTVPAAGKPSFTLAENEMEFGVGIHGEPG
FT                   IERRPFENLDKTVRQMFETLIAHGDYERTVRRWDNDTQQWNEVLNKKQALQKGDRVIAL
FT                   VNNLGAVPLSELYGVYNVLADCCEQFGLTIERNLVGSFCTSLDMQGVSITLLKVDDETL
FT                   ALWDAPVNTPALRWGE"
FT   gene            92114..93067
FT                   /gene="trxB"
FT                   /locus_tag="APP7_0084"
FT   CDS_pept        92114..93067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trxB"
FT                   /locus_tag="APP7_0084"
FT                   /product="Thioredoxin reductase"
FT                   /EC_number="1.8.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60736"
FT                   /db_xref="GOA:B3GZS4"
FT                   /db_xref="InterPro:IPR005982"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B3GZS4"
FT                   /protein_id="ACE60736.1"
FT                   /translation="MTVKHAKLLILGSGPAGYTAAVYAARANLNPVLVTGMQQGGQLTT
FT                   TDEIENWPGEYEHTTGTGLMDKMLKHAEKFNTEIVFDHINSVDLSKRPFTLKGDINTFT
FT                   CDALIIATGASAKYLGLPSEEAFKGKGVSACATCDGFFYRNKPVAVVGGGNTAVEEALY
FT                   LANIASEVHLVHRRDSFRAEKILLGRLQKRVEEGKIILHTDRTVEEVLGDNMGVTGVRL
FT                   ASTKDESKEEIKVDGFFVAIGHAPNTAIFDGQLELDNGYIKVKSGLEGNATATSVAGVF
FT                   AAGDVMDHNYRQAITSAGTGCMAALDAERFLDALEA"
FT   gene            93175..93927
FT                   /gene="kdsB"
FT                   /locus_tag="APP7_0085"
FT   CDS_pept        93175..93927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdsB"
FT                   /locus_tag="APP7_0085"
FT                   /product="3-deoxy-manno-octulosonate cytidylyltransferase"
FT                   /EC_number="2.7.7.38"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60737"
FT                   /db_xref="GOA:B3GZS5"
FT                   /db_xref="InterPro:IPR003329"
FT                   /db_xref="InterPro:IPR004528"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3GZS5"
FT                   /protein_id="ACE60737.1"
FT                   /translation="MNFTVIIPARYASSRLPRKPLLDIAGKPMIQHVWEKAQQAGATRV
FT                   IIATDHPEIEATAKAFGAEVCMTSDQHNSGTERLAEVIEKMQIADNEIIVNVQGDEPLI
FT                   PPVIVSQVAENLDRCQVNMATLAVKLTTKEELFNPNAVKALADKNGMALYFSRAPIPFA
FT                   RDHFADCDDAFVASQNYLRHIGIYAYRAGFVKQYVAWQPTQLEQLESLEQLRALWYGEK
FT                   IHIELAKQAPQVGVDTQEDLERVRRILA"
FT   gene            complement(94552..95322)
FT                   /gene="nudC"
FT                   /locus_tag="APP7_0086"
FT   CDS_pept        complement(94552..95322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nudC"
FT                   /locus_tag="APP7_0086"
FT                   /product="NADH pyrophosphatase"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60738"
FT                   /db_xref="GOA:B3GZS6"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015376"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:B3GZS6"
FT                   /protein_id="ACE60738.1"
FT                   /translation="MKSYWVLVHHFDLALKDDEIPFGTTEQLGLVGFTKLQVGEYQNSP
FT                   VFLVQLNEQAVENLQNFTMVNLRSQIARPAEFAHLLHRAVSLNHFLNTHKFCGKCGAHT
FT                   ELANNEIAVHCPDCEHRSYPTISPSIIVAVRRGRQILLANHLRHKGTIYTTLAGFVEAG
FT                   EAIETTVQREVWEESGLKIKNIRYFGSQPWAFPNSLMLGFLADYESGEITLQEEEIFDA
FT                   KWFDCDQPLPELPPEGTIALELIKETLKICREER"
FT   gene            complement(95340..96038)
FT                   /gene="rluE"
FT                   /locus_tag="APP7_0087"
FT   CDS_pept        complement(95340..96038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rluE"
FT                   /locus_tag="APP7_0087"
FT                   /product="ribosomal large subunit pseudouridine synthase E"
FT                   /EC_number="5.4.99.12"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60739"
FT                   /db_xref="GOA:B3GZS7"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR018496"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR042092"
FT                   /db_xref="UniProtKB/TrEMBL:B3GZS7"
FT                   /protein_id="ACE60739.1"
FT                   /translation="MMFKAKFNQKNKPRSATNKPNLQNRTKKRPLKLQLSFEDTVVVLF
FT                   NKPFDVLTQFTDEQGRQTLKDFIPIPQIYPVGRLDRDSEGLLLLTNNGEIQHRLANPKF
FT                   EKQKTYLAQVEGIPQAADLAKLEKGVELKDGLTKPAKAKAISAPNYEWQTAPKIRERKT
FT                   IPTSWIELKIHEGKNRQVRRMTAHIGFPTLRLIRIGLGQFQLGELNSGEYRVLDEKEKR
FT                   QLFQQIDLKI"
FT   gene            complement(96039..96887)
FT                   /gene="rhaT"
FT                   /locus_tag="APP7_0088"
FT   CDS_pept        complement(96039..96887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rhaT"
FT                   /locus_tag="APP7_0088"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60740"
FT                   /db_xref="GOA:B3GZS8"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B3GZS8"
FT                   /protein_id="ACE60740.1"
FT                   /translation="MDKHTLALLKVHFTAILFGASGIFGALIESSPDTLVLGRVMIALV
FT                   CISLYFIWKKQPLVKLTHRELFSQILSGVLLTAHWVTFFTAVQVGGVALATLGFASFPA
FT                   FVALFEMLFFREKLSYREGFLLIAITIGLMLVTPEFTFGNNATLGLLWGILSALVYGVL
FT                   AVVNRKTMSKLSGTQTSWWQYLVAMLILLPFSTKGLLNAPALDWFWIFCIGFFCTTLAY
FT                   TLFVSSLDTINARTASMIISLEPVYAIAIAWLCFNEVPTIKMLIGGAIILLSVAWANLK
FT                   K"
FT   gene            complement(96887..97351)
FT                   /gene="fxsA"
FT                   /locus_tag="APP7_0089"
FT   CDS_pept        complement(96887..97351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fxsA"
FT                   /locus_tag="APP7_0089"
FT                   /product="Protein fxsA"
FT                   /function="Protein affecting phage T7 exclusion by the F
FT                   plasmid"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60741"
FT                   /db_xref="GOA:B3GZS9"
FT                   /db_xref="InterPro:IPR007313"
FT                   /db_xref="UniProtKB/TrEMBL:B3GZS9"
FT                   /protein_id="ACE60741.1"
FT                   /translation="MPFLFILFGIFLYIYFEISLLVSIGSQIGVLPLILLLIGISALGL
FT                   WFVKLRGIYAIYSVRNELSQGKIPTQAVIGSLLFILAGVFLIIPGFLSDIIAILLMLPM
FT                   TRQIAERYLMKFFKAKVRFNHFSSGQFSQQDNNTFDAEFERKQDQDKWIK"
FT   gene            complement(97374..98705)
FT                   /gene="pepQ"
FT                   /locus_tag="APP7_0090"
FT   CDS_pept        complement(97374..98705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepQ"
FT                   /locus_tag="APP7_0090"
FT                   /product="Xaa-Pro dipeptidase"
FT                   /EC_number="3.4.13.9"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60742"
FT                   /db_xref="GOA:B3GZT0"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="InterPro:IPR022846"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3GZT0"
FT                   /protein_id="ACE60742.1"
FT                   /translation="MKQLFTQHIKRLQQVVQTILETNFLSGLWIHSGTARYHFLDDQTA
FT                   PFKINPHFNYLFPFPTAENCWLFLDGKNKPTVYFYAPNDYWHTPPVAPTDAFFADEFQW
FT                   VILQDSQEIAKFIQNPTACTFIGEDENLAESLGFNQINPQKVLNQFHFERSIKSEFEIE
FT                   AIYQAQFAALKGHQAAKQAFFEGKSEFEINLAYLKASQQSDLNVPYGNIVAINQHSAIL
FT                   HYTQLDYAPNPQQQSFLIDAGATIHGYASDITRTYAADPNSEFAAMIKQMEQYKYRIID
FT                   QLTVGVNYLSYHTQMQQWIAEMLYEYDFVRLTPEQIFEEGISRAFLPHGLGHLLGLQVH
FT                   DAAGFQQNPRGTRQSPPEVYPSLRCTRDLAENMVLTMELGFYFIDMLLNPLQNSPLARH
FT                   INWHKIAEFKPFGGIRTEDNIVMRSQGAENLTQKAEIELQLSDH"
FT   gene            98729..98968
FT                   /gene="sirA"
FT                   /locus_tag="APP7_0091"
FT   CDS_pept        98729..98968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sirA"
FT                   /locus_tag="APP7_0091"
FT                   /product="sulfurtransferase"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60743"
FT                   /db_xref="GOA:B3GZT1"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR022931"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3GZT1"
FT                   /protein_id="ACE60743.1"
FT                   /translation="MTDIKIDQTLDTLGLRCPEPVMLTRKTIRNMAEGEVLLIVADDPA
FT                   TTRDIPSFCEFMDHQLLNSETENTPYRYWVKKGL"
FT   gene            complement(99018..99458)
FT                   /locus_tag="APP7_0092"
FT   CDS_pept        complement(99018..99458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0092"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60744"
FT                   /db_xref="GOA:B3GZT2"
FT                   /db_xref="InterPro:IPR009671"
FT                   /db_xref="InterPro:IPR016716"
FT                   /db_xref="InterPro:IPR036701"
FT                   /db_xref="UniProtKB/TrEMBL:B3GZT2"
FT                   /protein_id="ACE60744.1"
FT                   /translation="MYDLNELRQETDEIIENLLNDGSDPEALYIIEHHVAHRDFDKLEK
FT                   LVVDAYKLGYEISEAEEVEEENGKVIFVCDIVSEVNLNADIITAQQKELLPLIEKVGAE
FT                   YEGWGTYFEDPNAEDDEYGEDGEFFDDQDEDFEFDQEEITRH"
FT   gene            complement(99460..100002)
FT                   /gene="engB"
FT                   /locus_tag="APP7_0093"
FT   CDS_pept        complement(99460..100002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="engB"
FT                   /locus_tag="APP7_0093"
FT                   /product="putative GTP-binding protein EngB"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60745"
FT                   /db_xref="GOA:B3GZT3"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019987"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030393"
FT                   /db_xref="UniProtKB/TrEMBL:B3GZT3"
FT                   /protein_id="ACE60745.1"
FT                   /translation="MEIAFAGRSNAGKSTALNALTNQKNLARTSKTPGRTQLINLFEVE
FT                   PNCKLVDLPGYGYAAVPEQMKLQWQKALGEYLQKRECLRGVVILMDIRHPLKDLDQQMI
FT                   EWAVSAQLPVLLLLTKADKLSQSARSKTVKMVREAILPFQGDIQVEAYSALNKVGIDKL
FT                   SGKLDSWFAEQFLNQGA"
FT   gene            complement(100361..100777)
FT                   /locus_tag="APP7_0094"
FT   CDS_pept        complement(100361..100777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0094"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60746"
FT                   /db_xref="GOA:B3GZT4"
FT                   /db_xref="InterPro:IPR008523"
FT                   /db_xref="UniProtKB/TrEMBL:B3GZT4"
FT                   /protein_id="ACE60746.1"
FT                   /translation="MIWYKALFSFQGRLNRQGFWIGFAINFIFLFMVANFWLNATDFNL
FT                   ISLLPLALSLYSLSAVIIKRLHDRNRSGKAVIMAFIPLVCYGVSLSAQGTMQWLLGIMM
FT                   PMFIGTMLLLEWGVFKGNPQANRYGEKGLSIKLR"
FT   gene            complement(100815..101645)
FT                   /locus_tag="APP7_0095"
FT   CDS_pept        complement(100815..101645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0095"
FT                   /product="zinc transporter family protein ZIP"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60747"
FT                   /db_xref="GOA:B3GZT5"
FT                   /db_xref="InterPro:IPR003689"
FT                   /db_xref="UniProtKB/TrEMBL:B3GZT5"
FT                   /protein_id="ACE60747.1"
FT                   /translation="MFDLFLSLNPILQAFIAGLFTWGCTIFGAAFVYFFKTVNRKLLDV
FT                   MMGFAAGVMIAASFWSLLAPALEYAEPSYGSLAWLPAAVGFLAGGFFLRMIDKVVPHLH
FT                   LSKPLTDAEGMPKFKQGLSKSMLLFLAITIHNIPEGLALGVTFGALASNVADHQAMLTG
FT                   AIGLAIGIGLQNIPEGSSLSLPIRGEGKSRKQAFLWGAMSAIVEPIAAVIGAAFVLSMT
FT                   AILPYALAFAAGAMIFVVVEELIPESQSGGNTDIATLGLMVGFVIMMVLDVALG"
FT   gene            complement(101796..103631)
FT                   /gene="ilvD"
FT                   /locus_tag="APP7_0096"
FT   CDS_pept        complement(101796..103631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvD"
FT                   /locus_tag="APP7_0096"
FT                   /product="Dihydroxy-acid dehydratase"
FT                   /EC_number="4.2.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60748"
FT                   /db_xref="GOA:B3GZT6"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004404"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3GZT6"
FT                   /protein_id="ACE60748.1"
FT                   /translation="MPILRSATSTQGRNMAGARALWRATGMKENDFGKPIIAVVNSFTQ
FT                   FVPGHVHLRDMGKLVAEQIEAAGGVAKEFNTIAVDDGIAMGHGGMLYSLPSRDLIADSV
FT                   EYMVNAHCADAMVCISNCDKITPGMLMAAMRLNIPAVFVSGGPMEAGKTKLSNQLIKLD
FT                   LVDAMMKSADKTVCDDDVDAIEKSACPTCGSCSGMFTANSMNCLTEALGLSLPGNGSML
FT                   ATHADRKELFLTAGRQIVELCKRYYEQDDASVLPRSIATKAAFENAMSLDIAMGGSTNT
FT                   VLHLLAAAQEAEVDFTMADIDRLSRKVPCLSKVAPNTNKYHMEDVHRAGGIMAILGELE
FT                   RADLLHSDTRTVLGMTIGEQIAKYDITLTKDEAVHKFFRAGPAGIRTTKAFSQDCRWDT
FT                   VDDDRQNGCIRSKEFAYSQDGGLAMLTGNIALDGCIVKTAGVDESILKFTGDAIVFESQ
FT                   EEAVEGILGGKVRAGHVVIIRYEGPKGGPGMQEMLYPTTYLKSIGLGKECALLTDGRFS
FT                   GGTSGLSIGHCSPEAASGGTIGLVRDGDKIAIDIPNRSIQLLVSDEELAVRRAEQDTKG
FT                   WKPANRQREVSMALKMFGHFATSADKGAVRDKTKL"
FT   gene            complement(103749..103967)
FT                   /gene="ilvM"
FT                   /locus_tag="APP7_0097"
FT   CDS_pept        complement(103749..103967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvM"
FT                   /locus_tag="APP7_0097"
FT                   /product="Acetolactate synthase isozyme II small subunit
FT                   (AHAS-II)"
FT                   /EC_number="2.2.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60749"
FT                   /db_xref="GOA:B3GZT7"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="UniProtKB/TrEMBL:B3GZT7"
FT                   /protein_id="ACE60749.1"
FT                   /translation="MQRYDLTLKAEKRPETLERILRVVRHRGFEVLTLNARNNGNQFEI
FT                   ALSVQSERAIELLTHQLSKLIDVTIIE"
FT   gene            complement(103985..105637)
FT                   /gene="ilvG"
FT                   /locus_tag="APP7_0098"
FT   CDS_pept        complement(103985..105637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvG"
FT                   /locus_tag="APP7_0098"
FT                   /product="Acetolactate synthase isozyme II large subunit
FT                   (AHAS-II)"
FT                   /EC_number="2.2.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60750"
FT                   /db_xref="GOA:B3GZT8"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR039368"
FT                   /db_xref="UniProtKB/TrEMBL:B3GZT8"
FT                   /protein_id="ACE60750.1"
FT                   /translation="MNGANLVIESLKAHGVTTLFGYPGGAIMPTYDAIYDSGLDHLLVR
FT                   NEQGAAMAAIGYARATGKVGVCIATSGPGATNLITGLGDAALDSIPVVAITGQVASHLI
FT                   GTDAFQESDVLGLSLACTKHSFIVQNIEELPEIIARAFQIAQSGRPGPVLVDIPRDIQL
FT                   APTSAKPIVYEKQAVEAQNQDLLNEAKTLLANAKRPVLYVGGGVGMAGGVQAVRNFLKV
FT                   TNIPSVSTLKGLGTITIDDPLYMGMIGMHGTKAANYAVQECDLLIACGARFDDRVTGKL
FT                   DTFAPHAKVIHIDIDIAEINKLRKVEVALRGDLVEAVNTLAQPLDIDPWREDVKRLKAD
FT                   LDFQYVDNAGEGDINAKALLNTLSQRKPKNAIITTDVGQHQMWSAQHLQHFAPENFITS
FT                   AGFGSMGFGLPAAVGAVKARPQDPVILVTGDGSIMMNIQELGTLKRGHLPVKILLLDNQ
FT                   RLGMVRQWQSLFFHGRHSNTILDDNPDFVVLASAFGIQGERIEKASEVSDALDRLLNAK
FT                   GAYLLHVCIPEEDNVWPLVPPGACNADMLDDEV"
FT   gene            106064..107545
FT                   /gene="nrfA"
FT                   /locus_tag="APP7_0099"
FT   CDS_pept        106064..107545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrfA"
FT                   /locus_tag="APP7_0099"
FT                   /product="Cytochrome c-552 precursor"
FT                   /EC_number="1.7.2.2"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60751"
FT                   /db_xref="GOA:B3GZT9"
FT                   /db_xref="InterPro:IPR003321"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR017570"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:B3GZT9"
FT                   /protein_id="ACE60751.1"
FT                   /translation="MATIAMLGCLSSAAWAEEKPAQTPSLTDKALKHEKLGVVVESANH
FT                   KFAEKYPLQYNSWKATSESTDRGSALAADPRYVVLWAGYAFAKDYNKPRGHYYAITDVR
FT                   EILRTGAPKDENDGPQPMACWTCKGPDVARLIEEKGERGYFDPKWAKYGAEIVNSIGCA
FT                   DCHDTTSKEFEEGKPALRVARPHVLRALETVGWKFEDLDKHGKRTAVCANCHVEYYFKG
FT                   KTDVTFPWDKGVDVDSIEKYYDEIQFADWTHALSKAPMLKTQHPDFEIWSQGVHGKNGV
FT                   TCVDCHMPKVKDKDGKVYTDHKIGNPFDQFDATCKTCHEQSKETLEKRVKEHKHQVKEA
FT                   MIRLEDQLVKAHFEAKAAWEAGATQEEMKDILTAIRHAQWRWDYSAAGHGSHMHAPDVM
FT                   LHVIASGIDRAADARAQLGVVLAKHGVTTPVAIPDISTKEKAQKAIGLDIPKDQAAKDE
FT                   FLRTVVPQWDAEARKKGLLPAEEPKAVVAPKAEAK"
FT   gene            107566..108213
FT                   /gene="nrfB"
FT                   /locus_tag="APP7_0100"
FT   CDS_pept        107566..108213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrfB"
FT                   /locus_tag="APP7_0100"
FT                   /product="cytochrome c-type protein NrfB precursor"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60752"
FT                   /db_xref="GOA:B3GZU0"
FT                   /db_xref="InterPro:IPR010177"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR017564"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:B3GZU0"
FT                   /protein_id="ACE60752.1"
FT                   /translation="MKNIISKAGRAIALQAVAFASFLAISTASQADMPQQPKPLWTQQA
FT                   SDAQIAEDARRDPNKYCVQCHESANATGKPFHHAGKHFQKDAKSPNTGEQVTCVSCHGN
FT                   ISENHRKGVKDVMRFNPHGKASNPSLERSVHEQNQVCAACHTADKLREKFWAHDTHAAK
FT                   ISCTNCHELHPEKEPMKGIEEKQRIKLCVDCHTKVQKGEFNTPAKTEVKETK"
FT   gene            108213..108890
FT                   /gene="nrfC"
FT                   /locus_tag="APP7_0101"
FT   CDS_pept        108213..108890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrfC"
FT                   /locus_tag="APP7_0101"
FT                   /product="nitrate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60753"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR017567"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B3GZU1"
FT                   /protein_id="ACE60753.1"
FT                   /translation="MTCTRRDFVSGAGAIAVVASTGLATSVTLATEKEEKKIRYAMVHD
FT                   ETSCIGCTACMDACRTTNKVPEGVSRLEIIRSEPYGEFPNVEYEFFRQSCQHCTNAPCV
FT                   AVCPTGASFVDPETGIVDVHSDLCVGCQYCIAVCPYRVRFIHPEKKSADKCNFCRDTNL
FT                   AEGKQPACVEACPTKALTFGDMNDHNSEVYKKVRENPVYRTKVALGTEPNLYHIPFGKG
FT                   EHR"
FT   gene            108890..109858
FT                   /gene="nrfD"
FT                   /locus_tag="APP7_0102"
FT   CDS_pept        108890..109858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrfD"
FT                   /locus_tag="APP7_0102"
FT                   /product="nitrite reductase transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60754"
FT                   /db_xref="GOA:B3GZU2"
FT                   /db_xref="InterPro:IPR005614"
FT                   /db_xref="InterPro:IPR017566"
FT                   /db_xref="UniProtKB/TrEMBL:B3GZU2"
FT                   /protein_id="ACE60754.1"
FT                   /translation="MNSYIPFQTPNLVWDSTIAIYLFLLGISSGAVQLAIAYRNSGAKI
FT                   AKNSDNWVIRSAAILGTLPTLIGLTLLIFHLTKPWTFWKLMFNYNGTSVMSMGVMLFQV
FT                   YMAVLVVWIAIMFKDWLAVLVNRYLPMFKFVLPWVDFAETRLLKAVEFVLFVLAAVLGA
FT                   YTGFLLSALISYPMLNNPVLPALFLASGTSSGIAATFLVILLAGKLSGESNEVHFMHKF
FT                   EVPIMVTELGLLVAFFVGLHFGGADKQLALQNALSGFWGTIFWVGVFLIGILIPLIANI
FT                   FGSHSLKHNVKFIILVSIFDLIGVLCLRYFILYAGQLTVAS"
FT   gene            110146..116847
FT                   /gene="ataA"
FT                   /locus_tag="APP7_0103"
FT   CDS_pept        110146..116847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ataA"
FT                   /locus_tag="APP7_0103"
FT                   /product="autotransporter adhesin"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60755"
FT                   /db_xref="GOA:B3GZU3"
FT                   /db_xref="InterPro:IPR008635"
FT                   /db_xref="InterPro:IPR008640"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR024973"
FT                   /db_xref="UniProtKB/TrEMBL:B3GZU3"
FT                   /protein_id="ACE60755.1"
FT                   /translation="MNKIFKVIWSHVTQTFVVVSELTRSKSKAKASVSDVKMNDVSSLI
FT                   TSGFKLSLISSLLISSIPRAYAAIAIDSTNNLGNAVNNGTAKANAKNSHQAYNYQNPGN
FT                   MYYEGQSDTSRYSGTLEASSGIAIGLNATTIASDNYSSGVAIGDNAMATGGLSFALGAY
FT                   TQATAIGSTVIGTAGLASGFNSLAMMRQSAATNNYAMAIGTASWADGVASLAMGSSATA
FT                   RGKQSIAIGSSDMLAQNGGNGRALTKYDGTNNTQASGVRAIAIGTTARTSADDTIAIGT
FT                   KTRILEKESGSIAIGNTAGTQGIKDTRADYLGYTPITIKDKVGNQQDKIAIGTNSYADG
FT                   HDSIAIGTRAQAIFTNNAPSIGTSRNTENAGAVSIGYQSIAQGDQAVALGSRAEALNRQ
FT                   AMALGNDAFASGVGSIVIGGDDSLPHGSADTAGYQLTTGYNPNSAKFRPSAATGNGAVV
FT                   VGVHSQALSQGSTAIGVAATAGDNDEVKTKDTVKTATAAKEATAVGAKSRAKSEHTTAV
FT                   GYEAKAFGLNSTTVGAESTAESTNSFAGGYKATANGTNATAIGSSAQTKGDDAIAIGTG
FT                   AKALNTNTISIGTGNTVTGANSTAIGDPTTISGTGSHSLGNDNIIPDDNSTVIGNSNVL
FT                   SKGDWSSTSDGSHVVGNNVQIRGENSLAFGNNAMVGDANNEGVSGSVNATAIGTSATAK
FT                   GANALAVGTGAKASKTNNTAIGASATVTKDAGEDNIAFGSGATVTRGKNNVVIGKGSQA
FT                   DSLNGSSIAIGDGATIGNGVTGNGYAIGTGANIASTNGGIAFGNGAKITNSNGGDGSSV
FT                   AIGEGAVATGTRAISLGHKANTDGNQVDSIAIGSSAKTSGNNNIAIGNNATAQGNQAEQ
FT                   IVIGTGANASDTSQYSIVMGSGAGATREHSTVLGSKANSIVDGGVALGANSVSDRQDGG
FT                   SATGHRSTYEPYIPATADQAQKDAINATKGTTGAVSVGSSTVKRQITNLAAGAEDTDAV
FT                   NVAQLKAAVTTAVASSTWNIKENTTQKDVVNSGDNVSFANGVGTTATVEVTDSDKTSTV
FT                   KYSVNKSNLNVATDGTVTAANTGDNFATAEQVAQAINNSEKTTAINNSTTITAKPITVG
FT                   TVTTYDLDLTQETKDKLQQGVDANTTVNTKGITFTADNAGAKTERKLGETLAINGDKTL
FT                   INTTVEAGKVSIAATDKLKTAVTNAESALQEIVTTVNGTTAQTVNKNSNKANFINGKNI
FT                   ELTPSKDGITVATKENVDFTTVNATTVNATTVNGNTIKSGNVVINQDGINAGGQTITNV
FT                   KAGDKGTDAVNVNQLNEVKNTANAGWTIQANGQNGSSVKPNETVSLNNADNNIVISKEA
FT                   SNDNVTFALNSTLNIGNTKPIKIDGTTGTISGLVSTLPNSSTLTAQTRPTTTETILSFA
FT                   ATVGDVLNSGWNLQGNSQAVDFVSAYDTVNFVSGSGTTAEVTVDAGKAVSTVKYSVNKS
FT                   DLSVTGGTVTAGKAGDNFATADQVAKAINDSEKTSSVVSTTQTIKITPKVSGNNTEYDL
FT                   DLSDATKTSLQKADSALQSWTAQANGQDVKTVSKDNATLNFVNGTNIQVTNDKGQIQIA
FT                   TVDAPTFTTVTAGTVNAENFTTGTVSITDNGINAGNQKITNLANGTANSDAVTLAQLNA
FT                   SKSVVQAGNNTHVRSETVTDGSTIYTVDANATTVSGSNALNITKSDAGNNVTNYALDLS
FT                   DKTKGEIKQGVDANTTVNTKGITFTGDTGTTERKLGETLAINGDNKLINTAVKDGQVSV
FT                   SATKALTYAVTNATSALQSIVTTADSKDAQTVNKDSNKANFISGTNIQLTPSKDGITVA
FT                   TKENVDFTTVNATTVNATTVNGDTIKSGDVVITKDGINAGNQTISNVKDGTISENSKEA
FT                   VNGSQLYATNQNVTNNTNNIAKNTADIAKGTVYAGDVGNSFTRPLGETTNVKGGATDNL
FT                   SDNNIGVVSDGKDTLTVKLAKTLTDLTSAEFGEKDSSDKTVINKDGVSSEVIGKDGNVI
FT                   SSTDLTSDGVTSESVIPETQTSSTETADDGTTTQTDTTTDGLDSNAVSSQGMIVSTSTT
FT                   ETKTTAVTPKDGTTGPKITTVETDTVKTTGVDNDGIRINTTKIVTTTTPDGPTTVVENG
FT                   EVSLTSGGLNNGGNRAINIAAGVNATDAVNVSQLEAAKTHYYSVKTTTEQANFNNDTAT
FT                   GENSIAAGPNVWAQGVQSAVFGSMAGASSDKATAVGNDAWALGVSIYGNRFRCCCGRKR
FT                   LCCYR"
FT   gene            116897..125821
FT                   /gene="ataB"
FT                   /locus_tag="APP7_0104"
FT   CDS_pept        116897..125821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ataB"
FT                   /locus_tag="APP7_0104"
FT                   /product="autotransporter adhesin"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60756"
FT                   /db_xref="GOA:B3GZU4"
FT                   /db_xref="InterPro:IPR005594"
FT                   /db_xref="InterPro:IPR008635"
FT                   /db_xref="InterPro:IPR008640"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="UniProtKB/TrEMBL:B3GZU4"
FT                   /protein_id="ACE60756.1"
FT                   /translation="MAIGTHAVVTKADAVAIGHNSGAVNVNTTAIGSGANASGERSTAL
FT                   GNKASSSGNNATALGVEANASGQESNVLGYKANSNGYRAMALGTLSNAAGTMAIALGSQ
FT                   SNASGIKAQAFGSNAIASAEDAIAMGSNANANAVSGVALGNRSMASGVSGVALGDGAAS
FT                   NAQQSISIGKSARTTATNSIALGNASLATADSAIAMGNSSSAVGSNGIAVGAKSKALKD
FT                   NAIALGNNATVTANNALALGLNSVAYSDNAIVLGTTSKATGSHSVAIGTGASAYRQNSI
FT                   AMGKDSSTGGDFAVALGDSANAAAENTLALGKNAIADKKDSVALGNNAYTGDVIATESA
FT                   TLAGKEYKFAGTAPVGTVSIGSEGKERTITNVAAGRISSTSTDAINGSQLYAVSEVASR
FT                   GWNIQANGDTASQVAPGATVQFIDGTNIDITRDGNNITIATATNVVTTDTDKYVTGGTV
FT                   VYNDKGEATATLTGNNGAGGAITGVKNNFVTKSETATDGKKATLTRNDGGTVDIDLTNT
FT                   VNQAVTEATDKGTKYAGDKADTGAAANEFGRKLGETTNVKGGAQGELSDNNIGVVSNGV
FT                   DTLTVKLAKALSGLTSATFGSDATDQTVINKDGVTINSTTPDKTVSLTETGLNNGGNKI
FT                   TNVAEGKAGTDAVNVNQLNQAITNNAYNWNISDGTNNTAVPDSGTVAVKGSANADSANT
FT                   VGVVTELEGTDVKVDLSQKAKDDIANGQKHSSVAGDTNFVVTQTTTNAEGGKQYDVKLA
FT                   DTVVIGKDKTNGGNPVTINGTTGEISGLTNTTWDPDTKYEGGKAATQEQLKSVSDVAQK
FT                   GWNIQANKDTATKVAPGDTVKFIDGENIKITRTGNDITVATAKDVKFDSVKVGDKVSIN
FT                   NDGINAGDTKVTNVTNGTLAADSKDAVNGSQLYATNQNVTNNAANITKNADNIAKGTVY
FT                   AGDRLDATVTGKTNNFTRALGEQTNVVGGATGELSDNNLAVISNGTDTLTVKLAKSLTD
FT                   LTNATFGSTDTDKTVINKDGVTVSSDKPEKEVSLTDKGLNNGNNQITNVTSGLVKRDGN
FT                   PVELSKAEGDVLTNAVNVGDLKTTVTNLTEEGKGGGFGLTAEDNKDVKADLGKTVKVQG
FT                   DGSVKTTVVEKDGQSALQVGLTENVTVGGQDKPGTITVKGENGKDGVSINGKDGSIGLT
FT                   GAPGKDGKDAQATIKVVDGTKGLDGNNGKDGESKTRIVYEKPNGGGTEEIATLNDGLNF
FT                   VGDKGQVIQKKLNETLAIKGNLDAAAVVTDKNLRVDNDKDKNGELIIKMAKSLTDLTNA
FT                   TFSSDDSNTVIGGNGLTITPKAGDEVSLTDKGLNNGNNTIINVAPGVNGTDAVNKDQLD
FT                   GVNATANAGWNLTTNGDNTNASNVAPNSTVDLANTDGNIVITKAGNNVTFDLNNNLTVG
FT                   GPGKDGKDGVDGQLGVQGKDGKTGVTLNGKDGSIGLTGPKGADGKDGANATISVVNGPV
FT                   GVDGTDGKDGKDGMTRIVYTDPKGTTHNVSTLNDGLNFAGNQGDTIVKKLNETLTVKGA
FT                   LANTADASSENLRVDSQDGALVVKLAQNLANLTTATFGNTDTDKTVVSKDGVTISNGSD
FT                   KDKTVSLTDKGLNNGNNQITNVTSGLTDSTGQKSDLANATTTNAVNVGDLKDTVNNLTN
FT                   ATTGGFGLKDDNNTEVKQDLGKTIQIKGKDGVTVTSNVADKSLEVALQGDVTVNGKDGK
FT                   DGSIGVKGADGKDGTKITKDAVVFNGVDGKDGKDGQVSIKVEQGEKGIAGNDGANGTTK
FT                   TRIVYEKPNGDKEQVATLNDGLNFVGDKGQVIQKKLNETLAIKGNLDANATVTDKNLRV
FT                   DNDKDQNGELIIKMAKSLTDLTNATFSSGDINATIGGNGLTITPKGGDVVSLTDKGLNN
FT                   GNNTITNVAPGVNGTDAVNKGQLDGVNATANAGWNLTTNGDNTNASNVAPNSTVDLANT
FT                   DGNIVITKAGNNVTFDLNNNLTVGGPGKDGKDGVDGQLGVQGKDGKTGVALNGKDGAIG
FT                   INGKDGSNGSITVKQGKPGVDGKDGETKTRIAYETKDETGKPTTEEVATLKDGLKFVGD
FT                   TGEVIAKKLNETLAIKGNLTATAAVTDKNLRVDNENGQLIVKMAKSLTDLTNATFGSDN
FT                   SNTTIGGNGVTITPKGGDASNTVSLTDKGLNNGNNQVTNVSTGLKDRDGNNVTLANASG
FT                   DVLNNAVNVGDLKDSVNNLTNATTGGFGLTDEKGNDVKADLGKTVTVQGDGSVKTEVVE
FT                   KDGKKALQIGLTNNVTVGNDKEPGTITVKGENGKDGVSISGKDGISIKGENGQDAVSIN
FT                   GKDGNGAIAVNGKDGKTGVGLDGANGTIGINGKDGSNGTITLAKGEPGVDGKDGKTRIV
FT                   YEAKTPDGKTVTEEVATLKDGLKFVGNDGKVITKELNETLTIKGNLSTAADVTDKNLRV
FT                   DNVDNALIIKMARTLTDLTSATFTNAGGDKSVVDGNGLTITPTKGGNTVSLTTSGLDNG
FT                   GNKVINVAAGDVNANSTDAVNGSQLYAVSEVANKGWNIQTNGNDTTNVKPGDTVNFVNG
FT                   DNIAITNDGTKVTVGLVKNVDLGEDGSIKAGDTFVNKDGVKVGDNVSLTKDGLTAGDVK
FT                   ISATTGINAGDKQITNVASGLGGKKLSEAEGDTLTNAANIGDLQTAVSSVTDASQGGGF
FT                   GLADDKGANVTQNLGKTIAVKGDGKNISTVVKGGALTVNLNKDVDLGKDGSVTTGNTKV
FT                   SDKGVSFADSLVNLTSNGLDNGGNKVTNVKAGDVNANSTDAVNGSQLYATNQNVTNVQN
FT                   EVAKGWNIEAGTVDGGKVFNASKTKVAMGDTVGVKAGKNIEITQDGSNIAIATSANPTF
FT                   ETVTTESVKVGKGDNTVAIETVTDKHGSALKVSGADGKSETRINNVADGKADNDAVNVR
FT                   QLRGVAQNVANIDNRVSKLDKRVRGIGANAAAASSLPQVYIPGKSMVALAGGAYSGASA
FT                   VAVGYSRASDNGKVILKVNGTANSAGHYSGGVGVGYQW"
FT   gene            complement(126062..127288)
FT                   /gene="uraA"
FT                   /locus_tag="APP7_0105"
FT   CDS_pept        complement(126062..127288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uraA"
FT                   /locus_tag="APP7_0105"
FT                   /product="putative uracil permease"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60757"
FT                   /db_xref="GOA:B3GZU5"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR029935"
FT                   /db_xref="UniProtKB/TrEMBL:B3GZU5"
FT                   /protein_id="ACE60757.1"
FT                   /translation="MTNQTISTPKQVFVGLQMLFVAFGALVLMPLITGLDPNTALLTAG
FT                   IGTLLFQLCTKGQVPIFLASSFAFIAPIQYGVQQWGIPTTMGGLVFTGFVYFALSALVK
FT                   WKGANILEKLFPPVVVGPVIIIIGLGLAPTAVDMALGKGTTIEPNTALLISMATLITTL
FT                   IVAVFAKGLMKLVPIMFGIVVGYILSLIFGIIDFSPVTNAAWFSLPKLTTPEFKLEAIL
FT                   YLLPIALAPAVEHVGGIMAISSVTGKDFMTKPGLHRTLLGDGVATSAAAFLGGPPNTTY
FT                   AEVTGAVMLTKNFNPRVMTFAAIWAIAISFCGKVGAFLQTIPGVVMGGIMMLVFGSIAA
FT                   VGMSTLIRAKVDMGEARNLCIVSVVMTFGIGGMLINVGEFSLKGISLCAIAAIIMNLLL
FT                   PKEAAKKAE"
FT   gene            complement(127447..131052)
FT                   /gene="putA"
FT                   /locus_tag="APP7_0106"
FT   CDS_pept        complement(127447..131052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="putA"
FT                   /locus_tag="APP7_0106"
FT                   /product="bifunctional protein PutA"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60758"
FT                   /db_xref="GOA:B3GZU6"
FT                   /db_xref="InterPro:IPR002872"
FT                   /db_xref="InterPro:IPR005933"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR024082"
FT                   /db_xref="InterPro:IPR024089"
FT                   /db_xref="InterPro:IPR025703"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="InterPro:IPR041349"
FT                   /db_xref="UniProtKB/TrEMBL:B3GZU6"
FT                   /protein_id="ACE60758.1"
FT                   /translation="MPTNIYQLLPSSAVLRENISRHYRIDEAELVQQLLIEAETETLQP
FT                   EIKNLARKLIEKVRTNRQKASGVDALMHEFSLSSQEGIALMCLAEALLRIPDQVTRDKL
FT                   IKDKIAKGDWKSHIGNSPSLFVNASAWGLVFTGKLLSLNQQALSSSLNQLISKAGEPVI
FT                   RKGIDFAMRLLGKQFVTGETIQLALKNSEARFNKGFRFTYDMLGESAFTEQDAQHYYQD
FT                   YVNSIHAVGAASKGLGVYHSSGVSVKLSAIHPRYSLAQYDRVMDELYPRLRDLFLLAKR
FT                   YNIGLNIDAEEANRLEISLDLIDRLLSEPELADFDGIGIVVQAYQKRCRSVIDYLIAKA
FT                   RENNRKLMIRLVKGAYWDSEVKLAQTESASGYPVFTRKVHTDLNYVACAKKLLAAQDVV
FT                   FPQFATHNAQTLATIYHLAKGKRFEFQCLHGMGETLYDQVVGKENLNIQCRVYAPVGSY
FT                   QTLLAYLVRRLLENGSNSSFVNQIVDENVSIDKLLEDPVAKAGITAGTMHPKTPLPINL
FT                   FADRKNSAGYELSDMHHLVQLGAQLNALADHNQYRAVPQIAEQFYQGSQRKVIYNPADQ
FT                   TQIVGEVTYANETDVEKAFAIAEQNQTAWQATPAEQRAAILEKIADLMESNMPTLFDLA
FT                   VREAGKTLNNAIAEVREAVDFCRYYANQVKRNPQAYQNPRGIIVAISPWNFPLAIFTGE
FT                   VVSALVAGNVVLAKPAEQTSLMAHYAVELFYQAGVPKNVLQCLPGSGAEIGNKLTADPR
FT                   VDGVIFTGSTETAKTINRNLQKHSKIVPLIAETGGQNALIMDSSALGEQVVADVLNSAF
FT                   DSAGQRCSALRVLYLQEDVADHILTMLKGAMAELRVGKPQLLNTDVGPVIDRTAQSRLL
FT                   AHIEKMKAAAKSYYQVPIAAEVEQNGIFVPPTLLEIDHISQIEHEVFGPVLHVIRFNAD
FT                   QFEQIIDDINSTGFGLTSGLHSRIDATIDQWLDKVHAGNLYVNRNTVGAVVGVQPFGGM
FT                   GLSGTGPKAGGPLYLQRLVKSEAWTLADLEGEAVIETDKLAQAVRQTLTGEQQSEALAL
FT                   LQTLRQKSPLAQVYKMQGITGENNYLRFEARPMIAVSNGSLFAQIKALIAIAVCGSKAV
FT                   VKKDSPLAEYAHQFAEYLTVADDLNSLPKLSVMIVLEPLSGEERQHYAERNGAILTYVE
FT                   SLDLALSLLPLVHEKSVSINTAAAGGNATLMSEMD"
FT   gene            complement(131155..132669)
FT                   /gene="putP"
FT                   /locus_tag="APP7_0107"
FT   CDS_pept        complement(131155..132669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="putP"
FT                   /locus_tag="APP7_0107"
FT                   /product="sodium/proline symporter"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60759"
FT                   /db_xref="GOA:B3GZU7"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR011851"
FT                   /db_xref="InterPro:IPR018212"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:B3GZU7"
FT                   /protein_id="ACE60759.1"
FT                   /translation="MFNFDPTTITFIIYIIGMIAIGFIAYRVTNNLSDYILGGRRLGSF
FT                   VTALSAGASDMSGWLLMGLPGAVYASGLIEGWLAVGLTIGAYLNWKLVAGRLRSHTEHS
FT                   GDALTLPEYFHNRFNDETRIIKILSAVIFLLFFAVYCASGVVAGARVFENLFGVPYENA
FT                   IWYGAVATILYTFIGGFLAVSWTDTIQASLMLFALILTPVFVIMNVGGFEVMQDTIAKA
FT                   GELAQKDYNDIFAGTTVLGVLSLLAWGLGYFGQPHIVVRFMAAESVKSLEKARRISMTW
FT                   MIICLAGAIGIGYFGMAYFFTHPEQAAVVNQNKEQIFIELAKLLFNPWIAGILLSAILA
FT                   AVMSTLSAQLLICSSAITEDLYKGILRPSATDKELVWLGRIMVLAVAALAIYIAQDPNS
FT                   QVFGLVKDAWAGFGSAFGPVVLLSLFWKRMNGFGAISGMLVGALIVYFWKDITLWANLP
FT                   EVYSMIPGFILATLAIVLVSLITPPPSKKVTDTFERADKAYLAELQ"
FT   gene            complement(133244..134029)
FT                   /gene="iclR"
FT                   /locus_tag="APP7_0108"
FT   CDS_pept        complement(133244..134029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iclR"
FT                   /locus_tag="APP7_0108"
FT                   /product="putative HTH-type transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60760"
FT                   /db_xref="GOA:B3GZU8"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B3GZU8"
FT                   /protein_id="ACE60760.1"
FT                   /translation="MTDKESAGSQTLVRGLKLLELLSQYPNGCPLAQLSELANLNKSTV
FT                   HRLLQSLQQEGFVRPAPTTGSYRLSTKCLAIGQRALSSLNILHIAAPHLEALNLKLGET
FT                   VNFAMREGNHAILIYKLEPTTGMMKTRAYIGQRLQLYCSGMGKLFLAYDKAEYIPHYWE
FT                   IQHDTIQQLTPNTITTVPAMNAELEKIRRQQFAMDDEENEMGVSCIACPIFDHQGRVNY
FT                   AISISLSTARLMQVGIDTLRAEIQATSHKISEELGWNFQ"
FT   gene            complement(134026..134601)
FT                   /locus_tag="APP7_0109"
FT   CDS_pept        complement(134026..134601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0109"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60761"
FT                   /db_xref="GOA:B3GZU9"
FT                   /db_xref="InterPro:IPR002698"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:B3GZU9"
FT                   /protein_id="ACE60761.1"
FT                   /translation="MQSHSVQARRQLRQSILNERAKLSLEQQSIASFNLIPQALALINQ
FT                   YHTEHIALYLPFNSEISPLPLIERLQQQNKSLYLPILHPFAKGHLLFQQYDAETLFLTH
FT                   KFGMQQPKPDVRKVKPLNEIEMIFTPLLACDKSGNRLGYGGGFYDRTLALTPQAISVGL
FT                   AYPFQFVENLPTEPWDIPLNHLIIGDIK"
FT   gene            complement(134872..135192)
FT                   /locus_tag="APP7_0110"
FT   CDS_pept        complement(134872..135192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60762"
FT                   /db_xref="GOA:B3GZV0"
FT                   /db_xref="InterPro:IPR007838"
FT                   /db_xref="InterPro:IPR036192"
FT                   /db_xref="UniProtKB/TrEMBL:B3GZV0"
FT                   /protein_id="ACE60762.1"
FT                   /translation="MSANYIEVQIFGQVLRLHCPPDQQENLLASAQRLEERVALLKDQS
FT                   GIIQLEKVLAIVALNLNYELEQEKQKNANNKAVLESCIHQLDNSLSKLLTGSSVAINQE
FT                   SV"
FT   gene            135234..135821
FT                   /locus_tag="APP7_0111"
FT   CDS_pept        135234..135821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0111"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60763"
FT                   /db_xref="InterPro:IPR011978"
FT                   /db_xref="InterPro:IPR036255"
FT                   /db_xref="UniProtKB/TrEMBL:B3GZV1"
FT                   /protein_id="ACE60763.1"
FT                   /translation="MPFFNRITNKTTMAITQSTEFNQLIAQLQIAESAAEVHGFLSGLI
FT                   AGGVQDESWKTLTYQFLNDGHAFSQAPLAELSAFYRQLSESFDEENTLFSLWTPNNEDG
FT                   FALADAIADWSSQFLLGLGLAQPKLSRETDEIGEALDDLEEISKLGYNEDDDNNELLEA
FT                   GEEVVEYLRVLTLFLHSHFALNVKTSEKPQLH"
FT   gene            135927..136991
FT                   /gene="hemE"
FT                   /locus_tag="APP7_0112"
FT   CDS_pept        135927..136991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemE"
FT                   /locus_tag="APP7_0112"
FT                   /product="uroporphyrinogen decarboxylase"
FT                   /EC_number="4.1.1.37"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60764"
FT                   /db_xref="GOA:B3GZV2"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="InterPro:IPR006361"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3GZV2"
FT                   /protein_id="ACE60764.1"
FT                   /translation="MNQLKNDRYLKALLREPVDMTPVWMMRQAGRYLPEYKATRAEAGD
FT                   FMALCRNADLACEVTLQPLRRYALDAAILFSDILTVPDAMGLGLSFGAGEGPKFARPIE
FT                   NKAQVDNLPIPDPESELQYVMNAVRTIRRELKGEVPLIGFSGSPWTLATYMVEGGSSKA
FT                   FTKIKKMMYADPKILHALLDKLADSVILYLNAQIKAGAQAVMVFDTWGGVLAHNEYKEF
FT                   SLRYMHKIVDGLIRENEGRKVPVTLFTKGGGLWLEAIAETGCDAVGLDWTVDIADARRR
FT                   VGHKVALQGNMDPSVLYAQPERIELEVKQILAGFGQGSGHVFNLGHGIHQDVPEQSPKV
FT                   FVDAVHEYSKQYHK"
FT   gene            137115..137705
FT                   /locus_tag="APP7_0113"
FT   CDS_pept        137115..137705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0113"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60765"
FT                   /db_xref="InterPro:IPR007338"
FT                   /db_xref="InterPro:IPR023381"
FT                   /db_xref="UniProtKB/TrEMBL:B3GZV3"
FT                   /protein_id="ACE60765.1"
FT                   /translation="MRNPIHKRMERFESWQHLTFMACLCERMYPNYQLFCDVTQQPEKA
FT                   KIFQNILNLIWEFLTIKGTKINFDNQLEKLEEIIPDVNDYDFFGVLPAQEACEALSELL
FT                   HGIIAGSSLEQAVRISQISLGTVASYLEMQNEKELNEQELKNSEEIQDELDVQWQIYRL
FT                   LNECEARDIELILGLKEDIRTSGISNIGLKFNQ"
FT   gene            137841..138113
FT                   /gene="hupA"
FT                   /locus_tag="APP7_0114"
FT   CDS_pept        137841..138113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hupA"
FT                   /locus_tag="APP7_0114"
FT                   /product="DNA-binding protein HU"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60766"
FT                   /db_xref="GOA:B3GZV4"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:B3GZV4"
FT                   /protein_id="ACE60766.1"
FT                   /translation="MNKTELIDAIAAGAELSKKDAKAALEATLNAISESLKNGDTVQLI
FT                   GFGTFKVNERNARTGRNPRTGEEIKIAASKVPAFVAGKALKDLVK"
FT   gene            complement(138166..139017)
FT                   /gene="thyA"
FT                   /locus_tag="APP7_0115"
FT   CDS_pept        complement(138166..139017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thyA"
FT                   /locus_tag="APP7_0115"
FT                   /product="thymidylate synthase"
FT                   /EC_number="2.1.1.45"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60767"
FT                   /db_xref="GOA:B3GZV5"
FT                   /db_xref="InterPro:IPR000398"
FT                   /db_xref="InterPro:IPR020940"
FT                   /db_xref="InterPro:IPR023451"
FT                   /db_xref="InterPro:IPR036926"
FT                   /db_xref="UniProtKB/TrEMBL:B3GZV5"
FT                   /protein_id="ACE60767.1"
FT                   /translation="MKQYLDLCHRIVNEGKWVENERTGKRCLTVINADLTYNVATGEFP
FT                   LVTTRRSFWKAAIAELLGYIRGYDNAADFRKLGTKSWDANANQNSAWLANPYRKGEDDM
FT                   GLVYGAVGRNFPKADGGSVDLLRQIVDDLKKGVDNRGEIYTFYHPGVFHMGCLRPCLYS
FT                   HHFSLLDGTLYLNSTQRSADVPLGLNWNMIQCYTFLALMAQITGHKAGQAFHKIVNAHI
FT                   YEDQFELMRDVQLKRKPLASPKLWINPAIKSLEDLETWVTLDDFKVESYEYHPAIQYPF
FT                   SV"
FT   gene            139105..139341
FT                   /locus_tag="APP7_0116"
FT   CDS_pept        139105..139341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0116"
FT                   /product="Uncharacterized protein"
FT                   /note="similar to HI0449 precursor"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60768"
FT                   /db_xref="UniProtKB/TrEMBL:B3GZV6"
FT                   /protein_id="ACE60768.1"
FT                   /translation="MKKLMKPIFVCLTLAVLTACSSKSSWTRLNDSEVDQKSYAIAYGA
FT                   TAQTYADRVNESYDIDSFMNGLMIGITKKLICR"
FT   gene            139356..139688
FT                   /locus_tag="APP7_0117"
FT   CDS_pept        139356..139688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0117"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60769"
FT                   /db_xref="UniProtKB/TrEMBL:B3GZV7"
FT                   /protein_id="ACE60769.1"
FT                   /translation="MILNRLMDHNIYAYYSGVLYAADLQGNFNHLDPSCWDLVQTPSMT
FT                   QGIHDAMLDIQKNKVRGDEYIKNGVEQILHLCVKTMVEDEHKQEVNSKAKGKKSAKAAQ
FT                   KQKSAK"
FT   gene            139784..140794
FT                   /gene="bioB"
FT                   /locus_tag="APP7_0118"
FT   CDS_pept        139784..140794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioB"
FT                   /locus_tag="APP7_0118"
FT                   /product="biotin synthase"
FT                   /EC_number="2.8.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60770"
FT                   /db_xref="GOA:B3GZV8"
FT                   /db_xref="InterPro:IPR002684"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024177"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3GZV8"
FT                   /protein_id="ACE60770.1"
FT                   /translation="MTTYNLRLKAKSELTPHPTAQYWRKCQVEELFEMPFMELIFKAAQ
FT                   VHREHFDPQAIQLSTLLSIKTGGCPEECEYCPQSARYDTGLEKQVMMDVEEIVEKAKIA
FT                   KARGASRFCMGAAWRGPKPKDIKVVSEIIGVVKALGLETCGTFGLLEDGMAEDLKQAGL
FT                   DYYNHNLDTDPERYNKIVHTRNHDDRMDTLGKVRHAGLKVCCGGIVGMNETRPERAGLI
FT                   ASLANLDPQPESVPINQLIKVEGTPLENAEDLDWTEFVRTIAVARITMPKSYVRLSAGR
FT                   TSMPEAMQTLCFMAGANSIFYGEKLLTTCNPEEDSDRLLMDKLDLYPLAYEPSDA"
FT   gene            complement(140858..141067)
FT                   /gene="cspC"
FT                   /locus_tag="APP7_0119"
FT   CDS_pept        complement(140858..141067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cspC"
FT                   /locus_tag="APP7_0119"
FT                   /product="cold shock-like protein CspC"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60771"
FT                   /db_xref="GOA:B3GZV9"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:B3GZV9"
FT                   /protein_id="ACE60771.1"
FT                   /translation="MSKATGIVKWFNSTKGFGFITPDQGGKDIFVHFSGIVGSNFRTLE
FT                   EGAKVEFEVQDSERGPSAVNVKTL"
FT   gene            141430..141978
FT                   /gene="proQ"
FT                   /locus_tag="APP7_0120"
FT   CDS_pept        141430..141978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proQ"
FT                   /locus_tag="APP7_0120"
FT                   /product="proQ-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60772"
FT                   /db_xref="GOA:B3GZW0"
FT                   /db_xref="InterPro:IPR016103"
FT                   /db_xref="InterPro:IPR023529"
FT                   /db_xref="InterPro:IPR036442"
FT                   /db_xref="UniProtKB/TrEMBL:B3GZW0"
FT                   /protein_id="ACE60772.1"
FT                   /translation="MSEQQVKIQNGNKTNPSVKEVITYLAEKFPLCFSVEGEAKPLKVG
FT                   LFQDLAEALANDEKVSKTLLRQALRTYTMSWRYLACCKANVQRVGLQGEEAGIVDEAQA
FT                   EHAAQTLTVAKEAYAARKAEQRKEQRKEFFKKKAQEEKAKKNAANQVKKTPRVAKEASV
FT                   KATAESLAALTSKFGKGNK"
FT   gene            142070..144082
FT                   /gene="prc"
FT                   /locus_tag="APP7_0121"
FT   CDS_pept        142070..144082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prc"
FT                   /locus_tag="APP7_0121"
FT                   /product="tail-specific protease precursor"
FT                   /EC_number="3.4.21.102"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60773"
FT                   /db_xref="GOA:B3GZW1"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR020992"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR040573"
FT                   /db_xref="UniProtKB/TrEMBL:B3GZW1"
FT                   /protein_id="ACE60773.1"
FT                   /translation="MKINQLSRLIAICFGTIVSSAFAVEPQIQESALVTPKPTEQHSLS
FT                   TKRVTARLTQSHYHKFKLDDEFADKIFNRYMDWLDGAHNTFLQSDIDEMRAKYAAKLDD
FT                   ELYEGKLDSAFEIYDLMTKRRYGRYKYALSLLDKEPNLKGSDQIENDREKAAFPATVEE
FT                   ANQLWEQRVKNDVINLYLKDKKWPEIKKTLIKRYNLAIKRLTQIKADDVLQTYLNAFAR
FT                   EIDPHTSYLSPRAAKAFQESMNLSLEGIGATLAMEDDVTTIKSLVPGAPAARSKKLVVG
FT                   DKIVGVGQDNDEIEDVIGWRLDDVVDKIKGKKGTKVRLEIEPEKGGKTKVITLVRDKVR
FT                   LEDSAAKLTVDKINGKNVAVIKISTFYIGLTNDVRKLLDEMKTKKVDGLIIDLRENGGG
FT                   SLTEVVELTGLFIKDGPVVQVRDAFNRIKVHEDPEADKSLYDGKIMVMINRHSASASEI
FT                   FAAAMQDYNRAIIVGQQTFGKGTVQQSRSLNFVYDLDQEPLGFIQYTIQKFYRIDGGST
FT                   QLKGVEADIKFPEIINAEKTGESFEDNALPWDKIPAASYQEAGHARDAVSALTAKHEER
FT                   IAKEPEFITLNEDIAIRKERDARKYSSLNLEERLKEDRADEAKRLKDLNARFAREGKKA
FT                   IKNIDALPKDYEAPDFFLKEAEKMMVDWLEIDKKS"
FT   gene            144179..144985
FT                   /locus_tag="APP7_0122"
FT   CDS_pept        144179..144985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0122"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60774"
FT                   /db_xref="UniProtKB/TrEMBL:B3GZW2"
FT                   /protein_id="ACE60774.1"
FT                   /translation="MSKAKTFKLLPLVMLSSVVLAETNATHLQAASTENATVNHATSDA
FT                   ILPQLSFSAQQARAAELAKRADYVFEQEQIRLEEERKLQEAVLKVKQTVGDNQLLLTKS
FT                   VAKIYLDNDYASMWNDKHAEKQFLKEYALFAASGVSSKSAKALQQILNHPEGLGRDILL
FT                   TDGFLDYLYYNKNVYKNANQWLYNLGSYSPKSPSSEQINQWVESTKNGDSAQFVANLVP
FT                   RNHIYQETVQRVLAMSAGGNTEKVAKAKKTKRLSRQRQPVTIRSIN"
FT   gene            145102..145743
FT                   /gene="ycbB"
FT                   /locus_tag="APP7_0123"
FT   CDS_pept        145102..145743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycbB"
FT                   /locus_tag="APP7_0123"
FT                   /product="Uncharacterized protein"
FT                   /function="Uncharacterized protein conserved in bacteria"
FT                   /note="similar to HI1667"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60775"
FT                   /db_xref="GOA:B3GZW3"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:B3GZW3"
FT                   /protein_id="ACE60775.1"
FT                   /translation="MIVGRDDRRTPVMYSKLSNVVVNPPWNIPPTILNKDIVPKLAKNP
FT                   GFADAAGYEIFDGKGNKINPRSVNWAQYVNSKNLPYRIRQKAGDDSALGRFKFNMPSSD
FT                   AIYLHDTPNRGLFGKTDRALSSGCVRVERSDDLASILLKEAGWSMDKKQKVLASQKTTS
FT                   ANIRSDNPVYLYYVTAWVENGKVYTLPDIYKFDTSIPKNAVNWSKVKSVI"
FT   gene            145915..146469
FT                   /locus_tag="APP7_0124"
FT   CDS_pept        145915..146469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0124"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60776"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="InterPro:IPR010275"
FT                   /db_xref="UniProtKB/TrEMBL:B3GZW4"
FT                   /protein_id="ACE60776.1"
FT                   /translation="MNQINVQRRKWLSLGGLVLGASLLPSKVMALLSTPTPLALRFRNI
FT                   NTGDTYAATFSNGSLSSGDLGKLNYLMRDRHTNQVKRIDPMLFVKLNQIQQRLGFRNAE
FT                   VLVLSGYRSAQTNARMHRTRRGVASNSYHIRGQAVDFRISGVPLAKLKAAAESLHNGGV
FT                   GYYPRSNFVHVDTGPVRTWRG"
FT   gene            146487..147116
FT                   /locus_tag="APP7_0125"
FT   CDS_pept        146487..147116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0125"
FT                   /product="glyoxalase II family protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60777"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:B3GZW5"
FT                   /protein_id="ACE60777.1"
FT                   /translation="MFNLQIIPVSAFQQNCSVIWDDNKNAAIIDAGDDADKIIQFVESQ
FT                   NLKVQKLLLTHGHLDHIMAVEKVRDHFGVEVYGSHIDDKPLFEQLPQMCEMFGIPPVKA
FT                   FLPDHWLSEDDRVEVGALRFSVRHLPGHAPGHIGFFDFENKIAFSGDVLFKDSIGRTDL
FT                   YLGNLDVLLNTIRTKMFDLDDDFIVVAGHGPHTTIGREKQHNPFLK"
FT   gene            complement(147119..147868)
FT                   /locus_tag="APP7_0126"
FT   CDS_pept        complement(147119..147868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0126"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60778"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:B3GZW6"
FT                   /protein_id="ACE60778.1"
FT                   /translation="MNTLDWLESQQQAVVFCKNLAGLTACSQQIQLASGERFVLRQQND
FT                   RATAFGINYAQEAQILHYLTRLTFTPKVYYHNENSSLLTWIEGNTANCFSSSLLNKLAL
FT                   QLAELHLFPITESLPKLDLAKRCQFLWQKLPVTKQATLRFRPPFQTIQPFTLAICHHDL
FT                   HLGNFIEKNDRLYLIDWEYSAVSDPALEIAMLFSANPAINQQQQTEFLRIYLQETQFNE
FT                   GKFKRKMAEYHSAIYQLNQLWFTILEP"
FT   gene            complement(147865..148218)
FT                   /locus_tag="APP7_0127"
FT   CDS_pept        complement(147865..148218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0127"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60779"
FT                   /db_xref="InterPro:IPR010824"
FT                   /db_xref="InterPro:IPR038483"
FT                   /db_xref="UniProtKB/TrEMBL:B3GZW7"
FT                   /protein_id="ACE60779.1"
FT                   /translation="MVIGSFFAFLTACGSNPQSYIKGKSAPIVNVEAQIATQIEIDAKS
FT                   EKVSVTNLTEYPLNLSYKLFWYDNQGITQTNNNISMQPWLSLWLNGKQSQTLSLEKPTA
FT                   ESSNYRIYLRGNR"
FT   gene            complement(148240..148605)
FT                   /locus_tag="APP7_0128"
FT   CDS_pept        complement(148240..148605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0128"
FT                   /product="HIT-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60780"
FT                   /db_xref="GOA:B3GZW8"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR019808"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:B3GZW8"
FT                   /protein_id="ACE60780.1"
FT                   /translation="MSNTTFEETIFSKIIRKEIPAAIVYQDELVTAFRDISPQAPTHIL
FT                   IVPNKLIPTVNHVEAEDELALGRLFTVAAKIAKEEGIAEDGYRLIVNCNVHGGQEVFHI
FT                   HMHLVGGEPLGKMLNNK"
FT   gene            complement(148677..149507)
FT                   /gene="yfeD"
FT                   /locus_tag="APP7_0129"
FT   CDS_pept        complement(148677..149507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfeD"
FT                   /locus_tag="APP7_0129"
FT                   /product="putative iron transport system membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60781"
FT                   /db_xref="GOA:B3GZW9"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:B3GZW9"
FT                   /protein_id="ACE60781.1"
FT                   /translation="MNELVLWFVEPFAFEFMQTALFTAVLVASVCAVLSCYLILKGWSL
FT                   MGDAISHAVLPGVVISSLLGLPLAIGAFTSGLFCAISVGYLKENSRLKEDTIMGIMFSG
FT                   LFALGIVLFTALPSDQHLTHLLFGNLLGVTQNELIQTIIICTLTFSVIIFKRKDFLLYC
FT                   FDSNHAKVIGLPVKRLHYGLLALLALTIISAMQVVGVILVVAMLIAPGITAYQLSNRFD
FT                   YMLAIAMTIAISSSALGTILSYHIDAATGPTIILIQSIVFVIVLISKHFQKRKR"
FT   gene            complement(149500..150354)
FT                   /gene="yfeC"
FT                   /locus_tag="APP7_0130"
FT   CDS_pept        complement(149500..150354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfeC"
FT                   /locus_tag="APP7_0130"
FT                   /product="putative iron transport system membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60782"
FT                   /db_xref="GOA:B3GZX0"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:B3GZX0"
FT                   /protein_id="ACE60782.1"
FT                   /translation="MLELLLEPFQYNYMQKAIFVSMGVGVVCAFLSAFLMLKGWSLIGD
FT                   ALSHAVVPGVAIAYALKLPYAFGAFFSGILAALAILWVKSITRIKEDAVIGFIFTTFFA
FT                   LGMFIVSLNPTSVDVNAIVMGNILGIADEDLWQVAIIIGLSLLGLIFFWKDLLLTFFDE
FT                   HHALSVGLSPLRYKILFFTLLSACVVVALQTVGAILVIAMVVTPGATAYLLTDKFPRLV
FT                   IIAILIGSLSSGIGAYLSYFLNGATGGVIVCLQTCIFLLAFCFAPKYGLISQKSKRLGA
FT                   INE"
FT   gene            complement(150355..150948)
FT                   /gene="rnhB"
FT                   /locus_tag="APP7_0131"
FT   CDS_pept        complement(150355..150948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnhB"
FT                   /locus_tag="APP7_0131"
FT                   /product="ribonuclease HII"
FT                   /EC_number="3.1.26.4"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60783"
FT                   /db_xref="GOA:B3GZX1"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022898"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3GZX1"
FT                   /protein_id="ACE60783.1"
FT                   /translation="MSTNFIYPNAHLIAGVDEVGRGPLVGAVVTAAVILDPNNPIEGLA
FT                   DSKKLSEKKRLLLAEEIKAKALCWSLGRAEPEEIDRLNILHATMLAMQRAVAGLNIQPD
FT                   FVLVDGNRIPTLPMPAQAVIKGDSLVAEISAASILAKVARDQEMAELDVQYPEYGFAKH
FT                   KGYPTKLHFEKLEQFGATPFHRKSFAPVKKILGL"
FT   gene            complement(150971..152005)
FT                   /gene="engC"
FT                   /locus_tag="APP7_0132"
FT   CDS_pept        complement(150971..152005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="engC"
FT                   /locus_tag="APP7_0132"
FT                   /product="putative GTPase EngC"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60784"
FT                   /db_xref="GOA:B3GZX2"
FT                   /db_xref="InterPro:IPR004881"
FT                   /db_xref="InterPro:IPR010914"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030378"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3GZX2"
FT                   /protein_id="ACE60784.1"
FT                   /translation="MSKRRLTQNQQRRIKSNHHKKIAKPELEWQDEMLGEVQQGIVVTR
FT                   HAKHADVETEQGEIYRCNLRRTLKNVVVGDQVSWRKGNEQLQGISGVIEAIYPRKNELS
FT                   RPDYYDGIKVMAANIDQIIIVSAVLPTLSLNIIDRYLVICETAKIPALIVLNKIDLLSE
FT                   SERQEVQKQLAIYENIGYETLCLSADTGENMEKLDRYLSRGTSIFVGQSGVGKSSLINQ
FT                   LLPEVNALTGAVSDISGLGQHTTTSSRLYHLPQGGNLIDSPGIREFGLWHLEPEQITLG
FT                   YREFQSVLGTCKFRDCKHKSDPGCAVREAVEKGEINAIRFENYHRLIESRDETKSQRHF
FT                   RTEE"
FT   gene            152515..153405
FT                   /gene="gcvA"
FT                   /locus_tag="APP7_0133"
FT   CDS_pept        152515..153405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcvA"
FT                   /locus_tag="APP7_0133"
FT                   /product="glycine cleavage system transcriptional
FT                   activator-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60785"
FT                   /db_xref="GOA:B3GZX3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B3GZX3"
FT                   /protein_id="ACE60785.1"
FT                   /translation="MNKRLPPLNALKAFESAARHLNFTKAADDLFVTQAAVSHQIKLLE
FT                   DFLGVSLFHRRNRLLELTEIGAQYFEEIQPLLEQIAVATEKVKLKNSRQILSISTTPSF
FT                   GMHWLVPRLNKFHKKYPDIEVRLTTASQDEGLLDKDIDVAIYYGSGNWQNLEAIELVQA
FT                   RIMILASPEYLRDHPITKPEDLEGKNLIHVCSHTKWKQMAEHLNLNNLEVESGPMYSNT
FT                   SMGMQAAKHGQGVVVANRILAQNAIEEGSVIEAFTTDVYDEKAFYVVYPPQMAEVAKVK
FT                   HFVEWITHEIKGSYK"
FT   gene            153405..154085
FT                   /locus_tag="APP7_0134"
FT   CDS_pept        153405..154085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0134"
FT                   /product="putative haloacid dehalogenase-like hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60786"
FT                   /db_xref="GOA:B3GZX4"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR011951"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:B3GZX4"
FT                   /protein_id="ACE60786.1"
FT                   /translation="MKYDWVLFDADETLFSFNSYLGLTSMLKRYGIEFTREDYEAFQAV
FT                   NKPLWVAYQNNEITAQDIQTRRFAKLSAQTGIDALQLNQELMAEMALVSKPLDGVMAML
FT                   EQLYGKVKMGIITNGFTELQQKRLANTHTEKFFEIVVVSEQIGAAKPDRQVFDYAFTLM
FT                   EQEDKTKVLMVGDTLASDVLGGNNAGIDTCWFNHSKSKNETQIRPTYEISSMDQLIEIV
FT                   KGTE"
FT   gene            154085..155068
FT                   /gene="cysB"
FT                   /locus_tag="APP7_0135"
FT   CDS_pept        154085..155068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysB"
FT                   /locus_tag="APP7_0135"
FT                   /product="HTH-type transcriptional regulator CysB"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60787"
FT                   /db_xref="GOA:B3GZX5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037423"
FT                   /db_xref="UniProtKB/TrEMBL:B3GZX5"
FT                   /protein_id="ACE60787.1"
FT                   /translation="MKLQQLRYIVEIVNQNLNITEAAETLYTSQPGISKQVRLLESELG
FT                   INIFERNGKHIKGLTPAGEKIVAIARELLVKAQSIKSVAEEQTRPNRGVLRIATPNTQA
FT                   RYVLPPIIEKFKAKYPEVSLQLHQGSPSQIYDALMAGEVDLAITTEAQHLFEDAILLPC
FT                   YLWNRSVIVKPDHPLVKFVNQSENLTVEELGKYDLITYTFGFTGQSDLDHAFNKEGILP
FT                   HIVFTATDADVIKTYVRLGLGVGIMASMAHTPADSDLVAIDASHLFQSSMTQIAFKRGT
FT                   FLRNYMYDFINYFSPHLTKMQVEKAEQLRESNAILRLFESTKLEEK"
FT   gene            155069..155713
FT                   /locus_tag="APP7_0136"
FT   CDS_pept        155069..155713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0136"
FT                   /product="protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60788"
FT                   /db_xref="UniProtKB/TrEMBL:B3GZX6"
FT                   /protein_id="ACE60788.1"
FT                   /translation="MGFIKKIALSFVAIFALISTAWADDFNIKYSSNYLMPAYVHFKNG
FT                   GGQYSIQSKINVPLYNIVFSAKGTERNGQFNMLSYRDTRNGKTYALAEIDSSTVKYGKA
FT                   KDPLKQEALTMPTFDLFTTAFQLSYYDQLPTSFQTTNGKKLYPTPNVKLHKVQKAVTVK
FT                   GQTYQEITYSFKTSDQKAITVKKYVGEKFPRYISYNRDGDNYELTFDSFVK"
FT   gene            complement(155792..156841)
FT                   /gene="ansB"
FT                   /locus_tag="APP7_0137"
FT   CDS_pept        complement(155792..156841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ansB"
FT                   /locus_tag="APP7_0137"
FT                   /product="probable L-asparaginase periplasmic precursor"
FT                   /EC_number="3.5.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60789"
FT                   /db_xref="GOA:B3GZX7"
FT                   /db_xref="InterPro:IPR004550"
FT                   /db_xref="InterPro:IPR006034"
FT                   /db_xref="InterPro:IPR020827"
FT                   /db_xref="InterPro:IPR027473"
FT                   /db_xref="InterPro:IPR027474"
FT                   /db_xref="InterPro:IPR027475"
FT                   /db_xref="InterPro:IPR036152"
FT                   /db_xref="InterPro:IPR037152"
FT                   /db_xref="InterPro:IPR040919"
FT                   /db_xref="UniProtKB/TrEMBL:B3GZX7"
FT                   /protein_id="ACE60789.1"
FT                   /translation="MKLKKLALSAVLSMAISSVYAAELPNITILATGGTIAGSGQSAVS
FT                   SAYQAGQLNIDTLIEAVPEMKTLANIKGEQVVKIGSQDMSDEVWLKLAKTVNSQCANTD
FT                   GFVITHGTDTMEETAYFLDMTVKCDKPVVLVGAMRPATEKSADGPLNLYNSIVVAKDKK
FT                   SAKRGVLVAMNDVVLGARDVTKTSTTAVQTFSSPNFGTLGYIHNSKVDYERAPESKHTL
FT                   NTPFTVDKLNELPKVGIIYAYSNMPTEPLKALFDAGYQGIVVAGVGNGNMNAANLALLE
FT                   QAAKNGVAVVRSSRVPTGYTTRDAEVDDSKYGFAASGTLNPQKARVLLQLALTQTKDIN
FT                   TIQQYFEDF"
FT   gene            157145..158782
FT                   /gene="pyrG"
FT                   /locus_tag="APP7_0138"
FT   CDS_pept        157145..158782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrG"
FT                   /locus_tag="APP7_0138"
FT                   /product="CTP synthase"
FT                   /EC_number="6.3.4.2"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60790"
FT                   /db_xref="GOA:B3GZX8"
FT                   /db_xref="InterPro:IPR004468"
FT                   /db_xref="InterPro:IPR017456"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033828"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3GZX8"
FT                   /protein_id="ACE60790.1"
FT                   /translation="MATNYIFVTGGVVSSLGKGIAAASLASILEARGLNVTIMKLDPYI
FT                   NVDPGTMSPTQHGEVFVTQDGAETDLDLGHYERFIRSKMSKANNFTSGKIYSEVLRKER
FT                   RGDYLGATIQVIPHITNEIKERVIEGGKGRDVVIVEVGGTVGDIESLPFLEALRQLAVD
FT                   VGREKTLFMHLTLVPYIPTAGEVKTKPTQHSVKELLSIGIQPDVLICRSDRAIPSNERK
FT                   KIALFCNVPERAVISLKDVDSIYRIPELLKSQGLDTFVCDRFRLDCPEADLSEWEQVLY
FT                   RQANPTGEVTIGMVGKYVELPDAYKSVNEALKHAGLTNRLTVNIKYIDSQDIETKGVEL
FT                   LHGLDAILVPGGFGYRGVEGKIRTAQYARENKIPYLGICLGMQIALIEYARNVAGLTQA
FT                   NSSEFDKDCPQPVVGLITEWQDESGNVETRSDESDLGGTMRLGAQQCHLIEGTKAREVY
FT                   GAETIVERHRHRYEVNNTLLPQIEAAGLKVSGLSADRKLVEIIEIPNHPWFIAAQFHPE
FT                   FTSTPRDGHPLFAGFVKAAKDYQDSHKA"
FT   gene            158882..159388
FT                   /locus_tag="APP7_0139"
FT   CDS_pept        158882..159388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0139"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60791"
FT                   /db_xref="GOA:B3GZX9"
FT                   /db_xref="InterPro:IPR019275"
FT                   /db_xref="UniProtKB/TrEMBL:B3GZX9"
FT                   /protein_id="ACE60791.1"
FT                   /translation="MADPHIKSPMDFWDYFTVIMYRLGFVVASIMVLLLPYQTEWASFG
FT                   LLIAGTMLASSLHLYLKRFRLIFQFVAWIGLLCQIFGLPIFALGAMLLVVGGLSYKEYF
FT                   CFRVFGLNAQPLLVAVIWLTILLDQMLLLQISSGISGILLVVLSIQKWRMPLHFDIGDK
FT                   TKFEV"
FT   gene            complement(159434..160036)
FT                   /gene="leuD"
FT                   /locus_tag="APP7_0140"
FT   CDS_pept        complement(159434..160036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuD"
FT                   /locus_tag="APP7_0140"
FT                   /product="3-isopropylmalate dehydratase small subunit"
FT                   /EC_number="4.2.1.33"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60792"
FT                   /db_xref="GOA:B3GZY0"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR004431"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3GZY0"
FT                   /protein_id="ACE60792.1"
FT                   /translation="MAGLKQHSGLVVPLDAANVDTDAIIPKQFLQAITRVGFGKHLFHE
FT                   WRYLDAEETRLNPDFVLNFPQYQGATILLARKNLGCGSSREHAPWALADYGFKVMIAPS
FT                   FADIFYNNSLNNHMLPIRLSEEEVEEIFQWVWANEGKQIHIDLEAMTVTVGDKIYRFEL
FT                   DEFRRHCLLNGLDNIGLTLQHEDAIIAYESKIPAFLR"
FT   gene            complement(160046..161455)
FT                   /gene="leuC"
FT                   /locus_tag="APP7_0141"
FT   CDS_pept        complement(160046..161455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuC"
FT                   /locus_tag="APP7_0141"
FT                   /product="3-isopropylmalate dehydratase large subunit 2"
FT                   /EC_number="4.2.1.33"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60793"
FT                   /db_xref="GOA:B3GZY1"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004430"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3GZY1"
FT                   /protein_id="ACE60793.1"
FT                   /translation="MAKTLYEKLFDAHVVYEAAGETPILYINRHLIHEVTSPQAFDGLR
FT                   VAGRQVRQIGKTFGTMDHSISTQVRDVNKLEGQAKIQVLELAKNCEANGISLFDMQTKE
FT                   QGIVHVMGPEQGLTLPGMTIVCGDSHTATHGAFGALAFGIGTSEVEHVLATQTLKQARA
FT                   KSMKVEVRGKVNPGITAKDIVLAIIGKTTMAGGTGHVVEFCGEAIRDLSMEGRMTVCNM
FT                   AIEFGAKAGLVAPDETTFAYLKGRPHAPKGKDWDDAVEYWKTLKSDDDAVFDSVVVLEA
FT                   KDIAPQVTWGTNPGQVIGIDQVVPNPQEMADPVTKASAEKALAYIGLDANTDMKNIPVD
FT                   QVFIGSCTNSRIEDLRAAAAVMKGRKKADNVKRVLVVPGSGLVKEQAEKEGLDKIFIEA
FT                   GAEWRNPGCSMCLGMNDDRLGEWERCASTSNRNFEGRQGRNGRTHLVSPAMAAAAAMFG
FT                   KFVDIRHVELN"
FT   gene            161799..162914
FT                   /locus_tag="APP7_0142"
FT   CDS_pept        161799..162914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0142"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60794"
FT                   /db_xref="InterPro:IPR008599"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="InterPro:IPR041522"
FT                   /db_xref="InterPro:IPR042070"
FT                   /db_xref="UniProtKB/TrEMBL:B3GZY2"
FT                   /protein_id="ACE60794.1"
FT                   /translation="MILKLDIPTAQTIVKRTMQIIPNSVNVMDEEGIIIASGDPSRLGE
FT                   RHTGAVIALRKKQSVEIDENLAKQWNYEAREGLNLPIAYLGKTVGVIGISGKPNEVRQY
FT                   GELVKMAAELIVEQSVLLAKERWQQRYKEEFIRQLLRGALSEAEITQQAVFFKLDSTKP
FT                   LVAMIIKMEQPDAEKLQLLLNHLELNSKHIALAVMDLDKLVLLKTEEEFQRLSKDRGLL
FT                   SLLPEHNRNQEYKIVVGAKVTHFHQASFSYQSALHTLSYAEQLRLKKQILLFSDYKLPA
FT                   LLADFAKTWQSEELLSPFKILLAQDGKATLFKSLQQYFLSNCDLAHASEKLFIHPNTLR
FT                   YRLEKIEQITSLSFNKIEDKFILYLGASLLK"
FT   gene            163042..164304
FT                   /locus_tag="APP7_0143"
FT   CDS_pept        163042..164304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0143"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60795"
FT                   /db_xref="GOA:B3GZY3"
FT                   /db_xref="InterPro:IPR003474"
FT                   /db_xref="UniProtKB/TrEMBL:B3GZY3"
FT                   /protein_id="ACE60795.1"
FT                   /translation="MVTVTAIGAVVALSVAIVLILKKVPPAYGMLIGALVGGLIGGADL
FT                   SQTVSLMIGGAQGITTAVMRILAAGVLAGVLIESGAASTIAETIVKKLGETRALLALVL
FT                   STMILTAVGVFVDVAVITVSPIALALAKRSDLSKPAILLAMIGGGRAGNIMSPNPNAIA
FT                   ASDAFHLPLTSVMAVGIIPAIFGIILTYFLAKRLINKGSKVADGEVAANNSQNLPAFLP
FT                   AIAAPLCAIILLALRPIADIKVDPLIALPLGGLVGALAMGKLKQVNQFATSGLLKMSPV
FT                   AVMLLGTGALAGIIANSGLKDVLIEALTASGLPSYLLAPISGALMSLATASTTAGTVVA
FT                   SNVFSTTLIELGVSALASAAMIHSGATVLDHMPHGSFFHATGGSVNMDIKERLKLIPYE
FT                   TAVGLIMAIVSTLVFGVFKLF"
FT   gene            164315..165448
FT                   /gene="glxK"
FT                   /locus_tag="APP7_0144"
FT   CDS_pept        164315..165448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glxK"
FT                   /locus_tag="APP7_0144"
FT                   /product="glycerate kinase"
FT                   /EC_number="2.7.1.31"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60796"
FT                   /db_xref="GOA:B3GZY4"
FT                   /db_xref="InterPro:IPR004381"
FT                   /db_xref="InterPro:IPR018193"
FT                   /db_xref="InterPro:IPR018197"
FT                   /db_xref="InterPro:IPR036129"
FT                   /db_xref="UniProtKB/TrEMBL:B3GZY4"
FT                   /protein_id="ACE60796.1"
FT                   /translation="MKIVIAPDSFKESLTALEVAQSIEGGFRRIFPDAQYIKVPMADGG
FT                   EGSVQSLIDATKGELLEVEVTAPLGNKVIGFLGVSGDKQTAFIEMAAASGLHLVPFEQR
FT                   NPLKTTSFGTGELIKKALDLGVKKILLGIGGSATNDGGVGMLQALGASFKNAAGEEIGF
FT                   GGEQLQQISRISLENLEPRLQSVEFEVACDVNNPLCGERGASAVFGSQKGATPEMVQTL
FT                   DNALAHFADVALAQQGIAIANHAGAGAAGGMGGGLLLLPNVQLKAGVQIIIEATRLAEH
FT                   IRDADLVITGEGRMDAQSIAGKTPVGVAKTAKQFNVPVIAIVGCLREDYNVVYQHGIDA
FT                   VFPIIRQLNSLEETLKQGRENLESSAENVARLIKRKM"
FT   gene            165467..165739
FT                   /locus_tag="APP7_0145"
FT   CDS_pept        165467..165739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0145"
FT                   /product="putative acylphosphatase"
FT                   /EC_number="3.6.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60797"
FT                   /db_xref="GOA:B3GZY5"
FT                   /db_xref="InterPro:IPR001792"
FT                   /db_xref="InterPro:IPR017968"
FT                   /db_xref="InterPro:IPR020456"
FT                   /db_xref="InterPro:IPR036046"
FT                   /db_xref="UniProtKB/TrEMBL:B3GZY5"
FT                   /protein_id="ACE60797.1"
FT                   /translation="MQQKLFIVTGHVQGVGFRFFTLQEAGKIGIKGYVKNRPEGSVEVV
FT                   AVGSDAQMAAFRNWLQKGPPTSVVCNLIEQSYQGSEQFEHFEIRR"
FT   gene            complement(165810..167369)
FT                   /locus_tag="APP7_0146"
FT   CDS_pept        complement(165810..167369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0146"
FT                   /product="predicted ATP-dependent endonuclease of the OLD
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60798"
FT                   /db_xref="GOA:B3GZY6"
FT                   /db_xref="InterPro:IPR022602"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034139"
FT                   /db_xref="UniProtKB/TrEMBL:B3GZY6"
FT                   /protein_id="ACE60798.1"
FT                   /translation="MYLQQIEISGFRGINHLSLTLRPNMVLIGENAWGKSSLLDALSHI
FT                   FNVKDELYQFSEQDFHLRDHQQAQPIKLCFTFCEEENETFGQNEENHYYDIFHLNDAGL
FT                   QHVYLQISGTLTDQGVKTEYQFLDSQGVRLDIDNLQQVVRSVISHTPVYRFRDARLNKF
FT                   ANLEALSQSDNLAQSELADELRALSFLLKYYFLSTHTNKHHPNSMLDTSQLWNKVKSLC
FT                   QRLKQNNDQQLIQQVRTQLSSLFVLNQKHNQIKTPIILFEDLEARLHPRMIAIFWELVT
FT                   YLPVQRITTTNSMELLSQVPLREISRLVRYRDRTEAYSLARSSLGKEDLRKLTFHIHYN
FT                   RGLALFSRAWILVEGETEVWILTELANLLDINLEMEGIRIVEFAQCGLRPLIKYAKAMG
FT                   IEWYVLTDGDQAGEKYADIAKSMLQEDEHPSKRLTVIPRQDIEHFFYHEGLREVFVHLA
FT                   RWQPRDHKYPTKTIIKRAIQYTSKPDLAIAISSEIKQRGNQAIPRLFKKLFIKVLQLIK
FT                   EQ"
FT   gene            complement(167373..168752)
FT                   /locus_tag="APP7_0147"
FT   CDS_pept        complement(167373..168752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0147"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60799"
FT                   /db_xref="InterPro:IPR021826"
FT                   /db_xref="InterPro:IPR027820"
FT                   /db_xref="InterPro:IPR031100"
FT                   /db_xref="InterPro:IPR037153"
FT                   /db_xref="UniProtKB/TrEMBL:B3GZY7"
FT                   /protein_id="ACE60799.1"
FT                   /translation="MTVHCVNPKGSLDQLSHLEMELLTKNAQGNLYSLYRNCSLAVLNS
FT                   GAVTDDSRALLNQYPDFDINLLTKEKGVSLELHNPPKSAFVDGKMIVNIQYHLFAVLRD
FT                   IVFVNALYQYIGQHTSPQEDNKYITNLVFSILRNAKALEIGSDPNLIVCWGGHSINQTE
FT                   YQYCRAVGTELGLRQFNIVTGCGTGVMEAPMKGATIGHANQRYKHSRFIGITEPSIIAS
FT                   EPPNPIVTELIIMPDIEKRLEAFVRMGHGIVIFPGGPGTLEELLYILGVKLNPANKAQK
FT                   LPVILTAPKESADYFTAIDRFIGETLGKEAQQMYEIIIDDPILVAQRMAKAMKEIKQQR
FT                   LELADSYSFNWSLHISDEFTHPFEPTHQNMSDLNLHFDQPTERLAANLRRAFSGIVAGN
FT                   IKPATQDLIEQFGPFQLQGDRKLLDKIDRLLQTFITQHRMKLPTGEAYKPCYQILPNTE
FT                   K"
FT   gene            complement(168812..169801)
FT                   /gene="dusA"
FT                   /locus_tag="APP7_0148"
FT   CDS_pept        complement(168812..169801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dusA"
FT                   /locus_tag="APP7_0148"
FT                   /product="tRNA-dihydrouridine synthase A"
FT                   /EC_number="1.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60800"
FT                   /db_xref="GOA:B3GZY8"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004653"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:B3GZY8"
FT                   /protein_id="ACE60800.1"
FT                   /translation="MNNLMQNQFYRGRFSVAPMLDWTTRHCRYFHRQFSRHALLYTEMI
FT                   TAPAIIHAKYDLLEYDPSENPVALQLGGSDPAQLAHCAKLVEERGYAEINLNVGCPSDR
FT                   VQNGMFGACLMAKADLVADCIKAMQDAVQIPVTVKHRIGIDDLDSYEFLCDFIEKVQPY
FT                   SNDFIVHARKAWLSGLSPKQNREIPPLDYECVYQLKRDFPHLNISINGGIKTIEEIKRH
FT                   LAFVDGVMVGREAYQNPSLLGEIDSQIFGENQPLVTAREAVEKMLPYIAAQTQKGVYLN
FT                   HIVRHMLGAFQNCKGARQWRRHLSENATKQGAGVEVVEQALSFVQESN"
FT   gene            170142..171119
FT                   /locus_tag="APP7_0149"
FT   CDS_pept        170142..171119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0149"
FT                   /product="ribonucleoside-diphosphate reductase beta chain"
FT                   /EC_number="1.17.4.1"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60801"
FT                   /db_xref="GOA:B3GZY9"
FT                   /db_xref="InterPro:IPR000358"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR033909"
FT                   /db_xref="UniProtKB/TrEMBL:B3GZY9"
FT                   /protein_id="ACE60801.1"
FT                   /translation="MSRNLFEKRLNIKPYEYPELLEFKDAIRHSYWLHTEFNFTGDIQN
FT                   YRIDINDHERHVLTRAMLAISQVEVNVKRFWGELYRYFPKPEMDDVGGTFAESEVRHKD
FT                   AYSFLLEKLGLNEMFSQIQDIEPLMNRIRYMESFMKDKDAGKGEFVLSLVLFSLFVEHI
FT                   SLFGQFLIMMSFNKHKNLFKGISNAVEATSKEEEIHGKFGIALYEILREEHSELFTPEF
FT                   FEDLKTLSSQAFEAECGILDWIFEEGDLSFISREEVENYIRSRYNNSLMTLGLEPPYDV
FT                   NPELLKETEWFDIEILSTKETDFFNKRSTDYSKKMKQITADDLF"
FT   gene            171106..172770
FT                   /gene="rnr1"
FT                   /locus_tag="APP7_0150"
FT   CDS_pept        171106..172770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnr1"
FT                   /locus_tag="APP7_0150"
FT                   /product="ribonucleoside-diphosphate reductase large chain"
FT                   /EC_number="1.17.4.1"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60802"
FT                   /db_xref="GOA:B3GZZ0"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR013350"
FT                   /db_xref="InterPro:IPR039718"
FT                   /db_xref="UniProtKB/TrEMBL:B3GZZ0"
FT                   /protein_id="ACE60802.1"
FT                   /translation="MTYSNSRPDFEWLNEDSRLFLQRGYLLEGTTALDRIRFIAEHAER
FT                   KLGIEGYADKFYHYMGRGYFSLSSPIWSNFGLDRGLPISCFGSYIGDSIHEIMVTTAEV
FT                   GMMSKIGGGTSAYFGDIRPRGSAIRNNGKSDGSFNFSKLFDTVIDVISQGTSRKGQFAG
FT                   YIDIEHGDIDEWLDIHTEGNPIQLMYYGVCVGHDWLESMKAGDPYKRQLWAKLLQRKTE
FT                   TGIPYLFFKDNANAGRPDVYKDKNMTVHASNLCTEIMLPSSSDESFVCCLSSMNLLYFD
FT                   EWKDTDAPEVLTYFLDVVMSEFIEKSKDMPFLERANRFATRHRALGLGVLGWHSYLQSH
FT                   NIAFDSFQAMQKNNLIFKTLQEKTLKASQELAKRFGEPELLKGYGRRNTTLMSIAPTKS
FT                   SSFILGSVSPSVEPFKSNYYVKDLAKIKTVYKNPFLEKLLQEKGLDTEEIWESILHNDG
FT                   SVQHLEQLTDEEKEVFKTFSEISQLSVIQQAAQRQKYIDQGQSINIMVHPATPARDLNQ
FT                   LYLTAEELGLKSIYYQYSMSAAQVFNRNLLSCSSCEG"
FT   gene            complement(172905..173504)
FT                   /locus_tag="APP7_0151"
FT   CDS_pept        complement(172905..173504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0151"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60803"
FT                   /db_xref="GOA:B3GZZ1"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR001075"
FT                   /db_xref="InterPro:IPR017726"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3GZZ1"
FT                   /protein_id="ACE60803.1"
FT                   /translation="MEQQETIHISISEAAQTHFRRLLEQQEENTNIRIFVVNPGTPNAE
FT                   CGVSYCPPNAVEETDTQFEYNGFSAFVDEISLPFLDEAEIDYVTDPMGSQLTLKAPNAK
FT                   MRKVADDAPFIERLDYVIQTQVNPQLASHGGRVTLIEVTEDKYAILQFGGGCNGCSMVD
FT                   VTLKEGIEKQLLAMFPDELAGVKDVTEHQRGEHSYY"
FT   gene            173959..175308
FT                   /gene="nqrA"
FT                   /locus_tag="APP7_0152"
FT   CDS_pept        173959..175308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nqrA"
FT                   /locus_tag="APP7_0152"
FT                   /product="Na(+)-translocating NADH-quinone reductase
FT                   subunit A"
FT                   /EC_number="1.6.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60804"
FT                   /db_xref="GOA:B3GZZ2"
FT                   /db_xref="InterPro:IPR008703"
FT                   /db_xref="InterPro:IPR022615"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3GZZ2"
FT                   /protein_id="ACE60804.1"
FT                   /translation="MITIKKGLDLPIAGTPAQVIHNGNTVNEVAMLGEEYVGMRPSMKV
FT                   REGDVVKKGQVLFEDKKNPGVVFTAPASGTVVTINRGEKRVLQSVVIKVEGDEQITFTR
FT                   YEAAQLASLSAEQVKQNLIESGLWTAFRTRPFSKVPALDAIPSSIFVNAMDTNPLAADP
FT                   EVVLKEYETDFKDGLTVLTRLFNGQKPVYLCKDADSNIPLSPAIEGITIKSFSGVHPAG
FT                   LVGTHIHFVDPVGATKQVWHLNYQDVIAIGKLFTTGELFTDRIISLAGPQVKNPRLVRT
FT                   RLGANLSQLTANELNAGENRVISGSVLSGATAAGPVDYLGRYALQVSVLAEGREKELFG
FT                   WIMPGSDKFSITRTVLGHFGKKLFNFTTAVHGGERAMVPIGAYERVMPLDIIPTLLLRD
FT                   LAAGDTDSAQNLGCLELDEEDLALCTYVCPGKNNYGPMLRAALEKIEKEG"
FT   gene            175313..176545
FT                   /gene="nqrB"
FT                   /locus_tag="APP7_0153"
FT   CDS_pept        175313..176545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nqrB"
FT                   /locus_tag="APP7_0153"
FT                   /product="Na(+)-translocating NADH-quinone reductase
FT                   subunit B"
FT                   /EC_number="1.6.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60805"
FT                   /db_xref="GOA:B3GZZ3"
FT                   /db_xref="InterPro:IPR004338"
FT                   /db_xref="InterPro:IPR010966"
FT                   /db_xref="UniProtKB/TrEMBL:B3GZZ3"
FT                   /protein_id="ACE60805.1"
FT                   /translation="MGLKNLFEKMEPAFHKGGKYEKWYTLFEATYTILYTPGTVTRKDS
FT                   HVRDALDSKRMMIIVWLALFPAMFWGMYNVGHQALLATNHLGTLADTIANNWHYGFADA
FT                   LGATLTADAGWGSKMFLGATYFLPIYLTIFLVGGFWEVVFAMVRKHEINEGFFVTSILL
FT                   ALIVPPTLPLWQAALAATFGVVVAKEVFGGVGKNFMNPALAGRAFLFFAYPAQISGDLV
FT                   WTAADGFSGATALSQWAQGGQGALKHVVTGQEITWMDAFLGNIPGSIGEVSTLMLIIGA
FT                   AIIVFTRIASWRIIAGVMVGMAATATVFNLIGSDTNPLFSMPWHWHLVLGGFALGMFFM
FT                   ATDPVSAAFTNKGKWWYGALIGVMCVVIRVANPAYPEGMMLAILFANLFAPIFDYLVVQ
FT                   GNIKRRKAKAA"
FT   gene            176548..177321
FT                   /gene="nqrC"
FT                   /locus_tag="APP7_0154"
FT   CDS_pept        176548..177321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nqrC"
FT                   /locus_tag="APP7_0154"
FT                   /product="Na(+)-translocating NADH-quinone reductase
FT                   subunit C"
FT                   /EC_number="1.6.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60806"
FT                   /db_xref="GOA:B3GZZ4"
FT                   /db_xref="InterPro:IPR007329"
FT                   /db_xref="InterPro:IPR010204"
FT                   /db_xref="UniProtKB/TrEMBL:B3GZZ4"
FT                   /protein_id="ACE60806.1"
FT                   /translation="MAKFNKDSVSGTLTVVVLLSLICSLIVAGAAVLLKPTQDIQKVLD
FT                   KQKNILQAAGLMQPNTNVQETYAKFIEPKIVDLATGDYVEGVKNFDAKAAAKDPAQNVA
FT                   INPADDKANIKVRAKYAEVYLVKDEAGKVNQVVLPMYGNGLWSIMYGFVAVQPDANTVN
FT                   GITYYEQGETAGLGGEIANPNWQKNFVGKKLFNANNEVALTVAKGASEDKDHGIDGLSG
FT                   ATLTSNGVDGSFKYWFGANGFGPYLAKFKAAMGAN"
FT   gene            177321..177944
FT                   /gene="nqrD"
FT                   /locus_tag="APP7_0155"
FT   CDS_pept        177321..177944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nqrD"
FT                   /locus_tag="APP7_0155"
FT                   /product="Na(+)-translocating NADH-quinone reductase
FT                   subunit D"
FT                   /EC_number="1.6.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60807"
FT                   /db_xref="GOA:B3GZZ5"
FT                   /db_xref="InterPro:IPR003667"
FT                   /db_xref="InterPro:IPR011292"
FT                   /db_xref="UniProtKB/TrEMBL:B3GZZ5"
FT                   /protein_id="ACE60807.1"
FT                   /translation="MASNNLKKLLLSPIADNNPIALQILGICSALAVTTQLQTAVVMAI
FT                   AVSLVTAFSSMFISMIRNYIPNSIRIIVQMAIIASLVILVDQILRAYAYELSKQLSVFV
FT                   GLIITNCIVMGRAEAFAMKSGPVESFVDGIGNGLGYGAMLIIVAFLRELIGSGKLFGVT
FT                   ILQTVQDGGWYQANGLFLLAPSAFFIIGFVIWGIRTWKPEQVEK"
FT   gene            178013..178540
FT                   /gene="nqrE"
FT                   /locus_tag="APP7_0156"
FT   CDS_pept        178013..178540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nqrE"
FT                   /locus_tag="APP7_0156"
FT                   /product="Na(+)-translocating NADH-quinone reductase
FT                   subunit E"
FT                   /EC_number="1.6.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60808"
FT                   /db_xref="GOA:B3GZZ6"
FT                   /db_xref="InterPro:IPR003667"
FT                   /db_xref="InterPro:IPR010967"
FT                   /db_xref="UniProtKB/TrEMBL:B3GZZ6"
FT                   /protein_id="ACE60808.1"
FT                   /translation="MVCVHSLRCLRSFNCFWFRYAVIVVLGIAVPANQLVYTHVLKDGA
FT                   LVEGVDLSFLNFITFIGVIAALVQILEMILDKFFPALYSALGIFLPLITVNCAIFGGVS
FT                   FMVQREYNFTESVVYGLGAGTGWMLAIVALAGLTEKMKYSDVPAGLRGLGITFITVGLM
FT                   ALGFMSFSGIQL"
FT   gene            178551..179780
FT                   /gene="nqrF"
FT                   /locus_tag="APP7_0157"
FT   CDS_pept        178551..179780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nqrF"
FT                   /locus_tag="APP7_0157"
FT                   /product="Na(+)-translocating NADH-quinone reductase
FT                   subunit F"
FT                   /EC_number="1.6.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60809"
FT                   /db_xref="GOA:B3GZZ7"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR010205"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:B3GZZ7"
FT                   /protein_id="ACE60809.1"
FT                   /translation="MDSNFIFGIIAFTALVLVLAVIILFAKSKLVDSGDITISINNDPE
FT                   KGITLPAGGKLLGALASKGIFVSSACGGGGSCGQCKVQVKSGGGEILPTELSHISKKEA
FT                   KEGWRLACQVNVKSSMDVELPEEIFGVKKWECTVISNDNKATFIKELKLQIPEGEEVPF
FT                   RAGGYIQIEADPHTVNYKDFDIPKEYHEDWDKFNLWRYVSKVDEHIIRAYSMASYPEEK
FT                   GIIMLNVRIATPPPRNPDVPPGQMSSYIWSLKPGDKVTISGPFGEFFAKETDNEMVFIG
FT                   GGAGMAPMRSHIFDQLKRLKSKRKMSFWYGARSKREIFYQEDFDQLAAENDNFVWHVAL
FT                   SDALPEDNWTGYTGFIHNVLYENYLKNHEAPEDCEYYMCGPPVMNAAVIGMLKSLGVED
FT                   ENILLDDFGG"
FT   gene            179987..181018
FT                   /gene="apbE"
FT                   /locus_tag="APP7_0158"
FT   CDS_pept        179987..181018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="apbE"
FT                   /locus_tag="APP7_0158"
FT                   /product="thiamine biosynthesis lipoprotein ApbE precursor"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60810"
FT                   /db_xref="GOA:B3GZZ8"
FT                   /db_xref="InterPro:IPR003374"
FT                   /db_xref="InterPro:IPR024932"
FT                   /db_xref="InterPro:IPR042159"
FT                   /db_xref="UniProtKB/TrEMBL:B3GZZ8"
FT                   /protein_id="ACE60810.1"
FT                   /translation="MKLKSILIFAISAIFLTACNKAPEQITLKGKTMGTTYTVKYIDNG
FT                   ELQNLQKPEEVQKTLDDLLKQVNNEMSTYQPDSQISRFNAMQEVNKAVQISPDFAKVVR
FT                   EAIRLNRVTEGALDVTVGKLVNLWGFGPDKRLNKAPSAEQIAALAPSVGIEKLSVSDNS
FT                   LMKSVPNLYLDLSSIAKGFGVDKLAEHLESLGLANYLVEIGGELRGKGKNLQGVDWRIA
FT                   IEQPTLAQGQAAQITVPLHNLGMATSGNYRNYFEDEQGNRLSHIINPKELRPVSHKLAS
FT                   ITVFAPTTMTADGLSTGLFVLGPEKALEVAEREKLAVFLIIKNGEAFETKMSREFEKLI
FT                   NQK"
FT   gene            181032..181277
FT                   /locus_tag="APP7_0159"
FT   CDS_pept        181032..181277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0159"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60811"
FT                   /db_xref="GOA:B3GZZ9"
FT                   /db_xref="InterPro:IPR007495"
FT                   /db_xref="UniProtKB/TrEMBL:B3GZZ9"
FT                   /protein_id="ACE60811.1"
FT                   /translation="METLLITFGFFIAVIFAMSIGFIVKGKTIKGSCGGITALGMKKMC
FT                   DCEEPCDNLKAKMADGTADPEEVARFSKEPQFYEVK"
FT   gene            181506..182675
FT                   /gene="trmU"
FT                   /locus_tag="APP7_0160"
FT   CDS_pept        181506..182675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmU"
FT                   /locus_tag="APP7_0160"
FT                   /product="putative tRNA
FT                   (5-methylaminomethyl-2-thiouridylate)-methyltransferase"
FT                   /EC_number="2.1.1.61"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60812"
FT                   /db_xref="GOA:B3H000"
FT                   /db_xref="InterPro:IPR004506"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023382"
FT                   /db_xref="UniProtKB/TrEMBL:B3H000"
FT                   /protein_id="ACE60812.1"
FT                   /translation="MTNQTQLSSKTYDTHFAKLTAEQLAENAKKKVIIGMSGGVDSSVS
FT                   AFILQQQGYQVEGLFMKNWEEDDDTDYCTAAADLADAQAVADKLGMKLHKINFAAEYWD
FT                   NVFEHFLNEYKAGRTPNPDILCNKEIKFKAFLEYAAEDLGADYIATGHYVRRSGDDNNA
FT                   QLLRGLDANKDQSYFLYTLSHKQVGQSLFPVGDIEKPIVRQIAEDLGLATAKKKDSTGI
FT                   CFIGERKFKDFLARYLPAQPGEIRTVDGKVVGRHDGLMYHTLGQRKGLGIGGVKGLSED
FT                   PFYVVEKDLINNVLVVAQGHDNSALLSSGLIATQLHWVDRQPIRENLRCTVKTRYRQTD
FT                   IACEIQPIDDDTIRVIFDEPQIAVTPGQSAVFYQGEVCLGGGVIEEQLK"
FT   gene            complement(182749..183903)
FT                   /gene="hcaT"
FT                   /locus_tag="APP7_0161"
FT   CDS_pept        complement(182749..183903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hcaT"
FT                   /locus_tag="APP7_0161"
FT                   /product="putative 3-phenylpropionic acid transporter"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60813"
FT                   /db_xref="GOA:B3H001"
FT                   /db_xref="InterPro:IPR024989"
FT                   /db_xref="InterPro:IPR026032"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B3H001"
FT                   /protein_id="ACE60813.1"
FT                   /translation="MIKLTPFQWSAFNFFGFFCAYGVFLPFLSVWLKQYGYSTEIIGLL
FT                   ASFGYLFRFAGGMLASQQVKSPNQLIPTARILTLLNLIAIVVIAWSAESIWLLFPALML
FT                   FHIFNAGAMPIGDSIASLWQQQVGIDYGKARLFGSIAFVVGSLSTGYLTGWLGEGSIIW
FT                   IMFGFFILLGCGQLLTPTVGFENQQDKKSSSNLSYWQILKEPTTLRMMLAVSLILGSHA
FT                   AYYAYSTIHWSAAGISTQTSSLLWGFAVCAEILFFLFSNRLFKSWRIAHLMMIASVIAI
FT                   IRWSILASTTEITLLVISQTFHAITFGMAHYAMIRYISAQNPEKITKLQGLYFALSNCG
FT                   FTAIFTFVSGMLYQDMPNFAFWLMAIIAVPAIFIVPKKFNTTLR"
FT   gene            complement(183900..184730)
FT                   /gene="proC"
FT                   /locus_tag="APP7_0162"
FT   CDS_pept        complement(183900..184730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proC"
FT                   /locus_tag="APP7_0162"
FT                   /product="pyrroline-5-carboxylate reductase"
FT                   /EC_number="1.5.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60814"
FT                   /db_xref="GOA:B3H002"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR029036"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B3H002"
FT                   /protein_id="ACE60814.1"
FT                   /translation="MRVKMNHQKLAFIGTGNMAYAIIQGLLKSHYPASQIIACNKSNLA
FT                   RRAELQAVGIATNFTNREAVEQAEVVVLAVKPQMMAEVCSEFSTVDFSNKTVISVAAGI
FT                   SVARLEQLLPTAKNIIRTMPNTPSLIGEGMTGLFAKKSVNSTACQFAESLMSAVGKCYW
FT                   VEQEQQINHIIAVTGSSPAYFFRFMEAMQQSAMQMGFSEADARLLVQQAALGAAKLVEA
FT                   NPNTSLAILRENVTSKGGTTAQALAVFERHKLTETVDQAMQAAIQRAEEMEQQL"
FT   gene            184893..185801
FT                   /gene="rdgC"
FT                   /locus_tag="APP7_0163"
FT   CDS_pept        184893..185801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rdgC"
FT                   /locus_tag="APP7_0163"
FT                   /product="recombination-associated protein RdgC"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60815"
FT                   /db_xref="GOA:B3H003"
FT                   /db_xref="InterPro:IPR007476"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3H003"
FT                   /protein_id="ACE60815.1"
FT                   /translation="MFWFKNVMIYRLTSPLSLESSSLEEQLRQTKFSPCSQSDISKFGW
FT                   SSPLSGSELLHFSQGKQFLLVSHKEDKLLPTNVIKKETEERIAVLEEKEARKLKKTEKQ
FT                   AIKDDVVAMLLPRAFSKHQFTAIWLDLDAQLVYVDAGSSKRAEDTLALLRKTLGSLPVV
FT                   PISFALLPSEVMTNWIAKGHTPNWLSLLEEAELKSFDTDSVIRCKRQDLESEEIAQHLQ
FT                   AGKFVTKLAIDWENHFSCVLNEDATLSRVKFADEVREKNDDILKEDIAQRFDADFLLMT
FT                   EELKLFTQKMIEEFGGIKERI"
FT   gene            185811..186416
FT                   /locus_tag="APP7_0164"
FT   CDS_pept        185811..186416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0164"
FT                   /product="putative phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60816"
FT                   /db_xref="GOA:B3H004"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR010976"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:B3H004"
FT                   /protein_id="ACE60816.1"
FT                   /translation="MLVSTEILDQYQALIFDMDGTIIDTMPSHAKAWEITGEHFGYQVD
FT                   SSVMYELGGATTYTIGREIMQRANMPMELLEEVVQMKRKIAMDLTYEHSSLLPAFEIIQ
FT                   HYSGKKPLAVGTGAHRVQAYKLLDKFNLRPYFNAIVDADNVKEHKPSPETFLLCAERLG
FT                   VAPKHCLVFEDADLGIQAALAGGMDVFDVRTNKITKAH"
FT   gene            complement(186581..187954)
FT                   /locus_tag="APP7_0165"
FT   CDS_pept        complement(186581..187954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0165"
FT                   /product="Phage T7 exclusion protein"
FT                   /function="Predicted P-loop ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60817"
FT                   /db_xref="InterPro:IPR011646"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3H005"
FT                   /protein_id="ACE60817.1"
FT                   /translation="MTNITFSQDEFNRRPIAEKIIKILNSDIDVSPLLLDGGWGTGKTT
FT                   FCKKTIALIEELEANEEIKSKIIYVDAFKTDHTGEPLLALLAEIIKVCEPNNETINKLG
FT                   MIAGSLLRTSAKAIISHVLKVNTDDIPESISDALEDVSNNAIDNGIAHLLKEQSKSEEY
FT                   INKLKEILSNMASGHKIIIFIDELDRCRPDYALDMLEVVKHIFDLQNVKIILVTNSEQL
FT                   RAMINHRYGEKVDSHQYLDKFIKIKIILPKEIIEQRYGDKKIASYTYFLNLLRENSLSH
FT                   PLKINEQESDRTVNLIHNLVRYNNITLRNIESIVRILKLCYIFSEREMDDSREIEGVFY
FT                   IFISFLYIINPNLFLQIKNNIADADDIASFLLIEKNSLQIDEYVDYKNLLFLICLSKCN
FT                   KNKEKYILPNFSSYNWDRYRHYFMGRFDYELNILEQRKRSTDKLKIFDEIFDVLALYS"
FT   gene            complement(188084..189865)
FT                   /locus_tag="APP7_0166"
FT   CDS_pept        complement(188084..189865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0166"
FT                   /product="anaerobic ribonucleoside triphosphate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60818"
FT                   /db_xref="GOA:B3H006"
FT                   /db_xref="InterPro:IPR012833"
FT                   /db_xref="UniProtKB/TrEMBL:B3H006"
FT                   /protein_id="ACE60818.1"
FT                   /translation="MIRLQPNQLEGKLGFIEHYLHAKNAADGSKMDANANVTQKNIATM
FT                   ENEMMKDFFVQINRAKVSNKIAELFDEELAGEYLRQIEAHEIYVHDETSLKPYCVSVTM
FT                   YPFLRDGLTKLGGESKAPKHLASFCGSFVNFVFAVSSQFAGAVATVEFLTYFDYFARKD
FT                   FGDNYLETHRSEIENHLQQVVYSINQPAAARGYQSVFWNISLYDKHYFDAMFGNFVFPD
FT                   FERPNWETTAALQIFFMKWFNQERTKAILTFPVVTAAMLTENGKCKDNEFADQMAEELS
FT                   QGNSFFIYQSDNPDSLASCCRLRNEISDHTFSYSLGAGGVATGSINVITINMNRLVQDG
FT                   RNLEEEVGKIHKYQYAYRKLMEEYLAAGMLPVYDAGFISLDKQFLTIGINGMAEAAESQ
FT                   GLTVGYNPDYMQFVQSRLKVIFDANQTASKKYGVKFNTEFVPAENLGVKNAKWDKEDGY
FT                   FVPRDCYNSYFYVVEDENTNALDKFLLHGKELIEWLDGGSALHLNLDEALTQSGYRSLL
FT                   DIAAKTGCNYFCINVKITICNECAHIDKRTLCSCSKCGSQNIDYGTRVIGYLKRVSAFS
FT                   SARQKEHSLRFYHREAA"
FT   gene            complement(189870..190337)
FT                   /locus_tag="APP7_0167"
FT   CDS_pept        complement(189870..190337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0167"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60819"
FT                   /db_xref="GOA:B3H007"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR014191"
FT                   /db_xref="UniProtKB/TrEMBL:B3H007"
FT                   /protein_id="ACE60819.1"
FT                   /translation="MKNLRFCSEQIVWQEVPHETSLAFLITGCPLGCKGCHSTESWKLG
FT                   SGQILTKNYLAEQLNKYQGLVSCVLFMGGEWLPEQLIPLLSYCKQRGLQTCLYTGLERD
FT                   ELSAELLSQLTYLKTGRWIAERGGLNSLTTNQRFIDLRTGENLNHLFSKGV"
FT   gene            190719..191402
FT                   /gene="rnfA"
FT                   /locus_tag="APP7_0168"
FT   CDS_pept        190719..191402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnfA"
FT                   /locus_tag="APP7_0168"
FT                   /product="electron transport complex protein RnfA"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60820"
FT                   /db_xref="GOA:B3H008"
FT                   /db_xref="InterPro:IPR003667"
FT                   /db_xref="InterPro:IPR011293"
FT                   /db_xref="UniProtKB/TrEMBL:B3H008"
FT                   /protein_id="ACE60820.1"
FT                   /translation="MVDYILLIISTALINNFVLVKFLGLCPFMGVSKKVETAIGMGMAT
FT                   TFVLTVASLSAYLVETYVLIPLEAQFLRTLVFILVIAVIVQLTEMIVHKTSPTLYRLLG
FT                   IYLPLITTNCAVLGVALLNVNLSNNLVESVLYGFGAALGFSLVLVLFAALRERLAAADV
FT                   PSPFQGASIALITAGLMSLAFMGFTGLVKSNVSISYYCVYPDCDCRDRTDFRCDFGLFV
FT                   DQIKS"
FT   gene            191903..194215
FT                   /gene="rnfC"
FT                   /locus_tag="APP7_0169"
FT   CDS_pept        191903..194215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnfC"
FT                   /locus_tag="APP7_0169"
FT                   /product="electron transport complex protein RnfC"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60821"
FT                   /db_xref="GOA:B3H009"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR010208"
FT                   /db_xref="InterPro:IPR011538"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="InterPro:IPR026902"
FT                   /db_xref="InterPro:IPR037225"
FT                   /db_xref="UniProtKB/TrEMBL:B3H009"
FT                   /protein_id="ACE60821.1"
FT                   /translation="MSNAIDVLDRIRQGNQSGKLWEFPGGIHPMQNKKQSNQKPIRSLH
FT                   LPKFFYVPVVQHSGWAGELLVKVGDRVLKGQPLTKGDNYRQLPVHTPTSGTVIGIEPYV
FT                   SAHPSGLPEITVIIETDGKDEWIERQPIDDFLTLTSGQIIEKVYQYGIAGLGGAVFPTA
FT                   SKLSLADKRCKVLIINGAECEPYITCDDRLMQDYTHEFLEGIRILRYVLRPEEVVLAIE
FT                   DNKPQAIKAMEQALKGSNDITLRVIPTIYPSGASDQLVQVLTGLEIPQGKRSIEMGIVM
FT                   HNVGTVFAVKRAVMDDEPLIERVVTLTGDKIRNKGNVWARLGTPIQHLLEQVDYQADSR
FT                   FPVFLGGPMTGFILQSLQAPITKTANCIIAPDHFEYAPPEPERSCIRCSSCSDACPVGL
FT                   LPQQLYWYARSEDHDKSKEYHLDACIECGVCAYVCPSYIPLIQYFRQEKAKITEIEEKA
FT                   KKAEEAKARFEAREARLQKEKDARTARIAQAADKRREEIANSAGEDPVAAALARIKAKK
FT                   AEAQTAEPVQAKANGEPDNSELMAQRRARRLAKQAEVKNEVNDNLSINTVQQVEETDPK
FT                   KAAVAAALARARAKKAAQAPEQAVENAEKFATATEAEDPRKAAVAAALARAKAKKAAQQ
FT                   ADQQEQVQAGENTEKVAAANEAEDPRKAAVAAALARAKAKKAAQQADQQEQAQAVENTG
FT                   KVATATEAEDPRKAAVAAALARAKAKKATQQEQLQAVENAEKVVTATEAEDPRKATVAA
FT                   AIARAKAKKMSQGLSND"
FT   gene            194208..194852
FT                   /locus_tag="APP7_0170"
FT   CDS_pept        194208..194852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60822"
FT                   /db_xref="GOA:B3H010"
FT                   /db_xref="InterPro:IPR005115"
FT                   /db_xref="UniProtKB/TrEMBL:B3H010"
FT                   /protein_id="ACE60822.1"
FT                   /translation="MTNLFDSLLPPFPWSFLFIQDLIGTIVFAVSGAIAARQHKMDIFG
FT                   MFILAFVTGVGGGTLRDVMIGSTPVFWMKQPIYVLMITLAVIITAVFKNNFSKKEWQTG
FT                   LLIFDAIGLGVFTVIGVQKGLDFGLHPLIAIALGGMTGCFGGVIRDILRNEVPIVLQKE
FT                   VYVTASLIGGVIFVLFYSAGVESRWVDIATVVTVIVIRLLAIRFNLNLPRI"
FT   gene            194872..195918
FT                   /gene="rnfD"
FT                   /locus_tag="APP7_0171"
FT   CDS_pept        194872..195918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnfD"
FT                   /locus_tag="APP7_0171"
FT                   /product="electron transport complex protein RnfD"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60823"
FT                   /db_xref="GOA:B3H011"
FT                   /db_xref="InterPro:IPR004338"
FT                   /db_xref="InterPro:IPR011303"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3H011"
FT                   /protein_id="ACE60823.1"
FT                   /translation="MFKMVSSPHTHSSNLTAKFMLWVMVAMLPALGMQAYFFGYGVFIQ
FT                   VFIALLLAVAIEIAIAKLRRKLTAFYVADLSGVLTALILAMSIPPYAPYWIIVIGIIVA
FT                   LLLAKHSYGGLGQNLFNPAMVAYALLLVSFPVQMTGWLVPIDLLNEPPTFGDAISLVFS
FT                   GVTSDGFSVHQLLGSVDGIAQATPLDSAKTSMQKLGVEGVLQSPIFSGLFANGWWQINL
FT                   AFLAGGLLLIYKSIIHWQIPAAMLGMFALLSGLTDLLLPHTHLNVVSQLFSGAMMFGAF
FT                   FIATDPVTASITPRGKLIFGGLIGLFVYLIRYYGNYPDAVAFSVLLANICVPLIDHYTQ
FT                   PRLYGSGR"
FT   gene            195918..196550
FT                   /gene="rnfG"
FT                   /locus_tag="APP7_0172"
FT   CDS_pept        195918..196550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnfG"
FT                   /locus_tag="APP7_0172"
FT                   /product="electron transport complex protein RnfG"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60824"
FT                   /db_xref="GOA:B3H012"
FT                   /db_xref="InterPro:IPR007329"
FT                   /db_xref="InterPro:IPR010209"
FT                   /db_xref="UniProtKB/TrEMBL:B3H012"
FT                   /protein_id="ACE60824.1"
FT                   /translation="MNTSKITVKYALLLGAIALICTAVSTGVYLLTKGRIDEVTAAQQR
FT                   QFLQEVVPASHFDNDLLGSCKIVNLPNAPYLNRIYIAKKSENLTAYAIQATAPDGYSGN
FT                   IVLLMGVQPDGKVLGVRTLEHKETPGLGDKIETRVSNWILSFSGKLFSLENESLWAVKK
FT                   DGGQFDQFTGATITPRAVVNNVRQSAKWVVTELAKSPEQLETFASCK"
FT   gene            196562..197248
FT                   /gene="rnfE"
FT                   /locus_tag="APP7_0173"
FT   CDS_pept        196562..197248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnfE"
FT                   /locus_tag="APP7_0173"
FT                   /product="electron transport complex protein RnfE"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60825"
FT                   /db_xref="GOA:B3H013"
FT                   /db_xref="InterPro:IPR003667"
FT                   /db_xref="InterPro:IPR010968"
FT                   /db_xref="UniProtKB/TrEMBL:B3H013"
FT                   /protein_id="ACE60825.1"
FT                   /translation="MNTENQIPVTEIDTTTPAEPSIWRNLLAEGVWKNNGALVQLLGLC
FT                   PLLAVSNNVTNALGLGLATLLVLVCTNTMVSLFRKFTPNDIRIPIYVMVIATVVTAVQL
FT                   LMNAFAYPVYQSLGIFIPLIVTNCIVIGRAEAFASKNSVAHSAFDGFAMGLGMTLSLVA
FT                   LGAMRELIGNGTLFDGLDLLLGDWAKSLRIDVLHLDSGLLLAILPPGAFIGLGVILAVK
FT                   NLIDKK"
FT   gene            197257..198213
FT                   /gene="msbB"
FT                   /locus_tag="APP7_0174"
FT   CDS_pept        197257..198213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msbB"
FT                   /locus_tag="APP7_0174"
FT                   /product="lipid A biosynthesis (KDO)2-(lauroyl)-lipid IVA
FT                   acyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60826"
FT                   /db_xref="GOA:B3H014"
FT                   /db_xref="InterPro:IPR004960"
FT                   /db_xref="InterPro:IPR011921"
FT                   /db_xref="UniProtKB/TrEMBL:B3H014"
FT                   /protein_id="ACE60826.1"
FT                   /translation="MAERITAREGYEHKFLKEFLYPKYWGVWLGVLALVVLAYVPARLR
FT                   DKLAVFVGRVVKNYLKKKGKKQYHRADTNLRYCFPNWSEQQREQVIERMFITVAQTMLG
FT                   IGEIAIRSVKHLQRRSEFLGLAHLQQAKQDGKNIILLVPHTWAIDASGIILHTHGMPMV
FT                   SMYNPHRNALVDWLWNATRERFGGKMHTRQNGIKPFLNDVRKGNMGYFLPDEDFGEELS
FT                   VYADFFATEKATLPGLNKMARVANAEVIPMFPIYNAEKSLYQMEILPALEFSGDPVQSA
FT                   REMNKVIEYFVTKNPEQYVWILRLLKTRRNGEDIYKR"
FT   gene            complement(198274..199260)
FT                   /locus_tag="APP7_0175"
FT   CDS_pept        complement(198274..199260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0175"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60827"
FT                   /db_xref="GOA:B3H015"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B3H015"
FT                   /protein_id="ACE60827.1"
FT                   /translation="MSQLIRTLKSHIRDEIIKKGGWVNSHAHADRAFTMTPEKIAIYQN
FT                   ANLQQKWDLVDEVKRNSTVDDYYRRFSQAIELMISQGVTAFGTFVDIDGVCEDRAIIAA
FT                   HKAREVYKSDIALKFANQTLKGVIEPTAKKWFDIGSEMVDMIGGLPYRDELDYGKGLEA
FT                   MDILMDKAKSLGKMLHVHVDQFNTPKEKETEQLCDKAIEHGMQGRVVAIHGISIGAHPK
FT                   EYRKMLYQKMRDSQMMVIACPMAWIDSGRKEDLQPFHNALTPADELIPEGITVAIGTDN
FT                   ICDYMVPLCEGDMWQELSLLSAGCRFTNLEEMANIASINGRKVLGLL"
FT   gene            199702..200667
FT                   /gene="tbp"
FT                   /locus_tag="APP7_0176"
FT   CDS_pept        199702..200667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tbp"
FT                   /locus_tag="APP7_0176"
FT                   /product="thiamine-binding periplasmic protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60828"
FT                   /db_xref="GOA:B3H016"
FT                   /db_xref="InterPro:IPR005948"
FT                   /db_xref="InterPro:IPR005967"
FT                   /db_xref="UniProtKB/TrEMBL:B3H016"
FT                   /protein_id="ACE60828.1"
FT                   /translation="MKLAKIAALSAFVTGVAYAQQPTLVVYTYDSFSSDWGPAPKLEPL
FT                   FEAQCQCDVKFMPFEDGITMLNRIRLEGKKTKADVMLGIDNFTMAEAEKTGLFAMHDLN
FT                   LAPLNWENKTFYPYDYSEYAFVYDKEKLANPPKSLKELVERQDLKVIYQDPRTSTVGRG
FT                   LLFWLNTVYGEQAEQAWQTLAKHTVTVGKGWSETYSAFLKGESDLVLSYSTSPLYHQWH
FT                   DKTDKYVAAQFDEGHLVQTEVAAILNSSKQKALAKQFLAFLHQPEAQKVISYHNVMKPV
FT                   VGSVPDSAFDKLPAYKPLAFKMPDATQVKNWLATWTKSWQ"
FT   gene            200874..201323
FT                   /gene="dksA"
FT                   /locus_tag="APP7_0177"
FT   CDS_pept        200874..201323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dksA"
FT                   /locus_tag="APP7_0177"
FT                   /product="DnaK suppressor protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60829"
FT                   /db_xref="GOA:B3H017"
FT                   /db_xref="InterPro:IPR000962"
FT                   /db_xref="InterPro:IPR012784"
FT                   /db_xref="InterPro:IPR020458"
FT                   /db_xref="InterPro:IPR020460"
FT                   /db_xref="InterPro:IPR037187"
FT                   /db_xref="UniProtKB/TrEMBL:B3H017"
FT                   /protein_id="ACE60829.1"
FT                   /translation="MSQVANTTSLGLLALAGVTPYQPKKDEEYMNDAQKEHFRKILRAW
FT                   HVQIMDEAERTKNQMQEEVANFADPADRATQEEEFSLELRNRDRERKLLKKIEQTLNSI
FT                   AEDEYGYCETCGVEIGLRRLEARPTADMCIDCKTLAEIREKQMGL"
FT   gene            201433..202998
FT                   /gene="pcnB"
FT                   /locus_tag="APP7_0178"
FT   CDS_pept        201433..202998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcnB"
FT                   /locus_tag="APP7_0178"
FT                   /product="putative poly(A) polymerase"
FT                   /EC_number="2.7.7.19"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60830"
FT                   /db_xref="GOA:B3H018"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR010206"
FT                   /db_xref="InterPro:IPR025866"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/TrEMBL:B3H018"
FT                   /protein_id="ACE60830.1"
FT                   /translation="MRWIIFNYIKSLFSRQKKSKKQPLAEQETLSAKQERKVKAVELQP
FT                   KSKRPAPAFNEQSERSTKKPKKHSDLPSHLLHKKFTVNAGHYDITPKDFPKNALAIVEK
FT                   LQRAGFEAYVVGGCIRDLLLGHKPKDFDVATNAKPEEIQKIFGRQCRLIGRRFRLAHIV
FT                   FGRDIYEVATFRADHASHNSDKISKVSEEGMLLRDNVYGTLREDAQRRDFSVNSLYYDP
FT                   KHNLIFDFFDGIADLKAGKLRLIGDPVVRYQEDPVRMLRAVRFMAKLDMFLDKPSDTPI
FT                   RELAHLLKNIPAARLFDESLKLFQSGQGFKTYQLMRQYGLFEQLFPVLTPFFTERNDSN
FT                   AERMLSKALNSTDDRIRDNLRVNPAFLFAALLWYPLREKMEVLKNEGGLNSHDAMMLAA
FT                   NDVLAESCKAIALHRRHTSVIRDIWALQFQMTKRSGKRPQQTLEHVKFRAGFDLLVMRA
FT                   EIEGGDLVELSAWWHEYQFSNDAQRAEMLKAVRNVPNFAGEEKKKRRRKTFRKKKPAKK
FT                   ASAE"
FT   gene            203026..203538
FT                   /gene="folK"
FT                   /locus_tag="APP7_0179"
FT   CDS_pept        203026..203538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folK"
FT                   /locus_tag="APP7_0179"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase"
FT                   /EC_number="2.7.6.3"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60831"
FT                   /db_xref="GOA:B3H019"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:B3H019"
FT                   /protein_id="ACE60831.1"
FT                   /translation="MPFLLASLTETDMMMKTVYIALGSNLDNPLAQVKQAVESLKTFAI
FT                   NFEISPFYGSKPVGPQDQPDYVNAVAKFDTDLTALELLDKLQSIENAQGRVRIRRWGER
FT                   TLDLDIILYGDERIHNERLIVPHIEMQNREFVIVPMYDLNPDLVLPSGQKLAEIYQRFK
FT                   HHQMVIF"
FT   gene            complement(203572..203793)
FT                   /locus_tag="APP7_0180"
FT   CDS_pept        complement(203572..203793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60832"
FT                   /db_xref="InterPro:IPR025985"
FT                   /db_xref="UniProtKB/TrEMBL:B3H020"
FT                   /protein_id="ACE60832.1"
FT                   /translation="MRKSLLFAIFCLNLTACTPKVQLETPAEGITINMNVVVDHRIDVK
FT                   FDEKSRTVLQTSDNKAAKSEAVVEAPIE"
FT   gene            complement(203790..206519)
FT                   /locus_tag="APP7_0181"
FT   CDS_pept        complement(203790..206519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0181"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60833"
FT                   /db_xref="InterPro:IPR021730"
FT                   /db_xref="UniProtKB/TrEMBL:B3H021"
FT                   /protein_id="ACE60833.1"
FT                   /translation="MLKRSLLVIGTLVALLIVGGAMLFSGKQLATVSNWFLPDGWQIQT
FT                   PAGGIQANLENANLAEFSLTYQNCPLITVDNLAVHWHSQYQVSIDKATLDYQCLIQLPA
FT                   SDESPSKFSLAQILALLPEGEAEIKALHWLNLPNDLHPRFSQLLETPSYGKFAFFQQKL
FT                   TALVRQQAVELTAEFANQTLSGNLSYQPSEQEKHNLLFSAHINPKDLLAIPSKFEGDYH
FT                   WILPKEMIANEVIREGSSLLSWQTDEQNHLIGDWAFASETAPQNRLNFPFRFDGQTLEI
FT                   KQGKFYWDWLEDFPLQGFINAKLTPNSLANGDYYPLKTYLRFNLLSQSKTAGKGNIVLE
FT                   SRDGELQADGLNMPFQITGNVKYDDFILYSTVPVAFSGKFNDLNVKFQPKSLLRLVGKQ
FT                   RLLAIHDLRFPLAGIQINKYGVNGRLHAVFKGESPDFKNINLHLDGFAKHFKIGQLDFF
FT                   EDAPDNNAVKDLWQWKVWGDTNIHTIAGKLKISGWGDWHRNLVRLNELNGELGKIHQQG
FT                   VYIPKTELSLLEPVKFAYQKWQLNGSVQIKSPEMRFDYGGIIPSPSAKLQVNGEIENLN
FT                   LKGELQADKIEPIKLFARRKLTKTASELIGRLYWREQSAKVFQPLIPFRRHWLITDGTV
FT                   RGETAFSAGIEKGIIAGGHFAIRNASLSMPNGEAKAIEFNLPYRLQDNEFDFGLKQPID
FT                   LKIGQLNLGLPIEKIRVKVFGHYPYSRKKPLMLQQLSMNLLDGELNVERFALPQTQIAY
FT                   LKLANINFEQILELVQYQQIELKGKANATLPFWLEGKPCYVCDGLLSQAVESNLKIQPE
FT                   LMKAISQTSGYSERLLLYLLNDTKITDLRGLINVGSTGEMVLDAKLKMQLNQQEKAKIN
FT                   FNYNHKENIFNLWHMINSGSYVEQNLENSIYQQLDKRK"
FT   gene            complement(206519..207343)
FT                   /locus_tag="APP7_0182"
FT   CDS_pept        complement(206519..207343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0182"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60834"
FT                   /db_xref="GOA:B3H022"
FT                   /db_xref="UniProtKB/TrEMBL:B3H022"
FT                   /protein_id="ACE60834.1"
FT                   /translation="MSHDHDSEKKYEVATHALLPMVLMLFVQMFLNHYFAPQNAIFISP
FT                   YLLAFFITNLIIFFVLWKGEICPGQTGRLLFVLKFFMLFSLGNFIYSIGFTPKHNPMAL
FT                   AGVASLMLSLFYWLFTTREKPINTLIYCAFGILAVGMIQYLAIYWIELPSLFNGIRANN
FT                   FAQLLLGILLAGWYLMLAKSRLDVFFKLLVQLALIVLVFNYLWSAFVLYQQLQIMPNMA
FT                   LLPYALYFIVQFVIFALLAWLLLGKGEKQIKNPLGWTLATLLAMLYPFTNMI"
FT   gene            207442..207849
FT                   /gene="gloA"
FT                   /locus_tag="APP7_0183"
FT   CDS_pept        207442..207849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gloA"
FT                   /locus_tag="APP7_0183"
FT                   /product="lactoylglutathione lyase"
FT                   /EC_number="4.4.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60835"
FT                   /db_xref="GOA:B3H023"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR004361"
FT                   /db_xref="InterPro:IPR018146"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B3H023"
FT                   /protein_id="ACE60835.1"
FT                   /translation="MRILHTMLRVGDLERSIKFYTEVLGMRLLRTSENPQYKYSLAFVG
FT                   YADESESAVIELTYNWGVESYELGTAFGHIALGVDDIYATIESVRAAGGKITREPGPVL
FT                   GGTTVIAFAEDPDGYKIEFIENKNAQAALGN"
FT   gene            207989..208645
FT                   /gene="dnaQ"
FT                   /locus_tag="APP7_0184"
FT   CDS_pept        207989..208645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaQ"
FT                   /locus_tag="APP7_0184"
FT                   /product="DNA polymerase III, epsilon subunit"
FT                   /EC_number="3.1.13.-"
FT                   /note="similar to other related 3'-5' exonucleases"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60836"
FT                   /db_xref="GOA:B3H024"
FT                   /db_xref="InterPro:IPR005987"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B3H024"
FT                   /protein_id="ACE60836.1"
FT                   /translation="MTEQVTDYNFLKNRFRGYLPVIIDVETAGLNAQTDALLELAAITV
FT                   KMDENGYLVPDQKCHFHIQPFEGANINPDSLKFNGIDIDNPLRGAVPENIAIPEMFKMV
FT                   RRAMKEQGCQRAVIVAHNATFDQAFVQAAVKRINAKRDPFHPFAMFDTATLAGFMYGQT
FT                   VLVKACQMAKIPFDDKQAHSALYDTEKTTELFCAMVNRLKDLGGFPLVSDSESNV"
FT   gene            complement(208736..210013)
FT                   /locus_tag="APP7_0185"
FT   CDS_pept        complement(208736..210013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0185"
FT                   /product="predicted Mn2+ and Fe2+ transporters of the NRAMP
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60837"
FT                   /db_xref="GOA:B3H025"
FT                   /db_xref="UniProtKB/TrEMBL:B3H025"
FT                   /protein_id="ACE60837.1"
FT                   /translation="MTQTQQIEPASNWQSKLKAMGPGILMASAAVGGSHIVASTQAGAI
FT                   YGWQLALIIILANLFKYPFFRFGVQYTLSSNKTLLEGYQEKGKIYLWIFFILNVIAAMI
FT                   NTAAVGIVTAAILKFIFSALGIQFDLSIPVASTVIIAVTWGILLLGKYRFLDTLSKGIM
FT                   IALTVSTVTAVIVAALKGGIQVAPDFIEPSPWNLASLGFIVALMGWMPAPIEISAINSM
FT                   WVVAKRRLNKVSYEDGIFDFNVGFIGTAILALVFLALGALVQYGSGEAVEQAGVKYIAQ
FT                   LIKMYSFAIGDWSKLLIAFIAFMCMFGTTITVIDGYSRANNEALRLLLNRKESSVASLS
FT                   IWMTVTAAIGILIITVFMSDVAKMLSFAMICSFVSTPIFAALNLSLVLKGEHKVKGGLF
FT                   WLSIVGLIYLTAFTLLFIAYELGMLS"
FT   gene            complement(210589..211710)
FT                   /gene="tyrA"
FT                   /locus_tag="APP7_0186"
FT   CDS_pept        complement(210589..211710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tyrA"
FT                   /locus_tag="APP7_0186"
FT                   /product="T-protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60838"
FT                   /db_xref="GOA:B3H026"
FT                   /db_xref="InterPro:IPR002701"
FT                   /db_xref="InterPro:IPR003099"
FT                   /db_xref="InterPro:IPR008244"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011277"
FT                   /db_xref="InterPro:IPR036263"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036979"
FT                   /db_xref="UniProtKB/TrEMBL:B3H026"
FT                   /protein_id="ACE60838.1"
FT                   /translation="MNPLNPLREQIDQVDQQLIRLFAERLKLVAEVGKVKSEHGIPVYA
FT                   PERETAMIAARRQEAEKQGVPADLIEDVLRRVMRESYVNENKHGFKTTNPHIHKIVIVG
FT                   GKGKLGGLFARFLTLSGYRVETLGSQDWEQAEHILSDCDLVIVCVPIVKTLETIERLQP
FT                   FLTENMILADLTSVKAQPLEKMLEVHSGPVVGLHPMFGPDIASMAKQVVACCHGRFSEK
FT                   YEWLIEQIKIWGAKIEVIDAHEHDHAMTYIQALRHFSTFTFGLHLSRQSVKLSQLLALS
FT                   SPIYRLELAMIGRLFAQDGGLYADIISDKPENLAVIESLKETFTSSLDFFKNNDKAGFI
FT                   QAFEDVHHWFGDYSEQFLKESRILLQQANDNRK"
FT   gene            complement(211823..212884)
FT                   /gene="aroF"
FT                   /locus_tag="APP7_0187"
FT   CDS_pept        complement(211823..212884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroF"
FT                   /locus_tag="APP7_0187"
FT                   /product="phospho-2-dehydro-3-deoxyheptonate aldolase,
FT                   Tyr-sensitive"
FT                   /EC_number="2.5.1.54"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60839"
FT                   /db_xref="GOA:B3H027"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006219"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B3H027"
FT                   /protein_id="ACE60839.1"
FT                   /translation="MNTVVNQDSLHNVNIVDEKVLLTPAELKAELPLPEYLRKQIETSR
FT                   REISDIIHKRDQRKLIVIGPCSIHDPIAAIEYGKKLKALADTVSDKLYIVMRVYFEKPR
FT                   TTVGWKGLINDPKIDGTFDVETGLRVGRKLCLDLAELGLPLATEALDPMTPQYLADLFS
FT                   WSAIGARTTESQTHRELASGLSMAVGFKNGTDGSLSVAINAMQSAAQSHSFIGINQKGQ
FT                   VNLLHTKGNPDSHVILRGGKTPNFEKQYVEECEAALRKAGLAEAIMIDCSHGNSNKDYR
FT                   RQPLVAEDALSQLLAGNTSIIGLMIESHLNAGNQSSDQAFNQMQYGVSITDACIDWQTT
FT                   ENLLTDFAEKLRA"
FT   gene            complement(212926..213972)
FT                   /locus_tag="APP7_0188"
FT   CDS_pept        complement(212926..213972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0188"
FT                   /product="ADP-heptose:LPS heptosyltransferase I"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60840"
FT                   /db_xref="GOA:B3H028"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="UniProtKB/TrEMBL:B3H028"
FT                   /protein_id="ACE60840.1"
FT                   /translation="MKKQPLNICILRLSAIGDVCHTLAVVQAIQRQYPDAKISWIIGKT
FT                   EAMLMQGLENIELIPYDKKTGWKGIFTLWKTLANKRFDFLLNMQTAFRASIISLGIKAT
FT                   KKIGFNRDRAREMQWLFTNEKVEMTASPHVLDGQMMFAKAIGVTDLTPRWSLPVSQSDL
FT                   DYSAAFIDKSKKNVLIAPCSSKQEKDWGAEHNAEIAKWLAAQNINVLIAGSPSAYETET
FT                   AAKIQQLTPNCINIAGKTSLKQLAALIKQVDLVISPDTGAAHIATTQGTPVIGLYAIHN
FT                   PRRTAPYNDRHNVVSVYDQAVLDYYGKPWYELPWATKAKSKSGEKLMERISVEDVKKKI
FT                   VETLAVKL"
FT   gene            complement(214060..215499)
FT                   /gene="pykA"
FT                   /locus_tag="APP7_0189"
FT   CDS_pept        complement(214060..215499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pykA"
FT                   /locus_tag="APP7_0189"
FT                   /product="pyruvate kinase"
FT                   /EC_number="2.7.1.40"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60841"
FT                   /db_xref="GOA:B3H029"
FT                   /db_xref="InterPro:IPR001697"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="InterPro:IPR015793"
FT                   /db_xref="InterPro:IPR015795"
FT                   /db_xref="InterPro:IPR015806"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018209"
FT                   /db_xref="InterPro:IPR036918"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:B3H029"
FT                   /protein_id="ACE60841.1"
FT                   /translation="MSRKLRRTKIVCTMGPATDRGNNLEKVIAAGANMVRMNFSHGVPE
FT                   DHIERANKVREIAARLGKTVAILGDLQGPKIRVSTFKDGKIFLNIGDKFTLDADLPRGE
FT                   GHQDAVGLDYKNLPNDVVPGDILLLDDGNVQLKVLSVEGVKVHTEVTVGGPLSNNKGIN
FT                   KLGGGLSAPALTEKDKEDIKLAAKIGVDYLAVSFPQSSADLDYARQLAREAGLEAKIVA
FT                   KVERAETVATEEAMDDIILGSDVVMVARGDLGVEIGDAALVGVQKRLIRRARKLNRVVI
FT                   TATQMMESMIKKPMPTRAEVMDVANAVLDGTDAVMLSGETANGDYPVETVKSMAEVCLG
FT                   AETMPSINISRHRMEGTFATIDEAVAMSAMYTANHLEGVSALIALTHSGETAKLMSRIS
FT                   SGLPIYALSRNQQALNRTALYRGVTPVFYDEESRTFEGAKKAIALLKEKGYLMSGDLVL
FT                   LTQGDELKEGGTNTSRLLKVE"
FT   gene            215631..216122
FT                   /gene="sixA"
FT                   /locus_tag="APP7_0190"
FT   CDS_pept        215631..216122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sixA"
FT                   /locus_tag="APP7_0190"
FT                   /product="possible phosphohistidine phosphatase"
FT                   /EC_number="3.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60842"
FT                   /db_xref="GOA:B3H030"
FT                   /db_xref="InterPro:IPR004449"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:B3H030"
FT                   /protein_id="ACE60842.1"
FT                   /translation="MNIWIMRHGEAGFNATTDSERPLTENGRKTAYKQGQWLAKRFLEQ
FT                   SIVSDKVIVSPYLRAQQTFEALNEGMQAVDFKRNLVNSSIEIWEGVTPGGDPENVKNYL
FT                   DFLREEGAKNILIISHLPLVYDLVVSLTQHQDSVHFYPAVIAEIDWKTDFGKVSAIEYP
FT                   "
FT   gene            216345..217307
FT                   /gene="dus"
FT                   /locus_tag="APP7_0191"
FT   CDS_pept        216345..217307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dus"
FT                   /locus_tag="APP7_0191"
FT                   /product="tRNA-dihydrouridine synthase B"
FT                   /EC_number="1.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60843"
FT                   /db_xref="GOA:B3H031"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR024036"
FT                   /db_xref="InterPro:IPR032887"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:B3H031"
FT                   /protein_id="ACE60843.1"
FT                   /translation="MRIGQYELKNRIFLAPMAGITDQPFRRLCTKLGASLTFSEMMSTN
FT                   PEVWHTEKSRLRLAHHEEIGINAVQIAGSDPAEMAMAAKVNVEYGAQIIDINMGCPAKK
FT                   VNKKMAGSALLREPELVAQILDAVVNAVDVPVTLKIRTGWDQENRNCLEIAKIAEKAGI
FT                   SALTIHGRTRHCLFEGNAEYDSIKAVKQAVSIPIIANGDITSAEKAKYVLDYTQADAVM
FT                   IGRGSFGRPWLFKEVEQFLENGRLLDLPLDEKCRLMFKHIEDLHRFYGEQKGYRIARKH
FT                   VGWYADQLSPDLTFKRTFNALDSTKEQLLALEDFMKSIR"
FT   gene            217335..217631
FT                   /gene="fis"
FT                   /locus_tag="APP7_0192"
FT   CDS_pept        217335..217631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fis"
FT                   /locus_tag="APP7_0192"
FT                   /product="DNA-binding protein Fis"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60844"
FT                   /db_xref="GOA:B3H032"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR005412"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:B3H032"
FT                   /protein_id="ACE60844.1"
FT                   /translation="MLEQQPVQNPLTVSMLNAQAQQVNKPLRDNVKAALKNYLSQLNGE
FT                   DPTELYELVLSEIEHPMLDMVMQYTRGNQTRAATMLGINRGTLRKKLKKYGMG"
FT   gene            complement(217696..219054)
FT                   /locus_tag="APP7_0193"
FT   CDS_pept        complement(217696..219054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0193"
FT                   /product="predicted Na+-dependent transporters of the SNF
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60845"
FT                   /db_xref="GOA:B3H033"
FT                   /db_xref="InterPro:IPR000175"
FT                   /db_xref="InterPro:IPR037272"
FT                   /db_xref="UniProtKB/TrEMBL:B3H033"
FT                   /protein_id="ACE60845.1"
FT                   /translation="MANKSVERQSWSNRLAYVMTVAGATVGFGATWRFPYLVGENGGGA
FT                   YVFLFCIAMIVIGIPMILVENVIGRRIKVNAIDAFGGMANGKKIASGWKILGYMGLLGA
FT                   FGILAYYMVLGGWVLNYISSLISGTLDLSTPVTVETTASYYKESIQNSPMAIIGYTALF
FT                   VLVNYFILSKGIVDGIERSVKYLMPLLFVFLLVMVIRNVTLPGAAEGIAFYLMPDFSKI
FT                   TPKLFVFVLGQVFFALSLGFGVLITLSSYLDKNENLVKTATITGIMNTLIAVLAGFMIF
FT                   PSLFSFGVAPNSGPTLVFQSLPIVFSNMWGGTLFAIIFFSLLVVAALTTSLTIYEVIIT
FT                   ALQEKTKMSRKKAIAVTLSTIFVIGNIPSVLGDNLWQHIRIMDKSIFDAFDYISGNILF
FT                   ILTALGSAIFVGFVLKDEAKKELGAGKVFTNIWFNYVKFVIPVIILVIFFNSL"
FT   gene            complement(219119..219952)
FT                   /gene="dam"
FT                   /locus_tag="APP7_0194"
FT   CDS_pept        complement(219119..219952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dam"
FT                   /locus_tag="APP7_0194"
FT                   /product="DNA adenine methylase"
FT                   /EC_number="2.1.1.72"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60846"
FT                   /db_xref="GOA:B3H034"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR012263"
FT                   /db_xref="InterPro:IPR012327"
FT                   /db_xref="InterPro:IPR023095"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B3H034"
FT                   /protein_id="ACE60846.1"
FT                   /translation="MSNKRAFLKWAGGKYRLTTEIRKHLPPKSAQGACFVEPFVGAGSV
FT                   FLNTDYERYLLADINPDLINLFNIIKHDVEHYIKETKTLFLASEANTASFYYARRQEFN
FT                   RSSDKFRRSVLFLYLNRFGFNGLCRYNQKHEYNVPFGAYKTHYFPENELRFFAEKAQKA
FT                   EFICADFEQVFARLYQAPDNYIVYCDPPYAPLQQDTNFTHYAGGGFSLVQQEKLAQLAR
FT                   QAQTNNIPVLISNHDTAFTRQIYHGAKIKKIKVQRSIGQRADSRIKVDELFALFL"
FT   gene            complement(219945..221045)
FT                   /gene="aroB"
FT                   /locus_tag="APP7_0195"
FT   CDS_pept        complement(219945..221045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroB"
FT                   /locus_tag="APP7_0195"
FT                   /product="3-dehydroquinate synthase"
FT                   /EC_number="4.2.3.4"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60847"
FT                   /db_xref="GOA:B3H035"
FT                   /db_xref="InterPro:IPR016037"
FT                   /db_xref="InterPro:IPR030960"
FT                   /db_xref="InterPro:IPR030963"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3H035"
FT                   /protein_id="ACE60847.1"
FT                   /translation="MLQVNVELKERRYPITIGAGLLGDPNSYSSLKAGDKVMIVSNPTV
FT                   AAHYLATVTNTLNGLGCSVDSVLIPDGEKYKTLDSLNMIFTALLEKNHNRDTTLIALGG
FT                   GVIGDVAGYAAASYQRGIRFIQIPTTLLAQVDSSVGGKTAVNHPLGKNMIGAFYQPISV
FT                   IIDTNTLQTLPKREVSAGLAEVIKYGAIFDIHFFEWLESNIHHLVALKQNELEYCIQRC
FT                   CQLKADVVARDETEKGDRALLNLGHTFGHAIEAHLGYGNWLHGEAVSVGMLEAAELSRI
FT                   LGDLSAQDVSRLERLLAQAVLPTISPDGMEPSEYLPYMWRDKKVLGGQLRLVLLKSLGK
FT                   AYVTAQASEQQVLSAIERFTQREFHE"
FT   gene            complement(221119..221682)
FT                   /gene="aroK"
FT                   /locus_tag="APP7_0196"
FT   CDS_pept        complement(221119..221682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroK"
FT                   /locus_tag="APP7_0196"
FT                   /product="shikimate kinase (SK)"
FT                   /EC_number="2.7.1.71"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60848"
FT                   /db_xref="GOA:B3H036"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR023000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:B3H036"
FT                   /protein_id="ACE60848.1"
FT                   /translation="MNLSHNIEIKEEQTMAEKRNIFLIGPMGAGKSTIGRQLAQMLGME
FT                   FIDSDAVIEERAGADIDWIFDLEGETGFRKREERIINELTQNQGVVLSTGGGSVLSKEN
FT                   RNVLSARGIVIYLETTVDKQFERTQRDKKRPLLQTENPRETLEALAKVRNPLYEEIADI
FT                   TLQTDEQSAKLVATHIIELIDNLQ"
FT   gene            complement(221710..221847)
FT                   /locus_tag="APP7_0197"
FT   CDS_pept        complement(221710..221847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0197"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60849"
FT                   /db_xref="UniProtKB/TrEMBL:B3H037"
FT                   /protein_id="ACE60849.1"
FT                   /translation="MVSCDNHTQLFWAICGISYTKHNRKNICKIFRKTDRLPLLKTRSN
FT                   "
FT   gene            complement(221902..224469)
FT                   /gene="mrcA"
FT                   /locus_tag="APP7_0198"
FT   CDS_pept        complement(221902..224469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mrcA"
FT                   /locus_tag="APP7_0198"
FT                   /product="membrane carboxypeptidase/penicillin-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60850"
FT                   /db_xref="GOA:B3H038"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031376"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:B3H038"
FT                   /protein_id="ACE60850.1"
FT                   /translation="MKIAKIILSALLSLIILGGIAAGLAYIHIRDSLPNVSSLKTVELQ
FT                   QPMQIFTADGKLIGEVGEQRRIPVKLAEIPQTLIDAVIATEDVRFYDHKGIDPKGIVRA
FT                   IWRSSQGDTQGASTITQQLARNFFLTPERNLERKLKEAILALEIEKVLTKDEILELYLN
FT                   KIYLGYRSHGVAAAAKTYFGKNLDQLTLGEMAIIAGLPKAPSTMNPLYSVKRAEARRNV
FT                   VLGRMLEVGKITQQQYDQAKAETVKATFYGTALEFRADYVTEMVRQEMVKRYGEDVAYN
FT                   KGFKVYATVLSTDQKAAQDALSENLINYDRRHGWRGAEKLWSGKEAWDDEKIIDHLSKL
FT                   PNSDPFIGAAVMAVGKNGYTIMLPNGDKEELQKSNAVFGKQIKLNVGEQIWVRKYKNGK
FT                   DWQLGQIPEVNSALVSLNSDNGAIEAIVGGFSFEQSRFNRATQSLVQVGSSIKPFIYAA
FT                   AMNKGLSLSTTLSDSPITITKKGQKPWTPKNADNRYEGPLRLRVALGKSKNMIAIRALQ
FT                   MAGVDYVAEYLERFGFNRDQFVATEALALGAASFTPLEMARGYAVFDNGGYLIEPYIIE
FT                   RILDNQGNELFKANPAIACMDCNIGVKYPEPTYFDGVKIHDETQLQGNSEISENDESND
FT                   TSAENDDELEIKPAVKSDAPSLMTEAAQNGTETRYAPRVISGELAFLMRSALNSAIYGE
FT                   PGQAWNGTSKALANEFKRKDIGGKTGTTNNSKVTWYAGFGANIVTTVYVGFDDNKRDLG
FT                   KGEAGARTAMPAWIKYMKVALADKKERTPVMPPNIIETKIDSVSGFLGNNLTEYFIKGT
FT                   EPTKKYIVEKAYKLPQEAKPHLEQRLGLPPKELLNSPGSFELF"
FT   gene            224608..225288
FT                   /locus_tag="APP7_0199"
FT   CDS_pept        224608..225288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0199"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60851"
FT                   /db_xref="UniProtKB/TrEMBL:B3H039"
FT                   /protein_id="ACE60851.1"
FT                   /translation="MKKFAESFKKESKNYSIGISENQAYRCFSFEYQEQRETYWQLKTD
FT                   DNRFTLPQAIECLKNPVFIRSVPFQYIWRKYLFLPINYDQAMIYRQILQVLRQELPLAI
FT                   EEVYFDYQCFPLPNDNLVRVIIYALRKNYADSLFIQPNTILDCELYCFVRGFNYLSSSE
FT                   SAQQDRIYALENKTFKLTPKGVEFNTDLTQANCHLKQLELPDSITDPVLYLTALGASLW
FT                   NGEE"
FT   gene            225270..225791
FT                   /locus_tag="APP7_0200"
FT   CDS_pept        225270..225791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60852"
FT                   /db_xref="GOA:B3H040"
FT                   /db_xref="UniProtKB/TrEMBL:B3H040"
FT                   /protein_id="ACE60852.1"
FT                   /translation="MEWRGINLTDFRVRQWKSKIYKQFCCLVLIVSVAIGLAVHLQLAA
FT                   LQINQQNRPLAKQNQQLKTERDNLHRKLEQYRSSPIRDTVQTFTKSQVGAFLNLLQSLP
FT                   LPQGGVEEAIFEYDDMPIMKIVGVLINSDQFERLEKYLSEQKTFKYSLVSFQLNEQQEI
FT                   EFVFNIMLRE"
FT   gene            225791..226321
FT                   /locus_tag="APP7_0201"
FT   CDS_pept        225791..226321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0201"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60853"
FT                   /db_xref="GOA:B3H041"
FT                   /db_xref="UniProtKB/TrEMBL:B3H041"
FT                   /protein_id="ACE60853.1"
FT                   /translation="MMLSLNRLYLLPNNYLFRVLSFIQTYFKTVCLIMFILIISYPLYR
FT                   YLYESYSHQELLLNRQRLTEEVEQEYRLYQSVSQYHQQLAEKEQYVSLLNQQLQIIFTD
FT                   NQVKPEQLQWELEQEKSIYFSVTHQVSNIFKLIRILSENSLLKFKTIHLIKLKQDKQLQ
FT                   LKANVIVTEDKNE"
FT   gene            226314..226718
FT                   /locus_tag="APP7_0202"
FT   CDS_pept        226314..226718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0202"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60854"
FT                   /db_xref="UniProtKB/TrEMBL:B3H042"
FT                   /protein_id="ACE60854.1"
FT                   /translation="MSKYIWILFIFSSISVADPFYGEKLARENPTFSADTEIAMNTENL
FT                   TACNISLPQISRYLPAKLTQLKFIGVLKKEDKYKAILMDVQKQLFDLQVNDWLADELIQ
FT                   IIDIDLKSIRYINWQTEKNCESPIPVILKL"
FT   gene            226730..228028
FT                   /gene="hofQ"
FT                   /locus_tag="APP7_0203"
FT   CDS_pept        226730..228028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hofQ"
FT                   /locus_tag="APP7_0203"
FT                   /product="type II secretory pathway, component HofQ"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60855"
FT                   /db_xref="GOA:B3H043"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004845"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR005644"
FT                   /db_xref="InterPro:IPR013355"
FT                   /db_xref="InterPro:IPR038591"
FT                   /db_xref="UniProtKB/TrEMBL:B3H043"
FT                   /protein_id="ACE60855.1"
FT                   /translation="MRKMIWLLLFILTPVMANTFSLSLKNAPTAEILSYLAEEYGKNIV
FT                   LSDNIETNTTLRIENSDFDSVLKSITRANKLTSAYEKQIYFIGHKKDEKAATAIGVNSD
FT                   LLKPKLITKTIKLDYAKAAEVIESLTKGSGHFLSENGYLHFDDRSNSLIIKDSPESMKN
FT                   IVQLIRNLDKPTEQIAIEARIVTISSENLQELGVRWGIFAPTNGHHKIAGSLEANGLPN
FT                   TNRLNVNFPVNNAASIALQVAKINGRVLDLELTALEQENNVEIIASPRLLTTNKKPASI
FT                   KQGTEVPYVLYNRKDEVKNIEFKEAVLGLQVTPHISNDKQILLDLVVTQNSPNSTGSTL
FT                   QGLVTIDKQELNTQVFAQHGETIVLGGIFQHLTAKGEDRVPILGSIPVLKKLFSHSSDK
FT                   ISKRELVIFVTPYIVKNGQPQISSHSSQKLAPK"
FT   gene            228154..228567
FT                   /gene="nusB"
FT                   /locus_tag="APP7_0204"
FT   CDS_pept        228154..228567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusB"
FT                   /locus_tag="APP7_0204"
FT                   /product="transcription antitermination protein NusB"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60856"
FT                   /db_xref="GOA:B3H044"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR011605"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3H044"
FT                   /protein_id="ACE60856.1"
FT                   /translation="MKVSPRRRARECAVQALYSWYVSQNSVEEVELSFVTDQDMNGVDL
FT                   PYFRKLLRGTVLYVEAIDNDLRPFLDRAEDEVDPIERTILRLSAYELKYELDVPYKVVI
FT                   NEGIEVAKVFGSDDSHKYINGILDKLAPALGRK"
FT   gene            228632..229597
FT                   /gene="thiL"
FT                   /locus_tag="APP7_0205"
FT   CDS_pept        228632..229597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiL"
FT                   /locus_tag="APP7_0205"
FT                   /product="Thiamine-monophosphate kinase"
FT                   /EC_number="2.7.4.16"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60857"
FT                   /db_xref="GOA:B3H045"
FT                   /db_xref="InterPro:IPR006283"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:B3H045"
FT                   /protein_id="ACE60857.1"
FT                   /translation="MMEFEVIAQYFKRKNLRSDVDLSVGDDCAVTTLKPNERLAVTTDT
FT                   LVSGTHFLPSISAADLAYKTLAVNLSDLAAIGAAPAWVSLALTLPKVDHQWLAEFSQSL
FT                   FAVLDRYHVDLIGGDTTGGPLSLTLTAQGILPQDQGLFRHQAQVGDWIFVSGSLGDSAA
FT                   GLSILLDNCKISDESDRYLVQRHLRPTPRVELGLALRAFSCCAIDISDGLLADLGHILE
FT                   RSQVGAEIELDNIPLSTHLTTKYSEKEALHFALTGGEDYELCFTVSDDKRSEMERILRS
FT                   QGIKVSCIGRITPAASGLILRQNGKQVPLPTQSGFDHFKS"
FT   gene            229610..230083
FT                   /gene="pgpA"
FT                   /locus_tag="APP7_0206"
FT   CDS_pept        229610..230083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgpA"
FT                   /locus_tag="APP7_0206"
FT                   /product="phosphatidylglycerophosphatase A"
FT                   /EC_number="3.1.3.27"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60858"
FT                   /db_xref="GOA:B3H046"
FT                   /db_xref="InterPro:IPR007686"
FT                   /db_xref="InterPro:IPR026037"
FT                   /db_xref="InterPro:IPR036681"
FT                   /db_xref="UniProtKB/TrEMBL:B3H046"
FT                   /protein_id="ACE60858.1"
FT                   /translation="MKNFNLKNPIHLFACGFGSGLLKPAPGTWGSLAGVLIAVLLWNLT
FT                   ESSLFFIGLTLVSFIAGCHICEKTSRDLNVHDDGRIVWDEIVAIFLMFAFLPEYNGLAY
FT                   TLTFICFRFFDVLKPYPIRYFDEKLETGLGIMFDDILAAIYALIALHFIYWLI"
FT   gene            230092..230718
FT                   /locus_tag="APP7_0207"
FT   CDS_pept        230092..230718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0207"
FT                   /product="putative threonine efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60859"
FT                   /db_xref="GOA:B3H047"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:B3H047"
FT                   /protein_id="ACE60859.1"
FT                   /translation="MLTILLVHLAGLASPGPDFFYVVRQSASHSTKAGILAAIGISLGI
FT                   IFWASFAIFGLAWLSNTIGTVFQFLIMVIGGIYLSYIGSLMVRVTKNATFTNEPTNLRV
FT                   LDNVTEIKKGLLINIFNAKAGVYFTSVVSAFLAQFTQTSDLFLLLFLFVFSTLIYFILV
FT                   ALLFSRRPIQEFYTKYSRYIDNVAGVIFILFGMILIFDGIKGLIS"
FT   gene            complement(230777..231814)
FT                   /locus_tag="APP7_0208"
FT   CDS_pept        complement(230777..231814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0208"
FT                   /product="predicted rRNA methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60860"
FT                   /db_xref="GOA:B3H048"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR016479"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:B3H048"
FT                   /protein_id="ACE60860.1"
FT                   /translation="MKPKFNENKPRFQTIEERRDNKFQTKSNRFEDKPRFDKPKFGGDK
FT                   ACFDRKDHQEAREAIYPTIGKKAAGEGNVQISVKGGNNTMKEKKTGPLSPRAPEKIKKN
FT                   RAEEMKVYGENACIALFKQRPDAIVRLWATVEGAKKLGDMLSYLAEHKKAYHVVDRAEM
FT                   ERVTGTEHHGDVCLLVKKAVPFSLEGYLQVPRKRDCLVLLDAVNNAQNVGGIIRTCAFY
FT                   GVNGVIVESADTLNSSAAARVAEGGLEFVRPLETKNKQIALTQLRNAGYQVVHLTRNKQ
FT                   AAPLAKTKLAAKTVFVLSEIPAQDIEYPEDTTVQLSFENPLNSGLNVAVSTGILLNQWY
FT                   QANII"
FT   gene            231980..232792
FT                   /gene="suhB"
FT                   /locus_tag="APP7_0209"
FT   CDS_pept        231980..232792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="suhB"
FT                   /locus_tag="APP7_0209"
FT                   /product="Inositol-1-monophosphatase (IMPase)"
FT                   /EC_number="3.1.3.25"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60861"
FT                   /db_xref="GOA:B3H049"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR020550"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="InterPro:IPR022337"
FT                   /db_xref="InterPro:IPR033942"
FT                   /db_xref="UniProtKB/TrEMBL:B3H049"
FT                   /protein_id="ACE60861.1"
FT                   /translation="MNPMLNIAIRAARKAGNIIAKGYEQAASEIEVAQKGTNDYVTAID
FT                   KAAEAAIIEVIRKSYPDHAIVGEESGILAGENENVQWVIDPLDGTTNFVKRLPHFAVSI
FT                   AVRENGRTTVGVVYDPIRNELFTAVRGEGAKLNEFRLRVETERRDLNGTVLATGFPFKA
FT                   AKHRPAHLNMLEGLMNNGVADFRRTGSAALDLAYVAANRVDGYFEIGLKPWDCAAGDLI
FT                   VREAGAIVTNFVGGTDYLKSGNVVAGQARVVKEILNAIQPTLTEDLKN"
FT   gene            232913..234766
FT                   /gene="dxs"
FT                   /locus_tag="APP7_0210"
FT   CDS_pept        232913..234766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dxs"
FT                   /locus_tag="APP7_0210"
FT                   /product="1-deoxy-D-xylulose-5-phosphate synthase (DXPS)"
FT                   /EC_number="2.2.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60862"
FT                   /db_xref="GOA:B3H050"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005477"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3H050"
FT                   /protein_id="ACE60862.1"
FT                   /translation="MQNKYPLLSQINSPEDLRLLAKEQLQSVADELRAYLLESVSQTSG
FT                   HLASGLGVVELTVALHYVYQTPFDQLIWDVGHQAYPHKILTGRRDQMHTIRQKNGIHPF
FT                   PWREESLYDVLSVGHSSTSISAGVGIAVAAEKENAGRKTVCVIGDGAITAGMAFEAMNH
FT                   AGALHTDMLVILNDNEMSISENVGALNNHLARIFSGSIYTTVRDGSKKVLDKVPTIKNF
FT                   MKKSEEHMKGVISPESTLFEELGFNYIGPIDGHNIDELVKTLSNMRELKGPQFLHIRTK
FT                   KGKGYEPAENDPIGYHGVPKFDPTCGQLPKSKTIPTYSDIFGNWLCEMAEQDSKLIGIT
FT                   PAMREGSGMVEFSKRFPEQYFDVAIAEQHAVTFGAGLAIAGYKPVVAIYSSFLQRAYDQ
FT                   LIHDVAIQNLPVIFAIDRAGIVGADGQTHQGAFDVSFMRCIPNMTIMCPSDENEMRQML
FT                   YTAYRMNTPTAVRYPRGNAQGVALAPMQALEVGKGKLIQQGQKVAILNFGPLLNEARIV
FT                   AEKHNYTLADMRFVKPLDEQLVAELADSHELLVTLEENAIQGGAGSAVNEYLQKIGKIR
FT                   PLVMLGIPDFFVPQATQAESYADLGLDAAGIEQRIQAVVNQ"
FT   gene            complement(234812..235531)
FT                   /locus_tag="APP7_0211"
FT   CDS_pept        complement(234812..235531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0211"
FT                   /product="hypothetical transposase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60863"
FT                   /db_xref="GOA:B3GXR4"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:B3GXR4"
FT                   /protein_id="ACE60863.1"
FT                   /translation="MIRQKVIEIYQDNDGNYGYRRITLKLRDFLGAINRKRIQRIMQQL
FT                   DLKGKCKQRKYRSYQGEVGKIAENVLQRDFHATAPNEKLVTDITEFKCAEGKLYLSPIK
FT                   DLFNSEILADDLARSPNFEQVMRMLKQAVAKLPKDAKPILHSDQGWQYRMADYQDMLRK
FT                   HHIRQSMSRKGNCLDNGAMESFFGRLKTECYFGKRFETFEQLEKVIHEYIHYYNNERIQ
FT                   VKLKGLSPVQYRTQSLN"
FT   gene            complement(235636..236145)
FT                   /locus_tag="APP7_0212"
FT   CDS_pept        complement(235636..236145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0212"
FT                   /product="hypothetical transposase"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60864"
FT                   /db_xref="GOA:B3H052"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:B3H052"
FT                   /protein_id="ACE60864.1"
FT                   /translation="MTKYNSLFKQQVIEFYLQNDKNRLFTQRHFQLSKKTLTRWIAQFN
FT                   HNGINGLAVIGKKQKYSPEFKLTVIQAVKKGQFSAESASLHFGIANSGSISQWLHIFEE
FT                   QGINGLLPKPKGRPTMKPKYPKMPPPPKTEEERLRYRILELEAENAYLKKLREFNQQKM
FT                   RQKQPS"
FT   gene            complement(236234..237499)
FT                   /gene="glyA"
FT                   /locus_tag="APP7_0213"
FT   CDS_pept        complement(236234..237499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyA"
FT                   /locus_tag="APP7_0213"
FT                   /product="glycine/serine hydroxymethyltransferase"
FT                   /EC_number="2.1.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60865"
FT                   /db_xref="GOA:B3H053"
FT                   /db_xref="InterPro:IPR001085"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019798"
FT                   /db_xref="InterPro:IPR039429"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3H053"
FT                   /protein_id="ACE60865.1"
FT                   /translation="MFTANMNIQDYDPILWQAIENENRRQEEHIELIASENYASPRVMQ
FT                   AQGSQFTNKYAEGYPGKRYYGGCEYADIVEQLAIDRAKQLFGADYVNVQPHSGSQANAA
FT                   VYGALIQPNDTILGMDLAHGGHLTHGAKVSFSGKIYNSVLYGITAEGLIDYEDVRQKAL
FT                   ECKPKMIVAGFSAYSQIVDWAKMREIADEVGAYLFVDMAHVAGLIAAGVYPSPLPYAHV
FT                   VTTTTHKTLGGPRGGLILSACGDEEIYKKLQSSVFPANQGGPLVHIIAAKAVCFKEALE
FT                   PEYKIYQQNVVKNAKAMVEVFKQRGYEVISNGTENHLFLVSFVKQGLTGKAADAALGQA
FT                   NITVNKNSVPNDPQKPFITSGIRIGTPAVTRRGFKEADVQALAGWMCDVLDSIGKDNHE
FT                   QVIAETKAKVLDICARLPVYAK"
FT   gene            complement(237730..238617)
FT                   /gene="pnnK"
FT                   /locus_tag="APP7_0214"
FT   CDS_pept        complement(237730..238617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pnnK"
FT                   /locus_tag="APP7_0214"
FT                   /product="probable inorganic polyphosphate/ATP-NAD kinase"
FT                   /EC_number="2.7.1.23"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60866"
FT                   /db_xref="GOA:B3H054"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017437"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:B3H054"
FT                   /protein_id="ACE60866.1"
FT                   /translation="MKPEERFFECIAIVGKPRHEIALETHLAVYNWLKDRHYRVLVEKS
FT                   IAQQLNLPEARSLEEIGQQANLVIVIGGDGNMLGMARRLAEYQVPLIGINRGNLGFLTD
FT                   IAPHSTFEQLHNCIERGEFVIEERFLLEARIERNGKIIATNNALNEVVIHPTQVARIIE
FT                   FEVYIDGKFAFSQRSDGLIISTPTGSTAYSLSAGGPILTPNMNAIALVPMHPHTLSSRP
FT                   LVIDGDSQISLRFAQYNQPSLEVSCDGQYDLPFTPEDRIIVEKSPNKLRLLHLKDYNYF
FT                   TVLGSKLGWSSKLF"
FT   gene            complement(238708..242055)
FT                   /locus_tag="APP7_0215"
FT   CDS_pept        complement(238708..242055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0215"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60867"
FT                   /db_xref="InterPro:IPR006483"
FT                   /db_xref="InterPro:IPR013395"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3H055"
FT                   /protein_id="ACE60867.1"
FT                   /translation="MNILLISQCNKNALTETRRILDQFAERCGDRCWQTAITQAGLETL
FT                   HNMLRQTARKNTAVACYWTHGKNLTELLWIVGDKSQFNAEGRVPTNRTQRNILRADDEN
FT                   GWLSAYSIQILTAIAALLHDIGKANIAFQQKLKPKAKFFPDCYRHEWISTRLFEAMIAG
FT                   CDTDEQWLARLANWQNYIEENPDWLPNLTLIADKSDHPHNFSHFPPLAKVVLWLILSHH
FT                   KLPFTQKTLDCHSDQKRILSEHFMLKTAVEPFYRFLAPVEHWVMNQSEHPQPENFWQFK
FT                   TLVMESKAWQKAMQRWANKALNHAPLRELSQLNKTINDPFLLILSRLCLIVGDHNYSSA
FT                   PADRQLGDLNFFEKLIANTDKKTKQPKQALDEHLLGVCKTSTKFARLLPKLAKELPHIQ
FT                   QHRPFTKRTNLDRFKWQNRAFELARSLQSESEQAGFFGVNMASTGCGKTLANAKIMYGL
FT                   SNQDGARFTIALGLRVLTLQTGLALRQKLMLSSEQLAVLVGGSATKQLFELQNESVQSG
FT                   SESAQEWFEDNEVYGMNFLESGIAEEEFGTLLADNKAKKLLYAPIVSCTLDHMIQATET
FT                   IRGGKHIVPLLRLLTSDLVLDEPDDFSQSDLPALSRLVHLAGMFGSKVLLSSATLTPDL
FT                   ISGLFNAYQAGRKIYNRHQGINPELPICCAWIDEYKQQQQKCAAVKEFERYHALFTASR
FT                   AEKLMQSPIRHKAEIIQLPPFSSVENQDINYTMLADSLIEQAITLHQRYAQQDPISKKF
FT                   VSVGLIRFANIKPMIPLVETLFKTPLNTQFSDYKIHLCCYHSRQLLLLRSKLEEKLDRI
FT                   LNRHEPEALFSQPEIMSALTQDKAVHHIFIVLGSPVTEVGRDHDYDWAIVDPSSMRSII
FT                   QLAGRVWRHRHEKIATQANILLLPTNWRGLQTKNNGSEPIFCRPGFEDQSNKLTSHKTV
FT                   GLIKQEHLASITAIPRIIKPLGLQAETNLADLEHKVIGDLLNNKGINRVNAYWQDNLTN
FT                   RLNANLPLITPFRKNEGKWQTEVVCLPSEESHWEFMFKSSERAWEDPYFENDYLAEISY
FT                   QKLNCESPWITPWLTTPLNQALSELCEQLDEADQTQAALRFATVSLQHYGKTLPIWKFN
FT                   ETLGFWQP"
FT   gene            complement(242052..243008)
FT                   /locus_tag="APP7_0216"
FT   CDS_pept        complement(242052..243008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0216"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60868"
FT                   /db_xref="GOA:B3H056"
FT                   /db_xref="InterPro:IPR002729"
FT                   /db_xref="InterPro:IPR019857"
FT                   /db_xref="InterPro:IPR042206"
FT                   /db_xref="InterPro:IPR042211"
FT                   /db_xref="UniProtKB/TrEMBL:B3H056"
FT                   /protein_id="ACE60868.1"
FT                   /translation="MKKTPYIPSSDLKTILHSKRANIYYLEHCRILLNGGRVEYVTDKG
FT                   NESLYWNIPIANTICLLLGSGTSITQAAMRELSKAGVMVGFCSGGGTPLFNGTEAEIGC
FT                   DFFSPQSEYRPVEYLQQWCRFWFDDNKRLNSAKTLQLARLQLLLRTWNKFDWEYAQDKL
FT                   TALVQHYQEEFTNVKDSQSLLAAEGRLTAKLYALANQATLNDESFKRESGKEGANQFLD
FT                   HGNYLAYGLGATACWVLGLPHGLAILHGKTRRGGLVFDAADIIKDAIILPQAFISAQNG
FT                   DNEKQFRQACINNLIRFEALDIIINTLKQLASEGANI"
FT   gene            complement(244955..245524)
FT                   /locus_tag="APP7_0217"
FT   CDS_pept        complement(244955..245524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0217"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60869"
FT                   /db_xref="GOA:B3H057"
FT                   /db_xref="InterPro:IPR013396"
FT                   /db_xref="InterPro:IPR042564"
FT                   /db_xref="UniProtKB/TrEMBL:B3H057"
FT                   /protein_id="ACE60869.1"
FT                   /translation="MSELTHYIELKAIPQVDILQTDVIAHGLQILHKFLPLYQGEIGLS
FT                   FPAYGLGRTLGGIIRVFGNEQHCTQIKTQLIGEGLQDYVLITSVTPVPEEIVEYHRYQR
FT                   VHRKGQSAIRRTEQFLVQQGKWTEEIRQEMLIHQQNQKVFPYVKLKSGSTKQHFVLAIR
FT                   QLRLAEPVSGLFNAYGLSKIATVPHF"
FT   gene            complement(245527..246522)
FT                   /locus_tag="APP7_0218"
FT   CDS_pept        complement(245527..246522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0218"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60870"
FT                   /db_xref="InterPro:IPR013399"
FT                   /db_xref="UniProtKB/TrEMBL:B3H058"
FT                   /protein_id="ACE60870.1"
FT                   /translation="MTKLTTASVLAFERKLDISDATFTQKNSTSSEPEIAVTIREKSVR
FT                   GTISNRLKNALANDPAKLDAEIEKANLQRVDVATLNDDYDTLVARFTCKVLPFEGKPNV
FT                   CNDPEYQAKLLSTIQNYLTAHGMSELAKRYATNLANARWLWRNRISAETIQVSIKVADD
FT                   VIVFENAKQLPLNSFEQADEKLQKIASYIEKGLKGEEFIILEVEAQAKMGRGQEVYPSQ
FT                   ELVLDTGTRKSKILYEINNKAGMHSQKIGNAIRTIDTWYAENAPFPIAVEPYGAVTNLG
FT                   TAFRQPKEKIDFYTLFDNWVLKDVAPELEQQHYVISVLIRGGVFGASGKE"
FT   gene            complement(246524..247483)
FT                   /locus_tag="APP7_0219"
FT   CDS_pept        complement(246524..247483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0219"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60871"
FT                   /db_xref="InterPro:IPR013398"
FT                   /db_xref="UniProtKB/TrEMBL:B3H059"
FT                   /protein_id="ACE60871.1"
FT                   /translation="MNYPNFYLLFDHVEIQAANTISSPITYGFPALTGFTGAIHALSRK
FT                   LFSQQVELGGVMIACHDYQILGYKHSDFSDLTFNQTRNPLKKNGDSPSIIEEGKIHLDI
FT                   SLVVEMEVKDPEFYYALNSQDSEQKTQFLEHCKKLLMQQRIAGGSVFQIENVELFNLSE
FT                   ESEIKLALMPAFVLMDAKQILTDITQSLQNGISNNEIMIYPATPNANALDALLEVATLH
FT                   HIPLSENATSQEWETFNVNQGKGWLVPIPVGYQAISPLFTAGEMQNCRTTEYPSQYVET
FT                   VYSLGKWVFPFSLPDDLSQCFWHYNTPQDNLYLITQGA"
FT   gene            complement(247480..248829)
FT                   /locus_tag="APP7_0220"
FT   CDS_pept        complement(247480..248829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60872"
FT                   /db_xref="InterPro:IPR013397"
FT                   /db_xref="UniProtKB/TrEMBL:B3H060"
FT                   /protein_id="ACE60872.1"
FT                   /translation="MITPLQIRAKIIDFLQAQHLKKSENDYKKLEKATEPEEIAKIKAE
FT                   ISKSEEKYRLDTWLHTAATEMAKQLKFGTHIAKGIHPDAKGNNINFRANLNLPATLVGS
FT                   QLIDKLVLDANGNAAALPLAAFFDIMVDEVNKRTLKDLLLTDEPCLDGCFSDDHSLSAQ
FT                   YKIAFQMALKGNLNSPETHERNKQVLWVNSSSAIEDNHYTCLIPLYPSSFTHAIYNKLN
FT                   QARFSEENKQARENRYKNKAQNPYISIPHLAATKLGGTKPQNVSLLTSKQGGRNYLLPS
FT                   LPPIFTKGELRLTNAQDTIFNDRLAYVCRAGLYQLYQAVADSRKNYIVRVPRAEAVNLI
FT                   VQMVLQQAYKLQKRTAGWSRDYQLAWCEKYWLDPQRAKLNGEEQFHSALTQQDWISEVE
FT                   QRFAAWLNALLKKRFPKHPDDFTATEYNEWRKYFRKKLHRQLRCLYKEVL"
FT   gene            249277..251208
FT                   /gene="thrS"
FT                   /locus_tag="APP7_0221"
FT   CDS_pept        249277..251208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrS"
FT                   /locus_tag="APP7_0221"
FT                   /product="threonyl-tRNA synthetase ThrS"
FT                   /EC_number="6.1.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60873"
FT                   /db_xref="GOA:B3H061"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002320"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR033728"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3H061"
FT                   /protein_id="ACE60873.1"
FT                   /translation="MPIITLPDGSQRQFDNPVSVMEVAQSIGAGLAKATIAGRVNGERR
FT                   DACDIISEDSSLEIITAKDEDGLEIIRHSCAHLLGHAIKQLFPDVKMAIGPTIDNGFYY
FT                   DVDLDRSLTQEDLDAIEKRMLELAKTNYDVVKKRVSWQEARDTFEKRGEPYKMAILDEN
FT                   IERTATPALYHHEEYIDMCRGPHVPNMRFCHHFKLQKVAGAYWRGDSKNKMLQRIYGTA
FT                   WADKKQLAEYLTRLEEAAKRDHRRIGKALDLYHMQEEAPGLVFWHNDGWTIFRELETFV
FT                   RTKLKEYDYQEVKGPFMMDRVLWERTGHWQNYADLMFTTQSENREYAIKPMNCPGHVQI
FT                   FNQGLKSYRDLPIRMAEFGSCHRNEPSGSLHGLMRVRGFTQDDAHIFCTEDQIESEVTS
FT                   CIRMVYDIYSTFGFSNIQVKLSTRPENRIGDDAMWDRAEDGLAKALTANGLSYEIQEGE
FT                   GAFYGPKIEFALRDCLDREWQCGTIQLDFALPGRLDASYVAEDNGRRTPVMIHRAILGS
FT                   IERFIGIITEEYAGFFPTWLAPTQAVVMNITDSQADYVQKVTKALSDAGIRAKSDLRNE
FT                   KVGFKVREHTLRRVPYMLVCGDKEIEAGKVSVRTRKGADLGTFTIDEFVEILKNQVKAR
FT                   GLKLLGEE"
FT   gene            251350..252024
FT                   /locus_tag="APP7_0222"
FT   CDS_pept        251350..252024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0222"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60874"
FT                   /db_xref="GOA:B3H062"
FT                   /db_xref="InterPro:IPR005534"
FT                   /db_xref="UniProtKB/TrEMBL:B3H062"
FT                   /protein_id="ACE60874.1"
FT                   /translation="MKKLLMTTLCVTALGLAGCATEGSRAIAPTVTQAASTATNYHGVK
FT                   SAISVGKFDNKSSFQNGVFSDGQDQLGNQSKTILVSHLQQTGRFSVLDRTNMSEAAAEA
FT                   KIKGQKQNLKGATYVITGDVTEFGRKTVGDHQLFGILGRGKEQVAYAKVTLNVVNVNTS
FT                   EVVYSVQGAGEYNLSNREVLGFGGTAGYDSTLNGKVLDLAIREAVNNLVNGIEAGHWTP
FT                   AK"
FT   gene            252034..252381
FT                   /locus_tag="APP7_0223"
FT   CDS_pept        252034..252381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0223"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60875"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR012640"
FT                   /db_xref="InterPro:IPR014508"
FT                   /db_xref="UniProtKB/TrEMBL:B3H063"
FT                   /protein_id="ACE60875.1"
FT                   /translation="MKKINIIMFALITVVLSACSSRSVDTNTYYWGNYSDLIYSYYNEP
FT                   GDFTKQENGFNEIIKMAKDAQKPVAPGVYGHLGLVLLKQGKTAEAQNAFLQEQQLFPES
FT                   KTFMQYLQRKK"
FT   gene            252393..252947
FT                   /locus_tag="APP7_0224"
FT   CDS_pept        252393..252947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0224"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60876"
FT                   /db_xref="InterPro:IPR008517"
FT                   /db_xref="UniProtKB/TrEMBL:B3H064"
FT                   /protein_id="ACE60876.1"
FT                   /translation="MKKLLILLSGILFLSGCAQQQKPSYDYSALKESKPKSILVLLPVN
FT                   NSVDVKADTSVLARVTYPLAELGYYVYPVALVDEVFKQNGLTDGNAIRSVNIKKIYDIF
FT                   GADSILYLNVDKYGTSYKVFDSVTEVELEGKLIDLKTGKTLWDGTGRFAEGSTHSNDGA
FT                   LVALVKAAVSQVVDTTKDKRL"
FT   gene            253331..253810
FT                   /gene="infC"
FT                   /locus_tag="APP7_0225"
FT   CDS_pept        253331..253810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infC"
FT                   /locus_tag="APP7_0225"
FT                   /product="translation initiation factor IF-3"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60877"
FT                   /db_xref="GOA:B3H065"
FT                   /db_xref="InterPro:IPR001288"
FT                   /db_xref="InterPro:IPR019813"
FT                   /db_xref="InterPro:IPR019814"
FT                   /db_xref="InterPro:IPR019815"
FT                   /db_xref="InterPro:IPR036787"
FT                   /db_xref="InterPro:IPR036788"
FT                   /db_xref="UniProtKB/TrEMBL:B3H065"
FT                   /protein_id="ACE60877.1"
FT                   /translation="MKEVRLTDENGEQVGIVSIQDALARAEDAELDLVEISPNAEPPVC
FT                   RIMNYGKFIYEKEKAAKEQKKKQKVVQVKEIKFRPGTDEGDYQIKLRSILRFLEDGDKV
FT                   KITVRFRGREMAHQDIGLDVLDRVKTDTAEVAVVESAPGKLEGRQAVMVIAPKKK"
FT   gene            254059..254256
FT                   /gene="rpmI"
FT                   /locus_tag="APP7_0226"
FT   CDS_pept        254059..254256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmI"
FT                   /locus_tag="APP7_0226"
FT                   /product="50S ribosomal protein L35"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60878"
FT                   /db_xref="GOA:B3H066"
FT                   /db_xref="InterPro:IPR001706"
FT                   /db_xref="InterPro:IPR018265"
FT                   /db_xref="InterPro:IPR021137"
FT                   /db_xref="InterPro:IPR037229"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3H066"
FT                   /protein_id="ACE60878.1"
FT                   /translation="MPKIKTVRGAAKRFKKTASGGFKRKQSHLRHILTKKTTKRKRHLR
FT                   HKSMVAKADQVLVVACLPYA"
FT   gene            254324..254677
FT                   /gene="rplT"
FT                   /locus_tag="APP7_0227"
FT   CDS_pept        254324..254677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplT"
FT                   /locus_tag="APP7_0227"
FT                   /product="50S ribosomal protein L20"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60879"
FT                   /db_xref="GOA:B3H067"
FT                   /db_xref="InterPro:IPR005813"
FT                   /db_xref="InterPro:IPR035566"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3H067"
FT                   /protein_id="ACE60879.1"
FT                   /translation="MARVKRGVIARARHKKVLKAAKGYYGARSRVYRVAFQAVIKAGQY
FT                   AYRDRRQRKRQFRQLWIARINAAARQNGLSYSKFINGLKKVSVEIDRKILADIAVFDKV
FT                   AFAALVEKAKSAL"
FT   gene            254726..255262
FT                   /locus_tag="APP7_0228"
FT   CDS_pept        254726..255262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0228"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60880"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3H068"
FT                   /protein_id="ACE60880.1"
FT                   /translation="MRKLIVIRGHSGSGKSTFAKQKIAEFEQHFPSGKVFHIEHDQFLY
FT                   ENGEYIWTKERFQSAKILAKQKLASAWEFAKNHPQVPILIVISNVNIALQAVEKYQNIA
FT                   NSLRMKIEKYRLMNFFKNQHDVDVYTVLNMYLMLEQQPLADEIIIQPIKQMPYFMRIIL
FT                   EKMRKRRDKKDIQAV"
FT   gene            255295..255588
FT                   /locus_tag="APP7_0229"
FT   CDS_pept        255295..255588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0229"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60881"
FT                   /db_xref="UniProtKB/TrEMBL:B3H069"
FT                   /protein_id="ACE60881.1"
FT                   /translation="MKKLMLLALSLVTVACSAPEQQSTVPMDMQAVAEYQQRVTSGNTV
FT                   SEKQKQRVAQQIEPDEPLNQSDKRPKVVRQVVREPVIYPSIGVGYGYHRHHW"
FT   gene            complement(255645..256940)
FT                   /locus_tag="APP7_0230"
FT   CDS_pept        complement(255645..256940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60882"
FT                   /db_xref="GOA:B3H070"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:B3H070"
FT                   /protein_id="ACE60882.1"
FT                   /translation="MSLFEASLIILLLIVTSAVISSAEISLAGARKLKLQSMINEGDLR
FT                   AEKVLKLQEQPGRFITVVQIGLNMVAILGGVVGESAINPYFSELLSKYTQAEWVDSAAS
FT                   WIAFIIVTSAFVLFADLMPKRLAMTYPEKIAVRTIGVMMFCIALFKPLVLFFDWIANTL
FT                   FKFFHVSTVRQDNMTSEDIVAVVDAGAKAGILKAQEHYLIENVFEMQERRVTSTMTTRE
FT                   HIVFLNRTDNREKVLETLGEDPYSKVLICDDGLDKILGYIETHDLLTQYLKNDNVSLTD
FT                   AKLLKKSLFIPDTLSLYEVLELFKSAGEDFAVIVNEYALVVGILTLNDVMSIVMGELVS
FT                   TEEEQIVRRDEDSWLIDGATPLEDVMKALEIESFPNAENYETIGGFMMYMLRKIPKKTD
FT                   FVLYDQYKFEIIDTENFKIDQLMVSFRKDISN"
FT   gene            complement(256984..257634)
FT                   /gene="rluA"
FT                   /locus_tag="APP7_0231"
FT   CDS_pept        complement(256984..257634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rluA"
FT                   /locus_tag="APP7_0231"
FT                   /product="predicted RNA pseudouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60883"
FT                   /db_xref="GOA:B3H071"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006508"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:B3H071"
FT                   /protein_id="ACE60883.1"
FT                   /translation="MTEKLTICFQHHDFVVIDKPVGVSVHKDEEAIGLTENLAEQLQAE
FT                   QVWLVHRLDKVTSGLLIFALNKQAAVHFYHLFEQHKIEKTYWALSDQKPKKKQGKISGD
FT                   MQKSRNGAWKLFHSKQNPAVTQFVSHSLEPNLRHFILQPKTGKTHQLRVAMKSLGSPIL
FT                   GDQRYAGTAADRVYLHAYQLKFDYQGESFCIQSQPTSGRFWAKLGNAEHLKNI"
FT   gene            257684..258316
FT                   /gene="gpmB"
FT                   /locus_tag="APP7_0232"
FT   CDS_pept        257684..258316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpmB"
FT                   /locus_tag="APP7_0232"
FT                   /product="phosphoglycerate mutase/fructose-2,
FT                   6-bisphosphatase"
FT                   /EC_number="5.4.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60884"
FT                   /db_xref="GOA:B3H072"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:B3H072"
FT                   /protein_id="ACE60884.1"
FT                   /translation="MALNIYLVRHGKTVWNLEGRLQGSGDSPLVEEGIEGAKKVGRALK
FT                   AVKFAAAYSSMQKRAQDTANYILAENNDKNIPHFHHFGLNEFDFGLWEGTKSVDLYSND
FT                   EYWTMKKTPAEYRAETNGGETYEDLYSRVIKVFNQIAQLHQDNENILIVAHGMTLTVLT
FT                   AVLRGLHWSECRDETKHSFVINTAINRAVVEKGKAELVEFNRTEHLA"
FT   gene            complement(258384..258797)
FT                   /locus_tag="APP7_0233"
FT   CDS_pept        complement(258384..258797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0233"
FT                   /product="putative Holliday junction resolvase"
FT                   /EC_number="3.1.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60885"
FT                   /db_xref="GOA:B3H073"
FT                   /db_xref="InterPro:IPR005227"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3H073"
FT                   /protein_id="ACE60885.1"
FT                   /translation="MARTILAFDFGTYSIGCAVGQDITGTAQGLPSFKAQDGIPNWDQI
FT                   EKVIKEWQPERLVVGLPLNMDGTEQPLTQRAKKFANRLNGRFNLPVELQDERLTTVSAK
FT                   AEIFERGGYKALKKDKVDSISACLILESWFEAQ"
FT   gene            complement(258848..259408)
FT                   /locus_tag="APP7_0234"
FT   CDS_pept        complement(258848..259408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0234"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60886"
FT                   /db_xref="InterPro:IPR003774"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3H074"
FT                   /protein_id="ACE60886.1"
FT                   /translation="MLENLQGKFLIATPEIDDDYFDRTVIYICEHNSNGAMGLVINTPT
FT                   DLSVLELITRMDFQMANQRNYHKDQMVLSGGPVSQDRGFIIHTKTEQEFLHSYRVTDNI
FT                   LLTTSGDVLDSLGKPEAPEKFIVCLGCATWKPEQLEQEIARNYWLISEANDKTLFETGY
FT                   LERWVEANEMLGISGVLARAGRA"
FT   gene            complement(259408..260139)
FT                   /locus_tag="APP7_0235"
FT   CDS_pept        complement(259408..260139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0235"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60887"
FT                   /db_xref="GOA:B3H075"
FT                   /db_xref="InterPro:IPR006700"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:B3H075"
FT                   /protein_id="ACE60887.1"
FT                   /translation="MRIPRIYHPELLANRTDCILSEDATNHVGRVLRMTEGEQIILFDG
FT                   SNHIFHATLQAVGKKQIIAKIDGSELDNRESNLPIHLGQVISRGDRMEFTIQKSVELGV
FT                   KTITPLWSERCGVKLNDERQDKKLQQWQKIAIAACEQCGRNEIPEIRPIMKLTDWCKEQ
FT                   DDMLKLNLHPRAKYTIRQLPNVPEAGVRLLIGSEGGLSAEEIAMTETQGFTEVLLGKRV
FT                   LRTETASLAAITALQVCFGDI"
FT   gene            complement(260314..260904)
FT                   /locus_tag="APP7_0236"
FT   CDS_pept        complement(260314..260904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0236"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60888"
FT                   /db_xref="InterPro:IPR005619"
FT                   /db_xref="UniProtKB/TrEMBL:B3H076"
FT                   /protein_id="ACE60888.1"
FT                   /translation="MKLSKKVLLIATTLATAVLTGCQSQSNVLNFTTPSPTATFNTNNQ
FT                   TAAVSVLTQDLRTSREVASYTKNGQITYLTSSPEVGLMFQQAVQQDLNAKGFQLVQGAA
FT                   NANVIVSVRKFFATVEQGNLLYKVNAAVGVEVAVKGSKGNFSKNFNATRGYEGAAVTTD
FT                   NDDIKKVLGQAYDDVVKAIYNDNEISNAIHQFK"
FT   gene            261033..261344
FT                   /gene="bolA"
FT                   /locus_tag="APP7_0237"
FT   CDS_pept        261033..261344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bolA"
FT                   /locus_tag="APP7_0237"
FT                   /product="stress-induced morphogen (activity unknown)"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60889"
FT                   /db_xref="InterPro:IPR002634"
FT                   /db_xref="InterPro:IPR036065"
FT                   /db_xref="UniProtKB/TrEMBL:B3H077"
FT                   /protein_id="ACE60889.1"
FT                   /translation="MLIEQAIRDKLTAQFSPVFLNIENESYMHSSGRGAESHFKVTLVS
FT                   ETFEGIRTVACHRAIYTCLADELENGVHALALHTYTPTEWAENNGMVPKSPNCAGVGL"
FT   gene            261456..261542
FT                   /locus_tag="APP7_tRNA03"
FT   tRNA            261456..261542
FT                   /locus_tag="APP7_tRNA03"
FT                   /product="tRNA-Ser"
FT   gene            complement(261737..262111)
FT                   /locus_tag="APP7_0238"
FT   CDS_pept        complement(261737..262111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0238"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60890"
FT                   /db_xref="InterPro:IPR007298"
FT                   /db_xref="UniProtKB/TrEMBL:B3H078"
FT                   /protein_id="ACE60890.1"
FT                   /translation="MKKIAFIALSMTLGACSLLPQKSVVGTFQGNLPCADCERIKAELI
FT                   LGNNNSYQYNTVYVKNGKEYPFTDKGTYTWEQNKRGVIRLERDSGSLAFKVNDMQAEIC
FT                   DANGNPAKIANSPYVLHKVK"
FT   gene            262542..262868
FT                   /locus_tag="APP7_0239"
FT   CDS_pept        262542..262868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0239"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60891"
FT                   /db_xref="InterPro:IPR020508"
FT                   /db_xref="UniProtKB/TrEMBL:B3H079"
FT                   /protein_id="ACE60891.1"
FT                   /translation="MFLMTLFRHFHKTPFWSQLVFGLVAIFALPEIQATLNRENEQNTV
FT                   INQLVTQYTQVTEDGEQQTLFIAERHLAQMNTTSQAVVFCKILTKSYRFDGDDNHPIRA
FT                   GPIA"
FT   gene            262977..265694
FT                   /gene="secA"
FT                   /locus_tag="APP7_0240"
FT   CDS_pept        262977..265694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secA"
FT                   /locus_tag="APP7_0240"
FT                   /product="preprotein translocase secA subunit"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60892"
FT                   /db_xref="GOA:B3H080"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3H080"
FT                   /protein_id="ACE60892.1"
FT                   /translation="MISKIITSIFGSSNDRTLKRLRKRVAQINKLEPAFEKLTDEELQA
FT                   KTAEFKQRLADGASLDSLLHEAFATVREASRRVMGMRHFDVQLIGGMVLTNRNIAEMRT
FT                   GEGKTLTATLPCYLNALTGKGVHVVTVNDYLARRDAETNRPLFEFLGLSVAVNVPGLPN
FT                   EVKREAYKADITYSTNSELGFDYLRDNLAHAKEDRFQRELHYALVDEVDSILIDEARTP
FT                   LIISGPAEDATQIYQAIDTIIPHLVQQDKEDTEEYTGEGDFTLDLKNKQAHLTERGMVK
FT                   VEGILTEMGLMQEGETLYHPVRIALLHHVYAALRAHKLFELNVDYIVKDGEVVIIDEHT
FT                   GRTMAGRRWSDGLHQAIEAKEKVNIQGENQTVASITYQNYFRLYEKLAGMTGTADTEAF
FT                   EFQQIYGLDTIVIPTNKPVIRDDRTDLMFKSEPEKFAAIIKDIQECMARQQPVLVGTAS
FT                   VEKSELLSAELTKAGIAHNVLNAKFHAQEAEIVAEAGAPGAVTIATNMAGRGTDIVLGG
FT                   NWKAEIAKLENPTEEQIEAIKAAWKERYDIVMKAGGLHIIGTERHESRRIDNQLRGRSG
FT                   RQGDPGSSRFYLSLDDALMRIYLNEGKLNMMRKAFSEEGEAMESKLLTKVIASAQAKVE
FT                   AHNFDGRKNLLQYDDVANEQRKAIYEQRNYLLETEDISAMIETIRGDVFNRVIDQFIPP
FT                   QSIEEMWDVAGLEEALKRQFGMELPIQHWLEQENDLHEETLRERIIDIATQEYHAKEEK
FT                   VGSEVMRNFEKGVMLQNLDELWKEHLSAMDYLRKGIHLRGYAQKDPKQEYKKESFEMFT
FT                   NMLDLLKSNVISVLSRIQVRSQEEIEEAQRQQETMAQAESENYRTADHQAEAQQSESLT
FT                   EEQLANLDIGRNDPCPCGSGKKYKHCHGSKARYA"
FT   gene            265824..267011
FT                   /locus_tag="APP7_0241"
FT   CDS_pept        265824..267011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0241"
FT                   /product="tetratricopeptide repeat (TPR) family protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60893"
FT                   /db_xref="GOA:B3H081"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniProtKB/TrEMBL:B3H081"
FT                   /protein_id="ACE60893.1"
FT                   /translation="MSEITFEQYLALLVEEQDSAATPFEWLTILRKYDEIIRLLPDKAV
FT                   LYHNRCTVLQNLGLYQLALKDINKAVELAPNYAIAWCNKAMLHNLLGDYSQGWQAYEWR
FT                   WQTGLPAFEPLEINIPQWQGENIGNAKILFHVEQGFGDNIQFVRYALEMKRQGLNVVVL
FT                   NHSGIENLLNDNLAQHGIETMRNGGRVSGLAYHLPMLSAPLVFGCTLENIPYSNGYLQA
FT                   QPEFLAKWQEKITACSKRQRLKIGVVWAGSAKHNRNASRSLPFELFSQLFALDADFHCL
FT                   QKELNETDYKRSDLFENLHIWQQDIGDFSDTAALIAQMDLVISVDTSVAHLAAAMSKPT
FT                   WVMLSYHPDFRWLLTRQDSPWYDSVKLFRQDASLNWQSVIKNIQQQLQHILKENT"
FT   gene            267008..267406
FT                   /gene="mutT"
FT                   /locus_tag="APP7_0242"
FT   CDS_pept        267008..267406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutT"
FT                   /locus_tag="APP7_0242"
FT                   /product="mutator mutT protein"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60894"
FT                   /db_xref="GOA:B3H082"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR003561"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:B3H082"
FT                   /protein_id="ACE60894.1"
FT                   /translation="MNKAVIQVAAGIIRNEFGQIYLTQRLEGQDFAQALEFPGGKVDAG
FT                   ETPEEALKRELEEEIGIHILSAFPYESFRFDYPTKVIEFFFYLVEEWVGEPFGREGQEG
FT                   FWVAQADLDESEFPPANSRLIQRLKSEV"
FT   gene            267641..268585
FT                   /gene="argC"
FT                   /locus_tag="APP7_0243"
FT   CDS_pept        267641..268585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argC"
FT                   /locus_tag="APP7_0243"
FT                   /product="N-acetyl-gamma-glutamyl-phosphate reductase
FT                   (AGPR)"
FT                   /EC_number="1.2.1.38"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60895"
FT                   /db_xref="GOA:B3H083"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR010136"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B3H083"
FT                   /protein_id="ACE60895.1"
FT                   /translation="MSKYKIFVDGAVGTTGLRIFDRLASAEDIELLSLPEELRKDLNAR
FT                   VAKVAEADLTFLCLPDEASKELVAHAPADARICDTSTAHRVNPNWTYGFAEFSGQFEKI
FT                   QNANRVAVPGCHATGYIALVRPLIEKGALSADYPLSCHSLTGYSGGGKAMIAEYQNPDR
FT                   EQKFSAPRVYGLALKHKHLPEMQALTGSNHPPIFTPVVADYYSGMLVTVPLPVSALSQA
FT                   VNSAEKIANLFSEYYQNSKLITVHPACSLPEDGMLAANTFSGKDSLEIFVYGNETQLLL
FT                   CARFDNLGKGASGAAVQCMNIMLGREETAGLDV"
FT   gene            268615..269469
FT                   /gene="argB"
FT                   /locus_tag="APP7_0244"
FT   CDS_pept        268615..269469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argB"
FT                   /locus_tag="APP7_0244"
FT                   /product="acetylglutamate kinase (AGK)"
FT                   /EC_number="2.7.2.8"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60896"
FT                   /db_xref="GOA:B3H084"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037528"
FT                   /db_xref="InterPro:IPR041727"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3H084"
FT                   /protein_id="ACE60896.1"
FT                   /translation="MLQNEVENFANLLEQATVYLAPYQEKIIVVKYGGNAMINEDLKKL
FT                   VMQDILLLNQLGVKVVLVHGGGPEISQGVKLLGKEPQFINGLRVTDQDTINVVLQMLAG
FT                   KVNKSLVALLKGKGVGLCGIDANMLQCEKLQAEVDYGFVGEIVKVNTQLLELALSANLI
FT                   PVISTVGVDDQGVAYNINADTVASEIAMALGAAKLVSMTDIAGLLRDRFDESTLIPEVE
FT                   VSEVQGLIDQGIIAGGMIPKIACCTDFINAGGIEANIIDGRVPHAILVSLFGGKNGTLF
FT                   YKK"
FT   gene            269483..270664
FT                   /gene="argD"
FT                   /locus_tag="APP7_0245"
FT   CDS_pept        269483..270664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argD"
FT                   /locus_tag="APP7_0245"
FT                   /product="acetylornithine aminotransferase (ACOAT)"
FT                   /EC_number="2.6.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60897"
FT                   /db_xref="GOA:B3H085"
FT                   /db_xref="InterPro:IPR004636"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B3H085"
FT                   /protein_id="ACE60897.1"
FT                   /translation="MNSNDIKQLDADYIAQTYGRFNLALSHGKGCDVWDFEGNQYLDFT
FT                   SGIGTNSLGWADDGWLAAVTTQAGKLQHTSNIFFTEPSAVLAKSLVEASGLKRVFFCNS
FT                   GAEANEGAIKTARKYSHDKYGKGRATVLSLVNSFHGRTISTLAATGQDVFHQHFFPFTQ
FT                   GFEHTPANDLDALHARIEQDDVCAIILEIVQGEGGVCALDTEYLQGVQAICQAKDIILI
FT                   IDEVQTGIGRTGKLFAYQHFGLQPDIITLAKGLGGGLPIGAFVLGDKCQNTLGKSDHGS
FT                   TFGANPVCCAAANAVLAKIDEKFLADVAAKGEKLRAALLTLPKVKSVSGLGLMLGIEFE
FT                   DGVKAADVVAKAIEKGVLTLTAKTKLRLLPPLVISERQIDHGVAVLREVLESL"
FT   gene            270878..271432
FT                   /locus_tag="APP7_0246"
FT   CDS_pept        270878..271432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0246"
FT                   /product="Transferrin-binding protein 2 precursor (TBP-2)"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60898"
FT                   /db_xref="InterPro:IPR035313"
FT                   /db_xref="InterPro:IPR038669"
FT                   /db_xref="UniProtKB/TrEMBL:B3H086"
FT                   /protein_id="ACE60898.1"
FT                   /translation="MNVKKSQIAIVIAATLLTACSGGKGGFGLDSTQEQIPRYDPKKTK
FT                   PIEFGDDVTEAKPYEQLPEFLQPTLDSEIAIPRRIIGPKAEERVELSPDNIKRLGGSLD
FT                   EIPHAKEIEDHSAVKKSGEKFSLVYSHDNKSPQRTRNMDYVRSGFVFALGGFSTEKNEK
FT                   QENVYRSGKIGYVFYERNKSV"
FT   gene            271359..272588
FT                   /locus_tag="APP7_0247"
FT   CDS_pept        271359..272588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0247"
FT                   /product="transferrin binding protein-like solute binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60899"
FT                   /db_xref="InterPro:IPR001677"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR035316"
FT                   /db_xref="InterPro:IPR038197"
FT                   /db_xref="UniProtKB/TrEMBL:B3H087"
FT                   /protein_id="ACE60899.1"
FT                   /translation="MRNKRMYIGQVKSDMCFMKGINPSKALPVDKIVKYEGTWDFTTDA
FT                   VNKRRAQGFEESYIGDRYGAISYDEPINNDKYGAVGHSSEFVVNFGKKELTGQIYRNHP
FT                   IRKENTQEKTKRYDINAKLFGNRFRGSAKATDPKDRYFGKDANNSLEGGFYGPNAEELA
FT                   GKFLSNDKSLFGVFAAKQKGQKAETETKFDARQIDLKDFKQSEMDSFGQANLLVIDGHI
FT                   IPLLKQNFDHQLANKSVKVTACCENLADVKFGTFDVAGEGPKLYLTGERTAVDAIPKSG
FT                   VFAYKGSWQGQISSQDGTKWQTPENSAAYLQVDFDNKRVNGGFGSGPTSGTVLSLQEGV
FT                   IDKNGFSGVVKTLKDGFSANGKTFHVDGKVSGGFYGKTASEIGGSLLSTEQSQDKAAGV
FT                   FGAKRQVEKK"
FT   gene            272603..275392
FT                   /locus_tag="APP7_0248"
FT   CDS_pept        272603..275392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0248"
FT                   /product="truncated transferrin-binding protein 1
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60900"
FT                   /db_xref="GOA:B3H088"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010916"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR010948"
FT                   /db_xref="InterPro:IPR010949"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:B3H088"
FT                   /protein_id="ACE60900.1"
FT                   /translation="MKQCKLSLSYIAIQSAFLILSAQTYAKQNETELDTVTVKAKTEIH
FT                   RRQNEVTGLGKVTKISKDLDKEQVQNIRDLTRYDPGISVVEQGRGASSGYSIRGVDRNR
FT                   VALLVDGLQQIQSYKSLSLFAQSGAINEIEYENIRSIEFSKGASSQEYGSGALGGAVGF
FT                   RTKNPDDVIKEGQNWGLDSKTAYSSKNKQFSESLSFAGRSGGFEALVQYTYRKGKETEI
FT                   HKDATKVRQSFYRVVPRELNWDKNQRDNWFVFEDECPTGQGSNPGCVPRPIVRGAKVIK
FT                   DSTNAKDYTGDGRIAPNPMKYQSGSWLFKLAYHFSPQHSVNAVFEQTKQRYDIQDMAQA
FT                   KYSNLLPNNKGEPDRKKTEVEYSLFGRNFYPDDPSQAIGYGNTLNPSLVRSAYWSRARF
FT                   FDERHTKRRLGFGYQYKSENDKGIFDRLNLNLDQQDIRLLTKLHSLSCSRYPYFDKNCK
FT                   ITPDKRDANATYERNIYKERHKQVQLSFEKDLAIGKTQHLFNLSMSYDRMRSNHKRDQF
FT                   ERVYLVYSKEDESEHPYYDVGNRDKDVGYYNSGTYKYPRIIGKRQAIVAHNNYCKFDMH
FT                   YGKRKDFSDCSAHITKGQHYAIGLSDRIFFGDKLDLGLGVRYDYYRFKSDDDWVNTGTH
FT                   KNFSWNTGLTIRPREYIALSYRASSGFRVPSFVEMFGRRVPGAADNKYWRRDLLKKKLT
FT                   SEKALNQEVGVAFNGNLGVLEVSYFDNRYRDLIVSAKEKGIDGIAGFYNLQSINLNGVN
FT                   LLGKLNWHGIWSALPDGLYSNLAYNRIKVKNVDTKPNYVFVRSPVLDAIQPERYVASLG
FT                   YDEPNGKWGVNYILTYSKAKKASELIGTTTYYTGDVVKGVTNQRTRPWYIYDVIGYYTF
FT                   AKHFTVRGGIYNLTNRKYSTWEAVRQTAETNVIPIYNRGHASYAAPGRNYVLSVEAKF"
FT   gene            complement(275440..276702)
FT                   /gene="rho"
FT                   /locus_tag="APP7_0249"
FT   CDS_pept        complement(275440..276702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rho"
FT                   /locus_tag="APP7_0249"
FT                   /product="transcription termination factor Rho"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60901"
FT                   /db_xref="GOA:B3H089"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004665"
FT                   /db_xref="InterPro:IPR011112"
FT                   /db_xref="InterPro:IPR011113"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036269"
FT                   /db_xref="InterPro:IPR041703"
FT                   /db_xref="UniProtKB/TrEMBL:B3H089"
FT                   /protein_id="ACE60901.1"
FT                   /translation="MHLTQLKNTPVSDLVALGEGQMGLENLARLRKQDIIFAILKQHAK
FT                   SGEDIFGQGILEILPDGFGFLRSADSSYLAGPDDIYVSPSQIRRFNLQTGDKIEGKIRP
FT                   PKEGERYFALLKVDLVNDDKPEVSRSKILFENLTPLHANSRLRMERGNGSTEDLTARIL
FT                   DLAAPIGKGQRGLIVAPPKAGKTVLLQNIAQSITHNHPECELIVLLIDERPEEVTEMQR
FT                   TVRGEVIASTFDEPATRHVQVAEMVIEKAKRSVEHKKDVVILLDSITRLARAYNTVTPV
FT                   SGKILSGGVDANALHRPKRFFGAARNVEEGGSLTIIATALVDTGSKMDEVIFEEFKGTG
FT                   NMELHLSRKIAERRVFPAIEFNRSGTRKDDLLMSPEEHRNAWMLRKVLNPMDEVAAMEW
FT                   LIDKLGVAKTNEEFFELMKRS"
FT   gene            complement(276900..277850)
FT                   /gene="cysK"
FT                   /locus_tag="APP7_0250"
FT   CDS_pept        complement(276900..277850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysK"
FT                   /locus_tag="APP7_0250"
FT                   /product="cysteine synthase"
FT                   /EC_number="2.5.1.47"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60902"
FT                   /db_xref="GOA:B3H090"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005856"
FT                   /db_xref="InterPro:IPR005859"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:B3H090"
FT                   /protein_id="ACE60902.1"
FT                   /translation="MTIYADNSYTIGNTPIVRLKNFGQNGNLLVKIESRNPSFSVKCRI
FT                   GANMVWQAEKDGILTKGKEIVDATSGNTGIALAYVAAARGYKITLTMPETMSTERKRLL
FT                   RGLGVNLVLTEGSKGMKGAISKAEEIVASDPNRYVILKQFENPANPAIHQQTTGPEIWN
FT                   ATEGKVDVIVAGVGTGGTITGISRYIKQDQGKQIISVAVEPKESPVITQTLNGEEVKPG
FT                   PHKIQGIGAGFIPKNLDLSLIDRVEQVSSEEAIATARRIMAEEGILVGISSGAAVAAAD
FT                   RLAKLPEFADKQIVAILPSASERYLSTLLFEGVEV"
FT   gene            complement(278062..279012)
FT                   /gene="thrB"
FT                   /locus_tag="APP7_0251"
FT   CDS_pept        complement(278062..279012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrB"
FT                   /locus_tag="APP7_0251"
FT                   /product="homoserine kinase"
FT                   /EC_number="2.7.1.39"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60903"
FT                   /db_xref="GOA:B3H091"
FT                   /db_xref="InterPro:IPR000870"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:B3H091"
FT                   /protein_id="ACE60903.1"
FT                   /translation="MTTLRIYAPASSANLSVGFDSLGAAISPIDGSLLGDVVQIEDCET
FT                   AFELESAGYFVRKLPKEPQKNIVYQAYVLFSERLKLRGGSVKNLRLTLEKNMPIGSGLG
FT                   SSACSIVAALVALNKFHDEPFSKMELLEMMGELEGRISGSIHYDNVAPCYLGGLQLMTQ
FT                   SLGNICQTIPFFDEWYWVLAYPGVEVSTAEARAILPKNYTRQDMIQQARYLGSFVHACH
FT                   THQDILAATMMKDLIAEPYRENLLPNFAEVRQGCKDLGALSVGISGSGPTMFAIAPDLE
FT                   HAQKLAAYLEKEYLQNNEGFIHICKVDNQGARELK"
FT   gene            complement(279012..281468)
FT                   /gene="thrA"
FT                   /locus_tag="APP7_0252"
FT   CDS_pept        complement(279012..281468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrA"
FT                   /locus_tag="APP7_0252"
FT                   /product="bifunctional aspartokinase/homoserine
FT                   dehydrogenase"
FT                   /EC_number="1.1.1.32"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60904"
FT                   /db_xref="GOA:B3H092"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR001342"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005106"
FT                   /db_xref="InterPro:IPR011147"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR019811"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:B3H092"
FT                   /protein_id="ACE60904.1"
FT                   /translation="MRVLKFGGTSLANPERFIQAADIIEKAHLKDQAAGVLSAPAKITN
FT                   HLVAIVDKAIAGESFESNLKEATEIFHNIINGLYAINNKVDREGLLALVEAELAQIQSV
FT                   ASEAAKSKSLPDSVAATIHCRGEKLSIAMMQAWFEAKGYEVTRIDPVEKLLAHGSYLES
FT                   SVDIAESTKRVDANSIPKKNVVLMAGFTAGNENGELVLLGRNGSDYSAACLAACLKADC
FT                   CEIWTDVDGVYTCDPRLVPEAICLESMSYQEAMELSYFGAKVIHPRTIGPLVPLNIPCL
FT                   IKNTANPDAKGTLIDGNVATDGLKVKGITNLDNVAMFNVSGAGMQGMVGMAARVFSTMS
FT                   KAGISVILITQSSSEYSISFCVPAKFEEKATACLNAEFAQELSKGDLDPIDMIRELSII
FT                   SVVGDGMRTAKGIAARFFSSLAQANISIVAIAQGSSERSISAVVPMNKAIEAVKATHQG
FT                   LFSNKKSIEVFLVGVGGVGSELIDQIKQQKEFLAKKDIEIRVCALANADKMLLNENGLN
FT                   LDNWKSDLETATQPSDFDVLLSFIKLHHVVNPVFVDCTAAQSVANLYTRALKEGFHVVT
FT                   PNKKANTGSYRYYQELREAARQGQHKFLYETNVGAGLPVIENLQNLLAAGDEVEKFEGI
FT                   LSGSLSFIFGKLDEGLSLSEATLIAKEKGFTEPDPRDDLSGADVARKLLILARETGLAL
FT                   EFDDIEVEGVLPKGFSDGMSKEEFLKVLPEIDVQFNERVQTAKAEGKVLRYVGSITGDK
FT                   CRVAIEAVDENHPLYKVKDGENALAFLTRYYSPIPLLLRGYGAGTDVTAAGIFADILRT
FT                   LHGGSN"
FT   gene            281878..282519
FT                   /gene="sodA"
FT                   /locus_tag="APP7_0253"
FT   CDS_pept        281878..282519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sodA"
FT                   /locus_tag="APP7_0253"
FT                   /product="manganese superoxide dismutase"
FT                   /EC_number="1.15.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60905"
FT                   /db_xref="GOA:B3H093"
FT                   /db_xref="InterPro:IPR001189"
FT                   /db_xref="InterPro:IPR019831"
FT                   /db_xref="InterPro:IPR019832"
FT                   /db_xref="InterPro:IPR019833"
FT                   /db_xref="InterPro:IPR036314"
FT                   /db_xref="InterPro:IPR036324"
FT                   /db_xref="UniProtKB/TrEMBL:B3H093"
FT                   /protein_id="ACE60905.1"
FT                   /translation="MAYQLPELGYAYNALEPHFDKATMEIHHTKHHQTYVNNANAALEA
FT                   HPELLEKCPGALIKDLSQVPAEKRTAVRNNVGGHVNHTLFWKGLKTGTTLQGALKDAIV
FT                   RDFGSVEAFQAEFEKAAATRFGSGWAWLVVEDGKLAVVSTANQDNPIMGKEVAGVSGFP
FT                   ILALDVWEHAYYLHYQNRRPDYIKAFWNVVNWDEAARRFEEHASHCGCAK"
FT   gene            complement(282608..283732)
FT                   /gene="alr"
FT                   /locus_tag="APP7_0254"
FT   CDS_pept        complement(282608..283732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="alr"
FT                   /locus_tag="APP7_0254"
FT                   /product="alanine racemase"
FT                   /EC_number="5.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60906"
FT                   /db_xref="GOA:B3H094"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR011079"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:B3H094"
FT                   /protein_id="ACE60906.1"
FT                   /translation="MKPATATISREALRHNIELIKTFTPQQKLLAMIKANAYGQGLLPA
FT                   ADTLADLVEGFGVARLREALEIQETGYTGKILLIEGFFDREELLKTLSRRFDTVIHCQE
FT                   QLELLEQVAKEWQQEQQKGFWKRKAKIYFPINVWLKIDTGMHRLGVHPEKVDMFYQRLK
FT                   ACPLVESISFVSHFSRADEPDCGYTEKQIAVFEAATSPYPTHERSISASSGILYWKQAH
FT                   YDWVRPGIIMHGISPHYTPITDLGFKPVMTLASSLIAVRTHKAGEPVGYGGAWVSDKDT
FT                   KLGVVAMGYGDGYPRNAPEGTPVLVNGRIVPIVGRVSMDMLTVDLGADSQDKVGDEVIF
FT                   WGKDLLIEEVAQHIGVISYELITKLTPRVIFEYE"
FT   gene            283853..285790
FT                   /gene="recD"
FT                   /locus_tag="APP7_0255"
FT   CDS_pept        283853..285790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recD"
FT                   /locus_tag="APP7_0255"
FT                   /product="exodeoxyribonuclease V alpha chain"
FT                   /EC_number="3.1.11.5"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60907"
FT                   /db_xref="GOA:B3H095"
FT                   /db_xref="InterPro:IPR006344"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027785"
FT                   /db_xref="InterPro:IPR041851"
FT                   /db_xref="UniProtKB/TrEMBL:B3H095"
FT                   /protein_id="ACE60907.1"
FT                   /translation="MLTLLYELKETNVISELDYQFAKMIDRKQQSYPYTEQQKNLAVLL
FT                   AALVSFHVMQGHAAIRLDSQASRFFFGLSNRNEEKALNDEILQKIGGITPLEWQGVLQN
FT                   HIAFSSDPIQVAPMLFQHGLLYFYRYWQAENNIANYLVKAVEFPEQIANTALNKQILEK
FT                   LFEKSDEINWQKIAVATAIKQKFSIISGGPGTGKTTTVAKLLAALQEKQLRSGKAMLNV
FT                   ALVAPTGKAAARLKESITLSLSVLNLNFEIPTTASTIHRLLGIRPQSDEPRYHSKNPLH
FT                   IDLLVVDEASMIDLFLMEKLMAALKPNTRLIILGDKDQLASVEAGAIMGELGAFLQQGY
FT                   SRKHCDYLNQVTEYQLVPKGKSLPICDSLCHLKKSYRFDANSGIGQLAKLVNEKQAVES
FT                   WQLFAKGSADLSLIEYAHTSDFPEKQQWIQNCVKQITDKAVELYKEYLTLVKQRYNNPT
FT                   KVSVNEIFEVFQKVRFLSALRISELGVEQLNKRIETALATAKLISLEQSKNYYIGKPLL
FT                   ITQNSPQNHIYSGDIGIILPDENGISRVYFDTKIDDGYLSLSLNRLPEFEPAYVMTVHK
FT                   SQGSEFEHTLLITPLHFAPVMSKELIYTAITRAKKHFTLFGEKQVWLQAVNNNLQRQSG
FT                   LKAQLMHLFS"
FT   gene            286137..287678
FT                   /locus_tag="APP7_r0004"
FT   rRNA            286137..287678
FT                   /locus_tag="APP7_r0004"
FT                   /product="16S ribosomal RNA"
FT   gene            287836..287908
FT                   /locus_tag="APP7_tRNA04"
FT   tRNA            287836..287908
FT                   /locus_tag="APP7_tRNA04"
FT                   /product="tRNA-Glu"
FT   gene            288113..291034
FT                   /locus_tag="APP7_r0005"
FT   rRNA            288113..291034
FT                   /locus_tag="APP7_r0005"
FT                   /product="23S ribosomal RNA"
FT   gene            291124..291243
FT                   /locus_tag="APP7_r0006"
FT   rRNA            291124..291243
FT                   /locus_tag="APP7_r0006"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(291591..293045)
FT                   /gene="pepD"
FT                   /locus_tag="APP7_0256"
FT   CDS_pept        complement(291591..293045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepD"
FT                   /locus_tag="APP7_0256"
FT                   /product="aminoacyl-histidine dipeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60908"
FT                   /db_xref="GOA:B3H096"
FT                   /db_xref="InterPro:IPR001160"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:B3H096"
FT                   /protein_id="ACE60908.1"
FT                   /translation="MSEITKLSPTLLWQWFDKICAIPHPSYHENQLAEFIVDWAKSKNL
FT                   FAERDEAGNVLIRKPATQGMENRCTIALQAHLDMVPQANAAAQHDFLKDPIQPYIDGEW
FT                   VKAKGTTLGADNGIGLASCLAVLEADDIAHPALEILLTMSEEVGMEGVLGLRPNWLKSD
FT                   IMINTDTEENGEIYIGCAGGENINLSLPLQYETNAHDSALQITLKGLQGGHSGCDIHTT
FT                   RANAIKLMARILAEIQTHYPIQISALKGGSVRNAIPREAQVTLTVAANHQQNVIAYLTE
FT                   LAKKIQNELRLAEANLKLEIEPSQLPNQSLTIESTQKVIHLLNVLPNGIIRNSDVVKDV
FT                   VETSLSIGLVKIEEQQLTATILARSLIESGKEDVRGKINSLAALTGAKVAFSGNYPGWE
FT                   PDTQSRITPLTKAIYDEVLGYEAQVKVIHAGLECGLIKKVYPNMDLVSIGPTIQNAHSP
FT                   DEKVHIPAVEIYWKLLTKLLAQAPVK"
FT   gene            293218..293691
FT                   /gene="gpt"
FT                   /locus_tag="APP7_0257"
FT   CDS_pept        293218..293691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpt"
FT                   /locus_tag="APP7_0257"
FT                   /product="xanthine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.22"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60909"
FT                   /db_xref="GOA:B3H097"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR023747"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:B3H097"
FT                   /protein_id="ACE60909.1"
FT                   /translation="MSEKYTNEKYVVTWDMFHMHARKLAERLLPASQWKGIIAVSRGGL
FT                   FPAAVLARELSIRHVETVCISSYDHDEQGELKVLHAAQTDGEGFIVVDDLVDTGNTAKE
FT                   IRKMYPKAKFVTVFAKPAGTPLVDDYVIDIPQETWIEQPWDLGITFVPPLARK"
FT   gene            293775..294395
FT                   /gene="gmk"
FT                   /locus_tag="APP7_0258"
FT   CDS_pept        293775..294395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gmk"
FT                   /locus_tag="APP7_0258"
FT                   /product="guanylate kinase"
FT                   /EC_number="2.7.4.8"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60910"
FT                   /db_xref="GOA:B3H098"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR017665"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3H098"
FT                   /protein_id="ACE60910.1"
FT                   /translation="MLGNLYILSAPSGAGKSSLINALLADLPRSEVQLSVSHTTRNPRP
FT                   GEEHAVHYYFTHHAEFESLIEQGHFLEWAEVFGNYYGTSLPMIEKSLENGIDVFLDIDW
FT                   QGARQIRNKVPNVKTIFILPPSREELEKRLIGRGQDSAETIGKRMAEAVSEMSHYNEFD
FT                   YVIVNDDFQTALSELKSILTSERLKQASQAVRYEKLIRQLLSK"
FT   gene            294497..295891
FT                   /locus_tag="APP7_0259"
FT   CDS_pept        294497..295891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0259"
FT                   /product="probable outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60911"
FT                   /db_xref="GOA:B3H099"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:B3H099"
FT                   /protein_id="ACE60911.1"
FT                   /translation="MKLSKLALTLSVVLALSACSTTKLSADGSLEQAQATYQQYEEITK
FT                   QFQINEQWWQGYNDSQLNSLVEQAIANNLDLAKSAIAVNRALYNANLVGANLVPTFSGS
FT                   GSSSAAKGVGSTSNQISTGISTISHTASFKLSYTLDLWQRLADAASAAEWEHKATVEDL
FT                   KATRLSLLNSVVSTYYQIAYYKDAIAVIERTINNYQQISTILNNKYAAGAIDRLAVEQA
FT                   QQATLNARNSLISERTNLKTAEQTLRNLLNLKPNQALPTRYPSILGVKLQGIDLNVPVS
FT                   AIANRPDVVARLNRLQSAFKSLTATEKSWFPTVTLGGSISASASKVANISDNPVGNGVI
FT                   SFDLPFLDWNRVKNNVKISESDYMTAKLNYEQTVTSALNEIDQHYYAYQQSLSSYATLQ
FT                   QAYEHDKRISNYYKNRYEQGVSEFREWISALNTELNSQLSILNQKYMILSNENTVYQSM
FT                   AGKYRR"
FT   gene            complement(295939..296268)
FT                   /locus_tag="APP7_0260"
FT   CDS_pept        complement(295939..296268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60912"
FT                   /db_xref="InterPro:IPR005346"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="InterPro:IPR037021"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0A0"
FT                   /protein_id="ACE60912.1"
FT                   /translation="MLLNNAQKRCTVSDIEKIEVEVLFAYPNKHFLKKITLDAPTSVQN
FT                   VILQSGILEKYTEIDLRTNKVGIFSRPVKLTDMVENGDRIEIYRPLIADPKEIRRKRAA
FT                   EQNKK"
FT   gene            complement(296228..296662)
FT                   /locus_tag="APP7_0261"
FT   CDS_pept        complement(296228..296662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0261"
FT                   /product="predicted oligoketide cyclase/lipid transport
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60913"
FT                   /db_xref="InterPro:IPR005031"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0A1"
FT                   /protein_id="ACE60913.1"
FT                   /translation="MPIVNQSSLVPYSAEQMYQLVNDYEKYPQFLSGCIGAKTISRGNN
FT                   ELEAELQIQKLGISQSFSTHNKMLPNERIEMKLVNGPFRQLQGAWNFQPFDEQSCKISL
FT                   YLEFEFSNPVVGMVFGKIFNELTLKMVNAFKQRAKEVYGV"
FT   gene            complement(296710..297765)
FT                   /gene="modC"
FT                   /locus_tag="APP7_0262"
FT   CDS_pept        complement(296710..297765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="modC"
FT                   /locus_tag="APP7_0262"
FT                   /product="molybdenum import ATP-binding protein ModC"
FT                   /EC_number="3.6.3.29"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60914"
FT                   /db_xref="GOA:B3H0A2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005116"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR011868"
FT                   /db_xref="InterPro:IPR015852"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0A2"
FT                   /protein_id="ACE60914.1"
FT                   /translation="MLQLNLHQTLGQLKLAVKLDIPNKGVTAIFGRSGAGKSSLINLIA
FT                   GLSTPQKGYIRLNQQTLFDSEQRINLAPEKRKIGYVFQEHRLFPHYTVENNLKYGYKRS
FT                   DSAHFLQIVQLLGIEHLLTRFPASLSGGEKQRVAIGRALLSEPQLLLMDEPLSALDLPR
FT                   KQELMNYLSKLAAQIEIPILYVSHSLDEIIRLADNLILLEQGKVTLFDSVANVWHHPAF
FT                   TAWQPDSQKVSLLELPISSYQSTYKMLSLALGSQKIWINETLHYHIGDKLRLIIASKDV
FT                   SISLEEPNPSSIRNILTGKITEIIPHSDRMDIAVLVDSHIIWASISLWSFDELALKNGQ
FT                   NVYLQIKSVSL"
FT   gene            complement(297769..298458)
FT                   /gene="modB"
FT                   /locus_tag="APP7_0263"
FT   CDS_pept        complement(297769..298458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="modB"
FT                   /locus_tag="APP7_0263"
FT                   /product="molybdenum transport system permease protein
FT                   ModB"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60915"
FT                   /db_xref="GOA:B3H0A3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011867"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0A3"
FT                   /protein_id="ACE60915.1"
FT                   /translation="MFNFTPQELDAIFLSLKVALLAVALSLPLAIFTAWLLSRKQFWGK
FT                   NLLNGIVHLPLVLPPVVIGYLLLVSMAKKGVIGQYLWQWFEFSFSFSWKGAVLASMVMA
FT                   FPLMVRSIRLTLDAVDPKLEQAARTLGAPPLKVFFTLTLPLSYSGIIAGAVLGFARSLG
FT                   EFGATITFVSNIPNQTQTIPSALFTFIETPDGELAAARLCAVSIMISLIALFASEWFAE
FT                   KQKRLLN"
FT   gene            complement(298518..299276)
FT                   /gene="modA"
FT                   /locus_tag="APP7_0264"
FT   CDS_pept        complement(298518..299276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="modA"
FT                   /locus_tag="APP7_0264"
FT                   /product="molybdate-binding periplasmic protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60916"
FT                   /db_xref="GOA:B3H0A4"
FT                   /db_xref="InterPro:IPR005950"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0A4"
FT                   /protein_id="ACE60916.1"
FT                   /translation="MKRLSKTLLIGISALSSAFAFAQNITVFAASSMSNVLQEINQDFA
FT                   KQYPNDKVIFSFASSSVLAKQIEQDAPADVFISADLKWMEYLKEKQPAKTQNIRHLVKN
FT                   DLVLIAPKDSSLTTSDIQAVDFTKILANSYLSVGDPAHVPAGKYAKKALEHYGLWQQVE
FT                   PKLARAKNVRDALSFVERGESPLGIVYSTDAKISDKVKVIAIFPTESYGEIVYPAATLS
FT                   DKAQAKAFLDFLYSQEAKAKFKAAGFYPIN"
FT   gene            complement(299372..300133)
FT                   /locus_tag="APP7_0265"
FT   CDS_pept        complement(299372..300133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0265"
FT                   /product="putative ABC transport system permease"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60917"
FT                   /db_xref="GOA:B3H0A5"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0A5"
FT                   /protein_id="ACE60917.1"
FT                   /translation="MNLTGFFTLSAKESRRIIRIWRQTLVPPIITTTLYFLIFGKLIGG
FT                   RIGEMNGVSYMQFIAPGLVMMNAITASYVNTASSFFLSKFTRNFEELLVSPLSTHNIIW
FT                   GYVMGSIVRGGLAGILVMLVALCFVSFDIHSWTIILLTLLMTTVAFALGGLINAVYAKS
FT                   FDDVGLIPTFVLTPLTYLGGVFYSISLLPEFWQTVSKFNPIVYMINGFRYGFLGISDVS
FT                   VSYTFVVLISFITVLYYIAFSLIEKGVGLRS"
FT   gene            complement(300137..301045)
FT                   /locus_tag="APP7_0266"
FT   CDS_pept        complement(300137..301045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0266"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60918"
FT                   /db_xref="GOA:B3H0A6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0A6"
FT                   /protein_id="ACE60918.1"
FT                   /translation="MNALEITNLIKTYPTGVQAVKGIDLIVEQGDFYALLGHNGAGKST
FT                   TIGIISSLVNKTSGSVKVFGYDLDTQKIQLKQQIGLVPQEFNFNQFEKVIDVLTQQAGY
FT                   YGISQKEATVSAETWLKKLDLWEKRHHLTRELSGGMKRRVMIARALMHNPKLLILDEPT
FT                   AGVDIELRRSLWDFLRELNQQGTTIILTTHYLEEAENLCRHIGIIQNGLLVENTSMKAL
FT                   LSKLETETFVLDLQKKSENQPLEIKGYPTQWLDENTLEVEVKREQGLTNLFHQIAQQDV
FT                   EVLSMRNKSNRLEELFMKMAN"
FT   gene            complement(301045..303111)
FT                   /gene="dnaX"
FT                   /locus_tag="APP7_0267"
FT   CDS_pept        complement(301045..303111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaX"
FT                   /locus_tag="APP7_0267"
FT                   /product="DNA polymerase III subunit gamma/tau"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60919"
FT                   /db_xref="GOA:B3H0A7"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR021029"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038249"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0A7"
FT                   /protein_id="ACE60919.1"
FT                   /translation="MSYQVLARKWRPQRFSEVVGQQHVLSALENGLREGRLHHAYLFSG
FT                   TRGVGKTSIARLFAKGLNCETGITATPCGECANCKAIEEGRFIDLIEIDAASRTKVEDT
FT                   RELLDNVQYKPTVGRFKVYLIDEVHMLSRHSFNALLKTLEEPPEYVKFLLATTDPQKLP
FT                   ITILSRCMQFHLRALDQAQIANHLEFILQQENIPYESVAIEKLAKAAQGSIRDSLSLTD
FT                   QAIAVSNANISLPIVQQMLGLIDDHQPIELVTALAQADGEKAMAVIQSVAEKGIDWSQL
FT                   LSDIAQTLHQIAMLQLLKNNGQEQTQLHFLAKQIAPEDVQFFYQLMLNGKKELEFAPEQ
FT                   RAGVEMTILRALAFHPKRTEELNRHPVMEAAKATSAQPHTPQQNIEQLKARLNQNHTQQ
FT                   AVNSVQNVATQPVAKMPENPTAYQQPAVNTTESGSTPVSPALAAMQARKQLQQTQAQLA
FT                   QNEKKKPELVKPATLPASRANPQKTPSLQERFMNLATEQQAQSRPQPTQQAAKPLSDED
FT                   YRWTWLNPELETQNESTKPSDIKQAILQERTPELVAKTIALSCEQDEWCKIVNELKLGG
FT                   LSRQVALNSYLAEKQGERLKLILKPAMAHLDNAESRQSLATALQEKGFSYELSIGESAE
FT                   HKTPLEIRRAIFENLTLEAKKALTHDEKLMLLRQTFDAEIDESTIRAVAENKE"
FT   gene            complement(303160..303699)
FT                   /gene="apt"
FT                   /locus_tag="APP7_0268"
FT   CDS_pept        complement(303160..303699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="apt"
FT                   /locus_tag="APP7_0268"
FT                   /product="adenine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.7"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60920"
FT                   /db_xref="GOA:B3H0A8"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005764"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3H0A8"
FT                   /protein_id="ACE60920.1"
FT                   /translation="MNQLDLIKSSIKSIPDYPKAGIIFRDITSLLEVPEAFKATVDAIV
FT                   AEFKDKGITKVVGTESRGFIFGAPVALALGVPFVLVRKPKKLPRAVISQSYALEYGEDT
FT                   LEIHLDSVKENDNVLMVDDLLATGGTIDATAKLIRRLGGKVEHAAFVIWLPDLGGKERL
FT                   EKEGINSFTLVEFAGH"
FT   gene            303900..304532
FT                   /locus_tag="APP7_0269"
FT   CDS_pept        303900..304532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0269"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60921"
FT                   /db_xref="InterPro:IPR013559"
FT                   /db_xref="InterPro:IPR039445"
FT                   /db_xref="InterPro:IPR039446"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0A9"
FT                   /protein_id="ACE60921.1"
FT                   /translation="MNQILIPYVSMADMLVETFGKSCEVVLHDLNRPEHSVVYVAGDVT
FT                   HRKPGQNFDHLVKEVMLSDKLNNNYVANYYFEVKGKLIRSSTQLIFDQNQQLVGALCIN
FT                   IDTTPITEQIAYLNTLLPNLNQIKQTEKTLETEELPLSAMVENLMDKILNGQSVQTMSR
FT                   DEKIEKIRFMEQKGLFLMKGSIEKAAEKLGVNKVTIYSYLDEVRGKR"
FT   gene            304532..304894
FT                   /locus_tag="APP7_0270"
FT   CDS_pept        304532..304894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0270"
FT                   /product="putative translation initiation inhibitor"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60922"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0B0"
FT                   /protein_id="ACE60922.1"
FT                   /translation="MEIILPNQSKGHYSPAIKSNGMLYVSGQLPFNTEGKIVGDIAAQT
FT                   KQALANLAQVLAAAELSRNDVVQCRVYIPDVAYWDTVNQVYADFFGSHKPARTVVPCGN
FT                   LHYNALIEIDAVAEFA"
FT   gene            304905..305957
FT                   /gene="thrCA"
FT                   /locus_tag="APP7_0271"
FT   CDS_pept        304905..305957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrCA"
FT                   /locus_tag="APP7_0271"
FT                   /product="putative threonine synthase"
FT                   /EC_number="4.2.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60923"
FT                   /db_xref="GOA:B3H0B1"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0B1"
FT                   /protein_id="ACE60923.1"
FT                   /translation="MKFICNQCQQIAPVSTRQAKCQCGGLWTLDYQPPKFDLNEIDQHE
FT                   WNLFRYRKFIALQDESWRDISLGEGMKPIVRFDENVLLKMDYFMPMLSFKDRGAVVQDS
FT                   GGNAGNSVAAYCAKAGIQCEIFVPEGTSPKKINMIEAHGAKANVIKGSRDHCSDVCRAK
FT                   VENEGVYYANHVYNPFFYEGTKTYIYETFEQLGRIPKHIVVPVGNGTLFIGVIKGLEHL
FT                   LESGVIDEMPTIIALQSEYCDPLLQAVKKGQKFAEQVEIKPTIAEGIAIGQPMRASEIL
FT                   AYAEKYAIRFVHAPEDKILAARNALAKKGIYCEHTTAANYAAYLHYCELYGAVEDCLIT
FT                   ICGAGLKSDH"
FT   gene            305972..306463
FT                   /locus_tag="APP7_0272"
FT   CDS_pept        305972..306463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0272"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60924"
FT                   /db_xref="GOA:B3H0B2"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0B2"
FT                   /protein_id="ACE60924.1"
FT                   /translation="MSEKTFENLTALLDQYQARYRVVHHTSAGKSEEVAKIRGTEIGQG
FT                   AKALVCKIKGNGIKQAVLAILPADEQADLNQIAQYLGGTKASLASPKEVDELTDCVFGA
FT                   IPPFSFHPDLKLIADPSLLERYDEIAFNAGTLERSIILNTQDYARIVQPILVCFVKREI
FT                   "
FT   gene            complement(306574..307329)
FT                   /locus_tag="APP7_0273"
FT   CDS_pept        complement(306574..307329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0273"
FT                   /product="putative chelated iron transport system
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60925"
FT                   /db_xref="GOA:B3H0B3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0B3"
FT                   /protein_id="ACE60925.1"
FT                   /translation="MVSIPTSISVEKLSVRYNNGHLALYDVSFQLQNGTICALIGVNGG
FT                   GKSTLFKSLMGLVKPQTGTILLNRMPIQQALKQNLVSYVPQSEEVDWQFPVSVYDVVMM
FT                   GRYGYMGLLRRPSSLDKQKVMQAMERVDICHLQHRQIGELSGGQKKRVFLARALAQESQ
FT                   IILLDEPFTGVDVKTENAIVELLQQLRSEGHLILVSTHNLNSVPSFCDQVLMINRTLLA
FT                   AGKTETTFTTENLEKVFGGVLHYLAKDIG"
FT   gene            complement(307331..308227)
FT                   /gene="yfeA"
FT                   /locus_tag="APP7_0274"
FT   CDS_pept        complement(307331..308227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfeA"
FT                   /locus_tag="APP7_0274"
FT                   /product="iron (chelated) ABC transporter,
FT                   periplasmic-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60926"
FT                   /db_xref="GOA:B3H0B4"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR006128"
FT                   /db_xref="InterPro:IPR006129"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0B4"
FT                   /protein_id="ACE60926.1"
FT                   /translation="MKLSFLKQVFVVALGLSATLAMAAPFKVVTTFTVIQDIAQNVAGD
FT                   KAVVESITKPGAEIHDYQPTPKDIAKAQKADLILWNGMNLERWFERFFENVKGKPAVVV
FT                   TEGITPIAITEGEYKNLPNPHAWMSSANALQYIENIRAALVKYDPKNAESYNQNAKVYA
FT                   EKVKEIAEPLRQRLSVIPEAQRWLVTSEGAFSYLAQDYQLKELYLWAINAEEQGSPQQV
FT                   KKVIDGVKANNIPVVFSESTVSDKPAKQVAKETGALYGGVLYVDSLSTKDGAVPTYLDL
FT                   LKVTISTIVDGFEKSKK"
FT   gene            complement(308294..308629)
FT                   /locus_tag="APP7_0275"
FT   CDS_pept        complement(308294..308629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0275"
FT                   /product="putative dissimilatory sulfite reductase"
FT                   /EC_number="1.8.99.3"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60927"
FT                   /db_xref="GOA:B3H0B5"
FT                   /db_xref="InterPro:IPR007453"
FT                   /db_xref="InterPro:IPR025526"
FT                   /db_xref="InterPro:IPR042072"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0B5"
FT                   /protein_id="ACE60927.1"
FT                   /translation="MHYIELNEKKYPTDASGYLTHLEDWSEALAIEIAKKEQIELTDEH
FT                   WEIIFLVRDFYQEYKTSPAIRMLVKAMAQKFGEEKGNSRYLQRLFPDGPAKQATKIAGL
FT                   PKPIKCL"
FT   gene            complement(308681..309346)
FT                   /locus_tag="APP7_0276"
FT   CDS_pept        complement(308681..309346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0276"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60928"
FT                   /db_xref="GOA:B3H0B6"
FT                   /db_xref="InterPro:IPR006214"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0B6"
FT                   /protein_id="ACE60928.1"
FT                   /translation="MENRVISGAAGNESLLSTHKVLRNTYLLLSMTLAFSAVIAFAAMS
FT                   MNAPALPWWGLLIGFYGLLFLTNATANSGAGILSVFALTGFLGYTLGPILNRYIGAGLG
FT                   DVVALALGSTALVFFACSAYVLTTKKDMSFLSGMMMALFVVLLVGIIANIFLAIPALSL
FT                   AMSALFVVFSSGAILLGTSNIIHGGETNYIRATVDLYVSIYNLFLSLLQIFGVLSSDD"
FT   gene            309528..310079
FT                   /gene="pgsA"
FT                   /locus_tag="APP7_0277"
FT   CDS_pept        309528..310079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgsA"
FT                   /locus_tag="APP7_0277"
FT                   /product="phosphatidylglycerophosphate synthase"
FT                   /EC_number="2.7.8.5"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60929"
FT                   /db_xref="GOA:B3H0B7"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR004570"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0B7"
FT                   /protein_id="ACE60929.1"
FT                   /translation="MKLNFPTYLTLFRVVLIPLFVIAFYLPAGWYAAEISTLIFFIASI
FT                   TDAFDGYLARKWNQTTQLGAFLDPVADKVLVAVALVCVVEYYHTWWITIPAAIMIAREI
FT                   IISALREWMAELGERASVAVSMWGKFKTTAQMLALGGMLWRFNFAMEVLAWILLYIAAG
FT                   LTLWSMMQYLNAAKGSLLKS"
FT   gene            310199..312169
FT                   /gene="frpB"
FT                   /locus_tag="APP7_0278"
FT   CDS_pept        310199..312169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frpB"
FT                   /locus_tag="APP7_0278"
FT                   /product="iron-regulated outer membrane protein B"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60930"
FT                   /db_xref="GOA:B3H0B8"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0B8"
FT                   /protein_id="ACE60930.1"
FT                   /translation="MHKKTIFKLSLISLAVAGYAEANQATLDTVKVQAQPTVNHTRNIS
FT                   NLRELLANRTDINVGGGSVSAQYISIRGSGQDRIGMIVDNTSTNTQQWYHQGRFQLDPS
FT                   MVKSIKIDKGAGSASAGIGITDGVIRAETVSAKDLLKDGRSFGARIGSEYNSNRGINDS
FT                   LSLYGQANNLDVLLLGSWGDDKNYKAGKGYSDAVNKNSRVVNNTARRQGNYLAKFGYDI
FT                   TDKQRIGLSFRQESFYGAGQDRFEMIFNSRPVNANTTKRTYNLEYDAKDIGFARDVKAN
FT                   VFHILGTDKREDYQQNKLTGYQRSSKTKTTGANLGFTSEFGGEHLFKYGVNLRKEQTGS
FT                   QNSFGNIKGEQKFEYGLYAEGIWSLGKVLTLTTGLRYDYYDLDTAGKVDKNGKPLAGNK
FT                   SVSDKRLNPSFGLIWDITPNFALNAKLNYASRSPILASANTITDNRGSLDKARGLRFID
FT                   PKLKTEDVRLAEVGFEWKYADFNLKGSVFEQRVKNFYQTTNSIISNAGTLKTKGYEAEL
FT                   DYQWNALKLTAGVAYADPKADFALSNDPLNVIPQGRQWSTGVSYKFVEPNLEIGWLGRY
FT                   AQSKEYKTGAAPKVETRRRIGYGVHDIFVNWQPLNQDNFNVNFTVKNIGNKFYRSHSQR
FT                   NLEVTPPSPGREFKIGMNYSF"
FT   gene            312322..314154
FT                   /gene="uvrC"
FT                   /locus_tag="APP7_0279"
FT   CDS_pept        312322..314154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrC"
FT                   /locus_tag="APP7_0279"
FT                   /product="UvrABC system protein C"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60931"
FT                   /db_xref="GOA:B3H0B9"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR001162"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004791"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR038476"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3H0B9"
FT                   /protein_id="ACE60931.1"
FT                   /translation="MFDAKAFLADVPHLPGVYRMYDAKNTIIYVGKAKDLKKRLSSYFR
FT                   SQLASKKTEALVANIHHIETTITHSETEALLLEHNYIKENQPKYNVLLRDDKSYPYILL
FT                   TKHQHPRITSFRGSKKVAGEYFGPYPNAGAVRETLNLLQKLFPIRQCEDSYYKNRSRPC
FT                   LQYQIGRCLAPCVEGYYSQAEYDNQVNLVRLFLQGKDGQVVEHLVQKMENAAQELDFEA
FT                   AARFRDQIQSVRAVQEKQFVSNERLDDLDIISIAYQHGIACVHILFVRHGKVLGNRSYF
FT                   PKVPNNTDLTELADTFVGQFYLQMNQHRTIPNQIIIDQPLSEATALANVLSEQAGHKVS
FT                   IADKNIRGDKSRYLALAKTNAEAALTLQLKQDTHIRQRYDSLKALLNLAEIKRMECFDI
FT                   SHTMGNQTVASCVVFDENGPLKSDYRRFNIEGITGGDDYAAMEQALLKRYGRHLEEEKI
FT                   PDIIFIDGGKGQLNRALETFASLNVSWDKRKPLLIGVAKGVERKAGLETLLISKWDKEI
FT                   HLPPDSPALHLIQHIRDESHNHAITGHRKKRQKAFTESGLESIAGVGAKRRQALLKYLG
FT                   GMQGVKSATLEEIQSVPGISKQLAEVIFDTLQHS"
FT   gene            314221..314973
FT                   /locus_tag="APP7_0280"
FT   CDS_pept        314221..314973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0280"
FT                   /product="putative Mg-dependent deoxyribonuclease"
FT                   /EC_number="3.1.21.-"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60932"
FT                   /db_xref="GOA:B3H0C0"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0C0"
FT                   /protein_id="ACE60932.1"
FT                   /translation="MFDSHIHLDQLDVSQIERIVSDPLLQGILAVSTDLASAETLLALK
FT                   QKFPKIQIAAGFHPEQVLIDEKQQQALFDWIVKNRANLTAIGEVGLPNYLKRQNPKLDY
FT                   QPYLALLEQFVVLSKRLNLPLNLHIVHDDVAITLDLLEKYQIQQAHFHWFKTDDDSLER
FT                   FLRTPYFASVTPDILWNLKTQKIVRNLPLDRLLIETDSPWRHESLENASISQQLQAILT
FT                   QLAKLRVESESMIRSQIRRNYQQLYGII"
FT   gene            complement(315110..317128)
FT                   /gene="rep"
FT                   /locus_tag="APP7_0281"
FT   CDS_pept        complement(315110..317128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rep"
FT                   /locus_tag="APP7_0281"
FT                   /product="ATP-dependent DNA helicase"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60933"
FT                   /db_xref="GOA:B3H0C1"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR005752"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0C1"
FT                   /protein_id="ACE60933.1"
FT                   /translation="MKLNDQQQQAVEYVTGACLVLAGAGSGKTRVIINKIAHLIAHCGY
FT                   SPKQIAAVTFTNKAAREMRERVAHSIGKENSKGLTISTFHTLGFEILKREYKLLGFKSG
FT                   MTLFDEHDQLALLKHLLPENAAEDKDLLKALISTISNWKNDLLSPEMVLTRVRDERERV
FT                   FSHFYRLYQNQLKAYNALDFDDLIMLPVLLFRQFPEAKTRWQQKVHYLLVDEYQDTNTS
FT                   QYELIKLLVGGEANFTVVGDDDQSIYSWRGAKPENMQRLREDFDLKVIKLEQNYRSSQR
FT                   ILHCANILIDNNDHIFQKRLFSNLSEGEKLNVIEAKNEEHEAERIVGELIAHRFSNKTK
FT                   YKDYAILYRGNHQSRLLEKLLMQNRIPYKISGGTSFFARAEIKDMMAYLRLVVNQDDDA
FT                   AFLRIVNTPKREIGAVTLEKLGLLANEKQVSLFEAIFDFELIQRLTPKPYQALQDFARW
FT                   IVEIADQAERSDPIEAVKDLLAKIQYEAYLYETATSPKAAEMQSRNVQTLFEWVQGMLE
FT                   GDEIEEPMTLVQVVNRLTLRDMLERGEDDDEADQVQLMTLHASKGLEFPHVFLVGMEEG
FT                   ILPHQTSLDEDNVEEERRLAYVGITRAQQTLTFSLCKERRQYGEIIKPEPSRFLLELPQ
FT                   DDLVWESEKPKMTEEQKVEKTSANIANLMAMLKANKK"
FT   gene            317462..318577
FT                   /gene="potA"
FT                   /locus_tag="APP7_0282"
FT   CDS_pept        317462..318577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="potA"
FT                   /locus_tag="APP7_0282"
FT                   /product="spermidine/putrescine import ATP-binding protein
FT                   PotA"
FT                   /EC_number="3.6.3.31"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60934"
FT                   /db_xref="GOA:B3H0C2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005893"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017879"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0C2"
FT                   /protein_id="ACE60934.1"
FT                   /translation="MEQLEQKPIIELRNVTKSYGSKTILKNLNLTINDGEFLTILGPSG
FT                   CGKTTALRLIAGFEDLTEGSIILDGQDVSNVPAEQRPVNTVFQSYALFPHMTIFENVAF
FT                   GLRMQKVPNDQIKPRVMEALRMVRLEDRAEQKPAQLSGGQQQRIAIARAVVNKPKVLLL
FT                   DESLSALDYKLRKEMQHELKALQRQLGITFIFVTHDQEEALTMSDRIIVMNGGKIAQDG
FT                   TPREIYEEPKNLFVARFIGEINVFDATVIERVDARNVKANVEGRICNIKVEDMDVQPNQ
FT                   KLKVLLRPEDILIEELDENESSKAIVGHILDRNYKGMTLESSVKLDHNGMNVLVSEFFN
FT                   EDDPNIDHEVGQKVALTWYEGWEVVLNDEDC"
FT   gene            318564..319430
FT                   /gene="potB"
FT                   /locus_tag="APP7_0283"
FT   CDS_pept        318564..319430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="potB"
FT                   /locus_tag="APP7_0283"
FT                   /product="spermidine/putrescine transport system permease
FT                   protein potB"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60935"
FT                   /db_xref="GOA:B3H0C3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0C3"
FT                   /protein_id="ACE60935.1"
FT                   /translation="MKIANNKFQAGTVSVIFGWLLLFVLVPNVLVLLISFLTENRQSAY
FT                   FVDFIFSLDAYTQLFNDTYATVLWNSFKMSAIATFFCLIIGYPFAFIIAKMPAKIRPIL
FT                   LFLVVLPFWTNSLIRIYGIKIFLGVKGVLNEALLAIGLIDEPLRLLNSELAIIIGLVYI
FT                   LLPFMILPLYSSIEKIDGRLLEAAKDLGANAFQRFVRVTIPLTMPGIVAGCLLVLLPAM
FT                   GMFYVADLLGGGKTPLIGNIIKSLFLNTNQFALGSAVSIALTVLMALMLYVYYRANKLL
FT                   NKKVELE"
FT   gene            319430..320197
FT                   /gene="potC"
FT                   /locus_tag="APP7_0284"
FT   CDS_pept        319430..320197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="potC"
FT                   /locus_tag="APP7_0284"
FT                   /product="spermidine/putrescine transport system permease
FT                   protein PotC"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60936"
FT                   /db_xref="GOA:B3H0C4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0C4"
FT                   /protein_id="ACE60936.1"
FT                   /translation="MKKTLRNFFMFVVFAYLYIPIIILVVNSFNEDRYGLQWKGFSWNW
FT                   YERLFANDTLVQATMNSLTIAFFAATFSTILGALISIALYRYKFRGKQMVGGLLFIVMM
FT                   SPDIVMAVSLLVLFMILGVQLGFISLLIAHITFCLPYVVITISSRLSDFDGKMLEAAKD
FT                   LGASEVTILRKIILPLALPSIISGWLLSFTISLDDVVVSSFVTSPSYEVLPLKIFSLVK
FT                   TGVTPEVNALATIMIIFSLTLVVLSQLVVRKKA"
FT   gene            320868..321473
FT                   /gene="ruvA"
FT                   /locus_tag="APP7_0285"
FT   CDS_pept        320868..321473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ruvA"
FT                   /locus_tag="APP7_0285"
FT                   /product="holliday junction ATP-dependent DNA helicase
FT                   RuvA"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60937"
FT                   /db_xref="GOA:B3H0C5"
FT                   /db_xref="InterPro:IPR000085"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR011114"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013849"
FT                   /db_xref="InterPro:IPR036267"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3H0C5"
FT                   /protein_id="ACE60937.1"
FT                   /translation="MIGRLHGKIIEKQPPEMVIDVQGVGYEVLLPMTSFYSLPQIGEEA
FT                   TIFTHLVVREDAHLLFGFAQKQDRTLFRELIKTNGVGPKLALAILSAMSVSQFANAVEH
FT                   EELAKLTKIPGIGRKTAERLLVELKGKFKGVAQSDFFEEHSVETIVATHSHDPADEARD
FT                   ALVALGYKLADAEKMIKKVNKAGATSEQLIREALKASL"
FT   gene            321492..321905
FT                   /gene="ruvB"
FT                   /locus_tag="APP7_0286"
FT   CDS_pept        321492..321905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ruvB"
FT                   /locus_tag="APP7_0286"
FT                   /product="holliday junction ATP-dependent DNA helicase
FT                   RuvB"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60938"
FT                   /db_xref="GOA:B3H0C6"
FT                   /db_xref="InterPro:IPR004605"
FT                   /db_xref="InterPro:IPR008824"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0C6"
FT                   /protein_id="ACE60938.1"
FT                   /translation="MIEADRIISASPKREEEIIDRAIRPKLLADYVGQPSVREQMEIFI
FT                   KAAKLRDEALDHLLIFGPPGLGKTTLANIVANEMGVNIRTTSGPVLEKAGDLAAMLTNL
FT                   EPYDVLFIDEIPAYHRQLKKCFIRRWKIISWIL"
FT   gene            321863..322495
FT                   /gene="ruvB"
FT                   /locus_tag="APP7_0287"
FT   CDS_pept        321863..322495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ruvB"
FT                   /locus_tag="APP7_0287"
FT                   /product="holliday junction ATP-dependent DNA helicase
FT                   RuvB"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60939"
FT                   /db_xref="GOA:B3H0C7"
FT                   /db_xref="InterPro:IPR004605"
FT                   /db_xref="InterPro:IPR008823"
FT                   /db_xref="InterPro:IPR008824"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041445"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0C7"
FT                   /protein_id="ACE60939.1"
FT                   /translation="MLYPAMEDYQLDIMIGEGPAARSIKLDLPPFTLVGATTRAGSLTS
FT                   PLRDRFGIVQRLEFYSVDDLTSIVKRSADCLNLNLSPDGAYEVARRSRGTPRIANRLLR
FT                   RVRDYADVRNNGVITSDIAKQALAMLDVDSEGFDFMDIKLLQAIVERFDGGPVGLDNLA
FT                   AAIGEERDTIEDVLEPYLIQQGFLQRTPRGRIATSRTYAHLGIAKLD"
FT   gene            complement(322552..323256)
FT                   /gene="ubiG"
FT                   /locus_tag="APP7_0288"
FT   CDS_pept        complement(322552..323256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiG"
FT                   /locus_tag="APP7_0288"
FT                   /product="3-demethylubiquinone-9 3-methyltransferase"
FT                   /EC_number="2.1.1.64"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60940"
FT                   /db_xref="GOA:B3H0C8"
FT                   /db_xref="InterPro:IPR010233"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3H0C8"
FT                   /protein_id="ACE60940.1"
FT                   /translation="MNNIDQTELDKFEKMAATWWDPNGSFKPIHLLNPLRLDYIQQKAN
FT                   GLFGKKVLDVGCGGGILSEAMAKAGANVTGIDMTTEPLDVARKHAEESGLTIDYRQTTI
FT                   EDFVQNQTACHAEKFDVITCMEMLEHVPDPLSIIQSCKALLKPDGVLFFSTINRTLKAY
FT                   MLVIIGAEYVLKMLPKGTHEFEKFIKPAELLNWCDMANLRCQEMKGYHFNPLTEKFWLN
FT                   NDVSCNYIAMLK"
FT   gene            323436..326126
FT                   /gene="gyrA"
FT                   /locus_tag="APP7_0289"
FT   CDS_pept        323436..326126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrA"
FT                   /locus_tag="APP7_0289"
FT                   /product="DNA gyrase subunit A"
FT                   /EC_number="5.99.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60941"
FT                   /db_xref="GOA:B3H0C9"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0C9"
FT                   /protein_id="ACE60941.1"
FT                   /translation="MSELAKDITPVSIEDELKTSYLDYAMSVIVGRALPDVRDGLKPVH
FT                   RRVLFSMDQNSNTFNRPHVKSARVVGDVIGKYHPHGDSAVYDTIVRMAQPFSLRYMLVD
FT                   GQGNFGSIDGDAPAAMRYTEVRMQKITQELLTDLEKETVDYSPNYDGKEMIPDVLPTKI
FT                   PALLVNGSSGIAVGMATNIPPHNLNEVLDGCLAYIENEQISIEELMRFIPGPDFPTGAI
FT                   INGRKGIEEAYRTGRGKVYVRAKASVETTEKGREQIIVTELPYQVNKAKLIEKIAELVK
FT                   DKKIEGISGIQDHSDKKGISIVIEVKRDAVGEVVLNHLYSLTQMQVTFGINMVALDHGQ
FT                   PKVLNLKQIIEAFVKHRREVVTRRTIFELRKARERAHILEGLAIALANIDPVIELIRNS
FT                   KTADEAREGLLARAWALGNVAPMLEAAGVDASRPEDLPENLGVRDGQYYLSEAQARAIL
FT                   ELRLHRLTGLEHEKIVDEYKALLTEIGELLRILSSAERLMEVIREELEKVKAEFGDERR
FT                   TEITAASGDINMEDLIAQEDVVVTLSHAGYVKYQPLSDYEAQRRGGKGKSATKMKEDDF
FT                   IEKLLVANTHDTILCFSSRGRLYQLKVYQLPQASRGARGTPIVNILPLVKEENERITAI
FT                   LPIPNGEFSADKFIFMATASGVVKKVSLDSFSNVRSSGLIALKLREGDELIGVDITDGE
FT                   SEIMLFSAQGRVVRFAEKAVRAMGRTATGVRGIKLATTDISSEEIEEAEIVEIENEEAE
FT                   ESSVSLDTDRVVSLVIPRTEGDILTVTQNGFGKRTVIGEYPVKSRATKGVVSIKVNERN
FT                   GKVVAAVQVEEADQIMLITDAGTLVRTRVAEVSLVGRNTQGVRIIRTADDESVVSVERV
FT                   CEPDDEDENSEALDNVESTETSTEA"
FT   gene            326223..327776
FT                   /locus_tag="APP7_0290"
FT   CDS_pept        326223..327776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0290"
FT                   /product="type I restriction-modification system, M
FT                   subunit"
FT                   /EC_number="2.1.1.72"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60942"
FT                   /db_xref="GOA:B3H0D0"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR004546"
FT                   /db_xref="InterPro:IPR022749"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038333"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0D0"
FT                   /protein_id="ACE60942.1"
FT                   /translation="MTAIQERAELQRRIWQIANEVRGSVDGWDFKQYVLGTLFYRFISE
FT                   HFVNYIEGGDESIKYATWSDDDENIKLGKEHVIKEKGYFIYPSQLFENVVKNAHNNPNL
FT                   NTELKDIFTSIESSAVGYDSENDIKGLFADFDTTSNRLGNTVEDKNKRLAAVLKGVAEL
FT                   DFGRFEDNQIDLFGDAYEFLISNYAANAGKSGGEFFTPQNVSKLIAQLALHGQKAVNKI
FT                   YDPACGSGSLLLQAKKQFDDHIIEEGFFGQEINHTTYNLARMNMFLHNINYDKFDITLG
FT                   DTLLKPQFGDSKPFDAIVSNPPYSVKWVGDSDPTLINDERFAPAGVLAPKSKADFAFIL
FT                   HALSYLSARGRAAIVTFPGIFYRGGAEQKIRQYLVDNNFVETVISLAPNLFFGTSIAVN
FT                   ILVLSKNKTDSKTQFIDASGIFKKETNNNVLTDEHIAEILKLFSDKADVDYLVKMVENQ
FT                   AIADNDYNLAVSSYVEAKDEREVINITELNAEISETVAKIDRLRTEIDSIIAEIEGDGK
FT                   "
FT   gene            327773..328681
FT                   /gene="rhuM"
FT                   /locus_tag="APP7_0291"
FT   CDS_pept        327773..328681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rhuM"
FT                   /locus_tag="APP7_0291"
FT                   /product="putative DNA-binding protein"
FT                   /function="Virulence protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60943"
FT                   /db_xref="GOA:B3H0D1"
FT                   /db_xref="InterPro:IPR011204"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0D1"
FT                   /protein_id="ACE60943.1"
FT                   /translation="MTKQEKQVVIFKSIDGAVAVNVQFDEDTAWLSLDQMADLFDRDKS
FT                   TISRHIKNIFKEGELVKDSVVANFATTALDGKTYQVDYYNLDVIISVGYRVKSLRGTQF
FT                   RQWASGILKEYLKKGFAMDDDLLKGLGGGNYFKELLERIRDIRSSEKVMYRQVLDLYAT
FT                   AIDYDPKSEESLQFFKIIQNKLHYAAHGHTASEVIYLSEQELKVLNNLVSAYFDFAELN
FT                   AIEEREMKMKDYVIGLDRILSGAGRKLLENAGEISHQQAQEKAKIEYKKYKAKTLSDVE
FT                   KDYLDVIQDLNQQVKKVSRRK"
FT   gene            328899..329195
FT                   /locus_tag="APP7_0292"
FT   CDS_pept        328899..329195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0292"
FT                   /product="Abortive infection bacteriophage resistance
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60944"
FT                   /db_xref="InterPro:IPR011664"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0D2"
FT                   /protein_id="ACE60944.1"
FT                   /translation="MKPQKIWKSFQEQLDLLDERELVIEDKKNALGYLKKIGYYRLSGY
FT                   LYSFRQIDEENPKNRLDNFISGSRFEDVKALYLFDKKLRQLALDALERIEIAL"
FT   gene            329196..329537
FT                   /locus_tag="APP7_0293"
FT   CDS_pept        329196..329537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0293"
FT                   /product="hypothetical protein"
FT                   /function="Abortive infection bacteriophage resistance
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60945"
FT                   /db_xref="InterPro:IPR011664"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0D3"
FT                   /protein_id="ACE60945.1"
FT                   /translation="MNIAYELGKYDPLAYQKSQYFEPHFEHQKWLDKYQNLLNRATENS
FT                   FVKHHLEHYGDLPIWAASEVWDFGAMSMLYKGMLPDDKDRIAKIYHLKDGKHLQTHLHA
FT                   FNFIRNSSS"
FT   gene            329476..329805
FT                   /locus_tag="APP7_0294"
FT   CDS_pept        329476..329805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0294"
FT                   /product="Abortive infection bacteriophage resistance
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60946"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0D4"
FT                   /protein_id="ACE60946.1"
FT                   /translation="MANIYKHICTHLTLFVTAHHSRLWNKPIVFKASLKGLQDAQWKQL
FT                   NVSQPFVYFCLMKRMLDVICPNSTWGARFLSLLDEFPKVENNAVNLQQMGIVTDLSQWA
FT                   LWKAT"
FT   gene            329971..331137
FT                   /locus_tag="APP7_0295"
FT   CDS_pept        329971..331137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0295"
FT                   /product="putative Type I restriction enzyme EcoR124II
FT                   specificity protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60947"
FT                   /db_xref="GOA:B3H0D5"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0D5"
FT                   /protein_id="ACE60947.1"
FT                   /translation="MNILELIKDCEVEWKSLGEVAKYVRGLTYNKTNESDEKAGGYYVL
FT                   RANNITLSNNQLNFDDVKLVKFDTKTKPEQKLYKDDILISAASGSKEHVGKVAFISENM
FT                   DFYFGGFMGVVRCSQEILPRFLFHILTSSLFKTYLNEVLNSSTINNLNAKVMNEFQIPI
FT                   PPLEIQEKIVKILDKFTELEATLEATLEAELSLRVKQYDYYRDDLLNFGDDVEWKMLGE
FT                   VCVRIFSGKNKIKNNEGKYNVYGSTGIIAKTDKKIYEEDLLLIARVGANAGFVHIATGE
FT                   YDVSDNTLIIKHKEDLVILKYLYYVLENMNLNRFANGAGQPLITAGQLKELKIPLPPLS
FT                   TQQKIVEILDKFDRLTNSISDGLPKEIELRRKQYEYYRERLLNFPKSE"
FT   gene            331143..332258
FT                   /gene="prrC"
FT                   /locus_tag="APP7_0296"
FT   CDS_pept        331143..332258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prrC"
FT                   /locus_tag="APP7_0296"
FT                   /product="Anticodon nuclease"
FT                   /function="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60948"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0D6"
FT                   /protein_id="ACE60948.1"
FT                   /translation="MSKTLLDIAKELKNNDKKVQLIYAFNGTGKTRLSKIFKELIVPKN
FT                   KNDDSESELARHKILYYNAFTEDLFYWDNDLAGDKEPKLKIQPNTFTDWVLREQAQDQN
FT                   IISYFQHYTNEKLTPKFSENFDKVTFSFSRGNDEIEENIKISKGEESNFVWSIFYSLID
FT                   EVIQIRNQKENRQMSNFDAIEYIFIDDPVSSLDENHLIELAVDLAKLIKSSDFKFNKIK
FT                   FIVTTHNSIFYNILYRGLGLNEGMLLEKKQDGLFELHTKKGDSNTSFNYHIYLKHTLEN
FT                   AISNNAIEKYHFTLLRNLYEKTASFLGYKEWSSLLPDDSRNAYYSRIINFSSHSSLAGE
FT                   TSVYLTDAEKNIVVFLLNDLTTRYNFFKSTE"
FT   gene            332265..335399
FT                   /locus_tag="APP7_0297"
FT   CDS_pept        332265..335399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0297"
FT                   /product="putative type I site-specific
FT                   restriction-modification system, R (restriction) subunit"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60949"
FT                   /db_xref="GOA:B3H0D7"
FT                   /db_xref="InterPro:IPR004473"
FT                   /db_xref="InterPro:IPR007409"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR022625"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040980"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0D7"
FT                   /protein_id="ACE60949.1"
FT                   /translation="MLEEIYTPITETNKFIVLDKYERLEQASIYQTESDLEREFIADLQ
FT                   NQGYEYRTDLNSQEALLQNVRKQLETLNNVQFLDLEWQRFLTEYLDKPSENIIDKTRKI
FT                   HHDHIYDFVFDNGRIQNIYLVDKKHIARNKVQVINQFEQMGTHANRYDVTILVNGLPLV
FT                   QIELKKRGVAIREAFNQIHRYSKESFNSEHSLFKFLQIFVISNGTDTRYFANTTKRDKN
FT                   SFDFTMNWARSDNTLIKDLKDFTATFFQKNTLLNVLLTYSVFDVSETLLIMRPYQIAAT
FT                   ERILWKIRSSYLANNWCSTESGGYVWHTTGSGKTLTSFKAARLATELDFIDKVFFVVDR
FT                   KDLDYQTMKEYQRFSPDSVNGSDSTAGLKANIEKDDNKIIVTTIQKLNNLMKSEDKLAI
FT                   YQQPVVFIFDECHRSQFGEAQKNLHKKFKKFCQFGFTGTPIFPENALGTETTASVFGRE
FT                   LHSYVITDAIRDEKVLKFKVDYNDVRPKFREMETEQNLEKLTALETKEALLHPERIKEI
FT                   TQYILSHFKQKTHRLNATGKGFNAMFAVSSVEAAKHYYEQFKLQQAVDKTQSVLNVGFA
FT                   NGSEGVRNLSQQISNKNPLKVATIFSFAANEEQNAIGEIEDEGFEPTAMNSSAKEFLAL
FT                   AIDDYNQMFRTNFGMDSKAFQNYYRDLAKRVKNQEVDLLIVVGMFLTGFDAPTLNTLFV
FT                   DKNLRYHGLMQAFSRTNRIFDATKTFGNIVTFRDLEQATIDAITLFGDTNTRNVVLERS
FT                   YQDYMHGYEDSSGKKHRGYLAVVKELQEKFPEPNNLKTEEDKKAFTKLFGEYLRLENVL
FT                   QNYDEFHELVKSGQDNQVCETPATYGSNAVETLTERQVQDYRSAYNDIRDWQRRERDNA
FT                   ESKSSVDWSDVIFEVDLLKSQEINLDYILELIFEHNKKIKNKDALVEEIRRMIRSSIGN
FT                   RAKESLVVDFIHQTDLNSIPDKASVIEAFFQFAQKEQRREAEDLIQSEKLNEEAAKRYI
FT                   SSSLKREYASENGTDLVSMLPKMSPLDPKRHKKKETVFQKIVSFIEKFKGVGGSI"
FT   gene            335418..337361
FT                   /gene="uupA"
FT                   /locus_tag="APP7_0298"
FT   CDS_pept        335418..337361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uupA"
FT                   /locus_tag="APP7_0298"
FT                   /product="ABC transporter ATP-binding protein Uup-1"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60950"
FT                   /db_xref="GOA:B3H0D8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032524"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="InterPro:IPR037118"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0D8"
FT                   /protein_id="ACE60950.1"
FT                   /translation="MALLNLSNAYLGFGDHPLLDHTELHIEPGERVCLVGRNGAGKSTL
FT                   MKVLAGEVQLDDGKLIFEKDIVVTRLEQDPPRHIQDTVFDYVAEGIAHLSDLLKQYHHI
FT                   SQQMQTDYSDELLSKLSNVQAQLEHNNGWQFENRIQDTLKLLELDLDKRLCELSGGWVR
FT                   RAALARALVADPDILLLDEPTNHLDVEAITWLEDLLLNFKGSIIFISHDRSFIRKMATR
FT                   IVDLDRGKLVSYPSNYDLYLETKAEDLRVEALQNELFDKKLAQEEVWIRQGIKARCTRN
FT                   EGRVRALKALREERRNRREVQGTAKIQIDQTARSGKIVFEVENASYEIEGKTLLKNFTT
FT                   TIQRGDKIALVGANGCGKTTFIKLLLGELQPTSGSIRCGTKLEVAYFDQYRAELDLEKT
FT                   VMDNVADGKQDVEVNGVKRHVLGYLQDFLFPPKRAMTPVKALSGGERNRLLLAKLLLKP
FT                   NNLLILDEPTNDLDVETLELLEDLLADYRGTLLIVSHDRQFIDNTVTECYFFEGNGVLN
FT                   KYVGGYFDAKQQQENYHANITQNQPNKRSNSAETLQKTEEKQPLVTKSEPAKKVKLSYK
FT                   EQRELDELPEKMEALEAEMESLQAEVNSADFFSKDPSYTQAQLQKLADAEMALEAAFER
FT                   WEVLENIKNGNS"
FT   gene            337361..338125
FT                   /locus_tag="APP7_0299"
FT   CDS_pept        337361..338125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0299"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60951"
FT                   /db_xref="GOA:B3H0D9"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0D9"
FT                   /protein_id="ACE60951.1"
FT                   /translation="MARVDNYEQRFGGIGRLYTPEGLAKLRQAHICVIGIGGVGSWAVE
FT                   ALARSGIGKITMIDMDDICVTNINRQIHAMTGTIAQLKTEAMKERIERINPECVVEIID
FT                   DFITPENIPEYLNRGYDYVIDAIDSVKTKAALIAYCKRNKIKMVTTGGAGGQTDPTQIQ
FT                   ITDLSKTIQDPLASKVRSLLRKEYNFSQNPKRKFGIDCVFSTQPLIFPKMGEGCEVSAT
FT                   MNCANGFGAVTMVTATFGFFAVSRVIDKLLKS"
FT   gene            complement(338204..338536)
FT                   /locus_tag="APP7_0300"
FT   CDS_pept        complement(338204..338536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60952"
FT                   /db_xref="InterPro:IPR020493"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0E0"
FT                   /protein_id="ACE60952.1"
FT                   /translation="MLKKFITSGIVSVMFISTIQNAVAEMKTSSLSMAKPSVSKHLPSQ
FT                   CQQMFSVAHKLVSDAEKQPGTHTQVQKMKNKLSSTKEEILKMETEMQEKSCNKGLTALN
FT                   TLKQKH"
FT   gene            338992..340542
FT                   /gene="cydA"
FT                   /locus_tag="APP7_0301"
FT   CDS_pept        338992..340542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cydA"
FT                   /locus_tag="APP7_0301"
FT                   /product="cytochrome oxidase subunit 1"
FT                   /EC_number="1.10.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60953"
FT                   /db_xref="GOA:B3H0E1"
FT                   /db_xref="InterPro:IPR002585"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0E1"
FT                   /protein_id="ACE60953.1"
FT                   /translation="MLDVVELSRLQFALTALYHFLFVPLTLGLSFVLVVMETLYVTTGK
FT                   EVYKDMTKFWGKLFGINFALGVTTGITMEFQFGMNWSYYSHYVGDIFGAPLAIEGLMAF
FT                   FLESTFIGLFFFGWDRLSKGKHLLATYAVAFGSNLSALWILVANGWMQNPVGSEFNFET
FT                   MRMELVSFSELVLNPVTQSKFLHTVTAGYTCGAVFVLGINAYYILKGQDLGFAKRSFSV
FT                   GASFGLVAIIAVAIMGDESGYEIGKAQPTKLAAMEGEFETQPAPAAWNVVVLPNTAEMK
FT                   NEFSIHIPYMAGIIATRSFDTEIKGLKDIRAINEQRVRTGIQAYALLEKLRTGNYTAED
FT                   KAAFQAVQKDLGFGLLLKQYTPNVVDATEEQIQKAAASTIPNVGPTFWAFRIMMASGGL
FT                   MLLLIGFAFFQNMRGTVGKNRLFLKAMLWGIPLPWIAIESGWFLAEYGRQPWAIYEMLP
FT                   TGVSNSALTTTDLWIAIGLLCGLYTLFLVVEMYLMFKYGRLGPSALKTGRYHFEQSAK"
FT   gene            340556..341692
FT                   /gene="cydB"
FT                   /locus_tag="APP7_0302"
FT   CDS_pept        340556..341692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cydB"
FT                   /locus_tag="APP7_0302"
FT                   /product="cytochrome oxidase subunit 2"
FT                   /EC_number="1.10.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60954"
FT                   /db_xref="GOA:B3H0E2"
FT                   /db_xref="InterPro:IPR003317"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0E2"
FT                   /protein_id="ACE60954.1"
FT                   /translation="MIDYEILRFIWWILIVVLLIGFAVTDGFDMGVLTLLPVIGKSNVE
FT                   RRVMINTIAPHWDGNQVWLLTAGGAIFAAWPTVYATSFSGFFLAMILVLAALFFRPVGF
FT                   EYRAKIDSPKWRNAWDWGLFIGGFVPSLIFGVAFGNLLQGVPFEFNNINQVVYTGSFFG
FT                   LLNPFALLCGVVSLMMLTTQGATWLQMKTTGDLRNRARATAQLTAAIVLVAFVLAGVWL
FT                   SFKDGFVITSDLDHNAQSFLTNKTVAVESAAWFRNFAEMPVLWVVPALAVVGALLTIVA
FT                   SKANRSGFAFFSSSIMLVGVITTAAVSMFPFIMPSISHPEMSLTVWDSTASQYTLMVML
FT                   VVACIFVPLVLAYTTWSYFKMYGRLDAKYLEDNKASAY"
FT   gene            342260..342649
FT                   /locus_tag="APP7_0303"
FT   CDS_pept        342260..342649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0303"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60955"
FT                   /db_xref="GOA:B3H0E3"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR006684"
FT                   /db_xref="InterPro:IPR008272"
FT                   /db_xref="InterPro:IPR014166"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0E3"
FT                   /protein_id="ACE60955.1"
FT                   /translation="MNFPIRVYYEDTDAGGVVYHANYVCFFERARTEFLRQAGFSQQEL
FT                   LSKSFAFVVKKLEVDYKVPARLDDLLRVETEIIELKKATIIFRQQLWRDDTCLSSALVT
FT                   VASVDLTKMKPVAIPVEIRQVLQAV"
FT   gene            342684..343364
FT                   /gene="tolQ"
FT                   /locus_tag="APP7_0304"
FT   CDS_pept        342684..343364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tolQ"
FT                   /locus_tag="APP7_0304"
FT                   /product="colicin transport protein TolQ"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60956"
FT                   /db_xref="GOA:B3H0E4"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="InterPro:IPR014163"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0E4"
FT                   /protein_id="ACE60956.1"
FT                   /translation="METEFNLVSLFMQASIVVKIVILILISFSILSWAVIIQRSRVLTE
FT                   AKKNALAFENKFWSGEDLHRLHEGLENRRDALNGSEQIFYAGFKEYMRLQQVNPDAPEA
FT                   TMKGSSRAMNLALNREVENLESYIPFLGTVGSISPYIGLFGTVWGIMHSFMGLSAVKQA
FT                   TLQSVAPGIAEALIATAIGLFAAIPAVMAYNRLSLRVNKLEQEYANFIDEFTTILHRQA
FT                   FSKK"
FT   gene            343441..343881
FT                   /gene="tolR"
FT                   /locus_tag="APP7_0305"
FT   CDS_pept        343441..343881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tolR"
FT                   /locus_tag="APP7_0305"
FT                   /product="biopolymer transport protein TolR"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60957"
FT                   /db_xref="GOA:B3H0E5"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="InterPro:IPR014168"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0E5"
FT                   /protein_id="ACE60957.1"
FT                   /translation="MSYRRKRNDIKSEINIVPFLDVLLVLLLIFMATAPVISQSVEVNL
FT                   PEDKHSQSVSNEDKTPVILQVADVGLYKLKIDGNFVQGSNGQEDLGEQEVIAYAGEAFQ
FT                   KDPNTLFLVAAEKNIPYEEVIKGIVLLKDAGIKNAGLMTQGK"
FT   gene            343897..345204
FT                   /gene="tolA"
FT                   /locus_tag="APP7_0306"
FT   CDS_pept        343897..345204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tolA"
FT                   /locus_tag="APP7_0306"
FT                   /product="cell envelope integrity inner membrane protein
FT                   TolA"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60958"
FT                   /db_xref="GOA:B3H0E6"
FT                   /db_xref="InterPro:IPR014161"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0E6"
FT                   /protein_id="ACE60958.1"
FT                   /translation="MKSKNDRLELAVIVSILLHALLIGLLILGSFFTKTTLEEAAGGSG
FT                   GTGEEFEAVMVDTGQVAAEYGRLKSDKKGNAKPKVEEKEEPKPEEVVEDEPTPQEIAEE
FT                   QAKEQQRIAMIEEQKKQEEQRKEEQRKKAEEKRQQEIEKQEQLKKEQAEEATRKKAAEA
FT                   ARLKAEAEAKNLEAAAKAAEEEKKAKEAQKKLEQQKKLEEQKQAEKEAKLKAEKEAKEK
FT                   AEKEAKAKAEKEAKEKAEKEAKLKAEKEAKEKAEKEAKLKAEKDAKAKAEKEAKAKAAA
FT                   EAKAKADAAAKAAQAKNNKALDDFLSGGDIGGDIGGGSSKGGNKNTAGSQGSGNAKGIG
FT                   DGRGTADTGYAQLIKKKLARTYRVDPSFSGRECQVKIFIDPAGNITNHQVLSGPDDICR
FT                   AAVTAITSARNVPRAPNEETYNKYKSPIIKFGLKVL"
FT   gene            345403..346338
FT                   /gene="tolB"
FT                   /locus_tag="APP7_0307"
FT   CDS_pept        345403..346338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tolB"
FT                   /locus_tag="APP7_0307"
FT                   /product="Protein tolB precursor"
FT                   /function="Periplasmic component of the Tol biopolymer
FT                   transport system"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60959"
FT                   /db_xref="GOA:B3H0E7"
FT                   /db_xref="InterPro:IPR007195"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR036752"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0E7"
FT                   /protein_id="ACE60959.1"
FT                   /translation="MPTTYVIAASLLPVERSKLPAQPGSAAEVNSQQWTDIGVDSVVVG
FT                   QVTPTGGGYNVAYQLVDTLSNPATVLAQGAFNVPAAQIRQGAHTVSDQVFEKITQIRGA
FT                   FRTKIAYVVQRGVSSYELRVSDYDGYNAFTVVKSKEPLMSPEWSPDGSRLAYVTFENKK
FT                   AQVVVHDLRSGSRRVVAALRGHNGAPAFSPDGSRIAFASNQDGELDIYVVGANGGKPSK
FT                   LTANAGNNTEPSWSPDGSTIYFTSDRAGSPQVYRMGSSGGGASPMGGSGSYNAKVSSDG
FT                   KNLIMIAGDKVVKTRSRFGWHGSIEFNVLR"
FT   gene            346316..346504
FT                   /gene="tolB"
FT                   /locus_tag="APP7_0308"
FT   CDS_pept        346316..346504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tolB"
FT                   /locus_tag="APP7_0308"
FT                   /product="translocation protein TolB precursor"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60960"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0E8"
FT                   /protein_id="ACE60960.1"
FT                   /translation="MSSTFLDESPSISPNGIMVIYSSTKGTSKVLQLVSADGRFKANLP
FT                   GAGGQFKFPAWSPYLTK"
FT   gene            346531..346989
FT                   /gene="palA"
FT                   /locus_tag="APP7_0309"
FT   CDS_pept        346531..346989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="palA"
FT                   /locus_tag="APP7_0309"
FT                   /product="outer membrane protein precursor PalA"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60961"
FT                   /db_xref="GOA:B3H0E9"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR014169"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="InterPro:IPR039001"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0E9"
FT                   /protein_id="ACE60961.1"
FT                   /translation="MKKLAKVLMIAAPAFVLAACSSSSDNANANANANAGQFGGMTAED
FT                   LQTRYNTVYFGFDSYAVEGEYQQLLDAHAAYLTSANGKVTVAGHADERGTPEYNIALGQ
FT                   RRADAVKNYLATKGANQVSTVSYGEEKPAVLGHTEADYAKNRRAVLEY"
FT   gene            347086..347973
FT                   /locus_tag="APP7_0310"
FT   CDS_pept        347086..347973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60962"
FT                   /db_xref="GOA:B3H0F0"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0F0"
FT                   /protein_id="ACE60962.1"
FT                   /translation="MINFWNHISPLMKGIICILLSALGFSLMALFMRLAGELPLAEKAI
FT                   FRNAITALISGYIIWRNKQSFLGQAENRTLLLLRSITGLLGILCGVYIIDHLVLSDVDM
FT                   IGKLTSFILIVFSAVFLKEKASYVQWGLCLSAFVGALFIIKPAFEIKFFPYVIGIIGAV
FT                   FAALAYLCLRLLGKRAKPETSNTIVFFFSAFSTIVLLPFVFLDFVPITAIQFNYLLLSG
FT                   ITATVGQFCVTLAYKYAAAKDISIYSYASVLFSAFLGATIFEQFPDGWSVLGYLIIFSS
FT                   GFLMFMFTRTKRKI"
FT   gene            348053..348913
FT                   /gene="djlA"
FT                   /locus_tag="APP7_0311"
FT   CDS_pept        348053..348913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="djlA"
FT                   /locus_tag="APP7_0311"
FT                   /product="DnaJ-like protein DjlA"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60963"
FT                   /db_xref="GOA:B3H0F1"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR007791"
FT                   /db_xref="InterPro:IPR023749"
FT                   /db_xref="InterPro:IPR029024"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0F1"
FT                   /protein_id="ACE60963.1"
FT                   /translation="MQFIGKIIGFFIGYKLFGGIFGGLLGVFIGHLADKKLYELGSVRS
FT                   SIFGKNLTRQSLFTQTTFAVLGHIAKAKGRVTEDDIHLARLLMARLKLDANAQQLAQQA
FT                   FTLGKEADFPLRQVIQEFREACGQRADLLRFFVEVQMQAALQDGQLDSNEQQILFTIAE
FT                   TMGMSRFQFEQMIAMVMAAQQFRSGGFYQQSQQQSGSYHQSQGNYGGYRPSGPNVKDAY
FT                   TVLGVTENDDQNTVKRAYRKLMNEHHPDKLAAKGLPDEMMELAKEKAQQIQAAYDLICK
FT                   TKGWK"
FT   gene            348998..349960
FT                   /gene="dusC"
FT                   /locus_tag="APP7_0312"
FT   CDS_pept        348998..349960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dusC"
FT                   /locus_tag="APP7_0312"
FT                   /product="tRNA-dihydrouridine synthase C"
FT                   /EC_number="1.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60964"
FT                   /db_xref="GOA:B3H0F2"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR032886"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="InterPro:IPR042270"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0F2"
FT                   /protein_id="ACE60964.1"
FT                   /translation="MINNIPKVILAPMQGVLDPFVRKLLTAVNDYDLCISEFVRVVDQK
FT                   LPKKAFYRRAPELLQGGLTDSGTPVRVQLLGQHPQWLAENARLAIELGSQGVDLNCGCP
FT                   SKTVNGSNGGASLLKDPDLIYRATKAMREAVPQDQIVSVKVRLGWDSADQCFEIADAVA
FT                   QGGANEITVHGRTKQDGYRAERINWQAIGEIQKRLSIPVIANGEIWDFESAKNCQNATA
FT                   CSSLMIGRGALNTPNLSRVVKFNQPKMAWNEVLQLLFQYVNMENEHDSGFYHVARIKQW
FT                   LHYLDKEYPQAKDLFQILKTEHGYDGLKTHIERAVNQEF"
FT   gene            350012..351058
FT                   /locus_tag="APP7_0313"
FT   CDS_pept        350012..351058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0313"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60965"
FT                   /db_xref="GOA:B3H0F3"
FT                   /db_xref="InterPro:IPR006507"
FT                   /db_xref="InterPro:IPR021147"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0F3"
FT                   /protein_id="ACE60965.1"
FT                   /translation="MKKQIFSEQEVTTEQQFVAKQEFEASDDIQIEEEYQEVEAELIVE
FT                   ESLKPSRFWVRVILFALGLFSVAVIAQSVQWLIDTFQARQWIYFAFAIVFALISLTGVV
FT                   AIIGEWRKLVFLRHHQQQQQVSEQLLLEELSTTSGEKAVNFCNEVVANLKNVPSVQHSQ
FT                   QRWQSQLNEAYNAKEVLYLFSETVLTPLDKQVKKMISKSATENAIIVAVSPLAVVDVLM
FT                   VAWRNIALVNKISKTYGIQLGYFSRLKLFKMVLTNMVFAGATEVVSDVGMEFFSQNLTA
FT                   KLSLRAAQGIGVGLLTARLGIKAMEFCRPVAFQAGEKPKLSAIRQQLLTSVKNTIFAKT
FT                   EEKASEKV"
FT   gene            complement(351255..353171)
FT                   /gene="yheS"
FT                   /locus_tag="APP7_0314"
FT   CDS_pept        complement(351255..353171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yheS"
FT                   /locus_tag="APP7_0314"
FT                   /product="putative ABC transporter ATP-binding protein
FT                   YheS"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60966"
FT                   /db_xref="GOA:B3H0F4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0F4"
FT                   /protein_id="ACE60966.1"
FT                   /translation="MIFFTDLILKRGQFVLLENTSATIHTGQKVGLVGKNGCGKSSLFA
FT                   LVKGELQPEGGDVSLPKNWAISWVNQETPALEISALDYVIQGDREYTGLMNQLEKANQE
FT                   NNGNQIAMIHTQLDTIDAWTIQARAATLLNGLGFSNEQLSLPVKSFSGGWRMRLNLAQA
FT                   LICRSDLLLLDEPTNHLDLDAVIWLEKWLTNYRGTLLLISHDRDFLDPIIDRVIHIENQ
FT                   QLNDYTGNYTSFEIQRATKISQQNAAYAQQQRKVAHLQSFIDRFKAKATKAKQAQSRIK
FT                   ALEKMELIAPAYADSPFEFEFRPPLALPSPLLMMEKAGAGYGNKTILESVKLNLVPGSR
FT                   IGLLGRNGAGKSTLIKLLAGELAPQTGHIQLAKGVQLGYFAQHQVDTLRFDESPLWHLQ
FT                   KIAPELTEQEVRNYLGGFDFKGDKVKQNVGSFSGGEKARLVLALIVWQRPNLLLLDEPT
FT                   NHLDLEMRQALTDALTYYEGSLVVVSHDRHLLRSTVNEFYLVHDKKVEEFKGDLDDYQK
FT                   WLNEQNALEAAKNSANSTACTEEKADNSAANRKEQKRLEAELRQQTAPLRKKITQLEKD
FT                   LEKASEKLNQLEALLASSEIYEAENKAQLTETLAKQIEAKKAVEEIEMEWLYCQEQLEA
FT                   LLS"
FT   gene            353762..355003
FT                   /gene="moeA"
FT                   /locus_tag="APP7_0315"
FT   CDS_pept        353762..355003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="moeA"
FT                   /locus_tag="APP7_0315"
FT                   /product="molybdopterin biosynthesis protein MoeA"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60967"
FT                   /db_xref="GOA:B3H0F5"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR005111"
FT                   /db_xref="InterPro:IPR008284"
FT                   /db_xref="InterPro:IPR036135"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036688"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0F5"
FT                   /protein_id="ACE60967.1"
FT                   /translation="MALLPLSEALANMLARLPSPTKIENLPLNQCANRILAEDIFSPIN
FT                   VPSFDNSAMDGYAFRLADLVQFERLIVAGKSFAGNPFIGEVKAGECIRIMTGAMVPADC
FT                   DVVVMQEEAEAETLASGQISVKFCKTPKLGQNIRRIGEDVKQGALVLAKGSLLNVTTLP
FT                   LLASLGVAQVPVFSRLKVAILSTGDELTSVGQALEQGKIYDTNRFAVRLMLEKLNCDIL
FT                   DFGILPDDPAVFEQTFTQAQQQADVLITSGGVSVGEADFTKEVLEKLGEIGFWKIAMKP
FT                   GKPFAFGKLQHAWFFGLPGNPVSALVTFYQLVQPALAKLAGVNAERIANFTQNLTAIAD
FT                   TNLKKAVGRQDFQRGFYYVNEQGEVAVRPVGLQGSHLFSAFYESNCFIVLEAERGNVDA
FT                   GEKVTIQPFNSLLR"
FT   gene            355013..355759
FT                   /gene="moeB"
FT                   /locus_tag="APP7_0316"
FT   CDS_pept        355013..355759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="moeB"
FT                   /locus_tag="APP7_0316"
FT                   /product="molybdopterin biosynthesis protein MoeB"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60968"
FT                   /db_xref="GOA:B3H0F6"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR012730"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0F6"
FT                   /protein_id="ACE60968.1"
FT                   /translation="MELSDQEMLRYNRQIILKSVDFDGQEKLKASRVLIVGLGGLGCSA
FT                   AQYLASAGVGHLILVDFDEVSLSNLQRQILHTDANIGQPKVESAKVRLSQINPHIQLEA
FT                   INKQCSDAEFAELIERVDLVVDCTDNATVRNQLNLQCFAQKRPLVSGSAIRFEGQISVF
FT                   TYAENKPCYNCLSRLFGDGTLSCVEAGVIAPIVGVVGSLQALEAIKLLLNIGKSLSGKL
FT                   LMIDGLYFSVREMNLPKLQDCEICCQ"
FT   gene            355852..355924
FT                   /locus_tag="APP7_tRNA05"
FT   tRNA            355852..355924
FT                   /locus_tag="APP7_tRNA05"
FT                   /product="tRNA-Asn"
FT   gene            complement(356156..357484)
FT                   /gene="rumA"
FT                   /locus_tag="APP7_0317"
FT   CDS_pept        complement(356156..357484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rumA"
FT                   /locus_tag="APP7_0317"
FT                   /product="23S rRNA (uracil-5-)-methyltransferase RumA"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60969"
FT                   /db_xref="GOA:B3H0F7"
FT                   /db_xref="InterPro:IPR001566"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030390"
FT                   /db_xref="InterPro:IPR030391"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0F7"
FT                   /protein_id="ACE60969.1"
FT                   /translation="MALFYSEKAAKQQAKKSAKVTACPPVTIQSLDYQGLGVAKINGKT
FT                   WFIENALPNEQVEIQVLEEKRQYGRAKAVKILKQSAARQQPSCALYGKCGGCQMQHIPL
FT                   DLQREAKQQALFQRLQKLQSQPIDFQPMIIGNDKGYRRRAKLSIVSQNNQLAIGFRMQN
FT                   SNQIIPLEQCEVLVEPLSQLIKPLQSLFSTWQNKKSLGHIELVQADDTITMLIRNVGQF
FT                   HPQDSRNLQQFAERHSLSLYVMTAENDITHLSGEAPYYQIHGVKLGFSIRDFIQVNGDL
FT                   NEKMVDKALEWLDLSAQDRVLDLFCGMGNFTLPIAKQAGFVVGVEGVEPMVAQAKQNRD
FT                   TSGLKNVAFYQTNLDEPFADKPWASEPFNKVLLDPARNGAFFCLDHLAALNPGTIVYVS
FT                   CNPATLVRDAEKLIQAGYKLQKAAMIDMFPHTGHLESISLFTK"
FT   gene            357542..358867
FT                   /locus_tag="APP7_0318"
FT   CDS_pept        357542..358867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0318"
FT                   /product="deoxyguanosinetriphosphate
FT                   triphosphohydrolase-like protein"
FT                   /EC_number="3.1.5.1"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60970"
FT                   /db_xref="GOA:B3H0F8"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006261"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR023023"
FT                   /db_xref="InterPro:IPR026875"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0F8"
FT                   /protein_id="ACE60970.1"
FT                   /translation="MIYNVWTERFLADKKREQDHRSPFQRDRARILHSEAFRCLQAKTQ
FT                   IHAVGEDDFYRTRLTHSLEVAQIGSSIRAKLLREKQAFQAVVSEQKFANFAENLTALLP
FT                   SRSLIESLCFAHDIGHPPFGHGGEMALNYKMRAHGGFEGNAQSFRIVTQLEPYTPQHGM
FT                   NLTRRTLLGIIKYPALLEETEPQARPQFAESPYINLHQFKTCKGIFSDDQTFFDWVLAP
FT                   LSEQDRNLLRSISFSKDPFEPHKTQYKSLDCSIMELADDIAYGVHDLEDAIAGGMVTPQ
FT                   SWQQAQQQLAQCSSNWIQTILPTLSQKLFSQHRYERKDVIGALVNYFVTNVQWREQPGF
FT                   DEPLLRFNAYLPDDVKCVLEILKRFVYQYVICDVKTQRVEYKGQRILMALFDMLSTDPE
FT                   RLLPQNVALRWQQSTPSKRPRVICDYLAGMSDGQAFKLYQSL"
FT   gene            359039..361948
FT                   /gene="hepA"
FT                   /locus_tag="APP7_0319"
FT   CDS_pept        359039..361948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hepA"
FT                   /locus_tag="APP7_0319"
FT                   /product="ATP-dependent helicase HepA"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60971"
FT                   /db_xref="GOA:B3H0F9"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR022737"
FT                   /db_xref="InterPro:IPR023949"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="InterPro:IPR040765"
FT                   /db_xref="InterPro:IPR040766"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3H0F9"
FT                   /protein_id="ACE60971.1"
FT                   /translation="MFVVGQRWISESENNLGLGIVTASDNRTVTIQFPAAEEERIYALS
FT                   VAPLTRVQFQKGDRINSVEGWQLDVEEVVENQGFIIYLGKRADSGEEAVLPEMQLDHKV
FT                   SFSKPQDRLFSAQIDRSDRFALRYRALQHQQAQFQSPLRGMRGIRASLIPHQLHIAKEV
FT                   GQRVAPRVLLADEVGLGKTIEAGMILQQQLFSGRVERVLVLVPESLQHQWLVEMLRRFN
FT                   LKFSLFDEERCSDFDKADEDGNDVSENPFDSEALVIASIDWLESSPNRAKQVLASHWDM
FT                   LIVDEAHHLAWSEDEPSVGYQFVERLSKQTPAVLLLTATPEQLGQESHFARLALLDADR
FT                   FYDYHSFIAEQKDYKPVADAVATLLNDKPLSHDEQNSIAELLSEKDTEPMFKVINSEKS
FT                   KENDRLQVRQELIRELIDRHGTSRVLFRNTRQGVKGFPHRVYHQITLEMPSQYTNALKV
FT                   MGMMGGVTKDDQLYPERLFQRMNPAAKWADFDPRIEWLITFLKNHRDEKILVICKQADT
FT                   AIALEQILREREAIRSAVFHEKMSIVERDRASAYFAQMEEGAQVLISSSIGSEGRNFQF
FT                   ASNLVLFNLPDNPDLLEQSIGRLDRIGQKNDIQIHVPCFENSMQMVLATWYHQGLNAFE
FT                   ETCPMGAALFREFGEELEGFLKNPQAVGFDEFLVRTFKRQQQLKAELEQGRDRLLELNS
FT                   NGGEVAQALAEAIAKEDNNPHLVNFALSLFDVIGLEQEDLGEQSIVISPTGHMLVPDFP
FT                   GIAEDGTTVTFDRQLALMREDVEFLTWDHPMIRNGIDLITSGYIGKSAISLLINKNLPA
FT                   GTLLLEAIYMVETQAPKGLNLTRFLPPTPVRILLDNKGNDMAAQVSFAGLEKQLKPLNK
FT                   QMANKIAKMAQADIKKLIGISEQKIAAKLPELIEKASQDADSTLSAELHRLTSLQAVNK
FT                   NIRSDEIEALEQQRIESLKQIALANWRLDSLRVIVSNKE"
FT   gene            362052..362732
FT                   /gene="rluA"
FT                   /locus_tag="APP7_0320"
FT   CDS_pept        362052..362732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rluA"
FT                   /locus_tag="APP7_0320"
FT                   /product="ribosomal large subunit pseudouridine synthase A"
FT                   /EC_number="5.4.99.12"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60972"
FT                   /db_xref="GOA:B3H0G0"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0G0"
FT                   /protein_id="ACE60972.1"
FT                   /translation="MVRKMALIEYHPPLEPFLTEVYRDNHILVINKPSGLLSVPGNRPE
FT                   YYDSAMTRVQQKYGFTEPAHRLDMATSGILLFALSKAAEKELKRQFRDREPKKHYIALL
FT                   WGKLGEKVGDTGEMNFPLICDWENRPRQKICYERGKKAITHYEVLAHLPNNTTRVKLTP
FT                   ITGRSHQLRVHSLALGHPILGDKFYASPLAKSLSPRLCLHAESLSITHPITGEAMTFTA
FT                   QTEF"
FT   gene            complement(362928..363476)
FT                   /gene="ampD"
FT                   /locus_tag="APP7_0321"
FT   CDS_pept        complement(362928..363476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ampD"
FT                   /locus_tag="APP7_0321"
FT                   /product="signalling protein AmpD"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60973"
FT                   /db_xref="GOA:B3H0G1"
FT                   /db_xref="InterPro:IPR002502"
FT                   /db_xref="InterPro:IPR036505"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0G1"
FT                   /protein_id="ACE60973.1"
FT                   /translation="MDLTIQNGILIHQKQVPSPHFNARPIANDISLLVIHYISLPPEQF
FT                   GGNFIDQFFQGNLDPTVHPYFEEIKDLRVSAHCLINRKGEITQYVNFNDMAWHAGLSEF
FT                   NGRDKCNEYSIGIELEGSNHQPFTEAQYQSLAHLTQALMTEYPEITLQRIAGHCDIAPE
FT                   RKIDPGQYFDWGYYKTLIA"
FT   gene            363597..364439
FT                   /gene="yhiR"
FT                   /locus_tag="APP7_0322"
FT   CDS_pept        363597..364439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yhiR"
FT                   /locus_tag="APP7_0322"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60974"
FT                   /db_xref="GOA:B3H0G2"
FT                   /db_xref="InterPro:IPR007473"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0G2"
FT                   /protein_id="ACE60974.1"
FT                   /translation="MLSYRHSFHAGNHADVVKHIVQLLILQSLKQKDKGFLYLDTHSGV
FT                   GRYSLLSAESEKTGEYLEGVARLWERTDLSEEVALYINELKKINKGEKLRYYAGSPLLA
FT                   VNQLRPQDRAILTELHPNDFPLLRQEFAKKDNVVTKRENGFQQLKSALPPKERRGFVLI
FT                   DPPYELKEDYELVVKAIEEGYKRFATGIYAIWYPVVLRQHTKRIVRGLADSGIRKILQI
FT                   ELAVRPDSDQRGMTASGMIVINPPWQLESQMKKVLPYLAEVLVPEGTASWTVSWITPE"
FT   gene            364525..365166
FT                   /gene="pryE"
FT                   /locus_tag="APP7_0323"
FT   CDS_pept        364525..365166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pryE"
FT                   /locus_tag="APP7_0323"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.10"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60975"
FT                   /db_xref="GOA:B3H0G3"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3H0G3"
FT                   /protein_id="ACE60975.1"
FT                   /translation="MEQYKHDFIEFALSRNVLKFGEFTLKSGRKSPYFFNAGLFNTGRD
FT                   LAKLGEFYAQAIQASGLNFDVLFGPAYKGIPIATTVAVALVNQFDVDKPCCFNRKEAKD
FT                   HGEGGNLIGSPLKGRILLVDDVITAGTAIRESMEIINANQAELAGVLIALNRKEKGKGE
FT                   LSAIQEVERDYGCQVFSIIDFDDLIQFIEKSEQYAPYLASMRAYREQYGV"
FT   gene            365305..366393
FT                   /locus_tag="APP7_0324"
FT   CDS_pept        365305..366393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0324"
FT                   /product="protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60976"
FT                   /db_xref="GOA:B3H0G4"
FT                   /db_xref="InterPro:IPR002629"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0G4"
FT                   /protein_id="ACE60976.1"
FT                   /translation="MAAKNLPFHADTVGSYLRTDAWKKAHADYKAGTISLEARDAIVEE
FT                   EVKKLVQAQLDAGIQVVTDGEFHRSWWHIDFLENLNGIEGYVPEKAYAFKGVAVRPYNT
FT                   RCCGKVSWNPNHPFLEHFKKFNAIVAGRAVAKFTIPSPNQLMYPVQWDHGIYATREEFA
FT                   KDVQQAYKDAIKAFYDAGCRYLQIDDVYWGSLCNNYQQPTFEADKAQAVANIQAILADK
FT                   PADLTITTHVCRGNYKSSYLLEGAYDPIADGLFGQTNYDGYFLEYDDERSGGFEPLKHF
FT                   ANNKGRVVLGLISSKFPELEDKEAIKARIAEAAKYVPLEQLCLSPQCGFASTEEGNVMT
FT                   EEQQWAKVRHVEEIAKEVWGED"
FT   gene            complement(366470..367660)
FT                   /gene="metC"
FT                   /locus_tag="APP7_0325"
FT   CDS_pept        complement(366470..367660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metC"
FT                   /locus_tag="APP7_0325"
FT                   /product="cystathionine beta-lyase"
FT                   /EC_number="4.4.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60977"
FT                   /db_xref="GOA:B3H0G5"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006233"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0G5"
FT                   /protein_id="ACE60977.1"
FT                   /translation="MSNLSQLETKLVHAGRKSRYTQGSVNPVVQRASSLVFESVSQKKH
FT                   ATRNRYKGELFYGRRGTLTHFALQDAMCELESGAGCYLYPCGAAAVTNSILAFVSQGDH
FT                   VLMTGAAYEPTQDFCNVILKNIGVSTTYYDPLIGEGIRALIRPNTKVLFLESPSSLTME
FT                   VPDIPTLVRIAREVNPNMVIMIDNTWAGGVLFPALEFGIDISIQAGTKYLVGHSDVMIG
FT                   TAVSNARCWDQLREHSYLMGQMVDADSAYTTARGLRTLGIRLKEHQERSIQVAQWLAQR
FT                   PEVKAVFHPALPSCPGHEFFKRDFKGASGLFSFELNQKLNDEQLANFLDHFELFTMAYS
FT                   WGGFESLILANQPEEIARIRPAIERKLSGTLIRIHVGLEAVEDLIADLEKSFSRLK"
FT   gene            complement(367737..368276)
FT                   /gene="dsbB"
FT                   /locus_tag="APP7_0326"
FT   CDS_pept        complement(367737..368276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dsbB"
FT                   /locus_tag="APP7_0326"
FT                   /product="disulfide bond formation protein B"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60978"
FT                   /db_xref="GOA:B3H0G6"
FT                   /db_xref="InterPro:IPR003752"
FT                   /db_xref="InterPro:IPR022920"
FT                   /db_xref="InterPro:IPR023380"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0G6"
FT                   /protein_id="ACE60978.1"
FT                   /translation="MLSYFKELSLNRTAWLLLAFVAFALEASAIYFQYGMGLVPCVMCV
FT                   YERLAIFGLLIAGLVGAISPRFFLTRWLALLLWGFSAFKGLALAIKHHDYQANPSPWNQ
FT                   CEFKPEFPQTMPFDQWFPSIFAPGPVNCSEKQWEMFGLGMPEWLILAFSIFALMFVIVL
FT                   LSQFKRAKPQYRSVFR"
FT   gene            complement(368373..369914)
FT                   /gene="nhaB"
FT                   /locus_tag="APP7_0327"
FT   CDS_pept        complement(368373..369914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nhaB"
FT                   /locus_tag="APP7_0327"
FT                   /product="Na(+)/H(+) antiporter 2"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60979"
FT                   /db_xref="GOA:B3H0G7"
FT                   /db_xref="InterPro:IPR004671"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3H0G7"
FT                   /protein_id="ACE60979.1"
FT                   /translation="MDSSNAIFKSFLGKAPEWYKICIIAFLVINPLIYFFISPFVAGWA
FT                   LVAEFIFTLSMALKCYPLQPGGLLAIEAVFIGMTSAHHVKEEIMANFEVILLLMFMVAG
FT                   IYFMKQLLLYVFTKLLIVIHSKKILSLAFCLSATFLSAFLDALTVIAVIISVGTGFYGV
FT                   YHKVASGNSFEDSTDISNDEKIITNKEILEQFRAFLRSLLMHAAVGSALGGVMTMVGEP
FT                   QNLIIAGQAEWGFVEFLLRVLPVSLPVLICGVITCLLLEHFKIFGYGARLPRRVWGVLA
FT                   RYNLLKEQRMTQQDRVKMGIQALAGIWLVVGLALHLADVGIIGLTIIIICTAFCGITDE
FT                   HAIGRSFQEPMPFTALIVVFFTVVAVIVDLKLFEPIISYVLSADPHSQLALFYVFNGLL
FT                   SMISDNVFVGTVYINEAKTALESAIISREQFDLIAVAINTGTNLPSVATPNGQAAFLFL
FT                   LTSPFAPLIRLSYGKMLYMALPYTIVLSIIGFLSLEFLLPPLTELMSNWGWIITR"
FT   gene            370078..370806
FT                   /gene="fadR"
FT                   /locus_tag="APP7_0328"
FT   CDS_pept        370078..370806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadR"
FT                   /locus_tag="APP7_0328"
FT                   /product="fatty acid metabolism regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60980"
FT                   /db_xref="GOA:B3H0G8"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR014178"
FT                   /db_xref="InterPro:IPR028374"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0G8"
FT                   /protein_id="ACE60980.1"
FT                   /translation="MDNSYILKAQSPAALAEEYIVRSIWNNKFPAGTDLPAERELADKI
FT                   GVTRTTLREVLQRLARDGWLHIQHGKPTRVNDVWETAGPNIISTIIKLDRSYLPVIIAN
FT                   VVSLRTRMAESYIPEAVKLNAEACIAFFNQLDELEDTADAFATFDYKLFRQFTFTANKP
FT                   VYALILNSFKGMYHQVASIFFADPVCRQLTLKFYRDLLNACVEKDHEKVSLIMAQNRQS
FT                   SSEIWGKLLQSIPENFGELK"
FT   gene            370815..371885
FT                   /gene="phoH"
FT                   /locus_tag="APP7_0329"
FT   CDS_pept        370815..371885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoH"
FT                   /locus_tag="APP7_0329"
FT                   /product="PhoH-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60981"
FT                   /db_xref="GOA:B3H0G9"
FT                   /db_xref="InterPro:IPR003714"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0G9"
FT                   /protein_id="ACE60981.1"
FT                   /translation="MNEILFTLEPQDNARLQSLCGAFDEHLTLIEKSFNLVIARNGFSF
FT                   SIQSAEDSHYSATLIQNAAKLLKRLYTDTAPIKGKIKELDLEDIHLAIQESRMLLQNQW
FT                   VSGSQGEISIKTKRGVIKPRGEHQQAYLRNILSHDISFGIGPAGTGKTFLAVAAAVESL
FT                   ERQEIRRILLTRPAVEAGEKLGFLPGDLGQKIEPYLRPLYDALFEMLGFEKVQKLMERN
FT                   VIEIAPLAYMRGRTLNDAFIILDESQNTTTEQMKMFLTRIGFNSKAVITGDITQVDLPR
FT                   SQKSGLKHAMEVLKDVPDLSFNYFDSHDIVRHPVVAKIVQAYDVWEAEDEQRREQRRLE
FT                   KLALEQQKILEQAEQL"
FT   gene            complement(371924..372901)
FT                   /locus_tag="APP7_0330"
FT   CDS_pept        complement(371924..372901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60982"
FT                   /db_xref="GOA:B3H0H0"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0H0"
FT                   /protein_id="ACE60982.1"
FT                   /translation="MFFESLQFSIGVMLPTILLMLLGIFLRRRKFVDDDFCNTASKVMF
FT                   NFALPTMLFLNVVKSPLDYSKDLNLIFAGLSGTLIIYLIAEWWAAKYIRERGYRCIFTQ
FT                   GVFRTNAAILGLALTINAYGEAGLATVSIYTASLVILFNVLSVITILNSLSDQKPSAAR
FT                   LAAAVAKNPLIQAIVLGIVVNYLQIRIPKSLMQTAQSLANITLPMALICIGATLDFKAL
FT                   SQFRQQTAESELTRVVLYASFSRLILAPLFLFILGKWVFALNPMQLGILFLTATAPVAA
FT                   ATYAMVRAYGGNGKGAANLIGITTIGSIFTASLGLFVLHHLGWI"
FT   gene            complement(372971..374014)
FT                   /gene="prfB"
FT                   /locus_tag="APP7_0331"
FT   CDS_pept        complement(372971..374014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prfB"
FT                   /locus_tag="APP7_0331"
FT                   /product="peptide chain release factor 2"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60983"
FT                   /db_xref="GOA:B3H0H1"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004374"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0H1"
FT                   /protein_id="ACE60983.1"
FT                   /translation="MYFGGIFDFDAKVERLEEVNAELEQPEIWNTPEKAQALGKERSAL
FT                   EMVVNTIRTLDQGVEDVEGLIELAVEAEDEDTFNEAQAEANELEEKLAKLEFQRMFSGQ
FT                   HDAADCYVDLQAGSGGTEAQDWTEMLLRMYLRWAESKGFKTELIEVSDGDVAGLKSATV
FT                   KITGEYAFGWLRTETGIHRLVRKSPFDSNNRRHTSFAAAFVYPEIDDDIDIEINPADLR
FT                   IDVYRASGAGGQHVNKTESAVRITHIPSGIVVQCQNGRSQHQNKDQCMKQLKAKLYEME
FT                   MMKKNAEKQAMEESKSDIGWGSQIRSYVLDDSRIKDLRTGVENRNTQAVLDGDLDKFIE
FT                   ASLKAGL"
FT   gene            374282..375253
FT                   /gene="selD"
FT                   /locus_tag="APP7_0332"
FT   CDS_pept        374282..375253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="selD"
FT                   /locus_tag="APP7_0332"
FT                   /product="selenide, water dikinase"
FT                   /EC_number="2.7.9.3"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60984"
FT                   /db_xref="GOA:B3H0H2"
FT                   /db_xref="InterPro:IPR004536"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR023061"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0H2"
FT                   /protein_id="ACE60984.1"
FT                   /translation="MLGTILQSQLDKFIEPNLLVGNETADDAAVYDIGNGIGIISTTDF
FT                   FMPIVDDPFDFGRIAAANALSDVFAMGGKPIMAIAILGFPVNKLPVEVAQKIVEGGRFA
FT                   CQQAGIALAGGHSIDSPEPIFGLAVTGTVSTEQVKKNASAQAGCELFLTKPLGIGVLTT
FT                   AEKKGLLKVEHQNLARDVMCQINLIGAQFSQLADVTAMTDVTGFGLLGHLSEICQGSNV
FT                   RAEVNFAEIHTLDGVKDYIAQGAVPGGTNRNFDSYGHLISAMTDEQKAILCDPQTSGGL
FT                   LIAVCSQAVDNVKQIAKQANVPLFRVGRLLEADTMKPLIEVI"
FT   gene            375258..375713
FT                   /gene="mutT"
FT                   /locus_tag="APP7_0333"
FT   CDS_pept        375258..375713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutT"
FT                   /locus_tag="APP7_0333"
FT                   /product="putative NTP pyrophosphohydrolase (MutT/Nudix
FT                   family)"
FT                   /EC_number="3.6.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60985"
FT                   /db_xref="GOA:B3H0H3"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR033713"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0H3"
FT                   /protein_id="ACE60985.1"
FT                   /translation="MHKPNITLACVVHCKGKFLFVEEIEYGKRTLNQPAGHLEANETLL
FT                   EGASRELFEETGIRAKVQRLIKIYQWHAPRSQTDYLRFVFAVELDDFVPIAPQDSDITQ
FT                   GFWLSLEEFKHFIRQDGQCERNPLVTQSLEDYLSGESYPLDVLRVFE"
FT   gene            375723..376922
FT                   /locus_tag="APP7_0334"
FT   CDS_pept        375723..376922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0334"
FT                   /product="2-octaprenyl-6-methoxyphenol hydroxylase"
FT                   /EC_number="1.14.13.-"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60986"
FT                   /db_xref="GOA:B3H0H4"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR010971"
FT                   /db_xref="InterPro:IPR011295"
FT                   /db_xref="InterPro:IPR018168"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0H4"
FT                   /protein_id="ACE60986.1"
FT                   /translation="MAEQFDVVIVGGAVTGSVLALALSSLSQHKMRIAIVEKQLPDYAQ
FT                   QGGFDARSIALAQGSLQKFAQIRPLAGSSLAEQIQQIATPIQQIQVSDLGHFGKTTLKA
FT                   SELNLAQLGVVVELAKLGKNLTACIEQQPNIHWFCPNQIVHFERLQTEVLLRLQNGERL
FT                   RTQLMVAADGIQSQIALQCGVETELLKDYQQSALIANVEISEPHQGQAFERFTTQGPLA
FT                   LLPLSDNRMSLVWCVKQAEDLQSLTDEDFLSQLQLQFGWTLGKFERVSKRFVYPLTSQK
FT                   AQSHIHHRLAIVGNAAQLLHPVAGQGFNLGMRDLFTLAQLLAKAFAQGKDLGAFALLNQ
FT                   FEQARKQDQAQIISLTSGLISLFSCDFLPLQAVRNLGLFAISHSKLLRENIANKALGWQ
FT                   "
FT   gene            complement(376952..377428)
FT                   /locus_tag="APP7_0335"
FT   CDS_pept        complement(376952..377428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0335"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60987"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0H5"
FT                   /protein_id="ACE60987.1"
FT                   /translation="MFKIIKITLSFPIVLGLIGCSNIRENHSPQADFQRFYHWDEVYGN
FT                   DYIQATLLTMHSLEVAKNTPSRIDAIQNYLEEVDTIQASLDYLDIQNDEILPIKNIGLR
FT                   ALQLSQETFRDMIKLESQPNEALAQSVQDKGKIITQLGNEISHEKLKLMKKYQL"
FT   gene            complement(377485..378150)
FT                   /gene="hlp"
FT                   /locus_tag="APP7_0336"
FT   CDS_pept        complement(377485..378150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hlp"
FT                   /locus_tag="APP7_0336"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60988"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0H6"
FT                   /protein_id="ACE60988.1"
FT                   /translation="MTKFTKISATALFALFLTACDKPANKPATEQAAATPAPAAQAQTE
FT                   AAKPAEPVVDTGAEDYKKFQEWQQVQEKSIGNAINTEIEKLGEKSKDPAVVQDTMNKAI
FT                   LAQIENIQKSAATLDIKDAQVNALKDKALEAMALGAKMITENDKLAKNPTPDAHKAFGE
FT                   LQAQLDKIAAEGQKIEAELATKYGPAPAPAPAPAPAPAPAPAPAPAPAPAPAPAPAQK"
FT   gene            complement(378231..378710)
FT                   /gene="hlpB"
FT                   /locus_tag="APP7_0337"
FT   CDS_pept        complement(378231..378710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hlpB"
FT                   /locus_tag="APP7_0337"
FT                   /product="lipoprotein HlpB"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60989"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0H7"
FT                   /protein_id="ACE60989.1"
FT                   /translation="MKKLATIGAVALLAFSVTACNKADPAADYKKFQEWYQVQEQTQAT
FT                   AQAELQKQLTEVMSQAQKDPKALEAVLNTFAGKVQETLKSLDAVDVKSAEIKALKDKTK
FT                   AVLGLSNEVISEQVKVMAAPTAEAQQAIQAKATQLNQAAQELQKLQADLKAKFEK"
FT   gene            complement(378846..380027)
FT                   /gene="visC"
FT                   /locus_tag="APP7_0338"
FT   CDS_pept        complement(378846..380027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="visC"
FT                   /locus_tag="APP7_0338"
FT                   /product="putative monooxygenase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60990"
FT                   /db_xref="GOA:B3H0H8"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR010971"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0H8"
FT                   /protein_id="ACE60990.1"
FT                   /translation="MKSADIVIIGGGMVGLAFAALLKNTESQIKIIEKQVPQTTKTFSN
FT                   RVSAINATSEKMLEQVGALQLIQTERLSPYQKMSVWEQDSFAHIEFDNSDPSIRQLSLS
FT                   QLGFIIENNQIQSALWQQVSRQDNVEIILSEPKTVGINENGAFLTLANNEMISAKLVVG
FT                   ADGANSWLRRQMHIPLVSKDYEQTALVCNVKTVEPHHNIARQIFSPKSILAFLPLADEN
FT                   LCSIVWSLPPEKAQQLQHCEVQQFNRELTIAFDNRLGLIELQSERAIYPLTARYARDFA
FT                   QPRFALIGDAAHTIHPLAGLGVNLGFADAITLAQEIKQHLTLGHDIGEYRHLRRFERIR
FT                   KTEAIKLLAAMEGLKQLFQGSHPVKKLIRGVGLSATNQLPVLKKLLIAQAVGI"
FT   gene            complement(380110..380976)
FT                   /locus_tag="APP7_0339"
FT   CDS_pept        complement(380110..380976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0339"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60991"
FT                   /db_xref="GOA:B3H0H9"
FT                   /db_xref="InterPro:IPR005337"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3H0H9"
FT                   /protein_id="ACE60991.1"
FT                   /translation="MELIIISGRSGSGKSVALRALEDVGYYCVDNLPLPLIPELAGFLS
FT                   NSGRSAVVSLDIRNIPENPESIEALLEQLSKLTIQTKIIFLDCERNTLIRRYSDTRRLH
FT                   PLSNKDLSLESAIDLENTLLEPLYQQANYIIDTTNISSHELAENLRGILRGSTDKALKI
FT                   VFESFGFKYGLPADADYVFDVRFLPNPHWNPELRPMTGLEQPVIDFLERQTEVHNFIYQ
FT                   TRNYLEMWLPMLEKNNRSYLTIAIGCTGGKHRSVFIAEQLAKYFQSRDKDVQIRHRSLE
FT                   KHHKKIS"
FT   gene            complement(380995..381507)
FT                   /gene="ptsN"
FT                   /locus_tag="APP7_0340"
FT   CDS_pept        complement(380995..381507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptsN"
FT                   /locus_tag="APP7_0340"
FT                   /product="PTS system, nitrogen regulatory IIA-like protein"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60992"
FT                   /db_xref="GOA:B3H0I0"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0I0"
FT                   /protein_id="ACE60992.1"
FT                   /translation="MKLTEFLTPENIRQGVLVSSKKRVLELAGKIIAEAANKSTACADD
FT                   EGLCPIECFGNLFKREKLGSTGINGIALPHAKFPDSIALAVDKPIAAFIQLEKPIDYEA
FT                   HDNKEVDLVYAIMIPSSCCEQYKNGLQEIAQRLNDKTLTKQLRSANNAEEIWQLLVYAD
FT                   NQILEQE"
FT   gene            complement(381557..382282)
FT                   /gene="yhgB"
FT                   /locus_tag="APP7_0341"
FT   CDS_pept        complement(381557..382282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yhgB"
FT                   /locus_tag="APP7_0341"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60993"
FT                   /db_xref="GOA:B3H0I1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030921"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0I1"
FT                   /protein_id="ACE60993.1"
FT                   /translation="MPTLYAEHLAKSYKNRQVVKDVSLNVKAGEIVGLLGPNGAGKTTT
FT                   FYMVVGLVRHDQGQIRIDDQDISLLPMHDRAKQGIGYLPQEASIFRRLTVYDNLMAVLQ
FT                   VRKDLTTQQRKARADELINEFHIEHIRNSLGQSLSGGERRRVEIARALAANPQFILLDE
FT                   PFAGVDPISVIDIKKIIVNLKERGLGVLITDHNVRETLDVCERAYIVGSGQMIASGTPE
FT                   EVLNNADVKRVYLGDQFKL"
FT   gene            complement(382292..382795)
FT                   /locus_tag="APP7_0342"
FT   CDS_pept        complement(382292..382795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0342"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60994"
FT                   /db_xref="GOA:B3H0I2"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="InterPro:IPR014340"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0I2"
FT                   /protein_id="ACE60994.1"
FT                   /translation="MKFAIKSMVFTALLSTSLSSYALKGDTDQPINIDSGSQSLDMNSN
FT                   VVTFSDNVVITQGSIKVTADKVTIIRQEGKKETLEASGSPVTFQQTLDNGKPVNGKGNS
FT                   VHYDLNSEFLTLVGNAELKQQGSFIKASKITYDVKKQQLKANSGNKSRVKTILIPNELN
FT                   DKKK"
FT   gene            complement(382820..383416)
FT                   /locus_tag="APP7_0343"
FT   CDS_pept        complement(382820..383416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0343"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60995"
FT                   /db_xref="GOA:B3H0I3"
FT                   /db_xref="InterPro:IPR010664"
FT                   /db_xref="InterPro:IPR026265"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0I3"
FT                   /protein_id="ACE60995.1"
FT                   /translation="MNIRLNIILLIIVAALAGWYVSQQKPENDGLDQLIKKEGNPDYTG
FT                   NRITTSVYDLKGKPQYFAEAKEIKRYQNTELTEFIQPLVELFDAETALKQWKVSADYAE
FT                   ITKEKILNLDGNVKLQALDKNARLQKIETDKLRIDLNTQDISTESVVKSVGLGISTTGT
FT                   GLKGNLKRQVATITKDVKTYLEPTIIKQSNDEQKN"
FT   gene            complement(383576..386215)
FT                   /gene="pepC"
FT                   /locus_tag="APP7_0344"
FT   CDS_pept        complement(383576..386215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepC"
FT                   /locus_tag="APP7_0344"
FT                   /product="phosphoenolpyruvate carboxylase"
FT                   /EC_number="4.1.1.31"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60996"
FT                   /db_xref="GOA:B3H0I4"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018129"
FT                   /db_xref="InterPro:IPR021135"
FT                   /db_xref="InterPro:IPR022805"
FT                   /db_xref="InterPro:IPR033129"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0I4"
FT                   /protein_id="ACE60996.1"
FT                   /translation="MNQPYSAMRNNIHMLGDFLGETIREAQGNEILELIESIRVLSRDS
FT                   RAGDEKAREQLLDKLANISTENVLPVARAFSQFLNLTNIAEQYQTISRHHQDESLGNRS
FT                   LSALFARLKAQGTPVETVIKTVEKLLIELVLTAHPTEVTRRSLVHKHVEINKCLGQLEH
FT                   DDLTEAEQTKLKRRLMQLIALAWHTNEIRAARPTPVDEAKWGMAIIENSLWKAVPDFCR
FT                   ELNFQLEKHFDVQYEVALSPVRFSSWMGGDRDGNPFVTAEITQKVLRMNRWKAAELFLN
FT                   DVSDLVEELSIVQCTPEFREKYGDHIEPYRVVVKGLRSKLQKTLTYFGELIEAKPTTVD
FT                   PSEIITCDNDLWEPLYDCYQSLHACGMRIIANGSLLDCLRRIRCFGLGLSRLDIRQESS
FT                   RHETAIAEITRYIGLGDYAQWTEDDKQAFLVRELSSRRPLVPTNWTPSPETQEILDTCK
FT                   VVAQQPEGTISAYVISMAREASDVLAVHLLLKEAGCNYTLPVAPLFETLDDLDHSEKVM
FT                   TDLFNIGWYRGVINNYQMVMIGYSDSAKDAGMLAASWAQYRAQEALVNLAEKYHIELVL
FT                   FHGRGGTVGRGGAPAHAALLSQPPRSLKSGLRVTEQGEMIRFKLGLPAVAVETLNLYAS
FT                   AILEANLLPPPEPKQKWRDIMDKGAAISCEIYRGVVRGEPDFVPYFRSATPEQELGKLP
FT                   LGSRPSKRNPNGGVESLRAIPWIFAWMQNRLMLPAWLGAGAALRQMIEQGEESTLKEMC
FT                   NEWPFFSTRIGMLEMVFSKADLWLAEHYDQRLVAKELHRLGKTLRAQLSADIQTVLTLA
FT                   HDGQLMADLPWIAESIALRNVYTDPLNLLQVELLQRLRSQGEVRDPQLEQALMITITGI
FT                   AAGMRNTG"
FT   gene            complement(386430..387269)
FT                   /locus_tag="APP7_0345"
FT   CDS_pept        complement(386430..387269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0345"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60997"
FT                   /db_xref="GOA:B3H0I5"
FT                   /db_xref="InterPro:IPR007621"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0I5"
FT                   /protein_id="ACE60997.1"
FT                   /translation="MIKAFFKPIWFILLAFFTLKAAAADNYPAAPNPFYYVTDYTKTLT
FT                   QQEWRTLEDALIANRAKTSSQIIVVIVPSTNGEDVASYSHNLFNKWGIGRTKNNENNGI
FT                   LLLIAKNDRKLFIATGRGLEGALPDAIASTIIRHNITPYFKQNLYAEGIASGLSAIMAA
FT                   INGEYAAYDSYGENSGEESLDQIDGLLFFLVAGIVIFLIFRPGRNDQYISPSAADQLGR
FT                   IIINSSRRRGGFGGGFGGGFGGGSSGGFGGGFGGGSRGSGDSFGGGSSGGGGAGGSW"
FT   gene            complement(387266..387715)
FT                   /locus_tag="APP7_0346"
FT   CDS_pept        complement(387266..387715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0346"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60998"
FT                   /db_xref="InterPro:IPR007621"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0I6"
FT                   /protein_id="ACE60998.1"
FT                   /translation="MKLFSFLSNKLPVDTQRIEQAISHLEQQTSAELRVVVERKAKGKA
FT                   DAITRANQLFDELKMRETEERNGVLIYLSFKPHNLAIVGDKAIHEKVGQVFWQSVYDAM
FT                   KQQCRQADYTQAICEGIKQVEVQLATYFPRRDNDTNELSNEVVIK"
FT   gene            complement(387782..388366)
FT                   /locus_tag="APP7_0347"
FT   CDS_pept        complement(387782..388366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0347"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ACE60999"
FT                   /db_xref="InterPro:IPR007156"
FT                   /db_xref="InterPro:IPR023353"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0I7"
FT                   /protein_id="ACE60999.1"
FT                   /translation="MKKIFWILVIAVVAIGGFSLTKYNDLMRAEEDINSVWGNVESAYQ
FT                   RRADLIPNLVNTVKGQANFEKETLTSVIEARAKATAVTIDLNNATEEQMAKFQEAQQGV
FT                   NSALSRLLVSVEKYPELKAHEGFLNLQAQLEGTENRINVERNNFNAAVKEYNKQVREFP
FT                   TKIAAMIMGFKAKPQFKAEAGSEKAPTVNFN"
FT   gene            complement(388519..390180)
FT                   /gene="fruA"
FT                   /locus_tag="APP7_0348"
FT   CDS_pept        complement(388519..390180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fruA"
FT                   /locus_tag="APP7_0348"
FT                   /product="PTS system fructose-specific EIIBC component"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61000"
FT                   /db_xref="GOA:B3H0I8"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR003353"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR006327"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013014"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0I8"
FT                   /protein_id="ACE61000.1"
FT                   /translation="MNISFVFPQSLGKARAFLVNEVLSAAAKQQGHQVVNAEQADFVVL
FT                   FNDEIPTIAAGKQGAVVNLDQAFSQPEATLKQAVENAKTFANATVSSASNSGMKNIVAV
FT                   TACPTGVAHTFMSAEAIENYAKAQGWNVKVETRGQVGAGNPISAEEIAAADLVFVAADI
FT                   DVDLDKFKGKPMYRTSTGLALKKTAQEFEKAFAQATVYQGGATAAQQAEGSASGEKKGL
FT                   YKHLMTGVSHMLPLVVAGGLLIAISFMFGIEAFKDETIAGGLPKALMDIGGGAAFHLMI
FT                   AVFAGYVAFSIADRPGLAVGLIGGMLATTAGAGILGGIVAGFLAGYTVKFLNGVIQLPA
FT                   SLTSLKPILILPLLGSAIVGLAMIYLINPPVKGIMDALVEGLNSMGQTNAIILGAILGA
FT                   MMCVDMGGPVNKAAYTFGVGLIASQQYTPMAAVMAAGMVPPIGMAIATLIARNKFTTNQ
FT                   RDAGKASFVLGLCFISEGALPFVAADPVRVIATSIIGGATAGAISMAFGITLQAPHGGL
FT                   FVIPFVSQPLMYLAAIAIGSVVTGVIYATIKQKASE"
FT   gene            complement(390262..391209)
FT                   /gene="fruK"
FT                   /locus_tag="APP7_0349"
FT   CDS_pept        complement(390262..391209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fruK"
FT                   /locus_tag="APP7_0349"
FT                   /product="1-phosphofructokinase"
FT                   /EC_number="2.7.1.56"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61001"
FT                   /db_xref="GOA:B3H0I9"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR017583"
FT                   /db_xref="InterPro:IPR022463"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0I9"
FT                   /protein_id="ACE61001.1"
FT                   /translation="MTQQLRIATVTLNPAFDLVGRLQRIEVGEVNTVETLGLYPAGKGI
FT                   NVAKVLADLGVKLAVSGFLGAENQGDFVQSFKQNGMDDQFYRIDGKTRINVKITETEAD
FT                   VTDLNFLGFEISAEDWTNFTAQSQQWAKAFDLVAVCGSLPRGVTAQQFAQWLESLHQQG
FT                   LKVVLDSSNAALTEGLKAHPWLVKPNRRELEVWANRPLNSLEEVIAAAQELSAGGIENV
FT                   IISMGADGSVWLNSEGVVQAQPPRCQNVVSTVGAGDSMVAGLIYGLAQGWDKAKTLAFA
FT                   SGTSALAVSQSNVGISDRNALDEIVAQVKLTQLS"
FT   gene            complement(391224..392732)
FT                   /gene="fruB"
FT                   /locus_tag="APP7_0350"
FT   CDS_pept        complement(391224..392732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fruB"
FT                   /locus_tag="APP7_0350"
FT                   /product="multiphosphoryl transfer protein"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61002"
FT                   /db_xref="GOA:B3H0J0"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR002114"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR016258"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0J0"
FT                   /protein_id="ACE61002.1"
FT                   /translation="MLNLSAKNICLNSSVNNKDEAIKLVAAGLTANGNVAEGYEAGMLA
FT                   RETQTSTFLGNGIAIPHGTLDTRHLVQNTGVQIYQFPQGVEWGEGNKAYVVIGIAAKSD
FT                   EHLTLLRQLTGVLSDEAAAELLATTQDTDEFISVLSGKKSLPSLTDTLISLNIDSPSLI
FT                   TLSAINAAKLQESGYVNQTFVSEVISNQPLNLGNEIYLADSAKGNQSNGVAVARNMSGQ
FT                   TVITVAATDEHLQSHLAYLLNGDIRSQFSTASAEQIIALFNGESIVNSAQNTTACVNLA
FT                   TGQVIGTFTVRNDNGLHARPSAVLVQTLKPFAAKVTVENLDRGTAPANAKSTMKVVALG
FT                   ASQAHRLRFVAEGEDAQQAIEALAKAFVEGLGESVSFVPAVEDTIEGTVQPQAVESTQN
FT                   PANPTASEPAVEGQVEGTFVIQNEHGLHARPSAVLVNEVKKYNATIVVQNLDRNTQLVS
FT                   AKSLMKIVALGVVKGHRLHFVATGDDAQKAIDGIGEAIAAGLGE"
FT   gene            392993..395326
FT                   /gene="glgB"
FT                   /locus_tag="APP7_0351"
FT   CDS_pept        392993..395326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glgB"
FT                   /locus_tag="APP7_0351"
FT                   /product="1,4-alpha-glucan branching enzyme"
FT                   /EC_number="2.4.1.18"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61003"
FT                   /db_xref="GOA:B3H0J1"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006048"
FT                   /db_xref="InterPro:IPR006407"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR037439"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3H0J1"
FT                   /protein_id="ACE61003.1"
FT                   /translation="MKTYTYSKQDLSFIEQLSQAYCKDPFSYLGLHQAGDVSVIRVFLP
FT                   EATTVKILSADGQILSEALKIDDSGLFVAQLSQQYSSLNYRLRVGYSLAEIDLEDPYRF
FT                   TSSLLPMDNWLLAEGTHLRPYEILGAHLKTQEGVSGVHFSVWAPNARRVSVVGDFNYWD
FT                   GRVNPMRFHAESGIWDIFLPNVEKGALYKFEILDSNGNIRLKSDPYAFASQFRPDTASV
FT                   VTGLPEKIEVDAKLRHANDPDQPISIYEVHLGSWRRHLENNYWLNYEEIANELIPYVKD
FT                   MGFTHIELLPITEYPFDGSWGYQPTGLYSPTSRFGSPDDLRTLIRKAHEAGINVILDWV
FT                   VGHFPTDSHGLTEFDGSHLYEHQDPREGYHQDWNTLIFNYGRHEVFNYLSSNALYWTER
FT                   FGIDGLRVDAVSSMIYRDYSRKDGEWIPNQYGGRENLEALDFLRRTNRMLKKEGHGAVV
FT                   IAEESTSFAGITHSPTENGVGFDYKWNMGWMNDTLRYMSLDPIYRQYHHDWMTFGMMYQ
FT                   YSEKFVLPLSHDEVVHGKCSILGKMSGDCWQKFANLRAYYGYMWGYPGKKLLFMGNEFA
FT                   QGREWNYNESLDWFLLGEQGGGWHKGVLNWVRDLNRTYQKYPALYQLDYDPAGFEWLVV
FT                   DDWQQSVFAFERKAKNGESVIVVSNFTPVVRHNYRIGVRQDGTYTEILNSDAAYYEGSN
FT                   VGNYGEIECEAIESHGKPFSIELSIPPLSTIFIACQPKPKEAVEAEQDIVKMAEVAMQK
FT                   ALKPTKKTVSVKAKAHKKAHKNKK"
FT   gene            395333..397318
FT                   /gene="glgX"
FT                   /locus_tag="APP7_0352"
FT   CDS_pept        395333..397318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glgX"
FT                   /locus_tag="APP7_0352"
FT                   /product="glycogen operon protein GlgX"
FT                   /EC_number="3.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61004"
FT                   /db_xref="GOA:B3H0J2"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR011837"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR040784"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0J2"
FT                   /protein_id="ACE61004.1"
FT                   /translation="MKVTAGSPFPLGAQAVENGTNFAIFSENATAIELCLFKQSQEQRF
FT                   AMRRTGDVWHLFVENIGEGIEYGFRVAGITDKQKGALFNPQKLLLDPYAKRIVGTVSAH
FT                   TADEIKYFQWDDKRDNAHLAPKSVVVAPDNFDWEDDERPHYPWRETIIYELHVKGFSRL
FT                   NQQIPEPLRGTYAGLAHPASIAYLKRLGVTTIELQPVSHHIDEVHLQKMGKTNYWGYNV
FT                   IGHSAVEPVLAWDQEDPITEFKYLVKTLHKHGFEVILDLVYNHTAEGGTDSLTLCQRGI
FT                   DNQNYYWLNQQGEYENWAGCGNALNLSHPRVCQWAIDSLVYWVSECHIDGFRFDLATTL
FT                   GRTPEFDQLSPFFEKIKQTPELEHIKLIAEPWDIGPNGYQVGRFPIQFAEWNDKYRTTM
FT                   REFFLGESGNLGEFARRLAGSDDLYWQYSPAKSINYFASHDGFTLQDLVSYNKKHNEAN
FT                   GENNRDGENTNHSNNHGVEGETDNEFVNILRDQTACSLLATLFLSNGVPMLRAGDELGH
FT                   SQKGNNNAYCQDNEIAWIDWQNANESRIEYVAKWIALRKRIALLSHQNHWWTENDVQWF
FT                   SSQGKVMEIEDWHNTESKALQILLQDHWLILINAKKTTQQFFLPTGKWHICLGKNIATL
FT                   IANTQSVALQFEQMGVCVLQRKLSSY"
FT   gene            397334..398650
FT                   /gene="glgC"
FT                   /locus_tag="APP7_0353"
FT   CDS_pept        397334..398650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glgC"
FT                   /locus_tag="APP7_0353"
FT                   /product="glucose-1-phosphate adenylyltransferase"
FT                   /EC_number="2.7.7.27"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61005"
FT                   /db_xref="GOA:B3H0J3"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005836"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR011831"
FT                   /db_xref="InterPro:IPR023049"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0J3"
FT                   /protein_id="ACE61005.1"
FT                   /translation="MLTQEKNDLNKSGLDITNDTLVLILAGGRGSRLYELTDRRAKPAV
FT                   YFGGCRRIIDFALSNCINSNLLKIGVITQYAAHSLLRHLQRGWSFLPYERNQYIDMLPA
FT                   RQQLDENTWYRGTADAVYQNMSMMKSHYRPKYVVILAGDHIYKMDYTQMLRDHVESGAK
FT                   CTVGCIEVPREQAVEFGVMAVNDKLKVKEFVEKPADPPAMPGRPDSSLASMGIYVFDAD
FT                   YLYKMLEQEAAVPGTSHDFGKDIIPKAVEEGVLYAHPFERSCKGRNATGAIYWRDVGTI
FT                   DSYWAAHMDLVSEEPQLDLYDESWPIHGRPQQTAPARFYYNKQRQRTLDNSLIAGGCVI
FT                   TDAEISNSVLFNRVHVAEETIIEHTVILPQVSIGKNCVIKRAVIDRHCVIPDGLQIGVN
FT                   PEEDAKHFRVSKGGIVLVTQGMLDKLQGITSNIKLHHTI"
FT   gene            398753..400189
FT                   /gene="glgA"
FT                   /locus_tag="APP7_0354"
FT   CDS_pept        398753..400189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glgA"
FT                   /locus_tag="APP7_0354"
FT                   /product="glycogen synthase"
FT                   /EC_number="2.4.1.21"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61006"
FT                   /db_xref="GOA:B3H0J4"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR011835"
FT                   /db_xref="InterPro:IPR013534"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3H0J4"
FT                   /protein_id="ACE61006.1"
FT                   /translation="MKILHICSEMYPLIKTGGLADVMGALPYAQQQSGNDVRVLIPLYP
FT                   QVAEKIGETNEVATIGTFAGLVTIRFTYFNGLGVYVIDAPHLFQRSGNPYHDSGYADYP
FT                   DNYKRFALLGYLGAQLSEGLDQWWGKADILHAHDWQGGLACAYLKSWNSPVKSVFTIHN
FT                   IAYPGRFHSYHLHELGLPWHFFQAEGLEFYGEISYLKAGLYFADKITTVSPTYALEITE
FT                   EIAGGGMHGLLQTRKAQGRLHGVLNGVDDTVWNPETDTNIVATYKPSYMQGKSKNKAEL
FT                   QQMFHLPEDKDAMLMVMVTRLTEQKGADFILDRIDELMEERVQLVVLGSGSPHLEYLLN
FT                   EARSRHPEQIGIYIGYNEALSHQIIAGGDVILVPSRFEPCGLTQLYGLKYGTLPLVRRT
FT                   GGLADTVVDSNKESIEQRTATGFVFNYPSSDDFLEAFRRAVNLWKKNKLWSSVRQNALA
FT                   QDFGWARAAASYQAIYQEIV"
FT   gene            400219..402723
FT                   /gene="glgP"
FT                   /locus_tag="APP7_0355"
FT   CDS_pept        400219..402723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glgP"
FT                   /locus_tag="APP7_0355"
FT                   /product="glycogen phosphorylase"
FT                   /EC_number="2.4.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61007"
FT                   /db_xref="GOA:B3H0J5"
FT                   /db_xref="InterPro:IPR000811"
FT                   /db_xref="InterPro:IPR011833"
FT                   /db_xref="InterPro:IPR035090"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0J5"
FT                   /protein_id="ACE61007.1"
FT                   /translation="MGNKALSPENIQQVKDAILYKMVFALGVEPREASKRNWLNAALRV
FT                   VRDLSTESWLQTRRSQVANGSRRVYYLSMEFLMGRTFSNAMIAEGVYELIDAALKELGQ
FT                   NLEDIINEEGDPGLGNGGLGRLAACYMDSLAAMKIPAIGYGIRYEYGMFRQEIRNGEQV
FT                   EQPDQWLENEFAWPYLRSSKRFPIRFGGRVWNEGSKVVWQPDEEIVAQAHDQLIPGFET
FT                   TATNSLRLWSAHASGKGFGLADFNRGDYFSAMSHQNLSENVSRVLYPDDSTYNGRELRL
FT                   RQEYFLCSASVQDIIRRHETECGSCVNLVDKVAIHLNDTHPTLAVPELMRILIDEKGYS
FT                   WEQAWSMTRKIFYYTNHTLMSEALETWPVEMLGRILPRHLGIIFEINEWFLNEVREKFP
FT                   GDEDLVQRVSLIDEHGDRRVRMAWVAVVASTKVNGVAKIHSDLMVESIFADFARIYPDR
FT                   FTNVTNGVTPRRWLRIANPGLANILDKRISTNWLTNLSELEKFNVFIDDADVQAEVAAV
FT                   KYENKRKLAEYVEKNLGITLNPEAIFDVQVKRIHKYKRQQLNVLHIITLYNRILKNPNA
FT                   DWTPRVFIFAGKAASAYYAAKKVIRLINDVANVINNDERIRDLIKVVFIPNYGVSLAQM
FT                   IIPAADVSEQISLAGTEASGTSNMKFALNGALTIGTLDGANVEILDCVGKDNIFIFGNT
FT                   VEQVEELRRNGYSPYHYYETDGELNEAVSQILNGKFSPDDPYRYQDLILNSGDYYQACA
FT                   DFRSYVEAQEKVAAAYRNKKAWTRSAIINIANMGYFSSDRSVLDYARDIWHIEPMDELQ
FT                   LKDNADLKSILESSNKLLGSRK"
FT   gene            complement(402835..403251)
FT                   /gene="ndk"
FT                   /locus_tag="APP7_0356"
FT   CDS_pept        complement(402835..403251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndk"
FT                   /locus_tag="APP7_0356"
FT                   /product="nucleoside diphosphate kinase"
FT                   /EC_number="2.7.4.6"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61008"
FT                   /db_xref="GOA:B3H0J6"
FT                   /db_xref="InterPro:IPR001564"
FT                   /db_xref="InterPro:IPR023005"
FT                   /db_xref="InterPro:IPR034907"
FT                   /db_xref="InterPro:IPR036850"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3H0J6"
FT                   /protein_id="ACE61008.1"
FT                   /translation="MIQQTLCLIKPDATQRNLIGKILSHLEEAGLTIKALKKVQLNQEQ
FT                   AEGFYAEHQGKEFFAPLVEFMISAPIVAVVLEGENAISHYRELMGATNPEQRKAGTIRA
FT                   LYAISGRENSVHGSDSEQSAKREIAYFFTPNEIL"
FT   gene            complement(403310..405358)
FT                   /gene="metG"
FT                   /locus_tag="APP7_0357"
FT   CDS_pept        complement(403310..405358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metG"
FT                   /locus_tag="APP7_0357"
FT                   /product="methionyl-tRNA synthetase"
FT                   /EC_number="6.1.1.10"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61009"
FT                   /db_xref="GOA:B3H0J7"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004495"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023458"
FT                   /db_xref="InterPro:IPR029038"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="InterPro:IPR041872"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3H0J7"
FT                   /protein_id="ACE61009.1"
FT                   /translation="MSRKMLVTCALPYANGAIHLGHMLEHIQADIWVRFQRMRGNEIYF
FT                   VCADDAHGTPIMLNAAKQGITPEQLIEKAKTDHVADFKGFNISFDNYHSTHSEENREIT
FT                   TEMYKKLRANGFIKSRVISQLFDPEKQMFLPDRFVKGTCPKCKAEDQYGDNCEVCASTY
FT                   SPMDLINPRSAVSGATPIVKESEHFFFDLPSFEGMLKEWTRSGSLQSEIANKMQEWFES
FT                   GLQQWDISRDAPYFGFPIPDAENKFFYVWLDAPIGYMASFKNLCDRTGLNFDEFWKKDS
FT                   ETELYHFIGKDIVYFHSLFWPAMLDGCELRKPTNVFAHGYVTVDGVKMSKSRGTFIQAS
FT                   TYLKHIDPECLRYYYAAKLNERIEDLDLSLEDFVQRVNSDIVNKLVNLASRNASFIAKR
FT                   FEGKLADKLEDEALFAEFIAQSEQIAAHYENREFNKAIRLIMDLCDKANKYVDDKAPWV
FT                   IAKQEGCDAQLQAVCSMGIELFRVLMSYLKPVLPQLAERAEAFLQTELTWDNIQQPLLG
FT                   QNVAPFKSLFSRLEKKQIDAVIEETKALFAAQNKAEDKKGKQKVENTENTAVEPIAAEI
FT                   TIDDFAKLDLRVAKVISCEAVPESNKLLKFQLDLGDHQRQVLSGIKAAYNNPEELVGRF
FT                   VIMVANLAPRKMKFGVSEGMILSAGTGGADLFLLSADEGIRPGMQVK"
FT   gene            405477..406487
FT                   /gene="menC"
FT                   /locus_tag="APP7_0358"
FT   CDS_pept        405477..406487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="menC"
FT                   /locus_tag="APP7_0358"
FT                   /product="O-succinylbenzoate synthase"
FT                   /EC_number="4.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61010"
FT                   /db_xref="GOA:B3H0J8"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0J8"
FT                   /protein_id="ACE61010.1"
FT                   /translation="MRQAVEFRQNFTNGQKMRKAELYRYAIPCQTGVVLRKQPLIQREG
FT                   LILKLEENGKIGLGEIAPLPGFSQETLADAEMQAKMWLANQTDDLEELFPSVAFGISCA
FT                   LAELRNELITQGKFASAILCDGNFTQFAQKIARIPQPLGKIKIGFEPEKEGELANRLLE
FT                   QFPHLTLRLDANRSFSLAQAVGFGKKIAKSNRLRIQFIEEPCFTPSFSRQFAQATGIAI
FT                   AWDESVREAGFNVKAEDYLKAIVIKPTLTGSLAKCVNLIKQAHTQGLKAVISSSLESSL
FT                   GLSQLARIAAQYTPETVAGLDTLGLMQVQLVRAWQGADLPLAGLQSRFLQKIAEI"
FT   gene            complement(406523..406684)
FT                   /locus_tag="APP7_0359"
FT   CDS_pept        complement(406523..406684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0359"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61011"
FT                   /db_xref="GOA:B3H0J9"
FT                   /db_xref="InterPro:IPR010652"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0J9"
FT                   /protein_id="ACE61011.1"
FT                   /translation="MLNMPKQKWIKIIIILIYLFSPIDILPEAVLGPLGLVDDAAAILL
FT                   LIQTVLKK"
FT   gene            406801..407493
FT                   /gene="rsuA"
FT                   /locus_tag="APP7_0360"
FT   CDS_pept        406801..407493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsuA"
FT                   /locus_tag="APP7_0360"
FT                   /product="ribosomal small subunit pseudouridine synthase A"
FT                   /EC_number="5.4.99.12"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61012"
FT                   /db_xref="GOA:B3H0K0"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR018496"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="InterPro:IPR042092"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0K0"
FT                   /protein_id="ACE61012.1"
FT                   /translation="MRLDKFIAENTGLTRSQAARALKSGLVTVNGKLEKSGSVKIGDTD
FT                   EICYEGERLEWVDEGQYFMLYKPQGYVCSHDDGEYPTVFQFFDYPLMTKLHTAGRLDVD
FT                   TTGLVLLTDDGKWSHRITSPKHHCEKTYLVTLADPVEDFYAKKLAEGILLRGEREPCLP
FT                   AKMEVIDDYNVNLTISEGRYHQVKRMFAALGNKVEALHRWRIGDVVLDENLEEGEYRPL
FT                   SEQEVESF"
FT   gene            407493..408266
FT                   /gene="proP"
FT                   /locus_tag="APP7_0361"
FT   CDS_pept        407493..408266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proP"
FT                   /locus_tag="APP7_0361"
FT                   /product="bicyclomycin resistance-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61013"
FT                   /db_xref="GOA:B3H0K1"
FT                   /db_xref="InterPro:IPR004812"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0K1"
FT                   /protein_id="ACE61013.1"
FT                   /translation="MVTQRPHPCFFIILGMMAMLPPLAIDMYLPSFLDIARDLQVSQEK
FT                   VQTTLAVFTFGFAVGQLFWGPMADSFGRKPIILFGLTGSALAAYFLTQVMTIENFYLLR
FT                   LIQGLCAAAPAVVLGALVRDLFDRNMFAQMMSVIMIISMLAPLLAPILGGYIAKYFHWH
FT                   SIFYTLVLMGISCVLLISWKIPETLAIEKRQPLRFGIVFKNFWTLLSDKATLGYVLVGG
FT                   LTFAGMFCFLTSGVKTRNKCQKQEINVTNLSLILL"
FT   gene            408300..410111
FT                   /locus_tag="APP7_0362"
FT   CDS_pept        408300..410111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0362"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61014"
FT                   /db_xref="UniProtKB/TrEMBL:B3GYY3"
FT                   /protein_id="ACE61014.1"
FT                   /translation="MFYLNNDNFKREPYRGYCPRHLEKLFTKPHLDIRGNGYYYPDNEY
FT                   VVAWYESDFIFKSRKAQAHAKVKLVNLTCSKYTGKNSAEYLSVLYISVPLNYLHYFTIG
FT                   SIWKGGVAKEQFAFEEFYITVEAENQDGKRENLSIVSFGESKENGLEKPFDYTIYTIST
FT                   EYHNYGDDLNRLLSISYQNQKFIIHPLHIFMMHYGYSTDIKRILATYPFDEVRERLFID
FT                   KVVENLDVERYVVLPKYFVKKDAIFLYHLKYDEETTGIRVKNLVSQFRLNVRNQKHPIE
FT                   IGFWHTQKVELKIRGIRLGNAVLCAEIIGLNQPEGEDITLVLSQSKREKSGNKTEEQNN
FT                   EVNNVPITRVYTREPELDELPLTDNSPDNRTVEYNNRQFELLGRQRQIRALKKAREESN
FT                   QKMKALTPDEIDSLGVGESDGRNGKVGLAFCFLDDTPVGKSSKLYKLWQHAKAVAEWNH
FT                   GEAHWYTPNLGFRNDDELLPVSLETNKCFDYPEIAIIICLQIYGETFFLIDFSMKQRDI
FT                   SIRGLGYKPDPNEDFLYESDMSKSELSELLSAVHHHEHLPKEYIEKKNKEKTKLTTFNH
FT                   SEAESSNWAYNAVQKLTSRAITKPTYF"
FT   gene            410120..412984
FT                   /gene="helD"
FT                   /locus_tag="APP7_0363"
FT   CDS_pept        410120..412984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="helD"
FT                   /locus_tag="APP7_0363"
FT                   /product="helicase IV"
FT                   /function="ATP-dependent exoDNAse (exonuclease V) beta
FT                   subunit (contains helicase and exonuclease domains)"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61015"
FT                   /db_xref="GOA:B3GYY4"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR013498"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:B3GYY4"
FT                   /protein_id="ACE61015.1"
FT                   /translation="MNAEQRVIVTPTFWGKFFGKIKSVELQQNKVIVTDKKNNITEHDL
FT                   GKTFDFPAIQKSFFGTKLFFKDDSTEVVLSKLAKKQTDSLLLEIEKVVASNIKVKVKEG
FT                   FQHFANLAENQYLRDSDIPTLNDRVRLSVLSYGDNKEHFQKYFDESLVKKIQYISSLFP
FT                   VNAINAQTIRKEYEQHVLNHRKHFFDVIESNPLTEQQRLSVIRNNDINMVLAAAGTGKT
FT                   SVMVAKALDLIDSGACKSEDILILAYNRDAATELSERLQERAREANLDLENSPSISTFH
FT                   ALGRRIIKECGKSVHLSKFAEDPMKLDRWFNKWLEDYIKEDPDNLAKFIQLAYQPIDPF
FT                   QFKTKEEYDRYVNDNDYRTLQGERVRGYQELLIANWLFSHSVEYEYEPRYVSKRRIEIG
FT                   FDYKPDFSLGDGVYLEHFGIDRQGRTRADINAQEYNANIQRKRELHAEHNTTLLETYHY
FT                   NWVENTLYKRLEQLMNEQFIPLKPKSQQEILDALNESGIFKENKNRYLKCLQAIRTERL
FT                   DYQQILKRLTDAKIVYAKEYATLLMRIHDAYVKELRSANEIDFDDMILLATQLVKTGEF
FT                   KPKWKHILVDEFQDISMARLELLKEIYTKGPRPIWTVVGDDWQSIYRFSGGKLEVTTRF
FT                   NDMVGSHTLSKLEKTYRYNNSIADTAGQFIMQNPEQYQKNVVTHTKVADSCVHLYDSHV
FT                   VKDEKSEANISLKASAILKLIRQKAPEATVAILARYRYLLEDAKSVIKDKNVKFWTFHG
FT                   SKGLEADYCILLGFFQGKVGFPNQNKEEAVVEALLPMLDSFPHSEERRLFYVALTRAKK
FT                   ESYLIADANAPSEFINELLSPKYKIDIVSKRFQERYRTIFKCNECSTGYFVMKQGKFGQ
FT                   FYSCTSGEVCRSSPRICEKCGSPSVDTASMSICQNPNCQNSFPICDKCGRPMRLREGKF
FT                   GKFWGCSGYGIKDDPCSNTRKYFI"
FT   gene            413379..414587
FT                   /gene="tnpR"
FT                   /locus_tag="APP7_0364"
FT   CDS_pept        413379..414587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tnpR"
FT                   /locus_tag="APP7_0364"
FT                   /product="iso-IS10R ORF"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61016"
FT                   /db_xref="GOA:B3GYY5"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:B3GYY5"
FT                   /protein_id="ACE61016.1"
FT                   /translation="MCELDILHDSLYQFCPELHLKRLNSLTLACHALLDCKTLTLTELG
FT                   RNLPTKARTKHNIKRIDRLLGNRHLHKERLAVYRWHASFICSGNTMPIVLVDWSDIREQ
FT                   KRLMVLRASVALHGRSVTLYEKAFPLSEQCSKKAHDQFLADLASILPSNTTPLIVSDAG
FT                   FKVPWYKSVEKLGWYWLSRVRGKVQYADLGAENWKPISNLHDMSSSHSKTLGYKRLTKS
FT                   NPISCQILLYKSRSKGRKNQRSTRTHCHHPSPKIYSASAKEPWVLATNLPVEIRTPKQL
FT                   VNIYSKRMQIEETFRDLKSPAYGLGLRHSRTSSSERFDIMLLIALMLQLTCWLAGVHAQ
FT                   KQGWDKHFQANTVRNRNVLSTVRLGMEVLRHSGYTITREDLLVAATLLAQNLFTHGYAL
FT                   GKL"
FT   gene            complement(414597..415013)
FT                   /gene="tetD"
FT                   /locus_tag="APP7_0365"
FT   CDS_pept        complement(414597..415013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tetD"
FT                   /locus_tag="APP7_0365"
FT                   /product="Transposon Tn10 TetD protein"
FT                   /function="AraC-type DNA-binding domain-containing
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61017"
FT                   /db_xref="GOA:B3GYY6"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="UniProtKB/TrEMBL:B3GYY6"
FT                   /protein_id="ACE61017.1"
FT                   /translation="MYIEQHSRYQNKANNIQLRYDDKQFHTTVIKDVLLWIEHNLDQSL
FT                   LLDDVANKAGYTKWYFQRLFKKVTGVTLASYIRARRLTKAAVELRLTKKTILEIALKYQ
FT                   FDSQQSFTRRFKYIFKVTPSYYRRNKLWELEAMH"
FT   gene            415026..415694
FT                   /gene="tetC"
FT                   /locus_tag="APP7_0366"
FT   CDS_pept        415026..415694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tetC"
FT                   /locus_tag="APP7_0366"
FT                   /product="Transposon Tn10 tetC protein (ORFL)"
FT                   /function="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61018"
FT                   /db_xref="GOA:B3GYY7"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="UniProtKB/TrEMBL:B3GYY7"
FT                   /protein_id="ACE61018.1"
FT                   /translation="MFLRLSRPHHHDTINILTVCYFKSIMENKNHQQENFKSTYQSLVN
FT                   SARILFVEKGYQAVSIDEISGKALVTKGAFYHHFKNKKQLLSACYKQQLIMIDAYITTK
FT                   TDLTNGWSALESIFEHYLDYIIDNNKNLIPIQEVMPIIGWNELEKISLEYITGKVNAIV
FT                   SKLIQENQLKAYDDDVLKNLLNGWFMHIAIHAKNLKELADKKGQFIAIYRGFLLSLKDK
FT                   "
FT   gene            complement(415807..416946)
FT                   /gene="tetA"
FT                   /locus_tag="APP7_0367"
FT   CDS_pept        complement(415807..416946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tetA"
FT                   /locus_tag="APP7_0367"
FT                   /product="Tetracycline resistance protein, class G"
FT                   /function="Permeases of the major facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61019"
FT                   /db_xref="GOA:B3GYY8"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B3GYY8"
FT                   /protein_id="ACE61019.1"
FT                   /translation="MPVLPTLLREFIASEDIANHFGVLLALYALMQVIFAPWLGKMSDR
FT                   FGRRPVLLLSLIGASLDYLLLAFSSALWMLYLGRLLSGITGATGAVAASVIADTTSASQ
FT                   RVKWFGWLGASFGLGLIAGPIIGGFAGEISPHSPFFIAALLNIVAFLVVMFWFRETKNT
FT                   RDNTDTEVGVETQSNSVYITLFKTMPILLIIYFSAQLIGQIPATVWVLFTENRFGWNSM
FT                   MVGFSLAGLGLLHSVFQAFVAGRIATKWGEKTAVLLGFIADSSAFAFLAFISEGWLVFP
FT                   VLILLAGGGIALPALQGVMSIQTKSHQQGALQGLLVSLTNATGVIGPLLFAVIYNHSLP
FT                   IWDGWIWIIGLAFYCIIILLSMTFMLTPQAQGSKQETSA"
FT   gene            417091..417717
FT                   /gene="tetR"
FT                   /locus_tag="APP7_0368"
FT   CDS_pept        417091..417717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tetR"
FT                   /locus_tag="APP7_0368"
FT                   /product="Tetracycline repressor protein class B from
FT                   transposon Tn10"
FT                   /function="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61020"
FT                   /db_xref="GOA:B3GYY9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR003012"
FT                   /db_xref="InterPro:IPR004111"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:B3GYY9"
FT                   /protein_id="ACE61020.1"
FT                   /translation="MMSRLDKSKVINSALELLNEVGIEGLTTRKLAQKLGVEQPTLYWH
FT                   VKNKRALLDALAIEMLDRHHTHFCPLEGESWQDFLRNNAKSFRCALLSHRDGAKVHLGT
FT                   RPTEKQYETLENQLAFLCQQGFSLENALYALSAVGHFTLGCVLEDQEHQVAKEERETPT
FT                   TDSMPPLLRQAIELFDHQGAEPAFLFGLELIICGLEKQLKCESGS"
FT   gene            complement(417695..418318)
FT                   /gene="arsR"
FT                   /locus_tag="APP7_0369"
FT   CDS_pept        complement(417695..418318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arsR"
FT                   /locus_tag="APP7_0369"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /function="Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61021"
FT                   /db_xref="GOA:B3GYZ0"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B3GYZ0"
FT                   /protein_id="ACE61021.1"
FT                   /translation="MSDISRVKILSALMDGRAWTATELSSVANISASTASSHLSKLLDC
FT                   QLITVVAQGKHRYFRLAGKDIAELMESMMGISLNHGVHAKVSTPVHLRKARTCYDHLAG
FT                   EVAVKIYDSLCQQQWITENGSMITLSGIQYFHEMGIDVPSKHSRKICCACLDWSERRFH
FT                   LGGYVGAALFSLYESKGWLTRHLGYREVTITEKGYAAFKTHFHI"
FT   gene            418435..419760
FT                   /gene="accI"
FT                   /locus_tag="APP7_0370"
FT   CDS_pept        418435..419760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accI"
FT                   /locus_tag="APP7_0370"
FT                   /product="Modification methylase AccI"
FT                   /function="Type II restriction enzyme, methylase subunits"
FT                   /EC_number="2.1.1.72"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61022"
FT                   /db_xref="GOA:B3GYZ1"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B3GYZ1"
FT                   /protein_id="ACE61022.1"
FT                   /translation="MSVINNELDLYDTSELWIKETDTLIDNEIDYFAKTGGYYDKVIGN
FT                   PPYGAWQDHEKRSTLKKKYLGHYVKETYTLFLLRCLSVLKPKGLLSFIIPDTFMFLNMH
FT                   SNLRKTLLTNAKIKEVLIFPSKFFPGVNFGYSNLSIITLEKCCKGDYQENEITIIKGLK
FT                   NINELELLSKGLVDQIPNLNKLKIKQNEILNNPDCRFILTESEDKDMLINSKVKLGDIA
FT                   SVVTGFYTGNNVEFIKVLDKNVKGSKGYKIIKENEIFNSNSLEGIENVNYGYIPYIKRA
FT                   SAGKYFRGKDEWFVRWDKDAIAYYQTNKKSRFQNTTYYFKTGIGIPMVKSKSIKAFLME
FT                   DRVFDQSIVGLFPYEESKTLYILALMNSSVMNKYIHLINPTANNSANYIKQLPYIEPTE
FT                   SQMNIINKMVSELITLQKLDKLDKAEKIHDEVDKIISEIYSS"
FT   gene            complement(419822..420046)
FT                   /locus_tag="APP7_0371"
FT   CDS_pept        complement(419822..420046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0371"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61023"
FT                   /db_xref="UniProtKB/TrEMBL:B3GYZ2"
FT                   /protein_id="ACE61023.1"
FT                   /translation="MNSTNNKSTLSLKQQFKLWLEQEQKDGDMIILVGIPDILKRFDRR
FT                   LAIIKGNQLEKRYLREWREAFRIDRKLFN"
FT   gene            complement(420164..421621)
FT                   /locus_tag="APP7_0372"
FT   CDS_pept        complement(420164..421621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0372"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61024"
FT                   /db_xref="UniProtKB/TrEMBL:B3GYZ3"
FT                   /protein_id="ACE61024.1"
FT                   /translation="MGTTKTTITNCSMKITKIRSQNSCSICGKTPVTRKFREEYYCANC
FT                   YAQWFKKKTCKSCGQLTRIHREGELCLECEKLTDCVRCGKTSGTFEIGMISRYGAVCSS
FT                   CTRYFREEIECSECGKMTRDRYRSPVTNESVCLQCYRRYTFATCKNCRRYRKVHNQEKQ
FT                   LCKKCDEKLLSTCPKCKGEMPSGYGNVCPDCARRSLLFNMIRLNGHILRNKAVKTAYKK
FT                   FIFWYMRKCGISVALHKGADFMRFFIDCDEIWQQIPDYAELVTHFKPNGLRANLTVLRW
FT                   LLDTNQIIVDEALKDDLAELERIQALFNKLKESVPCIASYYQKLQRRCDEGKTSLKSVR
FT                   LALQPAIDLISTNEVTDYPTQDQLNQYLVKKSGQTAAITGFINHLKSEYHRELEIDRKL
FT                   IQQIKTKQLKKHCSQRLIELYKKSELTDNEQMELIYVVLYSLHSVEIKKPKQDKILLLD
FT                   GVAYYRSEDRDYFLPQDIYQRINPQFS"
FT   gene            complement(421582..422700)
FT                   /locus_tag="APP7_0373"
FT   CDS_pept        complement(421582..422700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0373"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61025"
FT                   /db_xref="InterPro:IPR009492"
FT                   /db_xref="UniProtKB/TrEMBL:B3GYZ4"
FT                   /protein_id="ACE61025.1"
FT                   /translation="MGTTNAGLPKNYRIKSGVIKTPLYSNESISSWLIRSALDCGTEPI
FT                   TFTGFYWNEWRLWTYDLDRGFEPISQHIYADINELSLNQQVNLVNHSLYSVLRPINGKN
FT                   TLIKGQAKWVLSRGSRNRSFRVGQSYCPCCLEETPYLRNEWRFAWHFGCLKHKVLFESK
FT                   CSCCGGLYQPHLLSAEKRQLNYCHQCGEKLQVITTPLNEVEIATMETLDNVFTTNSGEC
FT                   FGKCVDSQVYFAILRYFINFTRRAAIAKSTHSFSRFVEQCGISQVEICQTKTALAFEQL
FT                   PVEERKNLLVNAGKILKLSSKDFIQAIKQSGITQKAFAFERYPTELDNLFKYAIEGKTT
FT                   SRKTIINKPKTDSVLSLNRQWERLKRQLQIAV"
FT   gene            complement(422658..423545)
FT                   /locus_tag="APP7_0374"
FT   CDS_pept        complement(422658..423545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0374"
FT                   /product="Transposition helper protein"
FT                   /function="Uncharacterized ATPase, putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61026"
FT                   /db_xref="InterPro:IPR008868"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3GYZ5"
FT                   /protein_id="ACE61026.1"
FT                   /translation="MQYEHVHEKFRHLVTADNQERIAFLDEPRWLGYGVAKDIMDNLVS
FT                   LMNKPKRPRMLNLLIVGDSNNGKTTLIRRFFDLYGQAYIDSDSNAIYPILLAEAPPSAN
FT                   EKELYISLLERFYVPYKPTDTIAKLRYQTIHLFREFRVKMLIIDEFHSLLVGTPRLQRQ
FT                   VMNAIKMLCNELQIPIVGVGTRDAIRVLHTDPQHASRFDVAELPTWKLDKDFQKLLFQF
FT                   QGILPLKKCSNLQSPELATKIHTISGGNLGNVHRLLTACAVEAITSGTEQITLDIIEKN
FT                   SWVQPTQGFRKIIG"
FT   gene            complement(423545..425473)
FT                   /locus_tag="APP7_0375"
FT   CDS_pept        complement(423545..425473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0375"
FT                   /product="Putative transposase"
FT                   /function="Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61027"
FT                   /db_xref="GOA:B3GYZ6"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR015378"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:B3GYZ6"
FT                   /protein_id="ACE61027.1"
FT                   /translation="MMSNSGFTEKRYHHRLDRGRIILQKGNIYLNREDGEQYELVDYMD
FT                   EPSQLLVRNLNTRTTKVVSIHQLENFKMNERTDLSVDLTAISNEYWEKAQQKYEAIKPL
FT                   LGMDQHRPYAVKARAEDVGVNPRTLYRWLQAYNSIGSIAGLVDQKRGWQQGNSRLTPEQ
FT                   DKLIVQVINEFYLHKQRPTTEQTIREIRRRCKIEKVESPSKETIRIRILHISEEERLRK
FT                   RGQREKARNKFKPKPNSFPDADYPLSVVQIDHTPVDLIIVDSKYRKPIGRPFLTVAIDI
FT                   YSRMIVGYYLSLDAPSVTSVAMCIARGILPKERLLLDLGLQGSEWNAFGYPVKVHVDNG
FT                   PDFQALDLSKSCFAHGIHLEFRPMGRPEYGGHIERVIGTFMKEVHSLAGTTFSNIKERD
FT                   SYDSEKEAIMTLDEFEKWLVHYIVNVYHKRVHSALGISPEQKWKIGIFGDENEVGCGYP
FT                   QLPVDEQTLLLDFLPSITRTIQHNGVTIDGLRYYDVALNMYISDSDESGKSKEFLFRRD
FT                   PRNISKIWFYDPKLKRYFPIPFANQAMPEMSIWEYREVRSRIANKGDKYINEQQVLDGL
FT                   TEMREMVAESAQRTKKARRQAERQKMHKASKPIIETKVETNAVVPVVVTSNLLALDDES
FT                   LSFGEVD"
FT   gene            complement(425463..426125)
FT                   /locus_tag="APP7_0376"
FT   CDS_pept        complement(425463..426125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0376"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61028"
FT                   /db_xref="InterPro:IPR014832"
FT                   /db_xref="InterPro:IPR014833"
FT                   /db_xref="UniProtKB/TrEMBL:B3GYZ7"
FT                   /protein_id="ACE61028.1"
FT                   /translation="MRKTHSFQQVRKIKPTWMSVSGHIPFRNGVSIPYESTLERDFLMY
FT                   FTYLPSVDEIVSQPTTLPFVKNGITYTYTPDFFLSFTDGRKPMLIEVKPKAKWQKHWKE
FT                   WKEKWKAAIRFCQENGYVFHVYDEDRIRHLALFNLNYVQRYKRIQHEQEDIDVILAQVK
FT                   LMGNTTIDYLLSRFFAGSLYRMKGLQIIYHLLATKQLHCNWFLPLNEFTEVWGNNDE"
FT   gene            426357..426782
FT                   /gene="bcr"
FT                   /locus_tag="APP7_0377"
FT   CDS_pept        426357..426782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bcr"
FT                   /locus_tag="APP7_0377"
FT                   /product="Bicyclomycin resistance protein-like protein"
FT                   /function="Permeases of the major facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61029"
FT                   /db_xref="GOA:B3H0L7"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0L7"
FT                   /protein_id="ACE61029.1"
FT                   /translation="MIVMVSMTALNGRIVVKVGSEKMLKIGLLVQLLAGIWLACVAIFK
FT                   LGFWAMAIGIPFYVGMLSTIGSNATAAILDRYPQMAGTANGLAGTARFGIASLVGAMLS
FT                   HIAVTSERPMLYAMAMCTIAASIAYYLLCKNKSKQAI"
FT   gene            complement(426828..427214)
FT                   /locus_tag="APP7_0378"
FT   CDS_pept        complement(426828..427214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0378"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61030"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0L8"
FT                   /protein_id="ACE61030.1"
FT                   /translation="MKKATWTIAITISFLLSACAVTPQQQAQRQARQIKAQQDLSVALA
FT                   KQCDVETAEMMAQLYNPPIAQTEKEKAEFTQRYQKKVNDPLFQACHKLAWENYKHQEEL
FT                   EQIQRYYDFVRTRFHPWHYCYACW"
FT   gene            complement(427285..427854)
FT                   /locus_tag="APP7_0379"
FT   CDS_pept        complement(427285..427854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0379"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61031"
FT                   /db_xref="InterPro:IPR026269"
FT                   /db_xref="InterPro:IPR036411"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0L9"
FT                   /protein_id="ACE61031.1"
FT                   /translation="MSETTINDFSLLCRLFGNLFYRSPTDPILAGTFAWLAQGGLRRQW
FT                   ALSTDAQSESALTVLEKNANPTQLQASYQALFGEDGAIATTISAYNISVEDFINFRRTR
FT                   AMPELEKPDHVALLLLTASWIEDNLDSDAAQQAFFEQFLLPCSAKFLGQIEAHDNGFYK
FT                   ALAQLCRDALGAMADELEELSEAEVE"
FT   gene            427912..428754
FT                   /gene="nfo"
FT                   /locus_tag="APP7_0380"
FT   CDS_pept        427912..428754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nfo"
FT                   /locus_tag="APP7_0380"
FT                   /product="putative endonuclease 4"
FT                   /EC_number="3.1.21.2"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61032"
FT                   /db_xref="GOA:B3H0M0"
FT                   /db_xref="InterPro:IPR001719"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR018246"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3H0M0"
FT                   /protein_id="ACE61032.1"
FT                   /translation="MKYIGAHVSASGGVENAVLRAVEIGANAFALFTKNQRQWKAPALK
FT                   ADTIEKFKRFCKAHQFSPEHILPHDSYLINLGNPEAENLAKSREAFIDEMERANQLGLK
FT                   LLNFHPGAHLNKISESECLARIAESINIAVDKVPNVIAVIENTAGQGSNLGYRFEHLAE
FT                   IIDQVEDKNRVGVCLDTCHLFSAGYDISSLESCEQTFSEFERTVGFQYLRGMHLNGSKT
FT                   PLGSRVDRHHTLREGTIGTDFCKFIMQDDRFDNIPLILETIQPEIWTEEIKFLRTLAK"
FT   gene            428875..429471
FT                   /gene="nlpC"
FT                   /locus_tag="APP7_0381"
FT   CDS_pept        428875..429471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nlpC"
FT                   /locus_tag="APP7_0381"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61033"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0M1"
FT                   /protein_id="ACE61033.1"
FT                   /translation="MKKHPTLTRLKPLFITSLFAIFGSYSSIASASLSSHPATSSQIKI
FT                   VAKAASAEQIEAQISYKQGMKARVSHREELSTDGGNAAKKVHSIYRKWAGTRYRLGGEG
FT                   RGGIDCSAFVQKTMSGAFNLDLPRSTAEQRHLGRSISKSDLRPGDLVFFRRNNHVGVYI
FT                   GAGKFVHASTSQGVTTSSLSERYWARNYTQSRRVL"
FT   gene            complement(429520..429975)
FT                   /gene="impA"
FT                   /locus_tag="APP7_0382"
FT   CDS_pept        complement(429520..429975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="impA"
FT                   /locus_tag="APP7_0382"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61034"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0M2"
FT                   /protein_id="ACE61034.1"
FT                   /translation="MASIRPLTRELPYQPLPMYRDMNSERSIKLDLNSLCIKRPTETFF
FT                   IQVKNPNLIAWGIELDDLLIVEQSEQYLVNDLIVIEKNGEYKFYQFFNEIENSVGTREI
FT                   ILFSLDVREPNLRITDWQEIEIAGVITNVVHQMRHKSAQTAARKYAA"
FT   gene            complement(430201..430587)
FT                   /gene="grcA"
FT                   /locus_tag="APP7_0383"
FT   CDS_pept        complement(430201..430587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="grcA"
FT                   /locus_tag="APP7_0383"
FT                   /product="autonomous glycyl radical cofactor"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61035"
FT                   /db_xref="GOA:B3H0M3"
FT                   /db_xref="InterPro:IPR001150"
FT                   /db_xref="InterPro:IPR011140"
FT                   /db_xref="InterPro:IPR019777"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3H0M3"
FT                   /protein_id="ACE61035.1"
FT                   /translation="MIKGVQITESSNSNLVNSFWLLDEEKNEARCIAAKGDVYKEDQVI
FT                   AISELGQIAYREVPVNVAPTIKVEGGQHLNVNVLRRETLEDAVKNPEKYPQLTIRVSGY
FT                   AVRFNSLTPEQQRDVITRTFTESL"
FT   gene            430793..431470
FT                   /gene="ung"
FT                   /locus_tag="APP7_0384"
FT   CDS_pept        430793..431470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ung"
FT                   /locus_tag="APP7_0384"
FT                   /product="uracil-DNA glycosylase"
FT                   /EC_number="3.2.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61036"
FT                   /db_xref="GOA:B3H0M4"
FT                   /db_xref="InterPro:IPR002043"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR018085"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3H0M4"
FT                   /protein_id="ACE61036.1"
FT                   /translation="MNNWTEALGEEKQQPYFQHILQQVHQERMNGVTVFPPQKEVFSAF
FT                   ALTEFKDVKVVILGQDPYHGPNQAHGLAFSVKPPVAPPPSLVNMYKELAQDVEGFQIPN
FT                   HGYLVDWAKQGVLLLNTVLTVRQGQAHSHANFGWEIFTDKVIAQLNQHRENLVFLLWGS
FT                   HAQKKGQFIDRSRHCVLTAPHPSPLSAYRGFFGCKHFSKTNRYLLSKGIAPINWQLRLE
FT                   IDY"
FT   gene            complement(431568..432440)
FT                   /locus_tag="APP7_0385"
FT   CDS_pept        complement(431568..432440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0385"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61037"
FT                   /db_xref="InterPro:IPR007488"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0M5"
FT                   /protein_id="ACE61037.1"
FT                   /translation="MKKFFHFPKFSEAFPNEKRPSKLLREYFRYSFRKVWCSTQCIQLT
FT                   NYLNNSPLWAELFNQNLYRVNTLLDTYCDKTFNKKQRLKAIKENFTRFENLFRIHFCNQ
FT                   LVTQQEVCIAKLSDELNLYLSINQIDPLEGFFSLNIKNNQKEHIYDASFTLLEENKILI
FT                   SSIQGPNSKSAQDLIKSATKQLYGIRPMFMLIYIFKLIAEKFNLELLGIPHKRQAKYRW
FT                   NDHSRLLFNYDIFWKDNNAILTKNDYWSLSNNIERKPLNIIPSKKRSMYKKRYQLLDDI
FT                   KEKINLMFY"
FT   gene            complement(432535..435336)
FT                   /gene="aasP"
FT                   /locus_tag="APP7_0386"
FT   CDS_pept        complement(432535..435336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aasP"
FT                   /locus_tag="APP7_0386"
FT                   /product="autotransporter serine protease"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61038"
FT                   /db_xref="GOA:B3H0M6"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR034061"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0M6"
FT                   /protein_id="ACE61038.1"
FT                   /translation="MLEKYYFNKSCIAIAISTFLSTSVAYADSLESPHSSIKLSDEISA
FT                   KYSGKGVKLGVLDGGFVVKHPLHSSKLNLSGFKLTSPDGKPLNYDPGYLQFEVKPVEQN
FT                   GKKGLAALFEIHGLAVSGIISAKASEKEGFKGGVAKEAEIHIATNTPNRSLSELIAEAN
FT                   QSKGEDEEKGDSENQKPDFNELAKSDLLISKDKKLSFERLEWATALNKLVERNLFAINN
FT                   SWNLDPISDNIADFDKFYHSLSTDKQNSLLQAVLNAKKKNTLLVFAAGNESKKQVGVMA
FT                   MLPRYLPELEKHYLSVVAVDNKHNLTDYSNHCGVSKNWCVAAPGNLAILNAIPDSTTLK
FT                   PQYNLGKEQGTSLAAPVVTGALAILKERFSYLAPTQIRDTLLTTATDLGEKGVDDKYGW
FT                   GVINIAKAINGPSQFLNDETVNVTRDDRWKNDFSSKFKFTKQGEKSLDLAGKNNIARID
FT                   VEQGRLNLSGMTQSQQVKNNAHLGVNQTEIRQGYMATENSQLTLLDSNGLIGKDKAIIQ
FT                   LNGSLKIADKLTENSKQGSISATVVKLHDKASYQGGFTKLIDNKNLANKGLMQDLYFKQ
FT                   SEIIAKVNSNKAFTDPNANDNAKSGLNLLNQLRTSSFAYRQGVYNDWLQSALEKKKLGQ
FT                   LHYAVSNHIYADALALLRHQNAKQLSHVQHNLFTAAYSPQKTSVWLEHSGQKHSKVAIK
FT                   QNSSALSLSHKFNDNALLSATLMRKNHHMDKDFAHADLKQTSLNIGLRYPLADHWFSEL
FT                   ALQFGQQKYNQRRWYKKSQLGQAQNKGHHMGGEIRVGYQFMPQTWIIEPSLGVQFIQTR
FT                   MKALNEKGELATNTTALHYNDINLTPSVKLKYTVKFEQGSISPYVGLNYLHRVKGKESK
FT                   ITSQLNGYPLQSYATQKRNHALNLEAGMQFQYKNWFVYANVDYDRIKSTNAFGWKTNIG
FT                   LTF"
FT   gene            complement(435556..439557)
FT                   /gene="hrpA"
FT                   /locus_tag="APP7_0387"
FT   CDS_pept        complement(435556..439557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hrpA"
FT                   /locus_tag="APP7_0387"
FT                   /product="ATP-dependent RNA helicase"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61039"
FT                   /db_xref="GOA:B3H0M7"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR010222"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR011709"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR024590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042035"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0M7"
FT                   /protein_id="ACE61039.1"
FT                   /translation="MKPSQKNFKNRPLDENQKALIANLKELTNTDYRRLRARIHGISSI
FT                   KKQETKNNVIAEIEREILSAQAAFQARKAQHSSLEITYPDLPVSARREEILKLIAENQV
FT                   VVIAGETGSGKTTQLPKMCLELGRGVKGLIGHTQPRRLAARSVANRIAEELKSEMGATV
FT                   GYKVRFNDQVGENTLVKLMTDGILLAEIQNDRYLNQYDTLIIDEAHERSLNNDFILGYL
FT                   KQILHKRPDLKVIITSATIDVERFSRHFNNAPIIEVSGRTFPVEVRYRPVVEEEDQDQL
FT                   QGIINAVDELQAEGRGDILIFMSGEREIRDTAEALQKQELRFTEILPLYARLSAAEQQR
FT                   IFQPSGLNRVILATNVAETSLTIPNIKYVIDTGTARISRYSYRTKVQRLPIEPISQASA
FT                   NQRKGRCGRTSEGICIRLYSEEDFNARPAFTDPEILRTNLASVILQMTSLGLSDIEAFP
FT                   FVDRPDTRQVQDGMRLLEELGAIGRGTLRVSSDVHSASRKHSPNLFPCVVSSDARSASL
FT                   HKLTPIGRQLAQLPIDPRLGRMVIAAAQNGSLHEVMMIVSALSIQDPRERPQERQQAAD
FT                   EKHRRFADKDSDFLAFVNLWHYIQTQQKELTKNQFRKQCQKDFLNYLRVREWQDIYHQL
FT                   RLAVREMGLPINSEEANYQQIHTALLTGLLSHIGMKDSEKMHYLGARNAHFYVFPTSAL
FT                   FKKQPKWLTASELVETTKLWARTVAKIEPEWIEPLAGHLIKRSYSEPHWSKSKGAVMAY
FT                   EKVSLYGIPVVANRLVNYGSIDPTVSREIFIRSAMVEGDWHNNYKFFKENNRLIKEVED
FT                   LEHKSRRRDILVDEQTLFDFYDQRIGTEVVSSRHFDTWWKKASQKDPELLNFEKSFLMN
FT                   ENANTVSDLDFPNFWYQGQLKLKLSYQFEIGKDHDGVTVHIPLPLLNQVEPEGFDWQIP
FT                   GLRHELVVALIKSLPKATRRNFVPAPNYADAFLARAEPYQKPLLESLAYELRRMTGVTI
FT                   DPELWDLSQLAPHLRMTFRVVDEKGKKLQESENLDELKFALKDQVQESLSTIADDGIEQ
FT                   SGVHLWNFANLPQFYEHKKANFSVKAYPAIVDEQTAVGVKLFETEFEQTRAMQAGLRRL
FT                   LLLNVPSPIKYLHEKLPNKAKLGLYFAPFGKVLELIDDCIACAVDKLVEEFGGFVWNEE
FT                   KFQALHEFVRANLNDTTAEIALQVEKCLTLAFEINKRMKGKMDFTMAFALSDIKAQIQG
FT                   LIYPDFVTKTGHQRLGDLYRYLSAIDKRLDKLGTDTNTDRAKMLRIEQIQNAYKQLLAK
FT                   LPKSKAIPDEILEIRYMIEELRVSLFAQQIGTKYPISDKRILNVISAIN"
FT   gene            complement(439693..440145)
FT                   /locus_tag="APP7_0388"
FT   CDS_pept        complement(439693..440145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0388"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61040"
FT                   /db_xref="GOA:B3H0M8"
FT                   /db_xref="InterPro:IPR007382"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3H0M8"
FT                   /protein_id="ACE61040.1"
FT                   /translation="MSLQFNPISLFLVVLIFLGVVGNNNSITIAATVLLLVQQTFLSKY
FT                   LPFLDKHGLSIGIIILTIGVLSPIVSGKISLPSFSEFLNWKMLLAVVAGIAVAWLGGRG
FT                   VSLMGGQPLLVTGLLVGTIIGVALLGGVPVGPLIAAGILSLLIGKG"
FT   gene            complement(440342..440938)
FT                   /gene="grpE"
FT                   /locus_tag="APP7_0389"
FT   CDS_pept        complement(440342..440938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="grpE"
FT                   /locus_tag="APP7_0389"
FT                   /product="heat shock protein (HSP-70 cofactor)"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61041"
FT                   /db_xref="GOA:B3H0M9"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3H0M9"
FT                   /protein_id="ACE61041.1"
FT                   /translation="MTAQNENAQAQAEQVEVANEAQLEQTAEVQQEQPVEAELAAAYAR
FT                   INELETYVAEADNREKDIQLRAQAEIQNIRRRAEQDIEKAHKFALEKFSKELLTVVDNL
FT                   ERGLNALDTAVTDEKTQALVDGVEMTHKEFISTLAKFGVEAVGVVGEAFNPEVHEAISM
FT                   QPAEGIEANHISVVLQKGYTLQGRVLRPAMVMVAG"
FT   gene            441183..442265
FT                   /gene="potD2"
FT                   /locus_tag="APP7_0390"
FT   CDS_pept        441183..442265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="potD2"
FT                   /locus_tag="APP7_0390"
FT                   /product="spermidine/putrescine-binding periplasmic protein
FT                   1 precursor"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61042"
FT                   /db_xref="GOA:B3H0N0"
FT                   /db_xref="InterPro:IPR001188"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0N0"
FT                   /protein_id="ACE61042.1"
FT                   /translation="MKKLAGLFAAGLATVALTACNEEKPKAAEAAAQPAAAGTVHLYTW
FT                   TEYVPEGLLDEFTKQTGIKVEVSSLESNETMYAKLKLQGKDGGYDVIAPSNYFVSKMAK
FT                   EGMLAELDHAKLPVIKELNQDWLNKPYDQGNKYSLPQLLGAPGIAFNSNDYKGDAFTSW
FT                   GDLWKPEFANKVQLLDDAREVFNIALLKLGKNPNTTNLEEIKAAYEELRKLRPNVLSFT
FT                   SDNPANSFIAGEVSVGQLWNGSVRIAKKEQAPVNMVFPKEGPVLWVDTLAIPANAKNKE
FT                   NAHKLINYLLSAPVAEKLTLEIGYPTSNVEALKTLPKEITEDPAIYPTADVLKAAQWQD
FT                   DVGNAIELYEKYYQELKAAK"
FT   gene            442409..443800
FT                   /gene="norM"
FT                   /locus_tag="APP7_0391"
FT   CDS_pept        442409..443800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="norM"
FT                   /locus_tag="APP7_0391"
FT                   /product="putative multidrug resistance protein NorM"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61043"
FT                   /db_xref="GOA:B3H0N1"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0N1"
FT                   /protein_id="ACE61043.1"
FT                   /translation="MNLQWQRYPENTRKLFKLTLPIFISQLSVAGMGLADIVMAGLVSD
FT                   DDVSAIAVSNSIYFPLFLFVLGLLNAITPTVSYLNGSNQRHLIAHQIRQGFWLVLVCSV
FT                   PLIIVFLNSHWILDYMNTPQAFSTKSQQYLAIMAIGVVPALLGINLRCMNDGLSNPKPA
FT                   MRIMFFGLLLNIPLNYIFIFGKFGLPEMGAVGCGMATAIVNWIMFLLLFHYSYTNKSQK
FT                   DIGLFNRWFEMPSGQTLLKICKLGLPIGFATFTEVMLFSTSALLLSPLGSQVVASHQAA
FT                   LQTSSLLFMIPMSFSIATTIVVGKTLGQKQVEQAKIISYHALITGALFALAAAVVIVIL
FT                   DEIIPLAFTSDPVSIAIAAHLLLFAAVYQIPDSLQAVANGILRGYKHTKPILYVTMFCY
FT                   WVIGMPFGYILARTDWIVEPMAASGFWFIFCVSLSIAAGLLIYQMHKIQQIPAEQLLAK
FT                   LERIK"
FT   gene            443816..447424
FT                   /gene="recB"
FT                   /locus_tag="APP7_0392"
FT   CDS_pept        443816..447424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recB"
FT                   /locus_tag="APP7_0392"
FT                   /product="exodeoxyribonuclease V beta chain"
FT                   /EC_number="3.1.11.5"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61044"
FT                   /db_xref="GOA:B3H0N2"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR004586"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0N2"
FT                   /protein_id="ACE61044.1"
FT                   /translation="MKPLSPIELPLNCTALIEASAGTGKTFTMANLYLRLLLGVGCASL
FT                   TVEQILVVTFTKAATEELRDRIRRNIKACRRFLQEYDAEKSYDANDFFFQLHQQIESVE
FT                   EAILRLRIAEREIDLASIFTIHSFCQKMLFQFAFDSGMRFDNDLQPDESDLLRRLSEEV
FT                   WREMFYPVGLTETAAVAEYLGTPYNAFEAIRAFVPAEFPPLSDEQHWLNGELAVHLAAL
FT                   QHFLADAKRHWSAHGEEISRLIESELAKKYKTGEKKALNRRSYQTRYLEKWRASVDEWA
FT                   ASSLSYLPEEQFERFCQEFLNEKAEEGAEPLVHPHFAKNQQILTAYQQQFANKQKPLLL
FT                   YQFLLAVRTKLADYKATHSEKSFNDMLTLLNQALNAERGAELAAQIRAQFPFAMIDEFQ
FT                   DTDKEQYEIFHKIFMQETHTNHGFIMIGDPKQSIYKFRGADIFTYLTASQQAQQKRTLA
FT                   KNWRSLPPIVSATNRLFEFPEAAENSPFLYQGIQFHSVEAKASEAELIGADYVNCYLQA
FT                   KFDEKLAAKQCAYQIQQQLKQMEAGEFGLKFTNTTEEINAFQAKDIAILVRSHSQATLI
FT                   KSALAELGIRSVFLSEKESVYQSETAKELLWVLYACLNPYHQRHLLSALGTTLWGLSAT
FT                   EIHQLKNSELQWDEQVGRFITYQQIWQQQGILPMLHKLFMQEGIIERLRANPRDSDRRL
FT                   TDLLHLTELLQNAMPSLENESALVRWYERQLAKTDSTEEHILRLESEEELIKIVTIHGS
FT                   KGLQYPIVWLPFIGKKNQGAKASNLAIYRDEQGQAHWYFGKPSEQVQALMDREELAEDL
FT                   RLLYVAVTRAESQLNLILPQRFEDGWNAVHYLLSNGEIGLNKSYKAEISTSEYLQQKGI
FT                   DCQAVELDEKIANDKWRPAPFVSETLSAYHFSGQIQQTGLVTSFSALHQQHEWAMQHHT
FT                   GYSMPKVFENAGQDYDQQQILAPETDNLFALDNEETNAYSSYQFPHSTKVGNILHSFFE
FT                   HSDFQQAVDFEQILTICEQLGLDENWHEPLQKWFEKVLATPFSETEFALKDVPITKRLN
FT                   EWQFYLRLKNSDGLRKLNQLLKQYSAVSAKLPDLNLPQLEGYLRGFVDCIVQVNEKFYL
FT                   IDYKSNFLGYLAQDYSRQNLEKTIGQYRYDLQYLLYTLALHRYLRVRLGEQYEYERDFG
FT                   GVAYLFLRGMNGIPNSGVFFEKPCKQLIEGMDELFG"
FT   gene            complement(447502..449013)
FT                   /gene="lnt"
FT                   /locus_tag="APP7_0393"
FT   CDS_pept        complement(447502..449013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lnt"
FT                   /locus_tag="APP7_0393"
FT                   /product="apolipoprotein N-acyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61045"
FT                   /db_xref="GOA:B3H0N3"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR004563"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0N3"
FT                   /protein_id="ACE61045.1"
FT                   /translation="MNFVKNPSILTACLLAFALGGFGTLAYSPFDLWGIVYLSAAGLIW
FT                   AATLPQRKTALWATFAWSLGCFCIGVNWVHVSMTQFGGVPLVVSYIAVFLLACYLALYN
FT                   LLFSYIAHKFRIQNPFALAAIFTFTEYLRGVVFTGFPWLQFGYTQIDSPFAGIAPLLGV
FT                   EGLTFFVMTVSGYLALLIKKSAKTTASLATLAVLCGLAFAAKFIPFVQIDEQKQPLTVS
FT                   LVQGNIEQKMKWDPAHFDYTLQTYQRLISPLLGKSDVIVLPESAVPALETQIYPLFSQL
FT                   QQVAADKGSEVIIGTLYQNESEQLFNSAVVLGNPLQPYDLHNTKRYNKHHLVPFGEYVP
FT                   FGSVLDWMRDVFILPINLSQGEFVQPALFAKNRKFNMAICYEVIFGNQMQQNQQAQQSD
FT                   YLLTITNDAWFGASIGPWQHFQMARMRALELGKPLLRAANTGITSIIGAKGEVIEQIPQ
FT                   FEANVLTAQIQPTKGETLFAKTGNRLIYALSLFCFIFAFVRNRKK"
FT   gene            complement(449095..449988)
FT                   /gene="corC"
FT                   /locus_tag="APP7_0394"
FT   CDS_pept        complement(449095..449988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="corC"
FT                   /locus_tag="APP7_0394"
FT                   /product="magnesium and cobalt efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61046"
FT                   /db_xref="GOA:B3H0N4"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0N4"
FT                   /protein_id="ACE61046.1"
FT                   /translation="MSDEQQSVNTQQDKKSFLQSIFGSLFQSEPKNREDLVEVIRDSLD
FT                   NELIDSDTKDMIEGVMEISELRVRDIMIPRPQIVYIDANLDLTACVDLIIESAHSRFPV
FT                   ILDDGKDTVLGILHAKDLLKFLRTDSEEFEMPTILRPAVIVPESKRVDRMLKEFRSERF
FT                   HMALVVDEFGAVSGLVTIEDILEQIVGDIEDEFDEEEIEPIRQLSRHTYAVSALTDIEK
FT                   FNETFATDFTDEEVDTVGGLVMQAFGHLPKRGEQIQLEGIDFKVTSADSRRLIQLRVTV
FT                   SDEQLEKMEQLVSNEE"
FT   gene            450158..450760
FT                   /locus_tag="APP7_0395"
FT   CDS_pept        450158..450760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0395"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61047"
FT                   /db_xref="InterPro:IPR018635"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0N5"
FT                   /protein_id="ACE61047.1"
FT                   /translation="MKLTKMAVTVATLAVSAFSVAGTLTASDSVELLAFDGQKVARGTA
FT                   GLSIDGNVHQVVVSVSDIVDGSYFSIDPIILTFNGTDEDAKIVTPKFTSNFTVDKFKKE
FT                   LNFKIETASGKEISYKRDFLKGEGFAPNSRVEDNLSKYNASKAVASVPAFANAALEAKG
FT                   QMVIETNNVKEEQLQVLFKKADKETQKRFLEWAKKQQ"
FT   gene            450996..451313
FT                   /gene="glpF"
FT                   /locus_tag="APP7_0396"
FT   CDS_pept        450996..451313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpF"
FT                   /locus_tag="APP7_0396"
FT                   /product="Glycerol uptake facilitator protein"
FT                   /function="Glycerol uptake facilitator and related
FT                   permeases (Major Intrinsic Protein Family)"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61048"
FT                   /db_xref="GOA:B3H0N6"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR022357"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0N6"
FT                   /protein_id="ACE61048.1"
FT                   /translation="MERSLKGACIAEFIGTGLIIFFGVGCVAAAQLAGATFGLWEISIM
FT                   WGVGVALAVYTTAGVSGAHLNPAVTVALWKFACFDGKKVLPYIISQFLGAFAAAALVYF
FT                   R"
FT   gene            451395..452369
FT                   /locus_tag="APP7_0397"
FT   CDS_pept        451395..452369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0397"
FT                   /product="Transposase for insertion sequence element
FT                   ISApl1"
FT                   /function="Transposase and inactivated derivatives, IS30
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61049"
FT                   /db_xref="GOA:B3GX19"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR001598"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025246"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B3GX19"
FT                   /protein_id="ACE61049.1"
FT                   /translation="MMSTSYRHLTINEREKIMILLAQGKKQAEIAKALGRSSSTISREL
FT                   KRHALESYSATNAQNSYLKHRQNSKAQRKLEQPEYFNLVQEKFLTENWSPEQISARLKL
FT                   EKSELSISYSTIYRGIYSGLFDIGERKASRKLRHKGKTRHTKNHHEKRGKIQISNHLND
FT                   RPISAQNRSRFGHWEADTVLGKAGGACLLTLTERKSRFELVKKIPAKKAEAVQKAMIEL
FT                   LDSHILRSITPDRGKEFAQHRLVTEALGVEFYFPEPHQPWTRGTNENTNGLLREYFPKH
FT                   QDINQWSEVDIQQVINKLNLRPRKCLGWKTPYEVYFKKSLHLV"
FT   gene            452332..452850
FT                   /gene="glpF"
FT                   /locus_tag="APP7_0398"
FT   CDS_pept        452332..452850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpF"
FT                   /locus_tag="APP7_0398"
FT                   /product="glycerol uptake facilitator protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61050"
FT                   /db_xref="GOA:B3H0N8"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0N8"
FT                   /protein_id="ACE61050.1"
FT                   /translation="MKFTSKNRCTWFDNSSLYKDLFAATEAAKNIVRGEGVGLAGVFST
FT                   YPHQHISVLQAFCVEAVITMALVALILALTDDGNGVPRGPMAPLLIGLLIAAIGGAFGP
FT                   LTGFAMNPARDFGPKAFAFLAGWGEVAFTGARDIPYFLVPLIAPIVGGLVGAWGYRRFI
FT                   GKNLPCNCK"
FT   gene            452885..454396
FT                   /gene="glpK"
FT                   /locus_tag="APP7_0399"
FT   CDS_pept        452885..454396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpK"
FT                   /locus_tag="APP7_0399"
FT                   /product="glycerol kinase"
FT                   /EC_number="2.7.1.30"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61051"
FT                   /db_xref="GOA:B3H0N9"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR005999"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0N9"
FT                   /protein_id="ACE61051.1"
FT                   /translation="MTKEYIIALDQGTTSSRAVLLDKNANIVEVSQREFTQIYPQVGWV
FT                   EHNPMEIWATQSSTLNEVVAKAGITSDKIAAIGITNQRETTIVWEKETGKPVYNAIVWQ
FT                   CRRTADICAKLKEDGHEAYIRKTTGLVVDPYFSGTKVKWILDNVEGAREKAERGELLFG
FT                   TVDTWLVWKLTQGRVHVTDYTNASRTMMFNIHTKQWDDKMLELLNIPRSMLPEVRNSSE
FT                   VYGETNIGGKGGVRIPVAGMAGDQQAALYGHLCVEAGQAKNTYGTGCFMLMNTGNEAVE
FT                   SKNGLLTTIACNAKGEPCYALEGSIFMGGASIQWLRDELKIVHDSKDSEYFATKEDSTN
FT                   GVYVVPAFTGLGAPYWDPYARGAILGLSRGANRNHIVRATLESIAYQTRDVLDAMQSDS
FT                   GKHLATLRVDGGAVANNFLMQFQADILNANVERPVVREVTALGAAYLAGLAVGFWKDLQ
FT                   ELRGKASIERTFVPDGDEAKRTRRYKGWKKAVKRALEWAKEDAEE"
FT   gene            complement(454517..456925)
FT                   /gene="lon"
FT                   /locus_tag="APP7_0400"
FT   CDS_pept        complement(454517..456925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lon"
FT                   /locus_tag="APP7_0400"
FT                   /product="ATP-dependent protease La"
FT                   /EC_number="3.4.21.53"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61052"
FT                   /db_xref="GOA:B3H0P0"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004815"
FT                   /db_xref="InterPro:IPR008268"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027543"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0P0"
FT                   /protein_id="ACE61052.1"
FT                   /translation="MAPRKKKAIELPLLPLRDVVVFPYMVMPLFVGREKSIQALRAAMD
FT                   SNKQLFLVTQQDPNKEEPTTEDVYSVGVIANIIQMLNLPDGTVKVLVEGQQRAKIEHIH
FT                   DDENGFWAGVQPLISEYEDENDELKTIARATLNEFEGYVKNNKKIPAEILPKLQKISLE
FT                   DRLADTMASNLIASVQKKQALLEETNLIARFEALLVAMATELDSLETETRIRNRVKQQM
FT                   EKNQRDYYLNEQIKAIQKELGNGEDAEQTELDKLKEQIEEAKLPLEVKEKLDSEFKKLK
FT                   AMPQSSSEATVVRGYIDWVLKMPWNKKSTVKKDLAKAQEILDKDHYGLERVKERIVEYL
FT                   AVQSRLNKLKGPILCLVGPPGVGKTSLGQSIANATGRKYVRMALGGVRDEAEIRGHRRT
FT                   YIGSMPGSLMMKMAKVGVKNPLFLLDEIDKMAQDMRGDPASALLEVLDPEQNKAFNDHY
FT                   LEVDYDLSDVMFVATSNSMNIPPALLDRMEVIRLSGYTEDEKMHIARDHLIAKQQENNG
FT                   LKAGELTIEDSAILSIIRYYTREAGVRSLEREIAKICRKAVKTLVLDKKVKSITVTEDN
FT                   IADYLGVKRFDYGKMDSQNRVGEVTGLAWTEVGGDLLTIETTSVGGKGKFSFTGSLGDV
FT                   MKESIQAAMMVVRARSAQLGIADDFYEKRDIHVHVPDGATPKDGPSAGIAMCTALISSL
FT                   TGNPVRKEVAMTGEISLRGKVLPIGGLKEKLLAAHRGGITTVIIPKDNEKDLEEIPENA
FT                   KAALAIHSVETIDEVLAIALENPPMGIEVISPKSQTIKVKKTRSKAAIQ"
FT   gene            complement(457071..458516)
FT                   /gene="glpT"
FT                   /locus_tag="APP7_0401"
FT   CDS_pept        complement(457071..458516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpT"
FT                   /locus_tag="APP7_0401"
FT                   /product="glycerol-3-phosphate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61053"
FT                   /db_xref="GOA:B3H0P1"
FT                   /db_xref="InterPro:IPR000849"
FT                   /db_xref="InterPro:IPR005267"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR021159"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0P1"
FT                   /protein_id="ACE61053.1"
FT                   /translation="MFGPFKPAPHIAELPADKIDARYKFLRWQVFAGIFFGYAAYYFVR
FT                   ANFDLAQKGLIEAGLYNKAELGIIGTGAGLAYGLSKFVMAGMSDRSNPKVFLPFGLLLS
FT                   GLCMTMMGLMPWATSGIAVMFIMIFLNGWFQGMGWPPCGRTMVHWWSKSERGTIVSIWN
FT                   CAHNVGGMVPGAMVLLASAIYFSNTGEHATAKDVWQQALYYPGIAAMIAAIPVYFVMKD
FT                   TPQSCGLPPVEKWRNDYPDDYNEETAEKDLSTKEIFVTYVLKNKLLWYIAIANVFVYLI
FT                   RYGVLKWSPVYLGEVKHFNIKGTAWAYTIYELAAIPGTLLCGWVSDKLFKGKRGLTGFI
FT                   FMILTTIAVFALWKNPATPEAELAQYAGKAWYENPYQLMDFILMTTIGFLIYGPVMLIG
FT                   LHALELAPKKAAGTSAGFTGLFGYLGGTVSASAVVGWAAEYYGWDGGFYVMIAGGVLAV
FT                   LLMFIVMIEEGKHKAKLGDHYGK"
FT   gene            complement(458719..459807)
FT                   /gene="glpQ"
FT                   /locus_tag="APP7_0402"
FT   CDS_pept        complement(458719..459807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpQ"
FT                   /locus_tag="APP7_0402"
FT                   /product="glycerophosphoryl diester phosphodiesterase"
FT                   /EC_number="3.1.4.46"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61054"
FT                   /db_xref="GOA:B3H0P2"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0P2"
FT                   /protein_id="ACE61054.1"
FT                   /translation="MKTIKALAVSLITTAVLAGCSNTQPVEPVKSNKLIIAHRGASGYL
FT                   PEHTLESKALAFAQQADYLEQDLAMTKDNRLIVIHDHFLDGLTDVAKKFPKRARKDGRF
FT                   YVADFTLKEIQTLEMTENFKTENGQQVQVYPNRFPMWKSHFRIHTFEDEIEFIQGLEKS
FT                   TGKQIGIYPEIKAPWLHHQEGKDIALETLKVLKKYGYDQKSDKVYLQTFDFNELKRIKT
FT                   ELLPKLGMDVKLVQLVAYTDWHETEEKDASGKWVNYNYDWMFKDGAMAEVAKYADGVGP
FT                   GWYMLVDDKNSKLGDIKYTPMVKDIAKTKMELHPYTVRKDALPEFFSDVNQMYDALLNK
FT                   AGATGVFTDFPDTGVQFIKGTK"
FT   gene            460059..461744
FT                   /gene="glpA"
FT                   /locus_tag="APP7_0403"
FT   CDS_pept        460059..461744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpA"
FT                   /locus_tag="APP7_0403"
FT                   /product="anaerobic glycerol-3-phosphate dehydrogenase
FT                   subunit A"
FT                   /EC_number="1.1.5.3"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61055"
FT                   /db_xref="GOA:B3H0P3"
FT                   /db_xref="InterPro:IPR000447"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR017752"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0P3"
FT                   /protein_id="ACE61055.1"
FT                   /translation="MNISPQMYQNVADFSPINTDVIIIGGGATGAGIARDCALRGLKCV
FT                   LLERRDIATGATGRNHGLLHSGARYAVNDRESAEECIKENLILKQIARHCVDDTKGLFI
FT                   TLPEDDLNYQKNFIQACTDSGIEAVEIEPDLAKYMEPSVNPSLVGAVVVPDGSIDPFRL
FT                   TASNMLDATENGAQIFTYCEVKGLIREGGRVIGVNVYDHRNRIDRQFFALIVVNAGGIW
FT                   GQGIAEYADLKIKMFPAKGSLLVMGHRINNMVINRCRKPANADILVPGDTICVIGTTSD
FT                   RIPYDQIDNMAVTPEEVDVLFREGEKLAPSLRHTRVLRAYAGVRPLVATDDDPSGRNVS
FT                   RGIVLLDHAERDGLDGFITITGGKLMTYRLMAEWATDLVCKKLNKSDRLCSTAERPLPG
FT                   SNESREETSKKIISLPNTIRHSAVYRHGSRALRLLETERLDKTLVCECEAVTAGEVRYA
FT                   VDELNVNNLVDLRRRTRVGMGTCQAELCACRAAGLMSRFKVATPKESTTQLASFMEERW
FT                   RGIQPIAWGDAMREAEFTSWIYYSLLGLNDVPMDKEQGVNSNEF"
FT   gene            461734..463020
FT                   /gene="glpB"
FT                   /locus_tag="APP7_0404"
FT   CDS_pept        461734..463020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpB"
FT                   /locus_tag="APP7_0404"
FT                   /product="anaerobic glycerol-3-phosphate dehydrogenase
FT                   subunit B"
FT                   /EC_number="1.1.5.3"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61056"
FT                   /db_xref="GOA:B3H0P4"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR009158"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3H0P4"
FT                   /protein_id="ACE61056.1"
FT                   /translation="MNFDVVIIGGGLAGLTCGIALQEQGKRCVIINNGQAAIDFSSGSM
FT                   DLLSRLPSGQKVENVYQSLDELKLQAPEHPYSILGKDQVLAKAQQFEQLAQSLNLHLEG
FT                   STVQNHERITPLGGLRATWLSPNSVPTVKHLTALADKQVAILGIEGYHDFQPQLLADNL
FT                   KQHSQFADYEFTIGYLNIPELDYLRQNSREFRSVNIAQLLEHKLSFQDLVQEIKQAAGN
FT                   AKAVFLPACFGLDNQDFFNSLQQATGLALFELPTLPPSLLGIRQHRQLRSRFEQLGGMM
FT                   MNGDRAVKAEFEGKNVARIFTTSHQEEPISADYFVLAAGSFFSNGLVAEFERVKEPVFD
FT                   LDICGCKNFDSSDRFTWTNNRFAAPQPYQSAGVVINSACQVQKNGEVVSNLYAVGNVIG
FT                   GFQGIEQGCGSGVAVVTALTVAEQIGGTK"
FT   gene            463017..464291
FT                   /gene="glpC"
FT                   /locus_tag="APP7_0405"
FT   CDS_pept        463017..464291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpC"
FT                   /locus_tag="APP7_0405"
FT                   /product="anaerobic glycerol-3-phosphate dehydrogenase
FT                   subunit C"
FT                   /EC_number="1.1.5.3"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61057"
FT                   /db_xref="GOA:B3H0P5"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017753"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0P5"
FT                   /protein_id="ACE61057.1"
FT                   /translation="MNIQQLIENARQGAQSPVVHQHFDPSFESCLKCTACTAVCPVSRN
FT                   NPFYPGPKQSGPDGERLRLKSPDFYDEALKYCTNCKRCEIACPSDVKIGDIIVRARNRH
FT                   VERQNKPLIHKLRDAVLSNTDIMGTMNTPFAPIVNTITGLKATRFLLEKTLKVSQHRTL
FT                   PKYSFGSFRNWYMKKEAKRQAQFKEQVAYYHGCYVNYNNPQLGKEVIDVMNALDIGVVL
FT                   LEKEKCCGLPLMVNGFPERAKKQAEFNLKYLEKTVDKQLEVIGTSSSCTANIKEEYSHV
FT                   LGMPNTKVKSHINIVTRYLYKLQKAGRKLPLKPMRLRVAYHTACHVEKAGWAPYTLELL
FT                   KQIPELEVVMLPSQCCGIAGTYGFKAENYETSQAIGRTLFEHINEGGFDYVISECETCK
FT                   WQIDMSSNVTCLHPITLLSMALDKR"
FT   gene            464556..465695
FT                   /gene="ribD"
FT                   /locus_tag="APP7_0406"
FT   CDS_pept        464556..465695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribD"
FT                   /locus_tag="APP7_0406"
FT                   /product="riboflavin biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61058"
FT                   /db_xref="GOA:B3H0P6"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR004794"
FT                   /db_xref="InterPro:IPR011549"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0P6"
FT                   /protein_id="ACE61058.1"
FT                   /translation="MPVMCFPLPSNSFKTMTDLDYMRRAIALAKQGLGWTNPNPLVGCV
FT                   IVKNGEIVAEGYHEKIGGWHAERNAVLHCKEDLSGATAYVTLEPCCHHGRTPPCSDLLI
FT                   ERGIKKVFIGSSDPNPLVAGRGANQLRQAGVEVVEGLLKEECDALNPIFFHYIQTKRPY
FT                   VLMKYAMTADGKIATGSGESKWITGESARARVQQTRHQYSAIMVGVDTVLADNPMLNSR
FT                   MPNAKQPVRIVCDSQLRTPLDCQLVQTAKEYRTVIATVCDDLQKVEQFRPLGVEVLVCK
FT                   ARNKRVDLQDLLQKLGEMQIDSLLLEGGSSLNFSALESGIVNRVHCYIAPKLVGGKQAK
FT                   TPIGGEGIQQIDQAVKLKLKSTELIGEDILLDYVVISPL"
FT   gene            465819..466466
FT                   /gene="ribE"
FT                   /locus_tag="APP7_0407"
FT   CDS_pept        465819..466466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribE"
FT                   /locus_tag="APP7_0407"
FT                   /product="riboflavin synthase alpha chain"
FT                   /EC_number="2.5.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61059"
FT                   /db_xref="GOA:B3H0P7"
FT                   /db_xref="InterPro:IPR001783"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR026017"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0P7"
FT                   /protein_id="ACE61059.1"
FT                   /translation="MFTGIIEEVGKIAQIHKQGEFAVVTINATKVLQDVHLGDSIAVNG
FT                   VCLTVTSFSSNQFTADVMSETLKRTSLGELKSNSPVNLERAMAANGRFGGHIVSGHIDG
FT                   TGEIAEITPAHNSTWYRIKTSPKLMRYIIEKGSITIDGISLTVVDTDDESFRVSIIPHT
FT                   IKETNLGSKKIGSIVNLENDIVGKYIEQFLLKKPADEPKSNLSLDFLKQAGF"
FT   gene            466527..467732
FT                   /gene="ribA"
FT                   /locus_tag="APP7_0408"
FT   CDS_pept        466527..467732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribA"
FT                   /locus_tag="APP7_0408"
FT                   /product="riboflavin biosynthesis protein"
FT                   /EC_number="3.5.4.25"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61060"
FT                   /db_xref="GOA:B3H0P8"
FT                   /db_xref="InterPro:IPR000422"
FT                   /db_xref="InterPro:IPR000926"
FT                   /db_xref="InterPro:IPR016299"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR032677"
FT                   /db_xref="InterPro:IPR036144"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3H0P8"
FT                   /protein_id="ACE61060.1"
FT                   /translation="MTDFQFSKVEDAIEAIRQGKIILVTDDEDRENEGDFICAAEFATP
FT                   ENINFMATYGKGLICTPISTEIAKKLNFHPMVAVNQDNHETAFTVSVDHIDTGTGISAF
FT                   ERSITAMKIVDDNAKATDFRRPGHMFPLIAKDGGVLVRNGHTEATVDLARLAGLKHAGL
FT                   CCEIMADDGTMMTMPDLQKFAVEHNMPFITIQQLQEYRRKHDSLVKQISVVKMPTKYGE
FT                   FMAHSFVEVISGKEHVALVKGDLTDGEQVLARIHSECLTGDAFGSQRCDCGQQFAAAMT
FT                   QIEQEGRGVILYLRQEGRGIGLINKLRAYELQDKGMDTVEANVALGFKEDEREYYIGAQ
FT                   MFQQLGVKSIRLLTNNPAKIEGLKEQGLNIVAREPIIVEPNKNDIDYLKVKQIKMGHMF
FT                   NF"
FT   gene            467843..468304
FT                   /gene="ribH"
FT                   /locus_tag="APP7_0409"
FT   CDS_pept        467843..468304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribH"
FT                   /locus_tag="APP7_0409"
FT                   /product="6,7-dimethyl-8-ribityllumazine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61061"
FT                   /db_xref="GOA:B3H0P9"
FT                   /db_xref="InterPro:IPR002180"
FT                   /db_xref="InterPro:IPR034964"
FT                   /db_xref="InterPro:IPR036467"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3H0P9"
FT                   /protein_id="ACE61061.1"
FT                   /translation="MAKITGNLVATGLKFGIVTARFNDFINDKLLSGAIDTLVRHGADE
FT                   NNIDTAWVPGAFEIPLVAKKMATSGKYDAVICLGTVIRGSTTHYDYVCNEAAKGIGAVA
FT                   LETGVPVIFGVLTTENIEQAIERAGTKAGNKGSECALGAIEMVNVLKAI"
FT   gene            complement(468393..468881)
FT                   /gene="greB"
FT                   /locus_tag="APP7_0410"
FT   CDS_pept        complement(468393..468881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="greB"
FT                   /locus_tag="APP7_0410"
FT                   /product="transcription elongation factor GreB"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61062"
FT                   /db_xref="GOA:B3H0Q0"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR006358"
FT                   /db_xref="InterPro:IPR018151"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028624"
FT                   /db_xref="InterPro:IPR036805"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0Q0"
FT                   /protein_id="ACE61062.1"
FT                   /translation="MAKSNYITRSGWQTLDQELKFLWKDERPKVTQAVSEAAALGDRSE
FT                   NAEYIYGKRRLREIDRRVRFLSKRLEVLQIVDYHPKQEGKVFFGAWVELENEQGETKQY
FT                   RIVGCDEFDPAKNWISIDSPVARALIGKEADDEIKVDTPLGKSLLYINKIWYEKEGLY"
FT   gene            complement(468891..469826)
FT                   /gene="kpsF"
FT                   /locus_tag="APP7_0411"
FT   CDS_pept        complement(468891..469826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kpsF"
FT                   /locus_tag="APP7_0411"
FT                   /product="arabinose-5-phosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61063"
FT                   /db_xref="GOA:B3H0Q1"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004800"
FT                   /db_xref="InterPro:IPR035474"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0Q1"
FT                   /protein_id="ACE61063.1"
FT                   /translation="MNYLASANETLSLYAQAISQLNQRLDGAFNQAVEMVLNCEGRVVV
FT                   AGIGKSGLVGQKMVATFASTGTPSFYLHPTEAFHGDLGMLKPIDVVILISNSGETDDVI
FT                   KLLPSLKSFGNKIIAMTGNPNSTLAQHANLILNIGVEREACPNNLAPTTSTLVTMALGD
FT                   ALAIALINARDFKAEDFARFHPGGSLGRKLLNRVKDVMQTKLPIAQPNADFSTILSVMN
FT                   EGRMGVALIMQGEQLQGIITDGDIRRTLAQFGTDSLAKTAEQIMSKHPKTVSDNTYLAK
FT                   AEEMMKELHIHSLIALNDEGKVSGIMEFSS"
FT   gene            complement(469954..471246)
FT                   /gene="pepB"
FT                   /locus_tag="APP7_0412"
FT   CDS_pept        complement(469954..471246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepB"
FT                   /locus_tag="APP7_0412"
FT                   /product="peptidase B"
FT                   /EC_number="3.4.11.23"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61064"
FT                   /db_xref="GOA:B3H0Q2"
FT                   /db_xref="InterPro:IPR000819"
FT                   /db_xref="InterPro:IPR001346"
FT                   /db_xref="InterPro:IPR008330"
FT                   /db_xref="InterPro:IPR011356"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0Q2"
FT                   /protein_id="ACE61064.1"
FT                   /translation="MVTMNITLSQDPAPEQWGKNAILSANQQGMTIHLQKDPLTTIQRA
FT                   ARKIKNQGVLNVTLSGQGWTLEECWAFHQGFISVRNIGTVSYPDLAEQQAEFDARLHCS
FT                   DFTRALINESSETLTPERLAQKAAEFITKQSEQYLGKNVVSAEMISGEVLKQQGYHGIW
FT                   TVGKGSANKPTLLKLDFNPSGDINAPVLACLVGKGITFDTGGYSIKPSDSMSTMRTDMG
FT                   GAALLTGALGFAISRGLTQRVKLYLCCAENMVSSTAFKLGDIIEYRNGVSAEVLNTDAE
FT                   GRLVLADGLIEASEQNAKFLIDAATLTGAAKVAVGNDYHSVLSMDDELTACLFNAAKAE
FT                   NEPFWRLPFEEFHRSQISSSFADIANIGSVPVGAGASTATAFLSYFVKDYEKNWLHIDA
FT                   SATFRKTASDLWAAGATGLGMKTLANLLLSR"
FT   gene            complement(471360..472175)
FT                   /gene="ompP4"
FT                   /locus_tag="APP7_0413"
FT   CDS_pept        complement(471360..472175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ompP4"
FT                   /locus_tag="APP7_0413"
FT                   /product="lipoprotein E precursor"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61065"
FT                   /db_xref="GOA:B3H0Q3"
FT                   /db_xref="InterPro:IPR005519"
FT                   /db_xref="InterPro:IPR006423"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0Q3"
FT                   /protein_id="ACE61065.1"
FT                   /translation="MKLFKLTGLAVASAFILTACAHHDTSNHDEMILQEQAALGLNWVQ
FT                   QSGEYQALAHQAFNTAKVAFDQAKVAKGKKKAVVVDLDETMVDNSAYAGWQVKNHKAFD
FT                   GESWTRWVNARQTQAIAGAVEFNNYVNSHKGTMFYVSNRKDNGEKAGTLDDMKKLGFTG
FT                   VSEQTLFLKKDKSNKTPRFEEIEKQGYEIVLYLGDNLNDFGDATYKKSNAERRDFVAAN
FT                   KDKFGKKFIVLPNPNYGDWEGGLDKNYYKGDAKSRLDIRHGAIKAWDGK"
FT   gene            472348..473286
FT                   /locus_tag="APP7_0414"
FT   CDS_pept        472348..473286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0414"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61066"
FT                   /db_xref="GOA:B3H0Q4"
FT                   /db_xref="InterPro:IPR002657"
FT                   /db_xref="InterPro:IPR004710"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0Q4"
FT                   /protein_id="ACE61066.1"
FT                   /translation="MNFLLKLTLFVSKTFAIWVVVFAFISAQYPETFKQFVPWIPYLLG
FT                   IVMLGMGLTLTFKDFGEVTKNPKAAIIGVIAQFVVMPSIAFLLAKAFQLPPDLAIGVIL
FT                   VGSCPGGTSSNVMTYLARGNTALSVACTTVSTLLAPVLTPAIFYLFASEWLEIDAGAMF
FT                   VSVLKMVLLPIFVGVVIRSIFKQKIEQFSQTMPLISVVAIILIVTAVVSVSKDRIIESG
FT                   LLIFFVVVLHNGLGYLIGYTVGRVLKLPIADSKAISIEVGMQNSGLGAALAALHFKANP
FT                   VVAVPSAVFSFWHNISGPVLAMIFASIKNEK"
FT   gene            complement(473366..474547)
FT                   /gene="macA"
FT                   /locus_tag="APP7_0415"
FT   CDS_pept        complement(473366..474547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="macA"
FT                   /locus_tag="APP7_0415"
FT                   /product="probable macrolide-specific efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61067"
FT                   /db_xref="GOA:B3H0Q5"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0Q5"
FT                   /protein_id="ACE61067.1"
FT                   /translation="MKLKSLITGLTLAGIITAGYFYFFNQSDNQQVYYITEPVARGTID
FT                   KHVLATGSVRASKRTEVGAQVSGKIINLYVTLGQQVKKGDLLAEIDSSNQSNSLSTAEA
FT                   TLSSYQAQLKSAQVALEVAQSNFNRLNKLYKQQSASQSDFETAKNTLASARATVDNVKA
FT                   QIKSAQISVNDAKTNLNYTQIVSPMDGTIVSIPVSVGQTVNANQTSPTIVHVADLSKML
FT                   VKLEISEGDIAQVKAGQAIRFTTLAEPNHTHNSKIDSVDPALTTLSDDNASNKYAEKSG
FT                   NTEAIYYYANSLVENSEQRLRIGMTVQGQVDIVKRENVLIVPTSALKKKSNAVFINVLE
FT                   NNQSIEKKVEIGLADSQYTEVLSGLNEGEKVITAQRTDDEKISAEIRRRPGGF"
FT   gene            complement(474644..475459)
FT                   /locus_tag="APP7_0416"
FT   CDS_pept        complement(474644..475459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0416"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61068"
FT                   /db_xref="GOA:B3H0Q6"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0Q6"
FT                   /protein_id="ACE61068.1"
FT                   /translation="MTHPFRAIVSDLDGTLLNADHKIGQYTIETLSKLSQQGVDIFFAT
FT                   GRNYPDVKHIISKVNVNEAMLITSNGARANFLSGQTVLNHYLPEDIAFQLMNIPFDSNR
FT                   VCLNSYQGDEWFINVDIEQLKKYHKDSGYSYQVVDFSKHHGRQTEKVFFIGKAPEDLVP
FT                   IEQYIKAKFGDRIYMTYSALLCLEVMNKSVSKGNALEELVKLRGYELKDCLAFGDGMND
FT                   IEMLSKVGKGCIMRNADKRLIQALPQHEIIGNNAHESVAAYIRATFGIL"
FT   gene            476056..477597
FT                   /gene="leuA"
FT                   /locus_tag="APP7_0417"
FT   CDS_pept        476056..477597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuA"
FT                   /locus_tag="APP7_0417"
FT                   /product="2-isopropylmalate synthase"
FT                   /EC_number="2.3.3.13"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61069"
FT                   /db_xref="GOA:B3H0Q7"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005671"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036230"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0Q7"
FT                   /protein_id="ACE61069.1"
FT                   /translation="MSNIIIFDTTLRDGEQSLKASLTVKEKLQIALALERLGVDVMEVG
FT                   FPVSSAGDFESVKTIAQHIKNSRVCALSRAVDKDIDVAAEALKVAEAFRIHTFIASSAI
FT                   HVESKLKRSFDDVVEMAVHAVKRARNYTDDVEFSCEDAGRTGIDNICRIVEAAINAGAT
FT                   TVNIPDTVGYCLPYQYGEIIANVMNRVPNIDKAVVSVHCHNDLGMATANSLTAVLNGAR
FT                   QIECTINGIGERAGNTALEEVVMAIKTRQDMFNGRDTRINTQEIHRVSQMVSQLCNMPI
FT                   QPNKAIVGSNAFAHSSGIHQDGMVKNKNTYEIMSPETIGLKKEKLNLTARSGRAAVKNH
FT                   MSEMGYQENDYDLDKLYDAFLKLADKKGQVFDYDLEALAFIDMQAGDEGRLHLDVITSQ
FT                   MISHLPASAFVQVELDGEKLSQVSSGGNGPVDAVFNAILAITGMDIKMLHYNLTAKGEG
FT                   AEALGQVDIVVEHEGRRFHGVGLATDIVESSARALIHAINAIYRAHKVADLKAKK"
FT   gene            477940..478518
FT                   /gene="rpoE"
FT                   /locus_tag="APP7_0418"
FT   CDS_pept        477940..478518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoE"
FT                   /locus_tag="APP7_0418"
FT                   /product="RNA polymerase sigma-70 factor"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61070"
FT                   /db_xref="GOA:B3H0Q8"
FT                   /db_xref="InterPro:IPR000838"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014286"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0Q8"
FT                   /protein_id="ACE61070.1"
FT                   /translation="MSELVADQELVERAQKGDKKAFNLLVVRYQNRVAGLLTRYVSRDD
FT                   IPDIVQESFIKAYRSLESFRGESAFYTWLYRIAVNTAKNHLTALGRRPPKEDILAEDAE
FT                   SFDVGGQLRESDTPENVVLSEELKRVVFDTIENLPEELKTAITLRELEGLSYEEIAEVM
FT                   QCPVGTVRSRIFRAREAIDAKVNPLMQQI"
FT   gene            478538..479161
FT                   /gene="rseA"
FT                   /locus_tag="APP7_0419"
FT   CDS_pept        478538..479161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rseA"
FT                   /locus_tag="APP7_0419"
FT                   /product="putative sigma-E factor negative regulatory
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61071"
FT                   /db_xref="GOA:B3H0Q9"
FT                   /db_xref="InterPro:IPR005572"
FT                   /db_xref="InterPro:IPR005573"
FT                   /db_xref="InterPro:IPR026279"
FT                   /db_xref="InterPro:IPR036147"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0Q9"
FT                   /protein_id="ACE61071.1"
FT                   /translation="MQQNETLSAFMDGKKVDDAFIDELCESPELKQKWARYHAVSSVLH
FT                   GDEIILGRDFSAKMEALLENEEIESQPSVQETTTAPQGKLIKLKRWSMPLMQAGIAASV
FT                   CLVAVLGVNMMNEKNELAQASQPVLQTQPFSDSVQPVSYNAPSKDVATLDKLESQQHKI
FT                   NALLQAQQLQSKLDVEAMNTSKEKEQKEKAQTSSTDKKSELEKN"
FT   gene            479386..479814
FT                   /gene="rseC"
FT                   /locus_tag="APP7_0420"
FT   CDS_pept        479386..479814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rseC"
FT                   /locus_tag="APP7_0420"
FT                   /product="putative sigma-E factor regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61072"
FT                   /db_xref="GOA:B3H0R0"
FT                   /db_xref="InterPro:IPR007359"
FT                   /db_xref="InterPro:IPR026268"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0R0"
FT                   /protein_id="ACE61072.1"
FT                   /translation="MMIETATVVDYQSGIATVQCSAKSACGGCAARNSCGTKSLSALTG
FT                   EKFAPQFKLSVDMPLTVGDKVQIGLPEQTLLLSVFLIYCVPLFVLVLSAAIFSQLFANE
FT                   LFVALFMLISVSMTFWNIRRIMYKKRESEFTPVFLRRL"
FT   gene            479826..481517
FT                   /gene="lcfA"
FT                   /locus_tag="APP7_0421"
FT   CDS_pept        479826..481517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lcfA"
FT                   /locus_tag="APP7_0421"
FT                   /product="long-chain-fatty-acid--CoA ligase"
FT                   /EC_number="6.2.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61073"
FT                   /db_xref="GOA:B3H0R1"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0R1"
FT                   /protein_id="ACE61073.1"
FT                   /translation="MEKIWLQNYPEGSPKTINVTPYDSLLEMFESAVRKHPDIPAYINM
FT                   GKVLTFRKLEERSRAFAAYLQNELRLEKGDRIALMMPNLLQYPIALFGALRAGLVVVNV
FT                   NPLYTPRELEHQLNDSGAKAIVVVSNFAATLEKIVFETNVKHVILTRMGDQLSFGKRTL
FT                   VNFVVKYVKKLVPKYKLPHAVSFREALSIGKQRQYVKPSLYREDLAFLQYTGGTTGVAK
FT                   GAMLSHGNLVANLMQAKWVAEPLLRNSRECIAVIPLPLYHVFALSVNCLLFIELGITGL
FT                   LITNPRDIPSFVKELKKYKVVALTGVNTLFNALLNNEQFKEIDFSHLKLSVGGGASIQS
FT                   AVAKRWHDATDCHIIEGYGMTECSPLIAATRSDSVEHTGSIGVPVPNTDIRIVDDEGND
FT                   VPIGERGELWVKGPQVMQGYWQRPQDTADVLKDGWMATGDIVVMGEDLNLRIVDRKKDM
FT                   IIVSGFNVYPNEIEEVVAHNPKVNEIVAIGIPSKSSGEAIKIFVTKKDESLTREELRTY
FT                   CRQYLTGYKIPREIEFRDELPKSNVGKILRRVLRDEELAKIKEQQN"
FT   gene            481584..482210
FT                   /gene="upp"
FT                   /locus_tag="APP7_0422"
FT   CDS_pept        481584..482210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="upp"
FT                   /locus_tag="APP7_0422"
FT                   /product="uracil phosphoribosyltransferase"
FT                   /EC_number="2.4.2.9"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61074"
FT                   /db_xref="GOA:B3H0R2"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005765"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR034332"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3H0R2"
FT                   /protein_id="ACE61074.1"
FT                   /translation="MKIVEVKHPLVKHKLGLMRAADINTKDFRALATEVGSLLTYEATT
FT                   DLETEAIEIDGWCGKVEVERIKGKKVTVVPILRAGLGMMDGVLEHIPSARISVVGIYRN
FT                   EETLEPVPYFTKLANDVEERLAIIVDPMLATGGSMIATIDLLKKAGCKQIKVLVLVAAP
FT                   EGIKALEAAHPDVELYTASIDSHLNEHGYIVPGLGDAGDKIFGTK"
FT   gene            complement(482318..483187)
FT                   /gene="ksgA"
FT                   /locus_tag="APP7_0423"
FT   CDS_pept        complement(482318..483187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ksgA"
FT                   /locus_tag="APP7_0423"
FT                   /product="dimethyladenosine transferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61075"
FT                   /db_xref="GOA:B3H0R3"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3H0R3"
FT                   /protein_id="ACE61075.1"
FT                   /translation="MSNQNSKKHLGHTARKRFGQNFLHDMNVIHNIVSAINPKNGQFLL
FT                   EIGPGLGALTEPVAEQVDKLTVVELDRDLAERLRHHPFLNHKLTIIEQDALRFNFREYF
FT                   ESLELREGEGVRVFGNLPYNISTPLMFHLFKFHDLIQDMHFMLQKEVVKRLCAAPNSKA
FT                   YGRLTIMAQYYCQVMPVLEVPPTAFKPAPKVDSAVVRLMPHKVLPHPVKDVYWLNRVTT
FT                   QAFNQRRKTLRNALSTLFSPEQLEALSIDLNARAENLSIADYARLANWLYDNPPAVDNQ
FT                   KEIIDEDI"
FT   gene            complement(483253..484203)
FT                   /gene="surA"
FT                   /locus_tag="APP7_0424"
FT   CDS_pept        complement(483253..484203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="surA"
FT                   /locus_tag="APP7_0424"
FT                   /product="peptidyl-prolyl cis-trans isomerase SurA"
FT                   /EC_number="5.2.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61076"
FT                   /db_xref="GOA:B3H0R4"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR015391"
FT                   /db_xref="InterPro:IPR023058"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0R4"
FT                   /protein_id="ACE61076.1"
FT                   /translation="MKLISAKSLLVALVTAIGISQTAIAIEERVVALVDGVPVMESQVQ
FT                   RALGKKANSEANHKAALEQIIDDLLVQKAVKEAGVKVNYAKVDQVIEDIAARNGITYGQ
FT                   LLDALDYQGITLEQYRQQIAQQMAMEQVRHISIGKSIQVDPKDVHAYAKELLEKDKANG
FT                   KLKNVTGVQHRVSHILIKTTPVLNDIQAKAKLAQIVADIKAGKTTFEEAAKANSVDYLS
FT                   AADGGDLGYNFLDIYDPAFAKAASTAKQEQITAPFKSQFGWHILKVTGTQQGDRTEDAY
FT                   NQRAYEQLVDKQAQEAAKDWVKALRKTADVQYVGK"
FT   gene            complement(484284..484823)
FT                   /gene="pyrR"
FT                   /locus_tag="APP7_0425"
FT   CDS_pept        complement(484284..484823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrR"
FT                   /locus_tag="APP7_0425"
FT                   /product="PyrR bifunctional protein"
FT                   /EC_number="2.4.2.9"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61077"
FT                   /db_xref="GOA:B3H0R5"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR023050"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3H0R5"
FT                   /protein_id="ACE61077.1"
FT                   /translation="MEKIIIDAEQFQRTISRISHQIIEKHSSLDNLVLVGIKRRGAEIA
FT                   EMLQSRIAELAQTELPLMALDITFYRDDLHLDHQDPVYTGVESQIDITGKNVILIDDVL
FT                   FTGRTIRAALDALLDFGRATRIELVILVDRGHRELPIRADYVGKNIPTARTEQVQVRTQ
FT                   FYDGMNQVVLIRAKDE"
FT   gene            complement(484839..486269)
FT                   /gene="hldE"
FT                   /locus_tag="APP7_0426"
FT   CDS_pept        complement(484839..486269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hldE"
FT                   /locus_tag="APP7_0426"
FT                   /product="bifunctional protein HldE"
FT                   /EC_number="2.7.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61078"
FT                   /db_xref="GOA:B3H0R6"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011913"
FT                   /db_xref="InterPro:IPR011914"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023030"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0R6"
FT                   /protein_id="ACE61078.1"
FT                   /translation="MMMQYSPKFNNAKVLVLGDVMLDRYWFGATNRISPEAPVPVVKVQ
FT                   DIEERAGGAANVAMNIASLGVPVTLHGLIGQDDAGRALDKLLNSHNIQNHCVALDSHPT
FT                   ITKLRILSRHQQLLRLDFEEGFHHVASDSLLAKLEQEITAYGALILSDYGKGTLESVQQ
FT                   MIQVARKAGVPTLIDPKGTDFERYRGATLLTPNMSEFEAVVGHCKDDDEIVEKGLKLIA
FT                   DFELTALLVTRSEKGMTLLRPNQAPFHLPTQAKEVYDVTGAGDTVISVLATAIADCRPY
FT                   EEACYLANAAAGVVVGKLGTSTVTPTELENAIHHREETGFGILAEDELKRAVEQAKQRG
FT                   EKIVMTNGCFDILHPGHVSYLENARKLGDRLIVAVNTDESVKRLKGESRPINDLNARMA
FT                   VLTGLASVDWVVPFAEDTPQRLIGEILPNLLVKGGDYKPEEIAGSQEVWANGGEVKVLN
FT                   FENGCSTTNVIKKIQASK"
FT   gene            complement(486383..487903)
FT                   /gene="engA"
FT                   /locus_tag="APP7_0427"
FT   CDS_pept        complement(486383..487903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="engA"
FT                   /locus_tag="APP7_0427"
FT                   /product="GTP-binding protein EngA"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61079"
FT                   /db_xref="GOA:B3H0R7"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR016484"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031166"
FT                   /db_xref="InterPro:IPR032859"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3H0R7"
FT                   /protein_id="ACE61079.1"
FT                   /translation="MTPVVALVGRPNVGKSTLFNRLTRTRDALVADFPGLTRDRKYGHA
FT                   NIAGYDFIVIDTGGIDGTEEGVEEKMAEQSLLAIEEADVVLFLVDARAGLVPADIGIAQ
FT                   YLRQREKTTVVVANKTDGIDADSHCAEFYQLGLGEVEQIAAAQGRGVTQLIDQVLAPLG
FT                   EQLNADQAVENEENSANEEADEWDTDFDFENEDDTALLDEALEEETEESIEDKNIKIAI
FT                   VGRPNVGKSTLTNRILGEERVVVYDMPGTTRDSIYIPMERDGQQYTIIDTAGVRKRGKV
FT                   NLAVEKFSVIKTLQAIQDANVVLLTIDAREGISDQDLSLLGFILNAGRSLVIVVNKWDG
FT                   LSQDIKDQVKSELDRRLDFIDFARVHFISALHGSGVGNLFDSVKEAYACATQKNSTSML
FT                   TRILRMAADEHQPPLVNGRRVKLKYAHPGGYNPPIIVIHGNQVEKLADSYKRYLSNYFR
FT                   KSLKIIGSPIRIQFQEGNNPFAGKKNKLTPSQLRKRKRLMKFIKKSKK"
FT   gene            complement(488061..489371)
FT                   /gene="hemA"
FT                   /locus_tag="APP7_0428"
FT   CDS_pept        complement(488061..489371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemA"
FT                   /locus_tag="APP7_0428"
FT                   /product="glutamyl-tRNA reductase (GluTR)"
FT                   /EC_number="1.2.1.70"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61080"
FT                   /db_xref="GOA:B3H0R8"
FT                   /db_xref="InterPro:IPR000343"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR015895"
FT                   /db_xref="InterPro:IPR015896"
FT                   /db_xref="InterPro:IPR018214"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036343"
FT                   /db_xref="InterPro:IPR036453"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3H0R8"
FT                   /protein_id="ACE61080.1"
FT                   /translation="MTILALGINHKTASVNLRSKVAFDDQKRQLAFEQIQHRALAESVV
FT                   ILSTCNRTELYFHNAEITPREEHEDNIAWREQCFEWFAEIHQLEHNELRECIYFKQNME
FT                   AARHLMRVACGLDSLILGEPQILGQVKQAYQYSENFYQSQNSHISTKLSRLFQRTFSTA
FT                   KRVRSETEIGSSAVSVAYAACGLARQIFDNFGKLRFLLVGAGETIELVARYLIQHGAKN
FT                   IMIANRTPQRAETLAERLNTPMQILSLSALQIGLNQADIVISSTGSPDMLISKEMVEIA
FT                   QKQRQFDPMLLIDIAVPRDIDENAGELDAVYSYSVDDLQHIIQRNMAQREQAAEQAAQI
FT                   VDEECKAFFEWLKQQQSSDLIKRYRQDAEQTRQELLAKALVALTSGQDSEKVLNELSYK
FT                   LTNSLLHVPTQALQAMAKSGNSQGLQSFSKALKLEEQ"
FT   gene            489649..491856
FT                   /gene="relA"
FT                   /locus_tag="APP7_0429"
FT   CDS_pept        489649..491856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="relA"
FT                   /locus_tag="APP7_0429"
FT                   /product="GTP pyrophosphokinase"
FT                   /EC_number="2.7.6.5"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61081"
FT                   /db_xref="GOA:B3H0R9"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004811"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR033655"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0R9"
FT                   /protein_id="ACE61081.1"
FT                   /translation="MVAIRRSHELDPSTFELASWSAALQMSPITFEELQIAWRYAHEKL
FT                   DTDTYHLMWDGIEMVEILHGLNMDDDSLVAALLFPLVKNHIIDLAQVKEDFGNQVKNLV
FT                   KGVIEMDNIRQLSANSVSDLQIDNIRRMLLAMVDDFRCVVIKLAERIVYLRGKYRHTEE
FT                   DLVLAAKECSHIYAPLANRLGIGQLKWELEDYCFRALHPQCYRVIALQLGERRLERESY
FT                   IAKFVADLTACLSEQIGDLEVYGRPKHIYSIWKKMQKKNLRFEQLFDIRAVRVIVPNLE
FT                   DCYTALGIIHTQYKHLPEHFDDYIANPKPNGYQSIHTVVLGEDERTIEVQIRTRAMHEN
FT                   AELGVAAHWKYKEGATAGRSGYEEKIVWLRKLLAWQNDIADSGEIMAAEMSSQVFDDRV
FT                   YVFTPKGEVIDLPKNATPLDFAYAIHSEVGHRCIGAKVAGRIVPFTYLLQMGDQVEIIT
FT                   QKNPNPSRDWLNPNAGFVNTSKARAKIIAWFKKLDREKNIPLGKEALEAEMARFGFTYK
FT                   QIEQYALPRYNLKQFDDLYAGIGGGDIRLNQLSHYLQSKLIKPTAEQEDEAVLKQVNKN
FT                   ANNQQHKGKNGQIIIDGVGNLMHTIARCCQPIPGDEIVGYITQGRGISIHRADCEQLFD
FT                   LRSANPERVVNAQWGTHYANGFSLAIRVTANDRNGLLRDVSAVMANEKVNVLSVSSRID
FT                   AKRSLAIMDMSIELNNIEMLGKLLARIAQLDDVIEAKRLSN"
FT   gene            491924..493120
FT                   /gene="dxr"
FT                   /locus_tag="APP7_0430"
FT   CDS_pept        491924..493120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dxr"
FT                   /locus_tag="APP7_0430"
FT                   /product="1-deoxy-D-xylulose 5-phosphate reductoisomerase"
FT                   /EC_number="1.1.1.267"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61082"
FT                   /db_xref="GOA:B3H0S0"
FT                   /db_xref="InterPro:IPR003821"
FT                   /db_xref="InterPro:IPR013512"
FT                   /db_xref="InterPro:IPR013644"
FT                   /db_xref="InterPro:IPR026877"
FT                   /db_xref="InterPro:IPR036169"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0S0"
FT                   /protein_id="ACE61082.1"
FT                   /translation="MDMKKLVILGSTGSIGKSTLSVVEQNKTEYEVFGLVGGKNVELMT
FT                   TQCLLFQPKFAALDDENAAKALVEQLRQLNVKTEVLSGQKAICELSAHPEVDMVMAAIV
FT                   GAAGLLPTLSAVKAGKKVLLANKESLVTCGQIFIDEARKSGAQLLPVDSEHNAIFQSLP
FT                   PEAQQKVGFCPLAELGVSKIILAGSGGPFRVKPLDEFAAITPAQAVAHPNWSMGKKISV
FT                   DSATMMNKGLEYIEARWLFNASAEEMEIIIHPQSIIHSMVRYIDGSVIAQMGNPDMCTP
FT                   IAHTMAYPKRINAGVAPLDFFKLKELTFIEPDFARYPNLKLAIDAFSEGQYATTAMNAA
FT                   NEVAVEAFLNERIRFIDIVNVNRTVVENIAPVQVKEIADVLHIDKLARELAEQAVINL"
FT   gene            complement(493180..493974)
FT                   /gene="lpxA"
FT                   /locus_tag="APP7_0431"
FT   CDS_pept        complement(493180..493974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxA"
FT                   /locus_tag="APP7_0431"
FT                   /product="Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine
FT                   O-acyltransferase"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61083"
FT                   /db_xref="GOA:B3H0S1"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR010137"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR029098"
FT                   /db_xref="InterPro:IPR037157"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3H0S1"
FT                   /protein_id="ACE61083.1"
FT                   /translation="MRLIDSTAKISPLAVVEEGAQIGAHVEIGPFSVIGKNVKIGAKTI
FT                   IHSHVVINGHTEIGEQNQIFQFASIGEINQDLKYQGEPTKVIIGNRNRIRESVTIHRGT
FT                   VQGGGVTRIGNDNLFMINTHIAHDCSIGNRCIIANNGTLAGHVTLDDFVIVGGMSAIHQ
FT                   FVVIGSHVMLGGGSMVSQDVPPYVMAQGNHAQPFGVNLEGLKRRGFDKPAMHAIRNAYK
FT                   LIYRSGKTIEEAIPEIEQFAVNEPAVQLFLDFFKRSTRGIIR"
FT   gene            complement(494002..494466)
FT                   /gene="fabZ"
FT                   /locus_tag="APP7_0432"
FT   CDS_pept        complement(494002..494466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabZ"
FT                   /locus_tag="APP7_0432"
FT                   /product="(3R)-hydroxymyristoyl-[acyl-carrier-protein]dehydratase"
FT                   /EC_number="4.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61084"
FT                   /db_xref="GOA:B3H0S2"
FT                   /db_xref="InterPro:IPR010084"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3H0S2"
FT                   /protein_id="ACE61084.1"
FT                   /translation="MTIEVQENREPKIIEVTEIMKMLPHRYPFLLVDRVIDFEEGKWLK
FT                   AIKNVTVNEPCFTGHFPESPIFPGVLILEAMAQATGVLAVATHGKMAQDELYYFAAIDN
FT                   ARFKRPVVPGDQLTFEVEFLKEMRGITKFTGKAFVDGKLVCEADLMCARK"
FT   gene            complement(494535..495560)
FT                   /gene="lpxD"
FT                   /locus_tag="APP7_0433"
FT   CDS_pept        complement(494535..495560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxD"
FT                   /locus_tag="APP7_0433"
FT                   /product="UDP-3-O-[3-hydroxymyristoyl] glucosamine
FT                   N-acyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61085"
FT                   /db_xref="GOA:B3H0S3"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR007691"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR020573"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0S3"
FT                   /protein_id="ACE61085.1"
FT                   /translation="MANFRLIELAEQIGGTLRGNADLAISSIAALDKANSSQITFISNA
FT                   KYRPQLAQSQAGAIIVSEADIEFCAESQNLIIVKNPYVAYALLAQYMDSTPKAANSISP
FT                   HAVISSEAILGNNVFVGANAVIESGVELGDDVIIGAGCFIGKNTKIGARTQLWANVSVY
FT                   HNVRIGSDCLIQSSAVIGSDGFGYANDKGQWIKIPQTGGVIIGNRVEIGACTCIDRGAL
FT                   DPTVIEDNVIIDNLCQIAHNVHIGFGTAVAGGVIMAGSLKVGRFCQIGGASVLNGHMEI
FT                   CDGAVITGMSMVMKPITEKGIYSSGIPAQTNKEWRKTAALTMNIDEMNKRLKAIEKRLA
FT                   E"
FT   gene            complement(495560..496366)
FT                   /locus_tag="APP7_0434"
FT   CDS_pept        complement(495560..496366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0434"
FT                   /product="hypothetical outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61086"
FT                   /db_xref="GOA:B3H0S4"
FT                   /db_xref="InterPro:IPR005632"
FT                   /db_xref="InterPro:IPR024930"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0S4"
FT                   /protein_id="ACE61086.1"
FT                   /translation="MKKLFKAATVTAALATAGLAQASDTIGFVDPNYLLQNHPVAIDAA
FT                   QKFEKFMKEGQSKFADEDKKLAEENKALTAERNKLESDAKKLQEEQTKVEASLKKKSAA
FT                   LEKDAPRLRSKEIQARQNAIEAEYKAFQNKVSAIQKREADFGKKAEAFQKKADAFQEKL
FT                   NKAQQEAGGMDPQAVQKQVVEEINATVKEVAKSKGYTLVLPPSVALYAEDETKDITEKV
FT                   LEALKAKHPEIKIEQPVANPEVKAEEAKPATDAPQAETTKPEEAKK"
FT   gene            complement(496482..498863)
FT                   /gene="d15"
FT                   /locus_tag="APP7_0435"
FT   CDS_pept        complement(496482..498863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="d15"
FT                   /locus_tag="APP7_0435"
FT                   /product="protective surface antigen D15 precursor"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61087"
FT                   /db_xref="GOA:B3H0S5"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR010827"
FT                   /db_xref="InterPro:IPR023707"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0S5"
FT                   /protein_id="ACE61087.1"
FT                   /translation="MKKFLLSSLLIANGVVAAPFVVKDIRVDGVQAETGQAIISSLPVK
FT                   VGQTATDNDVANVVRQLFEQNRFDDVRATREGNTLVIKVAERPFINSVDVEGNSAIPKE
FT                   PLQENLKANLITKGELYDAAKLEGFKQGLLDHYHSIGRYEAKIDTTTTRNENGGINIKL
FT                   NITEGEVAYVKNIKFEGNQVFTDKELTKPLDIQPDVSWWNIFESSKFEQQAYNKDLETL
FT                   RDYYLNRGYAQFALQDTDVTFNDKKTEVDLTYKIHEGAQYNISDIRIIGNTAKLDNELN
FT                   TLLKDFEPGQLFRKSELVEIEEGIKQILGEHGFGSAKVDLYPKFNEQDKTVQINFIVDA
FT                   GRRIYVRKIRFEGNDVTADSTLRREMRQQEGAWLSTTNAALGKSRLERTGFYETVDMTM
FT                   PTVQNTDDQVDLVYKIKERNTGSINFGIGYGTESGISYQAGIKQDNFLGMGSTVSLSGR
FT                   RNDYGTSVNLGYTEPYFTKDGVSLGGNVFYEDYDNSDSNTSAAYKRQTYGINGTLGFPV
FT                   NENNSYYLGLGYTHDKLKNVKREFTREKYVKSMNFPIIDGSNRYERIKADDFDFSFGWN
FT                   YNSLNRGYFPTEGTTANIGGKVTIPGSDNKYYRLNADFRNYYPLNREHKWVISTKAGLA
FT                   YTKGFGGKEVPFYQLYSAGGIGTLRGFAYGAIGPKAIYYSTQSNKFTNASDDVVGGNAM
FT                   ANASLELITPTPFVSDKYQHNVRTSLFVDAASVWNTKWKKSVYPTLPDYKDYKRVRASA
FT                   GIAFQWQSPIGPLAFSYAKPIKKYAGDEIEQFQFSIGSSF"
FT   gene            complement(498925..500238)
FT                   /gene="ecfE"
FT                   /locus_tag="APP7_0436"
FT   CDS_pept        complement(498925..500238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ecfE"
FT                   /locus_tag="APP7_0436"
FT                   /product="putative zinc metalloprotease"
FT                   /EC_number="3.4.24.-"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61088"
FT                   /db_xref="GOA:B3H0S6"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004387"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0S6"
FT                   /protein_id="ACE61088.1"
FT                   /translation="MTSVIAFFILICVLVFVHEYGHFWAARKCGVKVIRFSIGFGKVLF
FT                   KKTDKHGTEFAFSLIPLGGYVQMYNGENEHQARADQTLASKSVLQRAFIIVAGPLANFI
FT                   FAILAYWLVFANGIPTLKPVTGQILPDTIAAQAKLPTEFDIKRVASHNVQDWEETTLAL
FT                   IGYVGSDRVEVEGSLVGEDRLQRFYLDLSNWNVDGNKENPLTTLGIRTKSSIVKPEIKQ
FT                   VIENSPAAKAGLQAGDKIVSVNQTPFDWADLVKQVQTGQIFELTVEKSGNTYRYSLQPD
FT                   KKDDRYFIGIVPSYEPLADKYRTELKYDILTALWKSVEKVGALVKTILQFIGNLITGEL
FT                   SLKNMGGPISMAKGAGATAEIGWVYYISFMALISVNLGVMNLFPILPLDGGQLILLGAE
FT                   TVRGKPLAEKFQLRFQQIGVFFVLSLMAFAFMNDLIHF"
FT   gene            complement(500245..501114)
FT                   /gene="cdsA"
FT                   /locus_tag="APP7_0437"
FT   CDS_pept        complement(500245..501114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cdsA"
FT                   /locus_tag="APP7_0437"
FT                   /product="phosphatidate cytidylyltransferase"
FT                   /EC_number="2.7.7.41"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61089"
FT                   /db_xref="GOA:B3H0S7"
FT                   /db_xref="InterPro:IPR000374"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0S7"
FT                   /protein_id="ACE61089.1"
FT                   /translation="MLKERVLSAIVMVIAVLAGIFLLSPLPLTIALAAIITAAMWEWAQ
FT                   FAGFKRSLPRAVVAFVTVCLFILLIFANTNYIRAARFLTDETVPLLFISCVWWLIAFIL
FT                   VVTYPRSANVWAKSVIAKFIFGFCTLIPFFIAALALRFNNYAVDEFQGTYLLLYVCLLV
FT                   WGADSGAYFFGRAFGKHKLAPKVSPGKSWEGAIGGLITSCVIAFLFLELAPSDVFGREL
FT                   STVPFILVSVATVAISVLGDLAESMFKRQANIKDSSNLIPGHGGILDRIDSLTAAIPFF
FT                   ATFFFFVL"
FT   gene            complement(501139..501831)
FT                   /gene="uppS"
FT                   /locus_tag="APP7_0438"
FT   CDS_pept        complement(501139..501831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uppS"
FT                   /locus_tag="APP7_0438"
FT                   /product="undecaprenyl pyrophosphate synthetase"
FT                   /EC_number="2.5.1.31"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61090"
FT                   /db_xref="GOA:B3H0S8"
FT                   /db_xref="InterPro:IPR001441"
FT                   /db_xref="InterPro:IPR018520"
FT                   /db_xref="InterPro:IPR036424"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0S8"
FT                   /protein_id="ACE61090.1"
FT                   /translation="MPQHVAIIMDGNGRWAKQQGKLRVFGHQNGVKAVRSAVSFAAKHG
FT                   IKVLTLYAFSSENWSRPEAEVSALMALFMRALDSEVKKLHKNNIRLNIIGNKSAFSESL
FT                   QKRIAESEKLTENNTGLILNIAANYGSHWDITQAAQQLAIKVKLGEITVSDITPERLQN
FT                   ALVTGTQPLVDLLIRTSGEQRISNFLLWQIAYAELVFSPVLWPDFNDDSFSEAIIAYQQ
FT                   RDRRFGGC"
FT   gene            complement(502024..502731)
FT                   /gene="gloB"
FT                   /locus_tag="APP7_0439"
FT   CDS_pept        complement(502024..502731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gloB"
FT                   /locus_tag="APP7_0439"
FT                   /product="putative hydroxyacylglutathione hydrolase"
FT                   /EC_number="3.1.2.6"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61091"
FT                   /db_xref="GOA:B3H0S9"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR017782"
FT                   /db_xref="InterPro:IPR032282"
FT                   /db_xref="InterPro:IPR035680"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3H0S9"
FT                   /protein_id="ACE61091.1"
FT                   /translation="MLNITPIPALSDNYIWAIQKDNDVIIVDPSDAVPVLAFIAKNQLN
FT                   LTAILLTHNHHDHTDGMPELLSRYPQLSVYGPQEVAQFANRIVQPEDHLTLFDYDVRVI
FT                   ESAGHTAQHVSYLFGNEYLFCGDVLFSGGCGRVFTGNYQAQFDALQRFKALPEFVEIFP
FT                   AHEYTLSNLKFAEAVLAPSCALFEIQERAEILRSRNQPTLPTTLERELQINPFLQAVDL
FT                   DQFIALRHQKDNF"
FT   gene            complement(502790..503707)
FT                   /locus_tag="APP7_0440"
FT   CDS_pept        complement(502790..503707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61092"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0T0"
FT                   /protein_id="ACE61092.1"
FT                   /translation="MAVYYGLDVGGTKIELAAFNAQLEKLYSERVPTPQTNYEDWLNTV
FT                   ETLVLNADQKFGEQGSVGLGLPGFVNRETGIAEITNIRVADGKAILKDLSERLGREVRA
FT                   ENDANCFALSEAWDPNNQQFSTVLGLIIGTGFGGGFVFDGKIHSGRIGMAGEVGHMQLN
FT                   YHALKLLGWDKAPIYDCGCGNRACLDTYISGRGFEMLFRDLVGETISAKEIIERFYQKE
FT                   SKTIEFVDKYIELMAISIGNLITILDPDMIVFGGGLSNFDHIYEALPKALPPHLMRSAK
FT                   VPVFKKAIHGDSGGTRGAAALFLK"
FT   gene            complement(503710..504462)
FT                   /gene="pgpB"
FT                   /locus_tag="APP7_0441"
FT   CDS_pept        complement(503710..504462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgpB"
FT                   /locus_tag="APP7_0441"
FT                   /product="phosphatidylglycerophosphatase B"
FT                   /EC_number="3.1.3.27"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61093"
FT                   /db_xref="GOA:B3H0T1"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0T1"
FT                   /protein_id="ACE61093.1"
FT                   /translation="MRKFSVVKKLSIFTSLMLLIPLFTWATGWKWTFGGMDYHLYDLDF
FT                   WLFFLTETGSTPYALITCVLFMLWLMWLTRKHYSWFLVGFICAGSVVGTQIIKEGAKAV
FT                   FKEPRPFVTEMFQAQTEQFYALPEAEQAQAVLTLAEKTHPNDADFIVSHQAGELGYSFP
FT                   SGHTIFAVSWLLVFGGLLFGLSGKAVVFAQIFTILWAGLMLISRLRLGMHYPIDLFVST
FT                   LIAWLFHIIVFVWVIPFLETFKIFQKRG"
FT   gene            complement(504506..504823)
FT                   /locus_tag="APP7_0442"
FT   CDS_pept        complement(504506..504823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0442"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61094"
FT                   /db_xref="GOA:B3H0T2"
FT                   /db_xref="InterPro:IPR001890"
FT                   /db_xref="InterPro:IPR017924"
FT                   /db_xref="InterPro:IPR035920"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0T2"
FT                   /protein_id="ACE61094.1"
FT                   /translation="MSITLTTKQKQFLKGLAHHLSPVVMLGGNGLTEGVLAEIENALAH
FT                   HELIKVKISGAERETKQLIIDAIVRETKAVPVQTIGHILVLYRQSEEKKISLPKATKAV
FT                   S"
FT   gene            504945..505703
FT                   /gene="lgtF"
FT                   /locus_tag="APP7_0443"
FT   CDS_pept        504945..505703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lgtF"
FT                   /locus_tag="APP7_0443"
FT                   /product="UDP-glucose--lipooligosaccharideglucosyltransferase"
FT                   /EC_number="2.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61095"
FT                   /db_xref="GOA:B3H0T3"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0T3"
FT                   /protein_id="ACE61095.1"
FT                   /translation="MPTLSVAMIVKNEAQDLAKCLETVQGWVNEIIVLDSGSSDETVQI
FT                   AESFGAKVYVNTDWQGFGKQRRLAQQYVTSDYVLWLDADERVTPELKRSILQAVEKNEE
FT                   NTVYQVSRLSEVFGKQIRHSGWYPDYVVRLYRTDFAKYGEELVHEKVHYPKNATVKKLT
FT                   GDLLHFTYKDIHHYLVKSASYAKAWAIQRANAGKKASLLDGVTHALGCFVKMYLLKAGF
FT                   LDGKQGFLLAVLSAHSTFVKYADLWNRTRN"
FT   gene            complement(505766..506587)
FT                   /gene="pbpG"
FT                   /locus_tag="APP7_0444"
FT   CDS_pept        complement(505766..506587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pbpG"
FT                   /locus_tag="APP7_0444"
FT                   /product="penicillin-binding protein 7 precursor"
FT                   /EC_number="3.4.16.4"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61096"
FT                   /db_xref="GOA:B3H0T4"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0T4"
FT                   /protein_id="ACE61096.1"
FT                   /translation="MLKKFLSLLLLSPSLAMAQSYVVYDFTHDRILESRAANNVQPIAS
FT                   VTKLMTANIFLENNKNKNCSASISDQDFDHIKGTGTKLPKHTPIACDELLKAMLVHSDN
FT                   YAAHALSRSAGMSRAQFIQKMNQKAQQLGMRSTRFSDSSGLSSANISSALDLVKLAKYS
FT                   LNNAKIQELSNTKAAYVRVGKRNVFMQNTSALVREELFDAAINKTGYIRESGYNLVFVN
FT                   KHQCNHATIGVISLNNRSSATRSTFTKNKLEQYGCVSLAKEDFNYHEEEDI"
FT   gene            complement(506670..507707)
FT                   /gene="waaQ"
FT                   /locus_tag="APP7_0445"
FT   CDS_pept        complement(506670..507707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="waaQ"
FT                   /locus_tag="APP7_0445"
FT                   /product="heptosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61097"
FT                   /db_xref="GOA:B3H0T5"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0T5"
FT                   /protein_id="ACE61097.1"
FT                   /translation="MKKILVIRNDKIGDFMVCFPAFAMLKQSMPNAEITALVPSYTASL
FT                   AELCPSIDNVIIDTPNKKDKTEFNRVLQAVKNAQFDAVICFVSDWYNAKLTWKSGIKHR
FT                   LAPATKVFQFLYNQRLTQRRSQSAKSESEYNLDLARAFLQKHRIAVVEPNPPYLQFSEA
FT                   QLAQQKAKLAKNLQISTACKWLFVHASTGGSATSLSIEQYAQMLNGIASETNCEIVLTA
FT                   GKGESEKAYQLAAQITATKAVVYDKNDGLQDFARSIACADLFIAGSTGPLHIAGALNVA
FT                   TIGFYPSRLSALPRRWRPINEEGKHLAFMPPEAKEKAQQMNLGLISIPEALKTIMPFVK
FT                   NIWHS"
FT   gene            507951..509282
FT                   /gene="argG"
FT                   /locus_tag="APP7_0446"
FT   CDS_pept        507951..509282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argG"
FT                   /locus_tag="APP7_0446"
FT                   /product="argininosuccinate synthase"
FT                   /EC_number="6.3.4.5"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61098"
FT                   /db_xref="GOA:B3H0T6"
FT                   /db_xref="InterPro:IPR001518"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018223"
FT                   /db_xref="InterPro:IPR023437"
FT                   /db_xref="InterPro:IPR024073"
FT                   /db_xref="InterPro:IPR024074"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0T6"
FT                   /protein_id="ACE61098.1"
FT                   /translation="MSATILESLPLGQKVGIAFSGGLDTSAALLWMRKKGAVPYAYTAN
FT                   LGQPDEDDYNAIPKKAMEYGAENARLIDCRAQLAHEGIAAIQCGAFHISTGGIPYFNTT
FT                   PLGRAVTGTMLVAAMKEDDVNIWGDGSTFKGNDIERFYRYGLLTNPKLKIYKPWLDQLF
FT                   IDELGGRFEMSQFLIENGFDYKMSVEKAYSTDSNMLGATHEAKDLEELSTGMKIVKPIM
FT                   GVAFWDESVEIKPETVSVTFEEGVPVALNGKRIEDAVELILEANRIGGRHGLGMSDQIE
FT                   NRIIEAKSRGIYEAPGMALLHIAYERLVTGIHNEDTIEQYRINGLRLGRLLYQGRWFDP
FT                   QALMLRETAQRWVAKAITGTVTLELRRGNDFTILNTESPNLTYEAERLSMEKVEDAPFT
FT                   PADRIGQLTMRNLDIVDTRGKLGIYTETGLLSVQNNVLPQLGKK"
FT   gene            509404..509865
FT                   /gene="rnhA"
FT                   /locus_tag="APP7_0447"
FT   CDS_pept        509404..509865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnhA"
FT                   /locus_tag="APP7_0447"
FT                   /product="ribonuclease HI"
FT                   /EC_number="3.1.26.4"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61099"
FT                   /db_xref="GOA:B3H0T7"
FT                   /db_xref="InterPro:IPR002156"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022892"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0T7"
FT                   /protein_id="ACE61099.1"
FT                   /translation="MKLVEIFTDGSCLGNPGKGGIGIVLRYNGHEKQVSKGYFQTTNNR
FT                   MELRAVIEALAMLKEPCQVQLNSDSQYMKDGITKWIFNWKKNNWKTANGKPVKNKELWI
FT                   ALDQEIQRHKIEWTWVKGHSGHRENEICDELAKAGANNPTLEDIGYNAD"
FT   gene            510022..510525
FT                   /gene="cvpA"
FT                   /locus_tag="APP7_0448"
FT   CDS_pept        510022..510525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cvpA"
FT                   /locus_tag="APP7_0448"
FT                   /product="colicin V production protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61100"
FT                   /db_xref="GOA:B3H0T8"
FT                   /db_xref="InterPro:IPR003825"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0T8"
FT                   /protein_id="ACE61100.1"
FT                   /translation="MVDIIVIGLIAFSILVSLWRGFISEVLSLAGWVVAFFVASGFYPY
FT                   LSSYLTQVNSVYLQNSEYLRNGVAAAVLFILTLIVCGIITALLSKLIDTTGLSATDRVL
FT                   GGAFGALRGILIVAAILFFLDTFSSASQTELWKESQLIPHFDFIVKWFFEQLQANSSFL
FT                   NSTK"
FT   gene            510539..512056
FT                   /gene="purF"
FT                   /locus_tag="APP7_0449"
FT   CDS_pept        510539..512056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purF"
FT                   /locus_tag="APP7_0449"
FT                   /product="amidophosphoribosyltransferase"
FT                   /EC_number="2.4.2.14"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61101"
FT                   /db_xref="GOA:B3H0T9"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR035584"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0T9"
FT                   /protein_id="ACE61101.1"
FT                   /translation="MCGIVGIIGGSPVNQAIYDGLTLLQHRGQDAAGIVTIDDENRFRL
FT                   RKANGLVSDVFRQEHMLRLQGNAGIGHVRYPTAGSSSVSEAQPFYVNSPFGLTLVHNGN
FT                   LTNNAELKERLFKEARRHVNTNSDSESLLNIFAHYLDQYPTSHLTPENIFETVRKTNEA
FT                   IRGAYACIAMIIGHGMVAFRDPFGIRPLVLGKRVVEGKTEYMFASESVALDIVGFEFVR
FT                   DVNPGEAVYITFDGELHSAICADNPKLNPCIFEYVYFARPDSVIDGVSVYGARVHMGEL
FT                   LGEKIKREWGRMVDEIDVVIPIPETSNDIAVRIANVLYKPYRQGFVKNRYVARTFIMPG
FT                   QAQRKSSVRRKLNAIASEFKGKNVLLVDDSIVRGTTSEQIVEMARAAGAKKVYFASAAP
FT                   EIRYPNVYGIDMPTCEELVAYDRSVEEVAEMIGVDKLIFQDLEALYKAVQAENPTIQHF
FT                   DASVFTGEYITGDVDKAYLDAIAHARNDKAKAKAAKQATNLEIHNEN"
FT   gene            complement(512125..512583)
FT                   /locus_tag="APP7_0450"
FT   CDS_pept        complement(512125..512583)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61102"
FT                   /db_xref="InterPro:IPR035279"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0U0"
FT                   /protein_id="ACE61102.1"
FT                   /translation="MMRKILFTLVCATLAHTGFANSAENSTAYTEQVKYKISETDIKIL
FT                   IRQLNNIEQCIFPDLAKPDYQKIYDNWSVAENMTMFYFQQNLLTELIGEQNAQFIEKDK
FT                   LSRQYFEQMHEKYNHQKASVDKSRCEDFKPIYAQIKQRIEYSIPQVYK"
FT   gene            complement(512679..514019)
FT                   /gene="gdhA"
FT                   /locus_tag="APP7_0451"
FT   CDS_pept        complement(512679..514019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gdhA"
FT                   /locus_tag="APP7_0451"
FT                   /product="NADP-specific glutamate dehydrogenase"
FT                   /EC_number="1.4.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61103"
FT                   /db_xref="GOA:B3H0U1"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR014362"
FT                   /db_xref="InterPro:IPR033524"
FT                   /db_xref="InterPro:IPR033922"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0U1"
FT                   /protein_id="ACE61103.1"
FT                   /translation="MSDLNALFQKIKQRDPDQAPFHQAVEEVFGSLAPFLAKNPKYTQQ
FT                   GILERIVEPERVITFRVTWVDDKGQVQVNRGYRIQMNSAIGPYKGGIRFHPSVDLGVLK
FT                   FLAFEQVFKNALTTLPMGGGKGGSDFDPKGKSDAEVMRFCQAFMTELSRHIGEDTDVPA
FT                   GDIGVGGREIGYMYGQYKKLRNEFTSVLTGKSLTWGGSLIRPEATGYGAVYFADAMLAT
FT                   HGQGFDGKRVVISGSGNVAQYAAEKAIQKGAKVLTVSDSNGYVLFPDSGMTEKQLADLL
FT                   VLKNERRERLSVYAKEQGVQYFEGQKPWGVKCDIALPCATQNELDGEAAKELVKNGCFC
FT                   VAEGANMPTTLEGVEVFIAAKILYAPGKAANAGGVATSGLEMSQNAMRLAWTREEVDQR
FT                   LFNIMTAIHQNCVENGTETDGYVNYVNGANIAGFKKVATAMLEQGIV"
FT   gene            complement(514323..514667)
FT                   /gene="smpA"
FT                   /locus_tag="APP7_0452"
FT   CDS_pept        complement(514323..514667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="smpA"
FT                   /locus_tag="APP7_0452"
FT                   /product="small protein A"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61104"
FT                   /db_xref="GOA:B3H0U2"
FT                   /db_xref="InterPro:IPR007450"
FT                   /db_xref="InterPro:IPR026592"
FT                   /db_xref="InterPro:IPR037873"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0U2"
FT                   /protein_id="ACE61104.1"
FT                   /translation="MKMKSLLAIALLAVGVTSCSTVKKVVYRIDVPQGNYLEQEKIDQV
FT                   KVGMDKTQVQYLLGTPMLKDTFNQDRWSYVYIKREGYNDPIQHTLFVNFDSKGLVSNIT
FT                   LDKPITNEAQ"
FT   gene            complement(514738..515790)
FT                   /locus_tag="APP7_0453"
FT   CDS_pept        complement(514738..515790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0453"
FT                   /product="nucleoid-associated protein NdpA"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61105"
FT                   /db_xref="GOA:B3H0U3"
FT                   /db_xref="InterPro:IPR007358"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0U3"
FT                   /protein_id="ACE61105.1"
FT                   /translation="MIISPTFYFYPYLKRNSMSINVTEIVLHQIHQTEGETPELNTVLR
FT                   DNLLAISPEVEQMMLQLHQAYQSKAKAYGIFKNESIFAQQLNRLLEQETDFLPFSHSCA
FT                   KMLSSELAKYPFASGGTFILCRYNFLATDYLFIALIDSRTSMLVDDQLEIKRTEYLDIT
FT                   QYDIACRINLTELKINAQSNRYLTFIKGRVGRKIADFFMDFLSAEEGLNPQLQNQTLLQ
FT                   AVSDYCDQGELSAPQTREVKKQVFEYCKGQINSGEEIALSELSEALPTLNEVDFAQFTQ
FT                   EQEYGLEENIPPVRNALKTLTKYSGSGKGVTISFNADLLGERLIWDELNDTLTIKGLPA
FT                   NLRDQLARNK"
FT   gene            515831..516220
FT                   /locus_tag="APP7_0454"
FT   CDS_pept        515831..516220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0454"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61106"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR019897"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0U4"
FT                   /protein_id="ACE61106.1"
FT                   /translation="MTKVIHTEKAPAAIGPYVQAVDLGNLVLTSGQIPVNPQTGEIPTD
FT                   ITQQARQSLENIKAIVEQAGLSVADIVKTTVFVKDLNDFATVNAEYEAFFRENNHPAFP
FT                   ARSCVEVARLPKDVGLEIEAIAVRK"
FT   gene            516248..516985
FT                   /locus_tag="APP7_0455"
FT   CDS_pept        516248..516985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0455"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61107"
FT                   /db_xref="InterPro:IPR003730"
FT                   /db_xref="InterPro:IPR011324"
FT                   /db_xref="InterPro:IPR038371"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0U5"
FT                   /protein_id="ACE61107.1"
FT                   /translation="MKNITPNWYAPEHIRAFTTVRTGGVSQPPFDNFNLGDHVADNPKD
FT                   VKQNRRLLVEQFGLPHFPLFLTQTHSTRVIRLPYDGDNLEADAVYTDQPNQVCLVMTAD
FT                   CLPVLFYSKDGKEVAAAHAGWRGLCDGVLENTVAEFACSPTDICAWLGPAIGPTKFQVG
FT                   KEVIEQFCAFDPQAEQAFVVDPTASGKFLGNLYQIARQRLRKLGITEISGGEHCTVTER
FT                   EDFFSYRRDKRTGRMASLIWRTE"
FT   gene            517083..517156
FT                   /locus_tag="APP7_tRNA06"
FT   tRNA            517083..517156
FT                   /locus_tag="APP7_tRNA06"
FT                   /product="tRNA-Met"
FT   gene            complement(517226..518242)
FT                   /gene="int"
FT                   /locus_tag="APP7_0456"
FT   CDS_pept        complement(517226..518242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="int"
FT                   /locus_tag="APP7_0456"
FT                   /product="Tyrosine recombinase xerD"
FT                   /function="Integrase"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61108"
FT                   /db_xref="GOA:B3H0U6"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0U6"
FT                   /protein_id="ACE61108.1"
FT                   /translation="MSIYKRKDSAIWWVDVVTPSGSRIRRSSKTAIKKQAQEFHDKLKS
FT                   QLWDVEILNKSPDRYFEEALLLFLKDGQGQKRFDSKQAHAQYFRERFHGRTLKSLTSEE
FT                   LINAIPTFCHRRNKPLSPATQNRYRSSLLRIFSLAHKAGWVEKIPFIMRKNEPKVRVSW
FT                   LEKSQAAELINSLKLEWMRNVCTFALLTGARMSEILTLTWDKVNFAKNLAIVSNDKAKS
FT                   GKARSLPLNNKAIDLLQQIKTKSKSKYVFVRCSTGHAIGDIDRRDFRQACEKIGMPSFH
FT                   FHDLRHTWASWHVQAGTPLFTLKEMGGWETLEMVRKYAHLNANHMLDYANHVTFTSQ"
FT   gene            complement(518472..519329)
FT                   /locus_tag="APP7_0457"
FT   CDS_pept        complement(518472..519329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0457"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61109"
FT                   /db_xref="GOA:B3H0U7"
FT                   /db_xref="InterPro:IPR010995"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0U7"
FT                   /protein_id="ACE61109.1"
FT                   /translation="MAKEKKKRNKKHDPNGWAKKKCKVAMDGSYFMSFQAMGRDDEIFV
FT                   YNNRYLPMNSKGSEQAFHEFFITPHAWTITAGVVCRDQFGYEYQKFSSQTANNHFIYHD
FT                   PEIQQWILDFTADRISEVNKEHIVSSFFIMNPSGYQFNENELSRMYRWTKIYDKSKYLT
FT                   RYECQQIGKQIDDFLLRHPLSEKLENHIVKKLTDAGFGSWMKIYTAEIDCLKAIKGIGE
FT                   KREKQIIGALVELLKSNDEILELSKEYSKQNVRVHQAKRDIERQFADSELVYKMYLEMK
FT                   ASRK"
FT   gene            complement(519379..519606)
FT                   /locus_tag="APP7_0458"
FT   CDS_pept        complement(519379..519606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0458"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61110"
FT                   /db_xref="InterPro:IPR007539"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0U8"
FT                   /protein_id="ACE61110.1"
FT                   /translation="MTKENNGWISVKDKKPELDCGTKSENLLLYGYKSDFEDYVEIFIG
FT                   YMINGNRFYSDNGECGKVTHWQTLPKPPQD"
FT   gene            complement(519599..520069)
FT                   /locus_tag="APP7_0459"
FT   CDS_pept        complement(519599..520069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0459"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61111"
FT                   /db_xref="InterPro:IPR023292"
FT                   /db_xref="InterPro:IPR033653"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0U9"
FT                   /protein_id="ACE61111.1"
FT                   /translation="MKQDTINQIEGWFRTAVPNPTVDNQRVQLGCHFEEVTEMLEALGL
FT                   FEGLFCAGDKLFELAAHLREFDNNNKFIEHLSAKEKIELLDALCDQIVTAIGVAHMFGM
FT                   DIQGALQEVANSNDSKFEDGKPVFNEHGKIAKGKNYFKPELAKFIKKDLGND"
FT   gene            complement(520202..520657)
FT                   /locus_tag="APP7_0460"
FT   CDS_pept        complement(520202..520657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61112"
FT                   /db_xref="GOA:B3H0V0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0V0"
FT                   /protein_id="ACE61112.1"
FT                   /translation="MSELTETVMISKAEYERLLNDKCFLDYIENNWCTKYPDSKELRID
FT                   LRIITNTSNLRSAVYQCMEGSNYLGLLELTDLGNFLRKFRVLANSTLGDMAKATNLGSA
FT                   ELSAIEFGRRPVTDEQLHNIACYLAGVDIRDHPYNPNKFSELMEKIK"
FT   gene            complement(520692..521414)
FT                   /locus_tag="APP7_0461"
FT   CDS_pept        complement(520692..521414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0461"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61113"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0V1"
FT                   /protein_id="ACE61113.1"
FT                   /translation="MISEQDKQAILNGAFGVTREGKKVKFLGKDDSIKDTFWYCIYTAD
FT                   NLVDDFMAYKTLSKRYTNNETRFDIVGLWQEKPEPFALEKALAGEPVLLRDGSKAYIFH
FT                   CINDEFTKKHNIGYQLLGVIVDSLEGKQLTRSWAKSGIFNEVNPYPDFDIIGMWKEPEP
FT                   QLSSNSLQLPKPLTEPLNNDDNYFTLASRNGKYVIDDWRWKDKTSDHIFLREARIYKTK
FT                   DDVIKVIEIITGKPYEDR"
FT   gene            complement(521416..521658)
FT                   /locus_tag="APP7_0462"
FT   CDS_pept        complement(521416..521658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0462"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61114"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0V2"
FT                   /protein_id="ACE61114.1"
FT                   /translation="MTINPFKLRKQLKNWQMLYSKQAVEFIEEKRKRAKALAENFQLRA
FT                   EIKALKEQAYRAEMIARQQSALLDMAEKQFKKLRG"
FT   gene            complement(521956..522858)
FT                   /gene="rdgC"
FT                   /locus_tag="APP7_0463"
FT   CDS_pept        complement(521956..522858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rdgC"
FT                   /locus_tag="APP7_0463"
FT                   /product="Recombination-associated protein RdgC"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61115"
FT                   /db_xref="GOA:B3H0V3"
FT                   /db_xref="InterPro:IPR007476"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0V3"
FT                   /protein_id="ACE61115.1"
FT                   /translation="MFWFKNLMTYRLTQAVDLSNLEEQLKQTAFTPCGKSDMSKFGWSA
FT                   PLSASDSLCFRQGSNTLIVSHKEEKILPAHVVIKKTEERIKALEEKEQRKLKKTEKQAI
FT                   KDDVTQELLIHAFSKDTFTAVWIDEANQLIYVDSSSSKRAEDTLALLRKTLGSLPVVPL
FT                   SFALLPSEVMTKWVADSTPPEWLNLLEEAELKSFDTASQLRCKHQDLETHEIEQHLQAG
FT                   KFVTKLAVEWENHLSCTIDESGAILKIKFTEDVRDKNDDILKEDVAQRFDADFFLMAEE
FT                   LSTFMKKLIDEFGGIKERI"
FT   gene            complement(522868..523824)
FT                   /locus_tag="APP7_0464"
FT   CDS_pept        complement(522868..523824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0464"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61116"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0V4"
FT                   /protein_id="ACE61116.1"
FT                   /translation="MLTIFTINMDNNLNPAKCGIFTIRNKIMTERKKYELTDEFIEHWS
FT                   GKKLYRIKALIDFGLVVAGSLGGFVESENNLDHNGNAWVYGNARVYGNARVYGDARVYG
FT                   DARVYGNAWVYGDARVYGNAWVYGDARVYGNAWVYGDARMYGNAWVYGDARVYGDARVY
FT                   GDARVYGDARVYGNAWVYGDARVYGNAWVYGDARVYGNAWVYGDARMYGNARVYGDARV
FT                   YGDARVYGNARVYGDARVYGNAEVCEQRSVIWFSVVGTENGTLTIYKSKDGSLLATRGC
FT                   FSGTVDEFLAKSAQVHDEKTKREYELLIEVAKSRILG"
FT   gene            complement(523793..523993)
FT                   /locus_tag="APP7_0465"
FT   CDS_pept        complement(523793..523993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0465"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61117"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0V5"
FT                   /protein_id="ACE61117.1"
FT                   /translation="MKNKRYKRPNKSQIREYKAYLDAVKTMYEDMPDGAYFAILIDSTE
FT                   SWLNENNLGHLDAHDFYHQYG"
FT   gene            complement(523997..524686)
FT                   /locus_tag="APP7_0466"
FT   CDS_pept        complement(523997..524686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0466"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61118"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0V6"
FT                   /protein_id="ACE61118.1"
FT                   /translation="MKETNNLYQLTVRCSGLSNFLSEPKTKAEKEAGEISQSAKSAVRE
FT                   IAKFDLFGWQSFEGNKFTAKGLELEDQAIKLSGMTRGLPLKKNTERRNKPCGNAILTGE
FT                   CDIYVPSRKLIIDTKCTYDIGSHPFFRDEAEAKVIKQGYDAQMQGYMWLWDCEEAQIDF
FT                   VLFPTPLDQIPQWQEPTKYVDLVEQIPIKKRITTVKIRRDEKIIARIQERVSLASTYYD
FT                   ELIKQMG"
FT   gene            complement(524670..525626)
FT                   /locus_tag="APP7_0467"
FT   CDS_pept        complement(524670..525626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0467"
FT                   /product="possible phage recombinase"
FT                   /function="Recombinational DNA repair protein (RecE
FT                   pathway)"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61119"
FT                   /db_xref="GOA:B3H0V7"
FT                   /db_xref="InterPro:IPR004590"
FT                   /db_xref="InterPro:IPR018330"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0V7"
FT                   /protein_id="ACE61119.1"
FT                   /translation="MTNQNQQQNQVAKKQDKFPIKTLFESQNVKQKLQELLNKNASTFT
FT                   TSVLQIVNSNSMLRNADPMSVFNAACMAATLNLPLQNGLGFAYIVPYQNKKERKTEAQF
FT                   QLGYKGLIQLAQRSGQFKRLVAVPVYEKQLINEDPINGYEFDWKQKPEANEKPVGYYAY
FT                   FQLVNTFTAELYMTAFEVDQHAQRYSQTYRTYLDKKAKGQWATSVWADNFEAMALKTVM
FT                   KLLLSKQAPLSVEMQQAVLADQAVVKDVDNSEFSYPDNDIQDAEFVDMTATPENFKLYK
FT                   QNILNGETTLQELCDNGVQFSNSQYDELEKIENERNQ"
FT   gene            complement(525630..526109)
FT                   /locus_tag="APP7_0468"
FT   CDS_pept        complement(525630..526109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0468"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61120"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0V8"
FT                   /protein_id="ACE61120.1"
FT                   /translation="MSYKLIVELHKDNDSYFAELFSGHGEFIATTKSFAMIEDVKESVK
FT                   RNHPSLSRKRQIKFKDLTGTDENLQAETEQVSGQENAIPAKLEPAKEMLENAIKQEEIK
FT                   MQELQITGFKQTGKQVTIYFANGKSRKTTSDRLFNINKPSKAEGIVKRMRKVVEG"
FT   gene            complement(526113..526343)
FT                   /locus_tag="APP7_0469"
FT   CDS_pept        complement(526113..526343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0469"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61121"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0V9"
FT                   /protein_id="ACE61121.1"
FT                   /translation="MSNLGYVLGALTLALVVGGQVTGCQSNDFDGKQTLEQVHCQQAGG
FT                   DMINRSNGTLFQTEYVCKYPKSQQIPIEFRG"
FT   gene            complement(527323..527550)
FT                   /locus_tag="APP7_0470"
FT   CDS_pept        complement(527323..527550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61122"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0W0"
FT                   /protein_id="ACE61122.1"
FT                   /translation="MDTQSVFNNKDFILCRHKEKRGNGFIQIFEAYENEETNEFVVERA
FT                   MFRNGKLIEWSQSEKMNAEKAEQLWNMYLC"
FT   gene            complement(528070..528885)
FT                   /locus_tag="APP7_0471"
FT   CDS_pept        complement(528070..528885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0471"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61123"
FT                   /db_xref="InterPro:IPR021398"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0W1"
FT                   /protein_id="ACE61123.1"
FT                   /translation="MKHPILYSFVRYRPYFETGEFVNVGLLMCEPESKKLTYRLVSKNN
FT                   KRVNDFFYRSKIFESVRDTIDNELQYIVNQPFDVSPQEMATFFHHYVDVKEGIIQYSDA
FT                   AVGVVDDPQTYFNNLYHQFIQNAGVKTESQEQSIIKHYRMLFKQDADQILLSYKQHIVR
FT                   GELAKFTLPLALKNDNDPQILKAVKPLAFDQIESPSMIEHCDSWVAKINRAEEEGLLKT
FT                   DNILFTLDTPDTADKVNILNTIKRTFDKFKIPHISWNEDRQLLEFAKSL"
FT   gene            complement(528882..529622)
FT                   /locus_tag="APP7_0472"
FT   CDS_pept        complement(528882..529622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0472"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61124"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0W2"
FT                   /protein_id="ACE61124.1"
FT                   /translation="MDKIIFIRERAKMGITRPFICQTDTGKWVIVKTLAMMPLPQLLAE
FT                   VFGSILAHKIALPSPEVCFVEVTLESNSYVSAEWRSDLPTGTAFASIFMKHAKVAKTAQ
FT                   ATNIHYLDETAQKLLYMFDRWILNSDRTASSVGTGNINLLFDEQQQKILVIDHNLAFDE
FT                   YAQFDEHIFAPQNRSWRLDWVDKDVFSQKAIDILNEFNDIYQQIPDCWFPIDDEEYQKM
FT                   DAEIHRIKTILSRITDPHYWNNIE"
FT   gene            complement(529666..530343)
FT                   /locus_tag="APP7_0473"
FT   CDS_pept        complement(529666..530343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0473"
FT                   /product="LexA repressor"
FT                   /function="SOS-response transcriptional repressors (RecA-
FT                   mediated autopeptidases)"
FT                   /EC_number="3.4.21.88"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61125"
FT                   /db_xref="GOA:B3H0W3"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0W3"
FT                   /protein_id="ACE61125.1"
FT                   /translation="MKRQWNEFVREKMVEKNLKQDDIAEALDRTQGSIGHWLTGRRTPN
FT                   FDDVAKMLNVVGVDQVILNSDGLITTLDNDELEIIGKPKDGIIPVVGEATMGRDETVRL
FT                   EELRTGYINLYSADPDAYAVRGKGSSMEPRIKSGEYIVIEPNTPPMNGDDVLICTIAGQ
FT                   YMIKTLDWHRDGEYRFSSINNAHQPFNLPENEVVNIHTVGAIVKAYRFVAFEDIEQAVE
FT                   SQG"
FT   gene            530465..530677
FT                   /locus_tag="APP7_0474"
FT   CDS_pept        530465..530677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0474"
FT                   /product="Uncharacterized HTH-type transcriptional
FT                   regulator MTH_1328"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61126"
FT                   /db_xref="GOA:B3H0W4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0W4"
FT                   /protein_id="ACE61126.1"
FT                   /translation="MNKILIFRKEIGLTQMELANEIGITQGALGHYEQGRRKPSLAMSR
FT                   KLVEALNKFGANVSIDDVFPPENEK"
FT   gene            530732..531481
FT                   /locus_tag="APP7_0475"
FT   CDS_pept        530732..531481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0475"
FT                   /product="Antirepressor protein 1"
FT                   /function="Uncharacterized phage-encoded protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61127"
FT                   /db_xref="InterPro:IPR014054"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0W5"
FT                   /protein_id="ACE61127.1"
FT                   /translation="MNQLLNISEQKSSAITMSSREIAVLIQKNHSDLCRSIGRLIEKQV
FT                   IKGYQPTAYTHPQNGQSYYEYHLAKRDCLIVVAQNCPEFTAAIVDRWQELENQQAVKLP
FT                   QSFAEALRLAADLEEEKQALLLENQQQLAQIESMESYFRNGISAPQFAKGLNGVNSHQI
FT                   NEHLHQVRWLYKDAKNQWRVSSYARDRYMTEQPAPVLNHGKEQLMTYKPVLLQKGAAKI
FT                   YEWYTQGKLTMKANWNGEFTQDKVVGL"
FT   gene            531478..532248
FT                   /locus_tag="APP7_0476"
FT   CDS_pept        531478..532248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0476"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61128"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0W6"
FT                   /protein_id="ACE61128.1"
FT                   /translation="MSRFIPNSFQVPNAVVDEFLRKMSGPGIKCYLLITRQTTGWQKQK
FT                   DRISINQFMEKCGIKDKRTAQNGVAELEELGLIIAFRQLGEITEFTLNFDFECDECEPV
FT                   AKNVPSIKNCTQPVAKNVPSTSSKKCTSTKNNIKNNITNNTLTGINARTRETKKSAVLM
FT                   LLEQFGITGKLAEDFIVHRKAKKAPITETALNGYQREADKAKIPIQKAVEIAIERGWTG
FT                   FKADWQWQDDQPKHRPKDNMRAEWNTPEAWAEVL"
FT   gene            532248..532904
FT                   /locus_tag="APP7_0477"
FT   CDS_pept        532248..532904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0477"
FT                   /product="Replication protein P"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61129"
FT                   /db_xref="GOA:B3H0W7"
FT                   /db_xref="InterPro:IPR009731"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0W7"
FT                   /protein_id="ACE61129.1"
FT                   /translation="MSLQKTEQNRPLAALGEQQGKLSSEIENLVDRIFDQLLASCPSIQ
FT                   YWSEKQVATAKQQWILGFAENHIRTIDQVRQGMKALRAKEDDFVPSVGKFIGWCKRIDF
FT                   EELGLPTVEQLLKRLNYFSAFGFSEIHEFKFRSDAEYWLLTDLYDRNCQHSWKDETLRN
FT                   QAEKVLIAMAKRIQSGETIPAPAITLPKKSECYVPPEDVISNRFAELKAKMGIKQ"
FT   gene            532901..533458
FT                   /locus_tag="APP7_0478"
FT   CDS_pept        532901..533458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0478"
FT                   /product="possible DNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61130"
FT                   /db_xref="GOA:B3H0W8"
FT                   /db_xref="InterPro:IPR008593"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0W8"
FT                   /protein_id="ACE61130.1"
FT                   /translation="MTEQFDRNTWQTPPYFSKWVAKKWHCTIDGASFSHNKVCGHWIGK
FT                   MAEGEDSAAHITDDFLADNLPDYLSNWGCGCHSIFVNPPYSNVTPFIQQAKRLRDAGHL
FT                   VVMLLNNDKSTQWYQQHVHNVASEVIDIIGGRIAFIHPVTGAEIKGNSKGQMVIVFDPT
FT                   MQDFVTRSVSLDFVKKVGGYDF"
FT   gene            533448..533636
FT                   /locus_tag="APP7_0479"
FT   CDS_pept        533448..533636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0479"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61131"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0W9"
FT                   /protein_id="ACE61131.1"
FT                   /translation="MISDVKCPKCGGELSKWEDDWTGTEYRCEGFAKEPKDERFGDYHW
FT                   MNRTKSCGWFEQNEIEH"
FT   gene            533620..534576
FT                   /locus_tag="APP7_0480"
FT   CDS_pept        533620..534576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0480"
FT                   /product="Type I restriction enzyme M protein"
FT                   /EC_number="2.1.1.72"
FT                   /note="similar to Type I restriction enzyme EcoR124II M
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61132"
FT                   /db_xref="GOA:B3H0X0"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0X0"
FT                   /protein_id="ACE61132.1"
FT                   /translation="MKSNTNFVEYNNRAKANKYAEYITGEELRKYVARKVEQYAGQNVS
FT                   VFDGAAGSGQLEQFIQPSSFVAVEIQAESCEALKGNYPQAVVFNESFFTYPTACQCDCV
FT                   VMNPPFSLKFKDLSEEEQQGIQADFPWKKSGVVDDIFTLKGLANANRWGFFILFPGVAY
FT                   RGTEKQFRSLIGNQLVELNRIQNAFEDTPIDVLFLVVDKLKTDSNAKRELYDCKAKQLI
FT                   NSDEWTINPDHWEQVQPPVRAEEKVNPIELEAFARESVKKKIIAELRFSKMVTMFERTP
FT                   EAEFDVFCDEICELVQAEKFSNGASTFDLDSMVGALR"
FT   gene            534573..535022
FT                   /locus_tag="APP7_0481"
FT   CDS_pept        534573..535022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0481"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61133"
FT                   /db_xref="InterPro:IPR009797"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0X1"
FT                   /protein_id="ACE61133.1"
FT                   /translation="MKAQMIKTAGGALVPLDDEQAEALKKFRNGEQYEIEIKLSRNPQF
FT                   HRKVFAFFKFCFDHWSADKTDWRYFDERTQFDVFRKNLTVLAGFKDVSYTIDGRMRVEA
FT                   KSLAYGNMEQDEFERCYQALITAAIKNIFQGCDRQTEEQLYAFFW"
FT   gene            535443..535712
FT                   /locus_tag="APP7_0482"
FT   CDS_pept        535443..535712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0482"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61134"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0X2"
FT                   /protein_id="ACE61134.1"
FT                   /translation="MKNNTLDQIRDERAKTHGRFEDGAKVFEILTAPVAQALNDGHISN
FT                   VQHYGLIMAMSKVTRILVGDPNEKDHWIDGANYLLLGGGVNDSK"
FT   gene            535699..536277
FT                   /gene="ninG"
FT                   /locus_tag="APP7_0483"
FT   CDS_pept        535699..536277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ninG"
FT                   /locus_tag="APP7_0483"
FT                   /product="Protein ninG"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61135"
FT                   /db_xref="InterPro:IPR008713"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0X3"
FT                   /protein_id="ACE61135.1"
FT                   /translation="MTVNKPPKQHKCKECGAYYIKSRSTQQACSIKCAMAIGKRKTEEK
FT                   RKKQEKADRLMERKRMKALKEKLKSRKEWLSDLQKIFNKFIRLRDKDLPCISCGRFHAG
FT                   KYDAGHYKTVGGNPELRFNEDNCHAQCVPCNQHLHGNIVNYRIGLIERIGIERVEFLER
FT                   KDHPPQKLSVDEIKSLIKHYKAKVKELEG"
FT   gene            536281..536766
FT                   /locus_tag="APP7_0484"
FT   CDS_pept        536281..536766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0484"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61136"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0X4"
FT                   /protein_id="ACE61136.1"
FT                   /translation="MIPKHIQNTWLPPAKQKHYEEVFKMYGAWEFSGLDRDKRVNMIYK
FT                   FMRSVEAIDKLGMRPVCNDQLGMLINEILTVRTKHAKGDTVLMRDFFKQKYWFGRSERQ
FT                   IAMYMQKRDDEGKCLRRWQEVVQQNLREIERYLAEQLEKLIPVHKNANFLKKYLFFS"
FT   gene            536875..536946
FT                   /locus_tag="APP7_tRNA07"
FT   tRNA            536875..536946
FT                   /locus_tag="APP7_tRNA07"
FT                   /product="tRNA-Gly"
FT   gene            537023..537406
FT                   /locus_tag="APP7_0485"
FT   CDS_pept        537023..537406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0485"
FT                   /product="Uncharacterized protein"
FT                   /note="similar to HI1416 precursor"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61137"
FT                   /db_xref="GOA:B3H0X5"
FT                   /db_xref="InterPro:IPR006481"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0X5"
FT                   /protein_id="ACE61137.1"
FT                   /translation="MYKMPDKTPDVWAALFAYLHQNYNAITGFVMAFFMSMLRGFFLQQ
FT                   KITFRQRLLDGSICGALTLSSMSLLVYAGVGESLSTFVGGMLGFVGAEKIREFLFSLIR
FT                   KKIDVNDVGFGKQNKVNDYDEFN"
FT   gene            537393..538025
FT                   /locus_tag="APP7_0486"
FT   CDS_pept        537393..538025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0486"
FT                   /product="putative chitinase"
FT                   /function="Predicted chitinase"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61138"
FT                   /db_xref="GOA:B3H0X6"
FT                   /db_xref="InterPro:IPR000726"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0X6"
FT                   /protein_id="ACE61138.1"
FT                   /translation="MSLINMIQQMSDSLDVKMHISEAKFLSVFPKSKPLIYHEIAKYIG
FT                   LAGCKTKEQQAMFLAQCGHETAGFSAFSENLNYSDIALLRTFPKYFNTGNVKAYARQPE
FT                   KIANRAYANRMGNGNEQSGDGYKFRGRGLVQITGKNNYVLFRKWLGREFKLDDVGTDLE
FT                   LIVLAGVWFWQKNNLAALECVVDVTKRVNGGFNGLADRQAKYDKLMS"
FT   gene            538027..538392
FT                   /locus_tag="APP7_0487"
FT   CDS_pept        538027..538392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0487"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61139"
FT                   /db_xref="InterPro:IPR022538"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0X7"
FT                   /protein_id="ACE61139.1"
FT                   /translation="MFTLLSKAKLWVAGILAALFIGLLVKLWTTQSQLSVLKSQYDKQT
FT                   AQIKSLEMTNATLEAETVNLKVSLAAEQQAVEQQSAIAAQFRRQAIDKKEVVRYVLKDN
FT                   QCANQHLPNAVIEQLRK"
FT   gene            538878..539357
FT                   /locus_tag="APP7_0488"
FT   CDS_pept        538878..539357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0488"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61140"
FT                   /db_xref="InterPro:IPR009901"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0X8"
FT                   /protein_id="ACE61140.1"
FT                   /translation="MENLHELKLNINQIAEVTGLHRQTVSQRVAGLTPAMGSNSKLKLY
FT                   LLRDLLLAGLSEKMSADVDSLSPNDRRAFWQAENERLKYEEKTGELIPASEVALEMGAM
FT                   AKAVVQTLETLPDILERDCGLQPKDLIRVQQVIDDVRDQMALHIQQAESEQGEDK"
FT   gene            539357..541474
FT                   /locus_tag="APP7_0489"
FT   CDS_pept        539357..541474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0489"
FT                   /product="predicted bacteriophage tail assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61141"
FT                   /db_xref="InterPro:IPR008866"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0X9"
FT                   /protein_id="ACE61141.1"
FT                   /translation="MFASAKEIRKDMANAIKAPRRMKVSEAVAEYMRVPVGGGNSVRWD
FT                   KHTAAYMLEPMDCLNSREYDAVIFVGPARTGKTIGLIDGWITYSIICDPSDFLLVQLTQ
FT                   EKASEHSRKRLDRTFRCSPEIAKRLSPRKNDNNVHDKYFRAGNLLKIGWPSINVLSSSD
FT                   YKFVALTDYDRWPEDVDGEGDGFSLASKRTTTFMSAGMTLVESSPGKDIVDLKHIPKST
FT                   HEAPPTTGILSLYNRGDRRRFYWQCPECSEYFEPSMANMVGYRDDLDLVKASENARLQC
FT                   PHCSHLVSPDLKRELNINGVWLKEGQKIDASGQITGESRKSRIASFWLEGPAAAYQTWS
FT                   QLTYKLLNAEHEYEMTGSEETLKAVTNTDWGLPYLPRSALEQRRADELMERREYVDKDN
FT                   KTIPPQCRFLIAAVDVQGGKNRRFVVQIVGYGENGERWLIDRYNISQTLPDEDGVFEKI
FT                   DPRNPDNWQILVSDVLEKRYPLVHNANHFMPILAMAVDSGGEDGVTDNAYKFWRRCRRD
FT                   GHAKRVYLVKGDSTKRQKLITKTYPDNTARSDRHSSARGDVPLYLLQTDYLKDRINNAL
FT                   TRNTEGANYIHFPDWLGEWFFNELTYEERGPDGKWRKPGKGNNEAFDLFCYAHAIAILR
FT                   GYERIKWGDEKDVPSWAKLPDINPNIIREQNTMSGQAVEIEEKTAKSNPNPTKAKNSWL
FT                   SGSGRKTGGWL"
FT   gene            541695..543215
FT                   /locus_tag="APP7_0490"
FT   CDS_pept        541695..543215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0490"
FT                   /product="bacteriophage capsid protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61142"
FT                   /db_xref="GOA:B3H0Y0"
FT                   /db_xref="InterPro:IPR006429"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0Y0"
FT                   /protein_id="ACE61142.1"
FT                   /translation="MNLLEKTIATLSPKWAAERSRNRYVLNAYEAALPSRTHKAQREGK
FT                   GANTAIRQSAVSLREQARALDQNHDIVIGILDKMEERVIGSKGIHIEPQPLTLTGDVHE
FT                   DLAEQIRKLWAEWSVKPDVTGLYTRPLLERMLLRTWLRDGEVFVQLVKGKVAGLEHSSP
FT                   VAFSLEALEPDFVPMQTDEAKNGLVQGVFLNAWRKPTAYQVYLDNPQESTAMYGKIKTV
FT                   PAENMLHLAFRKRLHQIRGVSMLHGVIVRLADLKEYEESERVAARIAAAMTMYIKKGDA
FT                   ALYDDESNNDGERLFDIAPGAVIDDLKPGEDVGLINSNRPNVNLETFRNGQLRATAAGT
FT                   RSSYSSIARDYNGTYSAQRQELVESFEGYAVLQDAFVAAISRPIYREWLKMAIASQAIE
FT                   IPPEIDEKSLFNAVYSGPVMPWIDPIKEANAWKERIKGGLATEGQAIRASGNNPAEVKR
FT                   QRIVEIKENAREGLKFDTDLTNTQGISNEKKTNGSSPDGEGSSSNQDE"
FT   gene            543151..545175
FT                   /locus_tag="APP7_0491"
FT   CDS_pept        543151..545175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0491"
FT                   /product="putative Clp-like protease"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61143"
FT                   /db_xref="GOA:B3H0Y1"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR018774"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0Y1"
FT                   /protein_id="ACE61143.1"
FT                   /translation="MRKKQMVLAPMAKAVAVTKTNNQSWFTIKAAANDTAEISIYDEIG
FT                   FWGVTAQQFANDLKALGNNLKQINLHIHSPGGDVFDGIAIYNLLKNHPANKTVYIDGLA
FT                   ASMASVIAMAGNEIIMPENAMMMIHKPWGIQGGDADDMRKYADLLDKVESTLIMAYVAK
FT                   TEKSEEELAEMLKEETWLTGKECVEQGFADKLAEPLVAMACIQSKKLEDYTKMPDKIKN
FT                   MLFAPQGNAGANPKPEQPQTPPQAGENPQNVAKPDAMVALAQRNATIKATFAAFGTQFD
FT                   GLLAECLADVSMTAEQAKDKLLAKLGENTTPSVPQNHIHAGNGNIVGDSVKQSLMARAG
FT                   QDTDKTNARDNTYNAMTLRELARASLVDRGVGIAGYTPMQMVGLAFTHSSSDFGQILID
FT                   VAHKSLLKGWEVSNENYEQFTSRGILTDFRPAKRVGLGEFGYLPTVGEGEEYTYGTLGD
FT                   EGASIALATYGQLFSITRQAIINDDMHLLTTIPQKMGQAARATIAKLVFALITGNATAQ
FT                   DGKKLFDASHKNSLTGAKLDVEHIDKAVQLMNGFVNSRGEPLAIEPEFMLLPTSLHTKA
FT                   KQILGSSSVEGADINSGIINPIRDIVSPIKSPRLQIADAKSWYLINKEAIEVSYLDGVD
FT                   SPYIEQQQGFSVDGVTTKVRIDAGVNVIDYRGIVKVTNQ"
FT   gene            545249..545572
FT                   /locus_tag="APP7_0492"
FT   CDS_pept        545249..545572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0492"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61144"
FT                   /db_xref="InterPro:IPR011231"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0Y2"
FT                   /protein_id="ACE61144.1"
FT                   /translation="MAKNYIQDGNTVRLTAAKAIVSGDVLVSGDLIAIAVTDAAKNDAV
FT                   VGLTTGVFNVKAKQADDIKQGAVLYWSETEGATLTAGGNKRLGIAWRDSGTSSDEVDVK
FT                   INV"
FT   gene            545565..545867
FT                   /locus_tag="APP7_0493"
FT   CDS_pept        545565..545867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0493"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61145"
FT                   /db_xref="InterPro:IPR025601"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0Y3"
FT                   /protein_id="ACE61145.1"
FT                   /translation="MCSPFEQAMKQADQVIMATMMSEWQLQGQPYPAVYDEAPKVFEGL
FT                   HFNEDTAINGTSRTLTLYRSSGYKPRTGDEAVREGKVFFVKSYYHQDNLLILRLE"
FT   gene            545870..546397
FT                   /locus_tag="APP7_0494"
FT   CDS_pept        545870..546397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0494"
FT                   /product="putative phage tail component"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61146"
FT                   /db_xref="InterPro:IPR010633"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0Y4"
FT                   /protein_id="ACE61146.1"
FT                   /translation="MSVKIDGMAEISANIAKLTKQKLPQAAKKSLNTLARRAMKGATQT
FT                   VAKEIGVPHKTIRNRAKLTKPAEKTRLEARIKVIRSNMPAIRLFENRSTKMWVGRGGIV
FT                   VGKYAIKRGFKQTLKNGRTHLMQRQGKARYSIDVVKIPLSQPLTQAFSHELKDYQQDIQ
FT                   KELTKQLSEVFK"
FT   gene            546394..546807
FT                   /locus_tag="APP7_0495"
FT   CDS_pept        546394..546807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0495"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61147"
FT                   /db_xref="InterPro:IPR009312"
FT                   /db_xref="InterPro:IPR035934"
FT                   /db_xref="InterPro:IPR038512"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0Y5"
FT                   /protein_id="ACE61147.1"
FT                   /translation="MIIHSQIREEILECLKQALPNEINWYNGRPSFIDIDEEQSAVAVF
FT                   IDEANCTPVTTCQEEWEAKLNIVLYQKALNDAETRLDKTAQNVVDVLQEVEFKNLSAMQ
FT                   LSGYTYDQDEQHSTWHIAIIQFEINYERTTGAD"
FT   gene            546807..547463
FT                   /locus_tag="APP7_0496"
FT   CDS_pept        546807..547463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0496"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61148"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0Y6"
FT                   /protein_id="ACE61148.1"
FT                   /translation="MATQTTPFQGTKFYIGTGLNQEKAITACTVTPNATITAAGHGAKV
FT                   GDFVKITGLGSLDGFYPVKTVATDTLTFADEVDWTGQDKPTDFSTAKFAVVKWSSNFCA
FT                   IKNIEGDGDTLSEEDVTTMCSEGTETEAGEIEYGSIKLTFFYAPATAMQSDLRKKFFAK
FT                   ETFPWMMVLKNKQGSLYGTGFIQTSPNWSGEVKGKFESGVTIKKSKRDYHLPTTA"
FT   gene            547522..547914
FT                   /locus_tag="APP7_0497"
FT   CDS_pept        547522..547914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0497"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61149"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0Y7"
FT                   /protein_id="ACE61149.1"
FT                   /translation="MTIGTRESLLANNKPKLKKIKIGDAEYFIREFNVGDMNRSLYGQQ
FT                   KVMCELAEAQGIVLNYDNPEELVKQLSKVYDPYRLARNLALRLCDADGNNLFDFENVDD
FT                   LEALSRLDKSVSEELSRALMDEEPKN"
FT   gene            547938..548213
FT                   /locus_tag="APP7_0498"
FT   CDS_pept        547938..548213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0498"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61150"
FT                   /db_xref="InterPro:IPR025116"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0Y8"
FT                   /protein_id="ACE61150.1"
FT                   /translation="MLSLALGKTLTEIEEMPESHFQEYMLFYDEQPFGLWRDDYRTAQI
FT                   SHLLTAIHSDPKQKATTLSDLMPFFSKKNSHEYDEDDGTEAYLANR"
FT   gene            548285..548521
FT                   /locus_tag="APP7_0499"
FT   CDS_pept        548285..548521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0499"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61151"
FT                   /db_xref="GOA:B3H0Y9"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0Y9"
FT                   /protein_id="ACE61151.1"
FT                   /translation="MRDFIQFWAKFFFIMLIALGALFLFFAIDFVYIFAFFSVFAIVFF
FT                   VRLVTVISQTHKHYDDLAKAEKEKARVKYVIIQ"
FT   gene            548579..552007
FT                   /locus_tag="APP7_0500"
FT   CDS_pept        548579..552007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61152"
FT                   /db_xref="InterPro:IPR009302"
FT                   /db_xref="InterPro:IPR013491"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0Z0"
FT                   /protein_id="ACE61152.1"
FT                   /translation="MASLGNLNISLNLETVQFQQGLNKSAYQSQKFARQFEANFSAAQN
FT                   RARQFSERTTQYLNNIERAANSINKTANIGLFSNIAGWATGNLSAATSQTLKYADSYTE
FT                   LQNRIRLVTDSQNEMVAATNTVFDIALRTNQAVGATSEVYQRFAKNADTLKLSQQQVAE
FT                   LTETVSKAVAMSGASAASAEAALMQFGQAMAGGVLRGAELNSVMEQTPALAQAIADGLG
FT                   VSVGALKDMGKNGELQISKVIEALQKAKDTVDTDFEKRVKTLSMSFTNLETSMIQFVGQ
FT                   VDSTYGVTQKLAEGVDFVSENLETLIKVAGALIGALAIGHISKYSATLLQTGYNSAKNA
FT                   IAHTREAQAILAKATAMRTAAQVEMASLAAQFQLAQSERTRYALREQMKVQAGQIIALA
FT                   EAEATAKRNLAAANTLASTTARGLQSAMALLGGPAGVIMIAASALMYFSSQVDQARQKA
FT                   LDTAGANERLKESYEGLSAAALSLKITQQQEELENYKNQIQQLQSDISALEANWFTTGL
FT                   PIPDSVKKEIAELSDQIELLKENSNIDFSVLENQLEALARAMLSSGKSLDDIRAKFKLL
FT                   GIDASETEWILAGIPSTLNDIGNSAEKAAGETLNLDDAMKKLQERSVTLAQKLEVAKLE
FT                   QQGQAESAYVLAGLYELLGVEGAKYNEVLISIATGTITAANAADKAIGLSQETLKKILD
FT                   GKAMLQGMFKNETQIQTIKTELRENAKVANPKKEKKAKKSNGENARENWLSFYDDLRKK
FT                   SGSTLNEINLEETRMFQRLEEHMKKGVVSHTEYETAKTAITQRFAKERLELAGKYAPEK
FT                   LLSANLKDELSAIQELRKAGHLTESEYQIAEQQLKFDYAQNKSQQAISPIEQVRGMYDA
FT                   EQELKNQQTQELAQLQAFYDQKLMTEEEFQKRKQQIISRYETERWQKEMSEYATGLNDL
FT                   GGAFDTLASAVEQSAGKQSAAYKAMFAVSKAFAIAEASLKLSQAITQAMADPTAMTPAQ
FT                   KFANMAAVAAAGANVISQLTSVAFAKGGHVQGPGTGTSDSILARLSNNEFVMTSRTVDH
FT                   YGVGFLNALNQRRLPKFASGGHVGGKSGSYDGLFNSSNNAQSNEVSITINIDSNGNENI
FT                   TTEQKAAQGKELAMAIQANVLEVLKKQRRPGGLLA"
FT   gene            552017..552352
FT                   /locus_tag="APP7_0501"
FT   CDS_pept        552017..552352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0501"
FT                   /product="predicted phage minor tail protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61153"
FT                   /db_xref="InterPro:IPR010265"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0Z1"
FT                   /protein_id="ACE61153.1"
FT                   /translation="MALRTLSWCPQPGYTVEEEPRRKVLKYGNGYQQRMEDGINTLLRK
FT                   YSVTYKIKNKESAQFRNFMKEHNGIRAFYFKDIALGGELVKVVCTKFPRQVGKTHTIFT
FT                   CEFEEVM"
FT   gene            552352..553083
FT                   /locus_tag="APP7_0502"
FT   CDS_pept        552352..553083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0502"
FT                   /product="phage-related minor tail protein L"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61154"
FT                   /db_xref="InterPro:IPR006487"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0Z2"
FT                   /protein_id="ACE61154.1"
FT                   /translation="MPKDLPSKMAQELPKLEQGALIELWEIDLRHITNSNGDSGELYRF
FT                   HNGLNQSRANIWWQGSEYQAYPIKADGFEISGNGPSSRPTLTVSNLYGIITGIAANFGQ
FT                   GVGGKVTRRLVYAQFLDARNFTGNKNSKADPTQEAVSYFIIEQLKSLDDEQATFELASP
FT                   AETDNAKIPLLMITSDVCIWQYRSAQCGYTGGPVADEFDKPTSDRKKDKCSHCICGCKL
FT                   RFGENAVLPFGGFPSTTQYGN"
FT   gene            553792..554397
FT                   /locus_tag="APP7_0503"
FT   CDS_pept        553792..554397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0503"
FT                   /product="putative phage tail assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61155"
FT                   /db_xref="GOA:B3H0Z3"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0Z3"
FT                   /protein_id="ACE61155.1"
FT                   /translation="MAKITFHGDLKRFSNQPFELEVSNFRELMSGLLTQIQGLREHLRN
FT                   GYYKVRIGKNYLNNDQLQTNPMIGLDDKSSIHFTPVIAGAGKGMGIGQLILGVVLVAAA
FT                   FYTGGASLLAWSSGATMMGAMGASLILGGAISLLSKTPEMSSGVKEGEKKQSTSFSNIR
FT                   NLTPQGRPIPLLYGKMMTSLVLISQGIETFDDVEALNN"
FT   gene            554469..560531
FT                   /locus_tag="APP7_0504"
FT   CDS_pept        554469..560531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0504"
FT                   /product="predicted phage tail protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61156"
FT                   /db_xref="GOA:B3H0Z4"
FT                   /db_xref="InterPro:IPR003305"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR015406"
FT                   /db_xref="InterPro:IPR021034"
FT                   /db_xref="InterPro:IPR032876"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0Z4"
FT                   /protein_id="ACE61156.1"
FT                   /translation="MGGKKQGSARTPHEAPDSLKSAQRLRAIGLISLGPIKGTANKWKS
FT                   TFFDNTPIQNENGIDDNDEASFNFKNTEVSFTLGTQDQLPLQGFEMSEREVSVSTEVKY
FT                   TTPITRTVTDPDVTRLRVTLGVNALYEQNDQGDTNGTSVSFRILINGLPRATYEINGKS
FT                   SSRFYRSYIVDNLPERPFTITVERMTADSKSQRLQNATNWVSYTEIIDTKLSYPNMALV
FT                   GIKTDSRYNPNFPNVNFLLYGRLVKVPSTYDPETRTYATALWKGDWKQAWTNNPAWVFY
FT                   DLVTDPLAGLGKRVGDYGLDKFQLYQIAKYCDELVDDGYGGKEPRMTANLWLTDQRSAY
FT                   DVLSDMASVFRAIAVWNGTQFTAIQDRTADPVCTYSQANVIDGKFSRQYAAMKSIYTAA
FT                   EVEYADERNMYQKAVEYVADDAMIARYGYNVKKMTAYATTSRGQAHRLGKWVLATSLLE
FT                   QCTITFSVGRQGLLHLPGDIIEVADNDYAGKTLGGRVVAVNGKVVTLDQPIEISGKSYL
FT                   SYLNDEMKVVKVTISSVDSKNKAVVTLATVPTGLEPMDDWVLKTPNISTQLYRAIGITE
FT                   NDDGSYTITALQHEPQKEAIVDGSASFVPVATTAHTGGVQKVANAEASIHENGVKLTWA
FT                   MPSSNSIVKYEVRLYRNGVLYQTYLDVESTELTFDDLPDGSYVAEIRSKNTNGQLSDPV
FT                   TRAFEINLRIPRFVTKSLLFAIELDWDLPKTATVGNYTELWRSPENDVSKAVKVATLAY
FT                   PQNNYTINGVSLNESYYFFARCGNKSGNKGEFTDGVFGEADHNTENLVNALEGKITQSH
FT                   LGKSLIESLKADIDEAVGEESQQRQSAVANVLAQLLAETQARAKSISEESKARTAAITA
FT                   ETSNRTKAIQAESASLTKKIQDEANARGTAITQLQQTDAQQAQLITAVTAKADQAIAGL
FT                   QEEKTARVNADKAEAQARNALTSRVANAESGIAEVRQSIATANSSIAEVSQNLNAKIDG
FT                   LSVGGRNYLEDTEKFERGLWAFSTGSSSDRTHIIENGVVRVIGNSTTWKQFQISAQMGQ
FT                   NANKTGKSPVLTKLEVGKTYTFSIDARLIEGSPDLWSSLRADSVTAGNIDNFHGNFKLT
FT                   ENWQRFQYTSTISQPVDDASWRIIIGYNRVGIVEFRKPKFELGTVATDWSPAPEDLEHS
FT                   VEAISADLTNYKSTQATKEQATAQQISGLTTRLANTESGISRVEKAVSDNQSSTATQLN
FT                   QLSANLTKAQTDLNAKITQEQTARADADKANADRITSVTSRVASAESSISNIQSTKASK
FT                   TEVASLAQQSLQAVWQADAQAKVDAISVGGRNLLRFTQKLTDSKFWKFYKSSTQTETES
FT                   PRSDDELLIKAKEDQWTGYRQEGTANPLIELEAGKTYTISFEAKGNSTATNLIRFFARE
FT                   YYQGGSRNIAKYFTLPNVDKWERFTFTFTVDSLNEKHNNWIIYWETVTANSSFALRRMK
FT                   LEIGNVATDWTPAPEDADSAINSISSKVDSVQQTLTTANQALGSRIDTVTASVNDAKSQ
FT                   VSQVSKAVSDVSGKLSATHTLKTQVINGGRMAIAGIALGAESDGVTTESSVIVMADKFG
FT                   IVANANDGKVKPVFSVANGQVGIRGDLVVAGSVTRDKLSGGAGENLLYNPIFANNGHGW
FT                   TYYVDTANIDNAGYSFNANTGVYQSGAYLPTENQFRLQHIRKSITGDVRLGGLYQDMKL
FT                   TPNTYYCFSVYTGGHRSYVDLNIEGGGIQIIHKSWSGRGRTGGFPDNTKETGVENWYRI
FT                   WLIFKTNATNSAETNYRLIINTWGQNGQDSPMFIIRRPMLEECNASSTEPSPWSNAGAG
FT                   PVHGGSIIANTIRGDHIMANQRISSPVIEGGSLNIGNGNFIVDSSGNVTAKKGTFSGDL
FT                   SGATGTFKGDISAASGTFSGKIYAKNLIDDTAQAFTLQHGKSLTIPAFGKKRIIIVPAC
FT                   FCELRVNSAAGSAAATIQASASITITSSAGGSISGSGSQRGSGASGTVFLSGFFVVNAN
FT                   TATTINYTSSVSGSGEVYCPDIPIIAIC"
FT   gene            560767..561108
FT                   /locus_tag="APP7_0505"
FT   CDS_pept        560767..561108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0505"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61157"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0Z5"
FT                   /protein_id="ACE61157.1"
FT                   /translation="MKFIEKQTECQRTGALATYHVVTGLQVDYVNSSTFVTIGSYVSKT
FT                   KKDEGKESLSVNTFTIQAVPAWDQIPYQWALAELVKAQPDDFIPETYAGYVNPYMFAGG
FT                   KVKDEPEAK"
FT   gene            complement(561565..561756)
FT                   /locus_tag="APP7_0506"
FT   CDS_pept        complement(561565..561756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0506"
FT                   /product="Uncharacterized protein yidQ precursor"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61158"
FT                   /db_xref="InterPro:IPR010780"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0Z6"
FT                   /protein_id="ACE61158.1"
FT                   /translation="MSQNLTACGTIVSLTEGDYSVYAGVTKDFETIQNGGILSIPAVVD
FT                   LPLSFVLDTLILPVTLSQ"
FT   gene            561909..562991
FT                   /gene="leuB"
FT                   /locus_tag="APP7_0507"
FT   CDS_pept        561909..562991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuB"
FT                   /locus_tag="APP7_0507"
FT                   /product="3-isopropylmalate dehydrogenase"
FT                   /EC_number="1.1.1.85"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61159"
FT                   /db_xref="GOA:B3H0Z7"
FT                   /db_xref="InterPro:IPR004429"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0Z7"
FT                   /protein_id="ACE61159.1"
FT                   /translation="MQTHNIAVLAGDGIGPEIMAQAIKVLEATQQKFGFKLNFNHFNIG
FT                   GAAIDAQGKALPENTLKGCEEADAILFGSVGGPKWVNLPPDEQPERGSLLPLRKHFKLF
FT                   CNLRPATLYKGLEKFCPLRADIAAKGFDMVVVRELTGGIYFGQPKGREGEGSQTKAFDT
FT                   EVYYKYEIERIARVAFESAMKRNKKVTSIDKANVLQSSILWRETVSEIAKEYPEVTLEH
FT                   MYIDNATMQLIKAPETFDILLCSNIFGDIISDEAAMITGSMGMLPSASLNEDGFGLYEP
FT                   AGGSAPDIAGKNIANPIAQILSAAMMLRYSFNLNEAADAIEAAIQKALADGYRTGDLAD
FT                   ENTPISTSEMGDIIASNILS"
FT   gene            complement(563115..563510)
FT                   /gene="msrB"
FT                   /locus_tag="APP7_0508"
FT   CDS_pept        complement(563115..563510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msrB"
FT                   /locus_tag="APP7_0508"
FT                   /product="methionine sulfoxide reductase B"
FT                   /EC_number="1.8.4.12"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61160"
FT                   /db_xref="GOA:B3H0Z8"
FT                   /db_xref="InterPro:IPR002579"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="InterPro:IPR028427"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0Z8"
FT                   /protein_id="ACE61160.1"
FT                   /translation="MIKDIDELTEEQVEILINHGTEMPYSGKFLNENRIGTYRCARCHN
FT                   ALFRSDTKFDAGCGWPSFYEAISDDALRYLDDYSLGRHRTEIRCGNCDSHMGHVFNDGP
FT                   PPTGLRFCLNSIALNFKWDETGEEIDG"
FT   gene            563733..564737
FT                   /gene="gapA"
FT                   /locus_tag="APP7_0509"
FT   CDS_pept        563733..564737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gapA"
FT                   /locus_tag="APP7_0509"
FT                   /product="glyceraldehyde-3-phosphate dehydrogenase"
FT                   /EC_number="1.2.1.12"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61161"
FT                   /db_xref="GOA:B3H0Z9"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B3H0Z9"
FT                   /protein_id="ACE61161.1"
FT                   /translation="MAIKIGINGFGRIGRIVFRAAQLRDDIEVVGINDLIDVDYMAYML
FT                   KYDSTHGRFNGTVEVKDGQLVVNGKAIRVTSERDPANLKWNEIGVDIAVEATGLFLDDA
FT                   TARKHITAGAKKVVLTGPSKDATPMFVNGVNFDAYAGQDIVSNASCTTNCLAPLAKVIH
FT                   NKFGIKEGLMTTVHATTATQKTVDGPSAKDWRGGRGASQNIIPSSTGAAKAVGKVLPAL
FT                   NGKLTGMAFRVPTANVSVVDLTVNLEKPATYEEICAEVKRASQEEMKGVLGYTEDAVVS
FT                   TDFNGAVETSVFDAKAGIALTNTFVKLVSWYDNETGYSNKVLDLVAHVYNYKG"
FT   gene            564933..565985
FT                   /gene="mreB"
FT                   /locus_tag="APP7_0510"
FT   CDS_pept        564933..565985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mreB"
FT                   /locus_tag="APP7_0510"
FT                   /product="rod shape-determining protein MreB"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61162"
FT                   /db_xref="GOA:B3H100"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:B3H100"
FT                   /protein_id="ACE61162.1"
FT                   /translation="MFKKFLGLFSNDLSIDLGTANTLVYVKGQGIVLDEPSVVAVRQDR
FT                   IGSLKSIAAVGSDAKLMLGRTPKSITAIRPMKDGVIADFFVTEKMLQHFIKQVHSNNFM
FT                   RPSPRVLVCVPAGATQVERRAIKESAIGAGAREVYLIEEPMAAAIGAGLPVHEATGSMV
FT                   IDIGGGTTEVAVLSLNGIVYSTSVRIGGDKLDEAIVAYVRRHFGSAIGEATAERIKKEI
FT                   AMAIIRDEDEVRKMEVHGHNLAEGAPRTFELNSTHVLEAIEQPLNGIVEAVKSVLEQCP
FT                   PELAADIFERGMVLTGGGALLKNIDVLLSEATGVTVIIADEPLTCVARGGGKALDMIDM
FT                   HGGDVFSSDE"
FT   gene            566102..567151
FT                   /gene="mreC"
FT                   /locus_tag="APP7_0511"
FT   CDS_pept        566102..567151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mreC"
FT                   /locus_tag="APP7_0511"
FT                   /product="rod shape-determining protein MreC"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61163"
FT                   /db_xref="GOA:B3H101"
FT                   /db_xref="InterPro:IPR007221"
FT                   /db_xref="InterPro:IPR042175"
FT                   /db_xref="InterPro:IPR042177"
FT                   /db_xref="UniProtKB/TrEMBL:B3H101"
FT                   /protein_id="ACE61163.1"
FT                   /translation="MKPIFAKAPSLGVRLFLAIVISIVLIAFDGRSSAIIQFRNMLETA
FT                   ISGLYYFANTPRSVLDGVSNNFIDNNKLQMENHVLKEQLREKNADLLLLDQLKVENQRL
FT                   RLLLSSPLRQDEYKKIGEVLTAEMDAYRQQVIINRGKSDGAFVGQPIIDEKGVVGQVIS
FT                   VGEKSSRVLLITDVTHAVPVQVLRNDVRGIASGTGHNDELFIDNLPRSVDVIKGDVLVT
FT                   SGLGGRFPEGYPVAIVEAVTNDTQSQFARIVARPLASFDRLRYLLLLWPTGEELRKAQS
FT                   LSPQQVRDVVEERRNSLNPLERLKEKKKEEVKEESKEELLDGSDESINPESQFELDNEE
FT                   NNHTEQGAE"
FT   gene            567151..567639
FT                   /gene="mreD"
FT                   /locus_tag="APP7_0512"
FT   CDS_pept        567151..567639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mreD"
FT                   /locus_tag="APP7_0512"
FT                   /product="rod shape-determining protein MreD"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61164"
FT                   /db_xref="GOA:B3H102"
FT                   /db_xref="InterPro:IPR007227"
FT                   /db_xref="InterPro:IPR026034"
FT                   /db_xref="UniProtKB/TrEMBL:B3H102"
FT                   /protein_id="ACE61164.1"
FT                   /translation="MRTNPLFQILVLLLIFIIAFVLEIMPWPVGLQGLRPSWLVLVLIY
FT                   WALALPNKISVGTAFVAGIVWDLILGSILGIHALVLSIAIYFVAKHHLILRNLSLWLQA
FT                   ILVMLYVILIRFMIFFVELVLHSAEFNTQEILGAIISGILWPWIFLLMRQIRRQLRLR"
FT   gene            567652..568992
FT                   /locus_tag="APP7_0513"
FT   CDS_pept        567652..568992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0513"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61165"
FT                   /db_xref="GOA:B3H103"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008824"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR021886"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032423"
FT                   /db_xref="UniProtKB/TrEMBL:B3H103"
FT                   /protein_id="ACE61165.1"
FT                   /translation="MSSLSFDFSEDFRPLPARMRPRTLAEYIGQAHLIGEGKPLRRAIE
FT                   AGHSHSMIFWGPPGTGKTTLAEIIAHHFDAEVERLSAVTSGVKEIREAIERAKLNRQTG
FT                   RRTLLFVDEVHRFNKSQQDAFLPHIEDGTIIFIGATTENPSFELNNALLSRAKIYILKP
FT                   LQAVEIAQVLTNALYDKERGLGNESYYIEDNVIELLADYVNGDARFALNCLELMSDMAE
FT                   ISPQGKHLNKALLAEVLGERQTRFDKGGDRYYDLISALHKSVRGSSPDGALYWYARILT
FT                   AGGDPLYVARRLLAIASEDIGNADPRAMQVAINAWDCYTRVGAYEGERAIAQAVIYLAV
FT                   APKSNAVYNAFNEAKRLAKEGKDYDVPEHLRNAPTKLMKSLGYGEEYRYAHHEPNAYAA
FT                   GENYFPPELKDTVFYHPTERGMEKQIKEKLQWLKAQDQSSLQQRYKR"
FT   gene            569073..569858
FT                   /gene="znuB"
FT                   /locus_tag="APP7_0514"
FT   CDS_pept        569073..569858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="znuB"
FT                   /locus_tag="APP7_0514"
FT                   /product="high-affinity zinc uptake system membrane protein
FT                   ZnuB"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61166"
FT                   /db_xref="GOA:B3H104"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:B3H104"
FT                   /protein_id="ACE61166.1"
FT                   /translation="MFEILFPAWLAGLLLAFITAPLGAFVVWRKMAYFGDTLSHSALLG
FT                   VALGIFLQIDPYIAVIVMTLILAMLLVWLEHKTAYSLDTVLGIIAHCSLSLGVITISLL
FT                   DNVRVDLMSYLFGDLLAIDFDDVVFIGSGMLFIAGVLGYFWKKLLSITISPELAQIEGL
FT                   NVVRLRLVLMLLTALTIALSMKFVGALIITSLLIIPSAIARRFAKTPEAMVGYAIIFSI
FT                   FSITGGLLFSAWKDTPAGPSVVVCAGAIFLLSLFRKEKV"
FT   gene            570037..570834
FT                   /locus_tag="APP7_0515"
FT   CDS_pept        570037..570834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0515"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61167"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR026869"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:B3H105"
FT                   /protein_id="ACE61167.1"
FT                   /translation="MCQLLGMNCNTPTDITFSFEGFRRRAGVTDQHTDGFGIAFFEGKG
FT                   VRIFRDNRPGASSPMADLVGQYHIKSFNVIAHIRKATRGDINLENTHPFIRELWGENWV
FT                   FAHNGTVEGVGVCEECHYQPIGTTDSEAAFCCLVSQLRERFLKKPSEKEIFDAVVEITS
FT                   EIAKHGVFNFILSNGHWMIARCSTNLHYVTRKAPFSTALRDDDVEIDFSKYTTANDKVT
FT                   IITTQPLTKNEKWVKMKNGGYAFFKNGDLIEEIEGTLPEQTHV"
FT   gene            complement(570914..571990)
FT                   /gene="metX"
FT                   /locus_tag="APP7_0516"
FT   CDS_pept        complement(570914..571990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metX"
FT                   /locus_tag="APP7_0516"
FT                   /product="homoserine O-acetyltransferase"
FT                   /EC_number="2.3.1.31"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61168"
FT                   /db_xref="GOA:B3H106"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR008220"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B3H106"
FT                   /protein_id="ACE61168.1"
FT                   /translation="MAHSITLFSEKPLSLILGGMLSPIDVAYQTYGTLNADKSNVVLLC
FT                   HALTGDAEPYKNAPEQGWWQDFIGSGLAFDTDRYFFICSNVLGGCKGTTGPSSINAKTG
FT                   KPYGSQFPIITVQDIVEVQKALLDTLGISHLHAVVGGSFGGMQATQWGISYPDFVSNII
FT                   NLCSSLTLSAEAIGFNHVMRQAIINDPHFNHGDYYDGLPPDNGLKIARMLGMLTYRTDV
FT                   QLARAFGREMKQQTEIWGDYFQVESYLSYQGVKFLDRFDANSYLRLLRALDLYDPALGY
FT                   EHEIDALKRIKANYTLVAITSDQLFKQIDVLKSKQRLEAAGVQVDYHEFHSNFGHDAFL
FT                   VDYDFFEPMIRKGLQTET"
FT   gene            572282..572971
FT                   /gene="sanA"
FT                   /locus_tag="APP7_0517"
FT   CDS_pept        572282..572971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sanA"
FT                   /locus_tag="APP7_0517"
FT                   /product="SanA protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61169"
FT                   /db_xref="GOA:B3H107"
FT                   /db_xref="InterPro:IPR003848"
FT                   /db_xref="UniProtKB/TrEMBL:B3H107"
FT                   /protein_id="ACE61169.1"
FT                   /translation="MELTQATESLPKTSLWKRCLSICPRIALVSFAIVLFLSIAIFIID
FT                   YATGIYVKDNIYTDIEKLPKHRNAVVLGTSKFYAKGTPNLYYKYRLEAAVQLINKGKAK
FT                   KLLVSGDNKTPYYNEPKVMLNDLYNMGIPKNMIEQDFAGYRTLDSIVRASKVYKLEPFI
FT                   IVSQQFHCERALFIAKYHNINAVCFTAKYPEGHIKVRLREFLARIGMIWDFLVWTKPET
FT                   LDKVKSK"
FT   gene            573228..575474
FT                   /gene="ataC"
FT                   /locus_tag="APP7_0518"
FT   CDS_pept        573228..575474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ataC"
FT                   /locus_tag="APP7_0518"
FT                   /product="autotransporter adhesin"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61170"
FT                   /db_xref="GOA:B3GX18"
FT                   /db_xref="InterPro:IPR008635"
FT                   /db_xref="InterPro:IPR008640"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR024973"
FT                   /db_xref="UniProtKB/TrEMBL:B3GX18"
FT                   /protein_id="ACE61170.1"
FT                   /translation="MNKIFKVIWSHATQTFVVVSELTRSKSKAKASVSDVKKSGVSSLI
FT                   TSGFKLSAISSLLISAMPSVYAAVAISSTGWNTVDTSNVQATGNGIAIGSNAGKQQSDG
FT                   YTSNNSAEATRNAYHLQNIGGSASNNTISLGTNAYAGGEDSVAIGTRAQAVHNVQTTNM
FT                   AYNSRGSYNAGAVAIGFQSIARGDQTVALGSRAAAYNRQATAIGNDSYAMGVGSVVIGG
FT                   DDSGYAYESINGTGKQAWANNSGNLGYTNLATGFNPSKEPNKADYRPSAASGNGATVVG
FT                   VHSQALSKGSTALGVAATAGDGGKISSTIKDGQIVGIDSTQNIEATAIGALAHAQFRNT
FT                   TAVGHAAKAIGEYSTSIGDDAAANGKNSSAVGKSATANGEFAIAIGNAESNNVEGTKTQ
FT                   ANGTRAIAIGTSAKSLANNTISIGSKANTSIEGAVALGANSESNRQLNAAETTNPYVPA
FT                   TANQSEANAIKATVATTGAVSIGKDGVRRQITNLAAGTADTDAVNVAQLKTAVDTWNVQ
FT                   ENGSQKKVINNRDNVNFANGTGTTATVGVDSAGKSAIVKYSVNQSGLNVATDGKVTAVT
FT                   NGNNFATAEQIADAINKSEKTTVVNGNTEITATPKVNGTVTTYDLALSEKTVNDIKQGT
FT                   TALQEIETTADGVKAQTIKKDSNKANFTSGKNIKLTPSDKGIEVATKDDVDFTTVNATT
FT                   VNGDTIKSGNVVINKNGINAGNQKITNVAKGTEDSDAVNYSHLNCQTKCNDFLK"
FT   gene            complement(575444..576418)
FT                   /locus_tag="APP7_0519"
FT   CDS_pept        complement(575444..576418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0519"
FT                   /product="Transposase for insertion sequence element
FT                   ISApl1"
FT                   /function="Transposase and inactivated derivatives, IS30
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61171"
FT                   /db_xref="GOA:B3GX19"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR001598"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025246"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B3GX19"
FT                   /protein_id="ACE61171.1"
FT                   /translation="MMSTSYRHLTINEREKIMILLAQGKKQAEIAKALGRSSSTISREL
FT                   KRHALESYSATNAQNSYLKHRQNSKAQRKLEQPEYFNLVQEKFLTENWSPEQISARLKL
FT                   EKSELSISYSTIYRGIYSGLFDIGERKASRKLRHKGKTRHTKNHHEKRGKIQISNHLND
FT                   RPISAQNRSRFGHWEADTVLGKAGGACLLTLTERKSRFELVKKIPAKKAEAVQKAMIEL
FT                   LDSHILRSITPDRGKEFAQHRLVTEALGVEFYFPEPHQPWTRGTNENTNGLLREYFPKH
FT                   QDINQWSEVDIQQVINKLNLRPRKCLGWKTPYEVYFKKSLHLV"
FT   gene            576478..584028
FT                   /gene="ataC"
FT                   /locus_tag="APP7_0520"
FT   CDS_pept        576478..584028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ataC"
FT                   /locus_tag="APP7_0520"
FT                   /product="autotransporter adhesin"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61172"
FT                   /db_xref="GOA:B3GX20"
FT                   /db_xref="InterPro:IPR005594"
FT                   /db_xref="InterPro:IPR008635"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="UniProtKB/TrEMBL:B3GX20"
FT                   /protein_id="ACE61172.1"
FT                   /translation="MLHLDCKFSQLKEYVGNNSSYTWNISDNAEGTNSATVSNKDTVAV
FT                   QGSVKKDESTTKSGIVTKLDGKNITVDLSEKAKQELENGQKHSSVNGDTNVLVEVNKAP
FT                   NAEGGKQYDVKLADKIVIGQGDNSVTIDGTSGTVSGLNNLTWDPSATYEGGKAATQEQL
FT                   KLVSDEVQKGWNVQTNNDTAQKVAPGETVKFVDGKNIKVTSNGKEITIATADNVVTTDT
FT                   DKYVTGGKVEYDNQGNGTTTLTLRDGSTAQVTGAKNNFVTSAKTDPNGKKATLTRNDGG
FT                   TVDIDLTNTVNQAVNEATEKGTHYEGDKPDTGATANNFKRKLGETTKVLGGAQGELSDN
FT                   NIGVVSNGSDTLTVKLAKSLTDLTNATFGSNDDKTVINKDGVTITNGADANKTVSLTDG
FT                   GLNNGGNKITNVAKGDADTDAVNVSQLNQAIKDSSYNWNISDGKTEQAVPDDGKVSVKG
FT                   SANDDSKATSGIVTTLTGTDITVDLSDKSKQDIADGKKHSSVEGDANVVVTQTTTNKDG
FT                   GKQYDVKLADKVSIGSDKATTVTIDGTKGTVSGLTNTTWDPNKEYTGGQAATQEQLKSV
FT                   SDVANSGWNISANGQNESNVGPKGKVSFNNTDGNVLISKETTDNNVTFNLNNDLTVGGA
FT                   GKDGKDGKDGTLSVKGADGKTGVTLNGKDGTIGLTGAPGKDGKDAQATIKVVDGTKGLD
FT                   GNNGKDGESKTRIVYEKPNGGGTEEIATLNDGLNFVGDKGQVIQKKLNETLAIKGNLDA
FT                   AAVVTDKNLRVDNDKDKNGELIIKMAKSLTDLTNATFSSDDSNTVIGGNGLTITPKAGD
FT                   EVSLTDKGLNNGNNTIINVAPGVNGTDAVNKDQLDGVNATANAGWNLTTNGDNTNASNV
FT                   APNSTVDLANTDGNIVITKAGNNVTFDLNNNLTVGGPGKDGKDGVDGQLGVQGKDGKTG
FT                   VTLNGKDGSIGLTGPKGADGKDGANATISVVNGPVGVDGTDGKDGKDGMTRIVYTDPKG
FT                   TTHNVSTLNDGLNFAGNQGDTIVKKLNETLTVKGALANTADASSENLRVDSQDGALVVK
FT                   LAQNLANLTTATFGNTDTDKTVVSKDGVTISNGSDKDKTVSLTDKGLNNGNNQITNVTS
FT                   GLTDSTGQKSDLANATTTNAVNVGDLKDTVNNLTNATTGGFGLKDDNNTEVKQDLGKTI
FT                   QIKGKDGVTVTSNVADKSLEVALQGDVTVNGKDGKDGSIGVKGADGKDGTKITKDAVVF
FT                   NGVDGKDGKDGQVSIKVEQGEKGIAGNDGANGTTKTRIVYEKPNGDKEQVATLNDGLNF
FT                   VGDKGQVIQKKLNETLAIKGNLDANATVTDKNLRVDNDKDQNGELIIKMAKSLTDLTNA
FT                   TFSSGDINATIGGNGLTITPKGGDVVSLTDKGLNNGNNTITNVAPGVNGTDAVNKGQLD
FT                   GVNATANAGWNLTTNGDNTNASNVAPNSTVDLANTDGNIVITKAGNNVTFDLNNNLTVG
FT                   GPGKDGKDGVDGQLGVQGKDGKTGVALNGKDGAIGINGKDGSNGSITVKQGKPGVDGKD
FT                   GETKTRIAYETKDETGKPTTEEVATLKDGLKFVGDTGEVIAKKLNETLAIKGNLTATAA
FT                   VTDKNLRVDNENGQLIVKMAKSLTDLTNATFGSDNSNTTIGGNGVTITPKGGDASNTVS
FT                   LTDKGLNNGNNQVTNVSTGLKDRDGNNVTLANASGDVLNNAVNVGDLKDSVNNLTNATT
FT                   GGFGLTDEKGNDVKADLGKTVTVQGDGSVKTEVVEKDGKKALQIGLTNNVTVGNDKEPG
FT                   TITVKGENGKDGVSISGKDGISIKGENGQDAVSINGKDGNGAIAVNGKDGKTGVGLDGA
FT                   NGTIGINGKDGSNGTITLAKGEPGVDGKDGKTRIVYEAKTPDGKTVTEEVATLKDGLKF
FT                   VGNDGKVITKELNETLTIKGNLSTAADVTDKNLRVDNVDNALIIKMARTLTDLTSATFT
FT                   NAGGDKSVVDGNGLTITPTKGGNTVSLTTSGLDNGGNKVINVAAGDVNANSTDAVNGSQ
FT                   LYAVSEVANKGWNIQTNGNDTTNVKPGDTVNFVNGDNIAITNDGTKVTVGLVKNVDLGE
FT                   DGSIKAGDTFVNKDGVKVGDNVSLTKDGLTAGDVKISATTGINAGDKQITNVASGLGGK
FT                   KLSEAEGDTLTNAANIGDLQTAVSSVTDASQGGGFGLADDKGANVTQNLGKTIAVKGDG
FT                   KNISTVVKGGALTVNLNKDVDLGKDGSLTIGNTTINSDQVKVGDVTVSSNGKVSGVADG
FT                   DISPNSTEAINGSQLYDANQNIANYLGGGSKLDDKGNVIAPTYTITKVDGNTTTANNVG
FT                   DAITNLNNEVVKPLTFEGDTGVASKRKLGSTVTIKGGVQDSSKLSENNIGVVSDGKGTL
FT                   AVKLAKDIKVDSVEAKTVNANTVNANTVKAGDTTINSDGVTIKDGPSVTKSGINAAGNR
FT                   ITNVKAGQADTDAVNVSQLKGAVGHVNQRINKVNKDLRAGIAGANAAAGLPQAYMPGKS
FT                   MMAVAAGTYKNESALAVGYSRSSDNGKVILKLQGNANTRGDLGGSVGVGYQW"
FT   gene            complement(584299..584997)
FT                   /locus_tag="APP7_0521"
FT   CDS_pept        complement(584299..584997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0521"
FT                   /product="protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61173"
FT                   /db_xref="InterPro:IPR003741"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:B3GX21"
FT                   /protein_id="ACE61173.1"
FT                   /translation="MDLQNRENFLNKLAQRMGRERKLVPDQMEAPVNNHPTTRLTHLSQ
FT                   QELCNEFMNFAKVLLVDVVETKEANVAQAVLEVCEKYGGGNIVLNNDARLETLGITDAV
FT                   KAKFDSYIWDFTNREENISRSEQANIGIVYGEYGLAESGGIVLFASKDNGRSTSLLPTT
FT                   SIVIVRKSTVLPRVAQLAQILHEKAQAGERMPSCVNIISGPSATADIELIKVVGVHGPV
FT                   SKIYVVIDDL"
FT   gene            complement(585126..586535)
FT                   /gene="ykgF"
FT                   /locus_tag="APP7_0522"
FT   CDS_pept        complement(585126..586535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykgF"
FT                   /locus_tag="APP7_0522"
FT                   /product="putative electron transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61174"
FT                   /db_xref="GOA:B3GX22"
FT                   /db_xref="InterPro:IPR003741"
FT                   /db_xref="InterPro:IPR004452"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR024569"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:B3GX22"
FT                   /protein_id="ACE61174.1"
FT                   /translation="MSHLQTSTLPFKQRVEQQVHNDIMRKAVVKAQETIGANRQKMVDE
FT                   LGNWEEWRDLSKQFRNHVLANLDAYLYQLSEKVTQNGGHVFFAETAEEATAYIRKVALE
FT                   KNAKTIVKSKSMVTEEIGLNHVLEAEGMKVVETDLGEYLLQIVGDKPSHIVVPAIHKDR
FT                   HRIRKELHEVLGYEGTEQPEEMNAFVRKTLRKDFLAADIGISGCNFAVPETGSVCLVTN
FT                   EGNLRLATTLPKTHIAVMGMERIAPTFKEVDALITMLCRSAVGAKLTAYNTWLTGPRLE
FT                   GETDGPEDFHLVIVDNGRSKILESEFSEVLRCIRCGACLNTCPAYRQIGGHGYGSIYPG
FT                   PIGSVISPLLGGYEEFKELPYACSLCTACNSVCPVKIPLAQLILKHREKIAEAGLTPFS
FT                   ERLSIKGFTFANSNPSVWNMGVKVGAKIAGKFIKNGKAPIQVGALAEWTKARDLPTADG
FT                   ESFREWFKNRK"
FT   gene            complement(586545..587270)
FT                   /gene="ykgE"
FT                   /locus_tag="APP7_0523"
FT   CDS_pept        complement(586545..587270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykgE"
FT                   /locus_tag="APP7_0523"
FT                   /product="putative dehydrogenase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61175"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="UniProtKB/TrEMBL:B3GX23"
FT                   /protein_id="ACE61175.1"
FT                   /translation="MNVNFYVTCIADIVKAGVAKNSVLLLEKLGCNVVFLEKQGCCGQP
FT                   AMNSGYAKQAIPGMKNLIETFEVNDYPIVAPAGSCVYAIKNYAEYLNRFGEPEWAKRAE
FT                   KIAARLYDLTDFIVNVLKRTDVGASLTGKAVYHPSCSLSRKLGIVDEPLTLLKNVKGLE
FT                   LLPIHNQQTCCGFGGTFSVKMAEISGEMVTEKVVNITEVEPEYLVGADVSCLINIAGRL
FT                   NREGKNVKVMHIAEVLMQE"
FT   gene            complement(587440..589035)
FT                   /gene="lctP"
FT                   /locus_tag="APP7_0524"
FT   CDS_pept        complement(587440..589035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lctP"
FT                   /locus_tag="APP7_0524"
FT                   /product="putative L-lactate permease"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61176"
FT                   /db_xref="GOA:B3GX24"
FT                   /db_xref="InterPro:IPR003804"
FT                   /db_xref="UniProtKB/TrEMBL:B3GX24"
FT                   /protein_id="ACE61176.1"
FT                   /translation="MALFLSIFPIVLLIYLMVKRNALPSYVALPWVAVVVLIIHLLFFA
FT                   TDITIISANISSAIMSVFTPITVIFGAILFNRFSEASGVTNTLRKWLGTINPNPVAQLM
FT                   IIGWAFAFMIEGASGFGTPAAIAAPILVGLGFNPIKVAILALIMNSVPVSFGAVGTPTW
FT                   FGFGSLNLAEAQILEIGSMTALIHAFAALVIPVIALSFIVTWKEIRQNIVFVYLSVFAC
FT                   VIPYFFLAQVNYEFPSLVGGAIGMFISIFLANKGVGLAKVENTLDNSSVTAKEVAKALL
FT                   PTGLLIGFLIVTRIQQLPFKAMMNNTTAWISTQLGSLGQFEISQGLVFSLKNIFGTTVS
FT                   ANYKLLYVPALIPFVITVLICIPLFALSGSKVKDVFAGSFKQTKNPFIALVGALIMVNL
FT                   MLVGNDGSMVKIIGKSFAAATGEYWTIFASYLGAVGAFFSGSNTVSNLTFGSVQLSTAE
FT                   ITGLSTSLVLALQSVGGAMGNMVCINNIVAVNSVLNIQNQEGAILKKTVLPMFIYGVIA
FT                   AIVALTIIPIFFNV"
FT   gene            complement(589501..589908)
FT                   /gene="hns"
FT                   /locus_tag="APP7_0525"
FT   CDS_pept        complement(589501..589908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hns"
FT                   /locus_tag="APP7_0525"
FT                   /product="DNA-binding protein H-NS"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61177"
FT                   /db_xref="GOA:B3GX25"
FT                   /db_xref="InterPro:IPR001801"
FT                   /db_xref="InterPro:IPR027444"
FT                   /db_xref="InterPro:IPR027454"
FT                   /db_xref="InterPro:IPR037150"
FT                   /db_xref="UniProtKB/TrEMBL:B3GX25"
FT                   /protein_id="ACE61177.1"
FT                   /translation="MSEILKTLSNIRNLRALAKDSTLEQMESLLEKVSIVVEEKRELVK
FT                   AQELEQAKVMEGLKKYKELLAQDGISAEELVALLNNATEHKKREPRAPRPAKYKYVDEN
FT                   GNEKTWTGQGRTPRPIQKALDEGKSLASFAI"
FT   gene            590466..591983
FT                   /locus_tag="APP7_0526"
FT   CDS_pept        590466..591983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0526"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61178"
FT                   /db_xref="GOA:B3GX26"
FT                   /db_xref="InterPro:IPR018461"
FT                   /db_xref="UniProtKB/TrEMBL:B3GX26"
FT                   /protein_id="ACE61178.1"
FT                   /translation="MNLIDYSSSLLSIIPASLALLLAMVTRRVLLSLSVGILVGAFMLS
FT                   ATFADGFVYLKNIAIGLVYADGEYSFGKVQILIFLLLLGVFTSLLTYSGSNQAFANWAK
FT                   KHIKGRRGAKLLTACLVFVTFIDDYFHSLAVGAIARPVTDKFKVSRAKLAYILDSTAAP
FT                   MCVLMPVSSWGASIIATIGGLLATYNITEYTAISAFASMSLMNYYALFALIMVFIVAYF
FT                   SFDIGSMSRFERKALASETHTNEDADVESKGRVYALIVPILVLIVTTVTSMIYTGAQAL
FT                   EAFSLLGAFENTNVNLSLVIGGSAGVLAVMLCTLGLIKAEDYPKAIWVGCKSMFGAILI
FT                   LTLAWLISSVVKDMHTGDYLSTLVAGNINPAFLPAILFVLATVMAFATGTSWGTFGIML
FT                   PIAAAMAINVDASLLIPCMSAVMAGAVCGDHCSPISDTTILSSTGAQCNHIDHVTSQLP
FT                   YALLVAVASIIGYLVLGFTGSAVSGFITTAVVMMVLIFIFRSKKMTA"
FT   gene            592189..593160
FT                   /gene="mglB1"
FT                   /locus_tag="APP7_0527"
FT   CDS_pept        592189..593160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mglB1"
FT                   /locus_tag="APP7_0527"
FT                   /product="D-galactose-binding periplasmic protein
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61179"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B3GX27"
FT                   /protein_id="ACE61179.1"
FT                   /translation="MKKLAICSLAVGISLSSSVIAQDTLGVSLYQYDDNFIRLMHDELI
FT                   SYTSENPSLSLLMNDAQNSQFVQNNQVQTLVNHKVDVLAVNLVDPNAWATVIGKAKDAN
FT                   LPIILFNKDPGAKAINSYKKVYYVGSNPEEAGKAQAKMIANHWKSSEALDLNHDGKMQY
FT                   ALLKGEVGHPDAEKRTKAVIEELKTQGIKTEQLALESAVWNKEIAKTKVNAWLSTPQNN
FT                   IEVIISNNDSMAIGALEVVTEKNKALPIYGVDATPEALNLIRKGKLAGTVTNDWRSQSR
FT                   AIIDFSRLLAKGELPENSQWKLENRVLRIPAMSIDRSNISDF"
FT   gene            complement(593295..594167)
FT                   /gene="sucD"
FT                   /locus_tag="APP7_0528"
FT   CDS_pept        complement(593295..594167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sucD"
FT                   /locus_tag="APP7_0528"
FT                   /product="succinyl-CoA ligase [ADP-forming] subunit alpha"
FT                   /EC_number="6.2.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61180"
FT                   /db_xref="GOA:B3GX28"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR005810"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017440"
FT                   /db_xref="InterPro:IPR033847"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B3GX28"
FT                   /protein_id="ACE61180.1"
FT                   /translation="MAILIDKNTKVICQGFTGGQGTFHSEQALAYGTKLVGGVSPNKGG
FT                   TTHLGLPVFDTVREAVEKTGATASVIYVPAPGCKDAILEAIDAGIQLIVCITEGIPTLD
FT                   MVCVKQKLKESGVRMIGPNCPGIITPDECKIGIMPAHIHKKGKIGIVSRSGTLTYEAVK
FT                   QTTDEGFGQSTCVGIGGDPIPGSSFIDILKLFQADPETEAIVMIGEIGGSAEEEAAEFI
FT                   KMHVTKPVVSYIAGVTAPKGKRMGHAGAIISGGKGTADEKFKTLENAGVKTVRSLAEIG
FT                   SALRELLHK"
FT   gene            complement(594170..595336)
FT                   /gene="sucC"
FT                   /locus_tag="APP7_0529"
FT   CDS_pept        complement(594170..595336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sucC"
FT                   /locus_tag="APP7_0529"
FT                   /product="succinyl-CoA synthetase beta chain"
FT                   /EC_number="6.2.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61181"
FT                   /db_xref="GOA:B3GX29"
FT                   /db_xref="InterPro:IPR005809"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR013650"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017866"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3GX29"
FT                   /protein_id="ACE61181.1"
FT                   /translation="MNLHEYQAKQIFAQYRLPVSKGIVCHSLDDAVSAIHTLAGDTWAA
FT                   KCQVHAGGRGKAGGVKLVRSEAEIREFCNQWLGQRLVTFQTDKNGQPVNTIYLEETCLI
FT                   ERELYLGAVIDRSSQKIVFMASNAGGMNIEDVAAQTPELIHKATIDPLTGAQAFQGREL
FT                   AFKLGLSGDQIKQFAHLFVQLAKLFIEKDLALLEVNPLVLTKQGQLLCLDAKMVIDSNA
FT                   LYRHPELKALQDPSQEDAREADAAKWDLNYVALDGNIGCMVNGAGLAMGTMDIVKLHGG
FT                   RPANFLDVGGGATKERVSEAFKLILSDQNVKAVLVNIFGGIVRCDLIAEGIIAAVNEVG
FT                   INIPVIVRLEGTNAELGREILANSSLRLIAANTLTQAAQLAVKAAEGK"
FT   gene            complement(595480..596346)
FT                   /locus_tag="APP7_0530"
FT   CDS_pept        complement(595480..596346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61182"
FT                   /db_xref="InterPro:IPR007488"
FT                   /db_xref="UniProtKB/TrEMBL:B3GX30"
FT                   /protein_id="ACE61182.1"
FT                   /translation="MTYYYPTANNVYPDQPHKSYRLKRFRFWLRSVLHASQVKKFSRFA
FT                   NRHPELSELLKAYPNYSYPVIHRFLDKRFNAERRLEIVCDNLTFLPQQFAQYHLPPLWV
FT                   KPISFGEFIPDFEIRLNINEYQAMEGFWALELRQKSSRRLVYLLTFGKIEQSLLIGAIQ
FT                   GANTENAKDLVKFLTKQCHGLRPAYLLIEVMKLLAHTLGYQLLGIPHKYQNKSRFIQSK
FT                   RYTVNYDTLFSESGGLLQEYWQLPLALNKDLTDVPSKKRSMYRKRFEMLDKLADVIQQT
FT                   FPLPPSS"
FT   gene            complement(596489..597718)
FT                   /gene="sucB"
FT                   /locus_tag="APP7_0531"
FT   CDS_pept        complement(596489..597718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sucB"
FT                   /locus_tag="APP7_0531"
FT                   /product="dihydrolipoyllysine-residue succinyltransferase
FT                   component of 2-oxoglutarate dehydrogenase complex (E2)"
FT                   /EC_number="2.3.1.61"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61183"
FT                   /db_xref="GOA:B3GX31"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR006255"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:B3GX31"
FT                   /protein_id="ACE61183.1"
FT                   /translation="MTIEILTPVLPESVADATVATWHKKVGDTVKRDEVLVEIETDKVV
FT                   LEVPAPNDGVLAEISQEQGATVTSKQLLGKISTVQAGDFTQETIKQTNEATPADRKSAA
FT                   IEYDHSDADSQGPAIRRLLAEHNIEAHLVKGTGVGGRITREDIEHYLAQRQVQETKQAM
FT                   ASEHNTVSTVAYSARSEKRVPMTRLRKRIAERLLEAKNTTAMLTTFNEVDMQPIMSLRK
FT                   TYGEKFEKQHGVRLGFMSFYIKAVVEALKRYPEINASIDGDDVVYHNYFDISIAVSTPR
FT                   GLVTPVIRNCDKLSMADIEKTIKALAEKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTP
FT                   IINPPQSAILGMHAIKDRPVAVNGQVVIRPMMYLALSYDHRLIDGRESVGFLVAVKDLL
FT                   EDPTRLLLEI"
FT   gene            complement(597838..600648)
FT                   /gene="sucA"
FT                   /locus_tag="APP7_0532"
FT   CDS_pept        complement(597838..600648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sucA"
FT                   /locus_tag="APP7_0532"
FT                   /product="2-oxoglutarate dehydrogenase E1 component"
FT                   /EC_number="1.2.4.2"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61184"
FT                   /db_xref="GOA:B3GX32"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR011603"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR031717"
FT                   /db_xref="InterPro:IPR032106"
FT                   /db_xref="InterPro:IPR042179"
FT                   /db_xref="UniProtKB/TrEMBL:B3GX32"
FT                   /protein_id="ACE61184.1"
FT                   /translation="MQHKNFEDWLASSPFGGSNQTYVEEIYEQYLENPANVDASWRVIF
FT                   DTLPKTQVVEQPHSQVRDYFRKLARENVPESVTMIDPEASAKQVRLLQWINAHRFRGYL
FT                   EAKLDPINYYRWKISVVPELDYRHHGFTEADLNETVTIGKYVYGKETMKFSELADALKQ
FT                   TYLGTIGLEFMHVQDMEQRNWLQAKIESTLNKPLFTHTEKVNLLTELTAADGLERYLGA
FT                   KFPGAKRFSLEGSDAFIPMMKEIIRHAGRQGMKDVVMGMAHRGRLNMLVNVLGKRPAEL
FT                   FDEFAGKHADDNRTGDVKYHQGFSSDFDVDGERVHLTLAFNPSHLEIVSPVVIGSVRAR
FT                   QERIRDTEHNKVLAVTVHGDSAVAGQGVVQETLNMSNARGYKVGGTIRIVINNQIGFTT
FT                   SNPNDTRSTEFCTDIAKMIQAPIIHVNGDDPEAVAFAARMAVEYRTLFKRDIFIDLISY
FT                   RRHGHNEADEPLATQPMMYSIIKKHPTPRKVYADRLVAEGVLNQDQATEIMNNYRDALD
FT                   NGDRVVPEWREMDMAAVDWLQYLNYDWTAPYESKFPQDRFYTLAKRVCEYPESLRPHSR
FT                   VEKIYSDRKEMYEGKKLLDWGMAETMAYATLLDEGTHVRLSGEDAGRGTFFHRHAVVHN
FT                   QNDGTGYVPLAHLHANQGRFEVWDSVLSEEAVLAFEYGYATTDPKTLTIWEAQFGDFAN
FT                   GAQIVIDQFISSGEQKWGRMCGLVMLLPHGYEGQGPEHSSARLERYLQLCAQQNMQVCV
FT                   PSTPAQAYHMLRRQAIRKMRRPLVAITPKSLLRHPLAVSSLEELTEGEFQNVIGEIDSN
FT                   ITAKKVKRVVMCSGKVYYDLLEQRRQNEQTDVAIIRIEQLYPFPYEDMKKVLEPYVHVK
FT                   DFVWCQEEPQNQGAWYCSKHNFEASIPEKAKLTYAGRPASASPAVGYTSLHAQQQKQLV
FT                   DDALTL"
FT   gene            complement(600891..601691)
FT                   /gene="znuC"
FT                   /locus_tag="APP7_0533"
FT   CDS_pept        complement(600891..601691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="znuC"
FT                   /locus_tag="APP7_0533"
FT                   /product="high-affinity zinc uptake system ATP-binding
FT                   protein ZnuC"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61185"
FT                   /db_xref="GOA:B3GX33"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017882"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3GX33"
FT                   /protein_id="ACE61185.1"
FT                   /translation="MQIKQLTPVPKEKSKGHPLVQLQQIEVSFNEQKVLHNINLAIYAN
FT                   SITTIVGPNGGGKSTLLKVLLKLLTPDSGKVIHQKGLKIGYVPQKLHLDHSMPITVWKF
FT                   LSLKPDATTQAIQEALSLFSITHLAQNSMQKLSGGELQRVLLARAVLNKPHLLVLDEPM
FT                   QGVDITGQTELYQLLNNTRSWLNCAILMVSHDLNIVMANTDEVLCVNKHICCAGTPEMV
FT                   TNDPHFIHFFGDQFAKNVAFYSHHHNHHHNLHGDVCSGQCECQH"
FT   gene            601895..603385
FT                   /locus_tag="APP7_0534"
FT   CDS_pept        601895..603385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0534"
FT                   /product="hypothetical metalloprotease"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61186"
FT                   /db_xref="GOA:B3GX34"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:B3GX34"
FT                   /protein_id="ACE61186.1"
FT                   /translation="MAILSIFIGIVLALKNQPSINTTANYEQYVVLDEQQADQKDDPEQ
FT                   PEETTQLTSAEDQKQAADKTSTNNVNTEANEEVSEDEKNSELTAEDNSATSYDDLLAED
FT                   DEVEGQEGEISKVENKENEEKLPQEAEKVLNDILDVADEALRIQDQFSYTVGRGDKLKD
FT                   VLEQSGLGASDARAMIKRFPELANLDGGQQFYWILDNYGELEYMNWLVSEKEERIYERK
FT                   DNGKWVFQKIEKKGEWRQDVVRGVISGSFSSSLKEVGLSERQVNQLAVGLQSQIATNKL
FT                   KKGDRFAILVKREYINGTVTEVGNVEGILIVSDKKRYYAIQADNGRYYSSHGETLSRGF
FT                   ARIPLLFNARVSSHYNPRRLHPVTRRVRPHNGVDFGIPTGTPIIAPSDGVVEHIAYQAK
FT                   GAGRYIKIRHGHITTVYMHLSKTLVRVGQSVKKGERIALSGNTGASTGPHLHYEFHLNG
FT                   RPVNPMTVKLPGSNSGMADKERKKFLTRAKYVEAKLKF"
FT   gene            603404..604099
FT                   /gene="dsbC"
FT                   /locus_tag="APP7_0535"
FT   CDS_pept        603404..604099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dsbC"
FT                   /locus_tag="APP7_0535"
FT                   /product="thiol:disulfide interchange protein DsbC
FT                   precursor"
FT                   /EC_number="5.3.4.1"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61187"
FT                   /db_xref="GOA:B3GX35"
FT                   /db_xref="InterPro:IPR009094"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR018950"
FT                   /db_xref="InterPro:IPR033954"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B3GX35"
FT                   /protein_id="ACE61187.1"
FT                   /translation="MKKNVTALFSVSLMGLCVSPVMADDMSLVKTLEGMGATNVKISDS
FT                   ALPGFRTAVSNEGVVQISENGRFVIQGQIFELKNGKAVNITNKSLLADLNALEKEMIIY
FT                   PAKNEKHVVTVFMDITCHYCHLMFQRIKEYNDLGITIRFLAFPRGGMNTQTAKQMEAIW
FT                   TSADKVKALTDAENGTLPKEVKTPNIVKKHYELGIKFGVTGTPNMVDSTGQLIAGYVEP
FT                   KELLKMLSE"
FT   gene            604149..605906
FT                   /gene="recJ"
FT                   /locus_tag="APP7_0536"
FT   CDS_pept        604149..605906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recJ"
FT                   /locus_tag="APP7_0536"
FT                   /product="single-stranded-DNA-specific exonuclease RecJ"
FT                   /EC_number="3.1.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61188"
FT                   /db_xref="GOA:B3GX36"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR004610"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="InterPro:IPR041122"
FT                   /db_xref="UniProtKB/TrEMBL:B3GX36"
FT                   /protein_id="ACE61188.1"
FT                   /translation="MIPLVLFITKRRKIVQKLIKQRPPLTSVTLSENPLLNRLYQSRGI
FT                   NSVQELERSLQYLYRPQQLANIEQAVSLLIDAFKQQSRIVIVGDFDADGATSTALTILA
FT                   LRQLGFKNVDYLIPDRFSQGYGLSVAVAEMVLAKGADLVITVDNGISSFEGIALLKLHH
FT                   IKVLVTDHHLPAETLPNADAMVNPNLADCSFPSKSLAGVGVAFYVMLALRSQMREAQLF
FT                   SLKEPNLAELLDLVALGTVADVVPLDHNNRILVHQGLTRIRSGHCRAGIRALAEVSKRE
FT                   LASLQAGDLGFAIAPRLNAAGRLENMSLGVELLIAENMEIARQLAFELDSLNQTRKEFE
FT                   QEMKTEALAICANLPSLMQKDQAHGIALYQADWHQGVIGILASRIKDQFHRPVIAFAQE
FT                   SENSEYLKGSARSIAGLHMRDLLERIDVKHPNLIVKFGGHAMAAGLTIHQNNFLKFQHI
FT                   FDEVIDEIIAPEQLQGVIYTDGELSSNELNIHIAELLQKAGPWGQSFPEPLFEGEFKIL
FT                   QQRILGGKHLKLMVEQPFGGLFDAIWFNADLRIFPDLSIKSARLIYKLDINEFKGNKNL
FT                   QLRIENIVI"
FT   gene            606040..606891
FT                   /gene="plpD"
FT                   /locus_tag="APP7_0537"
FT   CDS_pept        606040..606891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plpD"
FT                   /locus_tag="APP7_0537"
FT                   /product="lipoprotein Plp4"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61189"
FT                   /db_xref="GOA:B3GX37"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR007450"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="InterPro:IPR037873"
FT                   /db_xref="UniProtKB/TrEMBL:B3GX37"
FT                   /protein_id="ACE61189.1"
FT                   /translation="MKNTTVFRGLLLSGIALAVTACGNLSNVTDEGTTENPVFPKISES
FT                   EFNHDGSQFGSWPNWENVRQIERGMNKDQLYNLIGRPHFEEGLYGVREWDYAFNYRENG
FT                   VHKICQFKVLFDKDMNAQSFFWYPNGCNGNASFNLSGDFLFDFDKDTLTAKGKEVVDNV
FT                   AAQLKSSKAEQVKVAGYTDRLGSEKYNLDLSQRRANMVKARLVQQGVTANINAVGYGKA
FT                   QQVKACDGIPHGQELKDCLRPNRRVEVTANGGVLKQNEGGNVAGPNGPAPLYQTPAYNS
FT                   GK"
FT   gene            606973..607791
FT                   /locus_tag="APP7_0538"
FT   CDS_pept        606973..607791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0538"
FT                   /product="Predicted hydrolases of the HAD superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61190"
FT                   /db_xref="GOA:B3GX38"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B3GX38"
FT                   /protein_id="ACE61190.1"
FT                   /translation="MTYQAIAFDLDGTLLNPRATILESSKQAIKKAREKGIKVFFVTGR
FT                   HHTAVRPYYAEIGLDTPVVCCNGTYLYDFQHDKVLSGKPLTAEQASHLINDAKSQGIHT
FT                   AVYFRDAMTYEQLNPHFAKLQQWVASCPESVRPNVYQLESFQQEIDKGTTVWKVLISDP
FT                   NLEKMQNFVKNLPLDQFSPEWSWVDRVDITSVGNSKGAMLAELLKMEGLEPQNVIAFGD
FT                   NFNDISMLELVGLGIAMGDSEEEVKQRADKTIGSNSEDSIAKTLTELLNL"
FT   gene            607791..609506
FT                   /gene="narQ"
FT                   /locus_tag="APP7_0539"
FT   CDS_pept        607791..609506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="narQ"
FT                   /locus_tag="APP7_0539"
FT                   /product="sensor protein NarQ-like protein"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61191"
FT                   /db_xref="GOA:B3GX39"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR016380"
FT                   /db_xref="InterPro:IPR029095"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR042295"
FT                   /db_xref="UniProtKB/TrEMBL:B3GX39"
FT                   /protein_id="ACE61191.1"
FT                   /translation="MNKPVNYSKYSIARRIGFYFLVMIAFASLISGISLSIMWSNKSDA
FT                   GLINVSGSLRMQSYRFLYEMEHHPQSIPARLAEYRQSLNSPEIQDSLEHKCLLPKEVTE
FT                   AYAKLQKNWLEMESFIVKRDRNAYEANIEGYANQVNNFVWQLQEFVELKLKVAIGVIAV
FT                   SMLLIIALAYFGVWYTRKRIITPLNQLVTASRQVKNEDFDHIRLAVDDPNELGLLSSAF
FT                   TQMASELAKLYASLEEKVEDKTRRLMAVNRSLLVLFQCSQLLTAKPVNQSVLFKVLQTI
FT                   LDNEQLRGIEIQVYGADYWNVTIDNAPEQDWQFNEIAIENEKLALLRWKPSLLCPDERL
FT                   IQNVSEMIGRSLYVLQVQKQQQQLLLMEERSIIARELHDSLAQSLTFFKIQVSLLKRNG
FT                   EVKQDWDKQKAILNDFEKALNEAYSQLRELLSTFRLTIEEANLTHALERVLDSLRIRTS
FT                   AQIRLNCKLPSQIFSAQQQVHALQIVREAVINAIKHANATEIYVVAETNADGEHCLIIR
FT                   DNGKGIASDIEPEGHYGLTIMKERAAELKGEFSIKNRPEGGVEVVVVLPNMITA"
FT   gene            609529..609942
FT                   /locus_tag="APP7_0540"
FT   CDS_pept        609529..609942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0540"
FT                   /product="predicted sortase--related acyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61192"
FT                   /db_xref="GOA:B3GX40"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B3GX40"
FT                   /protein_id="ACE61192.1"
FT                   /translation="MQIRKSTEADFETILNIYNQAIPTHQITADLELATPINRRAWFDF
FT                   HLTSEQYPIWTVEDENGIAGWFSFSPFYERPAFVHTSEISIYLDSSAKGKGYGSKIIEF
FT                   MQAEMLKHNIHTLMAYVFELNQVSQNLMRKHGF"
FT   gene            610089..610685
FT                   /locus_tag="APP7_0541"
FT   CDS_pept        610089..610685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0541"
FT                   /product="HAM1-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61193"
FT                   /db_xref="GOA:B3GX41"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:B3GX41"
FT                   /protein_id="ACE61193.1"
FT                   /translation="MERTKVVLATGNKGKVKEMADVLAQFGFDVVAQSEFGIESPEETG
FT                   LTFVENALLKARYASKMTGLPAIADDSGLAVDALGGAPGLYSARYAGEDGNDEANRKKL
FT                   LAELQNVADEKRGAKFVSCIVFLQHETDPTPKIALGECFGEILREERGQNGFGYDSLFF
FT                   YPPKNCSFAELETSEKKQISHRAIALDVLKQQLLK"
FT   gene            610713..611033
FT                   /locus_tag="APP7_0542"
FT   CDS_pept        610713..611033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0542"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61194"
FT                   /db_xref="InterPro:IPR002765"
FT                   /db_xref="InterPro:IPR035439"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3GX42"
FT                   /protein_id="ACE61194.1"
FT                   /translation="MIITTTPTIDGHQITEYKGLVFGEVVSGANFIRDFFASITDVIGG
FT                   RSGAYESKLNSARQEALAELEKEAKRVGANALVGVSMEYQSMGGDKGMFIVVATGTAVV
FT                   IR"
FT   gene            complement(611139..612809)
FT                   /gene="fhs"
FT                   /locus_tag="APP7_0543"
FT   CDS_pept        complement(611139..612809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhs"
FT                   /locus_tag="APP7_0543"
FT                   /product="formyltetrahydrofolate synthetase"
FT                   /EC_number="6.3.4.3"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61195"
FT                   /db_xref="GOA:B3GX43"
FT                   /db_xref="InterPro:IPR000559"
FT                   /db_xref="InterPro:IPR020628"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3GX43"
FT                   /protein_id="ACE61195.1"
FT                   /translation="MKSDVEIAQAATMQPIHKIAEKLGLNADQIEQYGKYKAKINPTDA
FT                   FKLPAKNGKLILVTAINPTPAGEGKTTVTIGLTDALNQLGKNAVVAAREPSLGPVFGVK
FT                   GGAAGGGYAQVLPMEDINLHFTGDFHAITSANNLLAALLDNHIYQGNALNIDTKRVLWR
FT                   RVIDMNDRQLRNVLGGLGNPTDGVIRPDGFDITVASEVMAIFCLAKDLADLKTRLGNIL
FT                   VAYTKDKQPVYAKDLNAHGAMAALLKDAIKPNLVQTIEGSPAFIHGGPFANIAHGCNSV
FT                   TATRLALHLGDYAVTEAGFGADLGAEKFCDIKCRLADLKPDVAVVVATVKALKYNGGVE
FT                   KANLAEENLTALQQGLPNLLKHISNLKNVFGLPVVVALNRFVSDTDAELALIQTACAKQ
FT                   GVEVSLTEVWGKGGAGGVDLAQKVLKAIDEQENRFNFVYDVNESVQNKIKAIAQKIYGA
FT                   DDVNFSAEALAEIKNLEKLGLDKLPICMAKTQYSLSDNAKLLGCPSGFTVTVRSISVSA
FT                   GAGFIVAICGSIMRMPGLPKVPAANRIDVDENGLITGLF"
FT   gene            612919..613365
FT                   /locus_tag="APP7_0544"
FT   CDS_pept        612919..613365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0544"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61196"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="InterPro:IPR008228"
FT                   /db_xref="UniProtKB/TrEMBL:B3GX44"
FT                   /protein_id="ACE61196.1"
FT                   /translation="MTNQLTPNFWQTKSLLEMNDAEWEALCDGCGKCCYRKYIQGRGKR
FT                   ERLYYTSVACNLLDVDNGRCTNYPNRFKIERDCTKLTKKNLPDFGWLPKTCAYRLLYEG
FT                   KPLFDWHPLISNDPQSVKKANILIPNGIHEKDVIDWFEFVIDEV"
FT   gene            613455..614204
FT                   /locus_tag="APP7_0545"
FT   CDS_pept        613455..614204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0545"
FT                   /product="probable NADP-dependent dehydrogenase"
FT                   /EC_number="1.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61197"
FT                   /db_xref="GOA:B3GX45"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B3GX45"
FT                   /protein_id="ACE61197.1"
FT                   /translation="MKTALVTGATAGFGLAICKLLIQSGYKVIGTGRRKERLDELHSQL
FT                   GNNFLPLAFDVSDDAATTQALNNRPAGWQAVDLLVNNAGLALGLEPAYKTDLKDWYQMI
FT                   DTNIKGLVTVTRLILPEMVERNSGHIINLGSIAGNYPYPGGNVYGGTKAFVKQFSLNLR
FT                   ADLAGTKVRVTNVEPGLCGGTEFSNVRFKGDDDKAAKVYENVNYVAPEDIANIVLWLNQ
FT                   QPEHVNINRIEVMPTAQTFSPLAVARG"
FT   gene            614390..615580
FT                   /gene="trpB"
FT                   /locus_tag="APP7_0546"
FT   CDS_pept        614390..615580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpB"
FT                   /locus_tag="APP7_0546"
FT                   /product="tryptophan synthase beta chain"
FT                   /EC_number="4.2.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61198"
FT                   /db_xref="GOA:B3GX46"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR006653"
FT                   /db_xref="InterPro:IPR006654"
FT                   /db_xref="InterPro:IPR023026"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3GX46"
FT                   /protein_id="ACE61198.1"
FT                   /translation="MSDTLLNPYFGEFGGMYVPEILVPVLKQLEETFVAAQNDPLFQAE
FT                   FTDLLKNYAGRPTALTLCRNLTKGSKTKLYLKREDLLHGGAHKTNQVLGQALLAKRMGK
FT                   TRIIAETGAGQHGVATALACAMLDLPCVIYMGAKDVERQSPNVFRMRLMGAEVIPVQKG
FT                   SCSLKDACCEAMRDWAANYETTHYLIGTAAGPHPFPTMVREFQKMIGEETKRQILEKEN
FT                   RLPDAVIAAVGGGSNAIGMFAGFIEEKSVQLIGVEPAGKGIETGEHGAPLKHGTTGIYF
FT                   GMKSPIMQTKDGQIEESYSISAGLDFPSVGPQHAYLNASGRADYVSITDKEALDAFQAL
FT                   AQHEGIIPALESSHALAYALKLIAQNPDKEQLLVVNLSGRGDKDIFTVDKILNGGN"
FT   gene            615582..616391
FT                   /gene="trpA"
FT                   /locus_tag="APP7_0547"
FT   CDS_pept        615582..616391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpA"
FT                   /locus_tag="APP7_0547"
FT                   /product="tryptophan synthase alpha chain"
FT                   /EC_number="4.2.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61199"
FT                   /db_xref="GOA:B3GX47"
FT                   /db_xref="InterPro:IPR002028"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018204"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3GX47"
FT                   /protein_id="ACE61199.1"
FT                   /translation="MSRFDTLFANLKAKNEGAFVPFVTLCDPDFDRSFEIIETLIANGA
FT                   DALELGFPFSDPLLDGSVIQAANKRALDGGYSTDACFEMIAKIRSKYPEIPIGLLLCAN
FT                   LVFVPTQCVFFNRCAESGVDAVLIADVPVLASEEFTQAAKKHGIQSVFICPPNADQVTI
FT                   ERIANLTEGYTYLVSRSGVTSAENQAHAKNLDNLIESLKRSNSAPILQGFGIAKPAQVK
FT                   EALALGCDGAISGSAIVKIIERNLDSQTQLLSELAKFVSVMKAATKS"
FT   gene            complement(616468..616761)
FT                   /locus_tag="APP7_0548"
FT   CDS_pept        complement(616468..616761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0548"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61200"
FT                   /db_xref="UniProtKB/TrEMBL:B3GX48"
FT                   /protein_id="ACE61200.1"
FT                   /translation="MQNIEKWENRELGQDEKFVQRSTHTTPEMLDELLALQPISIRLSK
FT                   GLIQDLKDIAQLHGLGYQPLIKQILTRFVESEKRMLANEKIQEDLAKLHNAA"
FT   gene            complement(616770..617054)
FT                   /locus_tag="APP7_0549"
FT   CDS_pept        complement(616770..617054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0549"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61201"
FT                   /db_xref="UniProtKB/TrEMBL:B3GX49"
FT                   /protein_id="ACE61201.1"
FT                   /translation="MLIISHQIYLKLIQKHRLSDPETEILEAFSNINGQFLIDTREEHL
FT                   SEPPTEWFIAETNRGIKLKVCFIRKNNDIYIRTAYRPNAEEIRIYEKYK"
FT   gene            617235..620108
FT                   /gene="polA"
FT                   /locus_tag="APP7_0550"
FT   CDS_pept        617235..620108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="polA"
FT                   /locus_tag="APP7_0550"
FT                   /product="DNA polymerase I (POL I)"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61202"
FT                   /db_xref="GOA:B3GX50"
FT                   /db_xref="InterPro:IPR001098"
FT                   /db_xref="InterPro:IPR002298"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR018320"
FT                   /db_xref="InterPro:IPR019760"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="InterPro:IPR020046"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B3GX50"
FT                   /protein_id="ACE61202.1"
FT                   /translation="MATIAQNPLVLVDGSSYLYRAFHAFPPLTNKNGEPTGAMYGVLNM
FT                   LKSLVAQVEPSHIAVVFDAKGKTFRDELFEQYKSHRPPMPDDLRAQVQPLHTIIKALGI
FT                   PLISIEGVEADDVIGTLAVQAANAGKNVLISTGDKDMAQLVNDHIMLINTMNNTLLDRE
FT                   GVIEKYGIPPELIIDYLALQGDASDNIPGVKGVGEKTALGLLQGIGSLKEIYANLDQVA
FT                   TLSFRGAKTLAPKLEAEKDAAALSYLLATIKTDVELEVTHEQLVVQPQKRDELVELFGR
FT                   YEFKRWLNEVMNDANPVTQNSEEKIPNNYQATASVPQAVETEQTFAKVEIDRSRYETVT
FT                   TMEQLQSWIEKINQVKLVAVDTETDNLDSMSANLVGVSFGLANGDACYIPLMHKEQVTL
FT                   EPQQSDLFAEQAEAETTTSFELAKKQLNLTACLTELKPLLENADVKKIGQNIKYDLTIF
FT                   ANHGVQVAGVAFDTMLESYTLNSTGRHNMDELADRYLGHKTIEFEEIAGKGKNQLTFDK
FT                   IAIDVASQYAAEDADVTMKLHQVLAPELEKAPTLVKLFNEIEMPLVEVLSRIERNGVLI
FT                   DPEKLLAQSAEIEQRLAELEQLVHSEAGEVFNLASTKQLQEILFTKLGLPVLKKTPKGA
FT                   PSTNEEVLDELAGQGHLVPKLLMEHRGLSKLKSTYTDKLPLMINPKTGRVHTSYHQAVT
FT                   ATGRLSSSDPNLQNIPIRNEEGRRIRQAFIANKGYKIVAADYSQIELRIMAHLANDEGM
FT                   ITAFAEGKDIHRATAAEIFGLALDQVTSEQRRSAKAINFGLIYGMSEFGLSNQLGISRA
FT                   DAKKYMERYFQRYPAVQQFMTDIRESASKKGYVETLFGRRLYLPEIKSSNAMRRKAAER
FT                   VAINAPMQGTAADIIKVAMIGIDKAIRGDENIKMIMQVHDELVFEVKEELVEHYSQLIK
FT                   AEMEKAIQLKVPLIAEVGVGDNWDEAH"
FT   gene            620205..620360
FT                   /locus_tag="APP7_0551"
FT   CDS_pept        620205..620360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0551"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61203"
FT                   /db_xref="UniProtKB/TrEMBL:B3GX51"
FT                   /protein_id="ACE61203.1"
FT                   /translation="MMTEEYREFLEKSVAQGIKDYEEGRVYTSEQFYERAMKAITQVEK
FT                   DMQDAA"
FT   gene            620783..621424
FT                   /gene="lolA"
FT                   /locus_tag="APP7_0552"
FT   CDS_pept        620783..621424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lolA"
FT                   /locus_tag="APP7_0552"
FT                   /product="Outer-membrane lipoprotein carrier protein
FT                   precursor"
FT                   /function="Outer membrane lipoprotein-sorting protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61204"
FT                   /db_xref="GOA:B3GX52"
FT                   /db_xref="InterPro:IPR004564"
FT                   /db_xref="InterPro:IPR018323"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3GX52"
FT                   /protein_id="ACE61204.1"
FT                   /translation="MKKLLKQSLLGFALVSMTGAAFADAQSVAELQRRLEQVSQYSADF
FT                   DQTVRSSKGKQIQSGKGKFQVKRPNLFRMDTKSPQENLIVSDGANLWFYDPFVSQVTVN
FT                   TVQDAVNNTPFVLLTSSDKSHWDQYDVTQNADTFVLKPKSKKSNLKQFDVRIDQSGMLK
FT                   GFSTIERDGQSNLYVLRNITGGGVSSDLFKFSVPKGAELDDQRGGKKSKK"
FT   gene            621499..621807
FT                   /gene="trpR"
FT                   /locus_tag="APP7_0553"
FT   CDS_pept        621499..621807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpR"
FT                   /locus_tag="APP7_0553"
FT                   /product="Trp operon repressor"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61205"
FT                   /db_xref="GOA:B3GX53"
FT                   /db_xref="InterPro:IPR000831"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013335"
FT                   /db_xref="InterPro:IPR038116"
FT                   /db_xref="UniProtKB/TrEMBL:B3GX53"
FT                   /protein_id="ACE61205.1"
FT                   /translation="MKILYNQREPQEWQQFMRLLQQAVAEDKLEQFFTSFLTADERDSL
FT                   GLRVQIVRELLKGDVPQREIQQNLSTSAATITRGSNMLKTLEPQFIEWLNEKLNGKA"
FT   gene            621794..622597
FT                   /gene="mtgA"
FT                   /locus_tag="APP7_0554"
FT   CDS_pept        621794..622597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtgA"
FT                   /locus_tag="APP7_0554"
FT                   /product="monofunctional biosynthetic peptidoglycan
FT                   transglycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61206"
FT                   /db_xref="GOA:B3GX54"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR011812"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:B3GX54"
FT                   /protein_id="ACE61206.1"
FT                   /translation="MARRKRKRKKKSVSMFSLIKRLCRRIINFFIPQAISSRSGWLWFG
FT                   TSRLGAGLGGFFVTFLMIFSVLPVPFSAYMAQKKVEHLIAGDNYKIQYDWVSLDKIAWQ
FT                   MQMAVIASEDQKFESHFGIDLQAIEIALQRNAKSKKVRGASTISQQTVKNMFLWHGQSW
FT                   LRKGIELPLTFVMENAWGKRRILEVYLNIAEFGDGIFGVEAAAKHFFKKRAKDLTLQES
FT                   ALLAASLPNPLVFRVNKPGPTMRKRQAWIMRQVSALGGRSYLEKL"
FT   gene            complement(622666..623001)
FT                   /locus_tag="APP7_0555"
FT   CDS_pept        complement(622666..623001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0555"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61207"
FT                   /db_xref="GOA:B3GX55"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:B3GX55"
FT                   /protein_id="ACE61207.1"
FT                   /translation="MFTNWKEQTQITKQAFGKMAQAHPKMLQAMGALNAASAEEGLDAK
FT                   TRELIALAVAITTRCESCISVHAEAAIKAGATDKEIAGALATAIETNAGAAYAYALRAF
FT                   EAVETQR"
FT   gene            complement(623028..624032)
FT                   /locus_tag="APP7_0556"
FT   CDS_pept        complement(623028..624032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0556"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61208"
FT                   /db_xref="GOA:B3GX56"
FT                   /db_xref="InterPro:IPR004695"
FT                   /db_xref="InterPro:IPR038665"
FT                   /db_xref="UniProtKB/TrEMBL:B3GX56"
FT                   /protein_id="ACE61208.1"
FT                   /translation="MLNEVNPAPSVENPTSGKKLANFPVPLFASVMGLSGLTIAWYKGH
FT                   EVLNLPSEISDGLRYLTTLIWLLLFVIYLFKGIRFPQQVKADSMHPVKMNFLTAISIGL
FT                   LLLSVAWKPASIAVSQSLWMVGAILHLGFTFFVVDRWIFKSQFKLAQITPAWFIPVVGN
FT                   IIVPVVGVNYAPSDVNWFFFSIGFLFWIVLLTLVLHRMFFADPLPTKLNPTLFVLIAPP
FT                   AVGFISYTKLVGELVPFGQILYFFAMFWTLFLALKVRVFLNTPFFLSAWGYSFPLAAFS
FT                   IASLEMSGLANIETALYYRIIGSVMLIISTLIITYLTVRTLREIINGSVFQPD"
FT   gene            complement(624047..624292)
FT                   /locus_tag="APP7_0557"
FT   CDS_pept        complement(624047..624292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0557"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61209"
FT                   /db_xref="GOA:B3GX57"
FT                   /db_xref="InterPro:IPR035308"
FT                   /db_xref="UniProtKB/TrEMBL:B3GX57"
FT                   /protein_id="ACE61209.1"
FT                   /translation="MTLVILLIKEKGFHLKRLVQAEVVGLVGGFIGVLVLFWLTQSGLS
FT                   DIGAPIDAFALLGTYAVNFFGFAVLYYTVKGWLFKN"
FT   gene            complement(624399..625742)
FT                   /locus_tag="APP7_0558"
FT   CDS_pept        complement(624399..625742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0558"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61210"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR015904"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B3GX58"
FT                   /protein_id="ACE61210.1"
FT                   /translation="MSDNIQNFDLTRRLFLQSSALGLTATASSLLLPKSALAEPKVSAA
FT                   IKIFIAGGGAARFATASRLAERLDEKAEIIVIEPNKHHIYQPGFTLIAAGLKPADYSVS
FT                   DTGDYLPPQVKWIEAKVEEFNPDANQVRLSNGENLNYDYLFVTTGLKLDYDAIEGMDTK
FT                   LIGTNGLGSIYHSAVGAEKTWKLLDEFSRKGGNAVLLRPNTEMKCSGAPLKYTFIVRDY
FT                   LHRRGTLAKSHISYNSNNGSFFSVPIVSEKVRMMFEARDIHYHYHRILKAIDPAKRIAT
FT                   FESKDEGKVELPYDFINVIPPQVAPDAVRNSPLAWQTGPWKNEGWMEVSKSTLRHVRYP
FT                   NVFGVGDIAGVPKGKTAASVKWQVPVAVDHLICELQGKESQLIYNGYTSCPLITEVGRA
FT                   MLVEFDYNNNLQPSFPGIIHPLEDSWTSWLLETIGLKPTYLSMLRGKA"
FT   gene            complement(625787..625999)
FT                   /locus_tag="APP7_0559"
FT   CDS_pept        complement(625787..625999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0559"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61211"
FT                   /db_xref="GOA:B3GX59"
FT                   /db_xref="InterPro:IPR021309"
FT                   /db_xref="UniProtKB/TrEMBL:B3GX59"
FT                   /protein_id="ACE61211.1"
FT                   /translation="MKANVGGIDKVLRIVIGALLTVLAATGTIGIWGYLGVIILLTGLF
FT                   SRCGLYSLLGINTAQNCPVCPFKKK"
FT   gene            626154..626441
FT                   /locus_tag="APP7_0560"
FT   CDS_pept        626154..626441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0560"
FT                   /product="predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61212"
FT                   /db_xref="GOA:B3GX60"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B3GX60"
FT                   /protein_id="ACE61212.1"
FT                   /translation="MSEIFEKAGEASNFLKLLANPNRLAILCCLLEKDCNVSELCQAIG
FT                   MPQAATSNQLAILRAAGVIVAEVKHRERVYRVEDEKVRAILAVLHQFYCE"
FT   gene            626516..627235
FT                   /locus_tag="APP7_0561"
FT   CDS_pept        626516..627235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0561"
FT                   /product="predicted nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61213"
FT                   /db_xref="GOA:B3GX61"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR016446"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:B3GX61"
FT                   /protein_id="ACE61213.1"
FT                   /translation="MMSKPTLETILSHRSIRKFTEQPISEDLFQTLIQAGQQASTSNHL
FT                   QCVSVIRVKDQTIRQALREVSGMAYVTECAEFLVFCIDFHKHKQLVPDSQLDWAEVSVI
FT                   GAVDTGIFAQNVLLAAESVGLGGVYIGALRNDVAKVAEVLGLPQYCVPLVGMCLGYPAQ
FT                   DPALKPRLPISLVCYEDQYQPLDQTELTKYNEILTAYYQARTGEGQQWQVAIDKTLNKA
FT                   VRPHMLPFFQQQGLLKR"
FT   gene            627232..628146
FT                   /gene="rimK"
FT                   /locus_tag="APP7_0562"
FT   CDS_pept        627232..628146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rimK"
FT                   /locus_tag="APP7_0562"
FT                   /product="ribosomal protein S6 modification protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61214"
FT                   /db_xref="GOA:B3GX62"
FT                   /db_xref="InterPro:IPR004666"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013651"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR041107"
FT                   /db_xref="UniProtKB/TrEMBL:B3GX62"
FT                   /protein_id="ACE61214.1"
FT                   /translation="MKFLMLCREPRLYSCQRLQQACEQRGISLDILDPNRMLIKLAVEQ
FT                   GQSVLRLYYQTGEIYDKNRPLPQLLPDYDAVLPRFGTTSTEMGCRVLRYFEAKRVKVLN
FT                   DSTAFALARDKWLSLQVLVAAQIAVPASSLAGELCSMDGHLAQHQFPLIMKTLSGSQGV
FT                   GVMLAESKQTAQSVLGVLQQAKLTYLLQDFVAESKGQDIRAFVIGDRVVAAMQRSSNEG
FT                   EFRANIHLGGKAQLIALTEAERQLAVKAANAIGLSVAGVDLIRSDSGLLVLEVNASPGL
FT                   EGIEQASGIDIAGLMIEHLIHSL"
FT   gene            complement(628181..628939)
FT                   /locus_tag="APP7_0563"
FT   CDS_pept        complement(628181..628939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0563"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61215"
FT                   /db_xref="GOA:B3GX63"
FT                   /db_xref="InterPro:IPR003848"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:B3GX63"
FT                   /protein_id="ACE61215.1"
FT                   /translation="MFKIMLLLTKLITAIILPPFNALILWIFSLFLHKLQFKKLSYFCT
FT                   ALGMTILYICSTPYFSHQLIQAVTFSEKLTIEDYKKAQAIVVLGGGVRNSHELFGRYAI
FT                   AAAPLERMRYAAYLHKQTGLPILVTGGSPEGREPEAKIIAQELHDFFNVSVKWVESASN
FT                   TTEQNAILSKAMLKQEGIDRIILVTNQWHMKRAKMLFEREGFNVLAAGTTAHQALDIGI
FT                   LPFIPQAQALQNSSIALKEWIGYWKEKLIG"
FT   gene            629256..630524
FT                   /gene="maeB"
FT                   /locus_tag="APP7_0564"
FT   CDS_pept        629256..630524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="maeB"
FT                   /locus_tag="APP7_0564"
FT                   /product="NADP-dependent malic enzyme (NADP-ME)"
FT                   /EC_number="1.1.1.40"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61216"
FT                   /db_xref="GOA:B3GX64"
FT                   /db_xref="InterPro:IPR001891"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="UniProtKB/TrEMBL:B3GX64"
FT                   /protein_id="ACE61216.1"
FT                   /translation="MSDLKQQALDFHEFPVPGKISVTPTKSLATQHDLALAYSPGVAEP
FT                   CLAIEKEPAAARRYTARGNLVAVISNGTAVLGLGNIGALASKPVMEGKGVLFKKFAGVD
FT                   VFDIEINEHDPDKLVDIIASLEPTFGGINLEDIKAPECFYIEKKLRERMGIPVFHDDQH
FT                   GTAIIVGAAAVNGLQIVGKNIGEVRLVVNGAGASAIACTNLLRSLGFKKENITMCDSKG
FT                   VIYQGRGDNMDETKQFYAIEDNGWRTLADAVAGADVFLGCSKAGALTQDMIKTMAKDPL
FT                   ILALANPVPETTPHEAKAVRADAIVCTGRSDYPNQVNNVLCFPYLFRGALDVGATTINE
FT                   EMKMAAAHAIADLAKEPVPFEVLSTYGELSFGPDYVIPTPFDPRLIVAVSSAVAKAAMD
FT                   SGVATRPITDWDAYAKQVKALIA"
FT   gene            630710..630997
FT                   /gene="rplY"
FT                   /locus_tag="APP7_0565"
FT   CDS_pept        630710..630997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplY"
FT                   /locus_tag="APP7_0565"
FT                   /product="50S ribosomal protein L25"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61217"
FT                   /db_xref="GOA:B3GX65"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR020055"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR029751"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3GX65"
FT                   /protein_id="ACE61217.1"
FT                   /translation="MSFKFEAEVRSAQGKGASRRLRHNGQVPAIIYGGNAEPVSIILDH
FT                   DKVNNAQAHDAFYNEVLTIVVAGKEEQVKVQAIQRHPTKPKLVHLDFKRA"
FT   gene            631575..632216
FT                   /locus_tag="APP7_0566"
FT   CDS_pept        631575..632216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0566"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61218"
FT                   /db_xref="InterPro:IPR010412"
FT                   /db_xref="InterPro:IPR016537"
FT                   /db_xref="UniProtKB/TrEMBL:B3GX66"
FT                   /protein_id="ACE61218.1"
FT                   /translation="MKLIKFAFFCFISFVSTQVAAHPHSFLDLKNKILVEGTSLKGFQM
FT                   EWTMDEIASAELIYEVKSSSDREATKKSITAEMVQTAIENHYFSYLYNAKDEPLKFTTK
FT                   PSNTTFRIAGNKVIFYVTFYLSRPYDLKNNPIRLYTYEPSYYMAMEYNNKADLTISNSA
FT                   CKATLEQPKVNSELRLYASSLDKTQTPDMPEGEDNTLGAQFAQKVVAVCE"
FT   gene            632207..633202
FT                   /locus_tag="APP7_0567"
FT   CDS_pept        632207..633202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0567"
FT                   /product="predicted ABC-type transport system, permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61219"
FT                   /db_xref="GOA:B3GX67"
FT                   /db_xref="InterPro:IPR011541"
FT                   /db_xref="UniProtKB/TrEMBL:B3GX67"
FT                   /protein_id="ACE61219.1"
FT                   /translation="MRVKHIVWIAVCFLLFFAVYNNYSLFLFKVLEWQKSFNQQISAAM
FT                   TGLSENRQQAGITLLIISFLYGVFHAVGPGHGKFILTGYLSLEKTKLNQAMKISFLSAL
FT                   AQGFVAIALVSIIVVAFTLSRSYFNLTLKWVERGSFVLMILFGIYWCYQALKTFKRKSD
FT                   TIPKIQRISAINLQKNSKITPLIRPQKHFHTEYCGCGHQHLPSSTQIHQAKDWKAQAMI
FT                   ILSIGARPCSGAILVLFLAYTLDIYVWGMLSALAMAIGTGMTLTLFAWLVIIARNRAIR
FT                   LSTWYISEQASRQAMLILKILVGMILVIFGVTLFHSSFIETSGGAGLFKR"
FT   gene            633302..634750
FT                   /locus_tag="APP7_0568"
FT   CDS_pept        633302..634750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0568"
FT                   /product="putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61220"
FT                   /db_xref="GOA:B3GX68"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="UniProtKB/TrEMBL:B3GX68"
FT                   /protein_id="ACE61220.1"
FT                   /translation="MDFIVSGFENVLTWIVNTIDGPLWDITILILLGTGLFFTITTGFV
FT                   QLRLLPRSLREMWGGRSAEGKSLTPFQAFTTGLASRVGVGNIGGVATAIALGGPGAVFW
FT                   MWITALMGMSSAFAESSLAQLYKTRDPNGMFRGGPAYYITRGLKFKPMAIAFAITLIFT
FT                   FGFAFNAVQSNSIVAATSKAWEWDGQYIGLILVIVTGIIISGGVKLIGQVSAKIVPMMA
FT                   LFYLIIAVIILGMNIERVPAVFGLIIDSAFDFSAAAGGMFGALVSKTMLMGIKRGLFSN
FT                   EAGMGSAPNSAATSDAKHPASQGLIQMLGVFVDTMVVCTCTAVIILMSDNYGGDSLKGV
FT                   ELTQTALQYHLGEFGVHFLAFILLLFCYTSIIGNYAYAETNIRYIKNKPWFVWAFRAVV
FT                   LFFVYFGAVRDGGIVWAFADTVMASMAVINLIAILILAPIVWRLLKDYVRQVKAGQEPL
FT                   FKIEEHQDLIHRGVDPLIWKSKED"
FT   gene            635347..635871
FT                   /locus_tag="APP7_0569"
FT   CDS_pept        635347..635871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0569"
FT                   /product="Phosphate import ATP-binding protein pstB"
FT                   /function="ABC-type spermidine/putrescine transport
FT                   systems, ATPase components"
FT                   /EC_number="3.6.3.27"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61221"
FT                   /db_xref="GOA:B3GX69"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3GX69"
FT                   /protein_id="ACE61221.1"
FT                   /translation="MADSARFLISWLSVLDNVQLAAHLQGKKNAETLAKAEQLLAAVKM
FT                   SEHKNKPCYQLSGGQRQRVALARTLMQDADLILMDEPFSALDAVTRLQLQQLAAQLLAD
FT                   KTVLLITHDPQEAIRLADQIYILKHQPAQLSNVIEPSNNAPRFGSDAEQWQLEQQLLNM
FT                   LSNQCVEGENV"
FT   gene            635864..636613
FT                   /locus_tag="APP7_0570"
FT   CDS_pept        635864..636613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0570"
FT                   /product="putative ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61222"
FT                   /db_xref="GOA:B3GX70"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B3GX70"
FT                   /protein_id="ACE61222.1"
FT                   /translation="MFKRLFKIGGLSLLLILLWQAVVTGFALPHYMLPAPLTVFEQIVN
FT                   QFPLLWQHGQVTFIEIIAGLSLGFLLGVMSALALSLSKWLNGFLLPLLVISQAIPVFAI
FT                   APLLVLWLGYGMASKIAMTVLIIYFPVTAACYDGLRNTPKAYLELAKTLEIKPLAMLLL
FT                   VRLPAALPALASGLRIAVSVAPIGAVVGEWVGSSQGLGYLMLHANARMQTDLLFAALTV
FT                   LLLMTLCLYFITDRLLRRWLPWVQYMR"
FT   gene            636657..636890
FT                   /locus_tag="APP7_0571"
FT   CDS_pept        636657..636890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0571"
FT                   /product="predicted dinucleotide-utilizing enzyme involved
FT                   in molybdopterin and thiamine biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61223"
FT                   /db_xref="GOA:B3GX71"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:B3GX71"
FT                   /protein_id="ACE61223.1"
FT                   /translation="MSLSDQDFLRYSRQILLEECGIEEQQKLAKSRVLVVGCGGLGSPV
FT                   AQYLASAGVGKLYLADFDKVDLTNYNAKHCSA"
FT   gene            636887..637357
FT                   /gene="thiF"
FT                   /locus_tag="APP7_0572"
FT   CDS_pept        636887..637357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiF"
FT                   /locus_tag="APP7_0572"
FT                   /product="predicted dinucleotide-utilizing enzyme involved
FT                   in molybdopterin and thiamine biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61224"
FT                   /db_xref="GOA:B3GX72"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:B3GX72"
FT                   /protein_id="ACE61224.1"
FT                   /translation="MKDLNKPKSEQARLNLQAINPSVEVVAINKQLTTDNLTYWVNKVN
FT                   VVLDCSDNMATRHAVNKVCVENQIPLISGSAVGMDGQLLGVFPPYQHGCYACLFPDTEI
FT                   GNLNCRTAGVLAPIVGIIGSLQALETLKFLLGLAVSCDGKFYVFDGRTLMWQ"
FT   gene            637433..637633
FT                   /gene="thiS"
FT                   /locus_tag="APP7_0573"
FT   CDS_pept        637433..637633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiS"
FT                   /locus_tag="APP7_0573"
FT                   /product="thiamine biosynthesis protein ThiS"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61225"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR010035"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:B3GX73"
FT                   /protein_id="ACE61225.1"
FT                   /translation="MQIFINNQPLDVAENTSIQTALALSQANLQGVAVALNQQIVPKNE
FT                   WQSYPLQEGAKLTVFKAIAGG"
FT   gene            637714..637935
FT                   /gene="thiG"
FT                   /locus_tag="APP7_0574"
FT   CDS_pept        637714..637935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiG"
FT                   /locus_tag="APP7_0574"
FT                   /product="Thiazole biosynthesis protein thiG 2"
FT                   /function="Uncharacterized enzyme of thiazole biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61226"
FT                   /db_xref="GOA:B3GX74"
FT                   /db_xref="InterPro:IPR008867"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033983"
FT                   /db_xref="UniProtKB/TrEMBL:B3GX74"
FT                   /protein_id="ACE61226.1"
FT                   /translation="MTDLLKIGDTEFHSRLFTGTGKFSNPKVMQQSIVTSGSQLATMAM
FT                   KRVDLAQEQDDILTPLIQSGVKTEYFGG"
FT   gene            638030..638479
FT                   /gene="thiG"
FT                   /locus_tag="APP7_0575"
FT   CDS_pept        638030..638479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiG"
FT                   /locus_tag="APP7_0575"
FT                   /product="thiazole biosynthesis protein ThiG"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61227"
FT                   /db_xref="GOA:B3GX75"
FT                   /db_xref="InterPro:IPR008867"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033983"
FT                   /db_xref="UniProtKB/TrEMBL:B3GX75"
FT                   /protein_id="ACE61227.1"
FT                   /translation="MLPDPIETLKGAEMLVKEGFIVLPYCGADPVLCKRLEEVGCAAVM
FT                   PLGAPIGTNQGLKTQDFLRIIIEQSRVPVVVDAGIGAPSHAAQAMEMGADAVLVNTAMA
FT                   VARDPIQVAQAFKLAVEAGRLGYLAGLGKVSQTAQATSPLTGFLG"
FT   gene            638489..639634
FT                   /gene="thiH"
FT                   /locus_tag="APP7_0576"
FT   CDS_pept        638489..639634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiH"
FT                   /locus_tag="APP7_0576"
FT                   /product="thiazole biosynthesis protein ThiH"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61228"
FT                   /db_xref="GOA:B3GX76"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR012726"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034428"
FT                   /db_xref="UniProtKB/TrEMBL:B3GX76"
FT                   /protein_id="ACE61228.1"
FT                   /translation="MKTNQFAHFSDYWQMLDWGHLALSLRAKTSADVENALQSSNRDLN
FT                   DFMALISPATEAYLEPMAQLAQQLTRQRFGNTVGFYLPLYLSNVCTNDCTYCGFSMSNR
FT                   IKRKILDEQEILKEIKAIKSMGYEHLLLVTGEHETKVGMAYFREKLKLIRPHFSALLME
FT                   VQPLQSEEYAELKTLGLDGVLVYQETYNAAEYAKHHLRSQKQDFIYRLDSQDRLGQAGI
FT                   DKIGLGALIGLSNDWRTDIYFVGEHLNYLQNKYWQSRYSISFPRLRPCVGGLQPASQMS
FT                   DKQLLQIICAFRLCFPEVELSLSTRESANFRNNVIPIAINTISAGSKTQPGGYAEEDDK
FT                   HLEQFSPDDERPPQIIAAELVKRGLQPVWKDWEPYLGRTLS"
FT   gene            639661..640311
FT                   /locus_tag="APP7_0577"
FT   CDS_pept        639661..640311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0577"
FT                   /product="putative transcriptional activator"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61229"
FT                   /db_xref="GOA:B3GX77"
FT                   /db_xref="InterPro:IPR004305"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="InterPro:IPR027574"
FT                   /db_xref="UniProtKB/TrEMBL:B3GX77"
FT                   /protein_id="ACE61229.1"
FT                   /translation="MTAIQQFIQNAEPYWSAYTEHLFVQKMADGSLPKGSFQHYLKQDY
FT                   LYLYQYCRALSLGVYKAENFDQMRYALDATQAILNEVELHLQFCREWGIEEQEVRKTPE
FT                   SSACVAYTRYVLDCGMRGGLADLFMAIAPCAIGYAEIGKKLAQTAVENTPYQAWIDTYA
FT                   APEYQEAVTKLADFLNQLCENLPAEHLAKLQEIFTTATRMEVAFWQMGLDKTV"
FT   gene            640334..641074
FT                   /locus_tag="APP7_0578"
FT   CDS_pept        640334..641074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0578"
FT                   /product="putative ABC transporter substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61230"
FT                   /db_xref="GOA:B3GX78"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="InterPro:IPR027939"
FT                   /db_xref="UniProtKB/TrEMBL:B3GX78"
FT                   /protein_id="ACE61230.1"
FT                   /translation="MKYVKKLAFLTACSLAVQAHAGEKMTVLLDWFVNPDHAAIIVAQQ
FT                   KGYFKQNGLEVELVEPADPSMPPKLVAAGQADIAVDYQPQLQLQVDQGLPLVRFGTLVP
FT                   TPLNSLIVLKNGSVKNIADLKGKKIGYSVSGFEDALLNTMLANSGVSAKDVELVNVNWS
FT                   LSPSLISGQVDAIIGGFRNFELNQMQLEKQEGKAFFVEDFGVPVYEELILVAHKDKAND
FT                   AKFSAFLTSLEQATQYLKQSPDEA"
FT   gene            641105..641278
FT                   /locus_tag="APP7_0579"
FT   CDS_pept        641105..641278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0579"
FT                   /product="Putative thiamine biosynthesis protein HI0357"
FT                   /function="ABC-type nitrate/sulfonate/bicarbonate transport
FT                   systems, periplasmic components"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61231"
FT                   /db_xref="UniProtKB/TrEMBL:B3GX79"
FT                   /protein_id="ACE61231.1"
FT                   /translation="MDTALNRLAWRDTLPKLADEPRKLDREKYQKFSEFMQKNGLTKTV
FT                   PELKVYTVELKP"
FT   gene            641303..641437
FT                   /gene="thiD"
FT                   /locus_tag="APP7_0580"
FT   CDS_pept        641303..641437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiD"
FT                   /locus_tag="APP7_0580"
FT                   /product="Phosphomethylpyrimidine kinase THI20"
FT                   /EC_number="2.7.1.49"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61232"
FT                   /db_xref="GOA:B3GX80"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:B3GX80"
FT                   /protein_id="ACE61232.1"
FT                   /translation="MEKIAQALTVAGSDSGGGAGIQADFKTFQMRGVFGTSVLTAITA"
FT   gene            641444..642115
FT                   /gene="thiD"
FT                   /locus_tag="APP7_0581"
FT   CDS_pept        641444..642115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiD"
FT                   /locus_tag="APP7_0581"
FT                   /product="phosphomethylpyrimidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61233"
FT                   /db_xref="GOA:B3GX81"
FT                   /db_xref="InterPro:IPR004399"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:B3GX81"
FT                   /protein_id="ACE61233.1"
FT                   /translation="MGVFDIHSVPLSTIESQLKAIAADFQISAFKIGMLGTVEVIECVA
FT                   NALRQYNFGKLVLDPVMIAKGGAPLLQQNAINALKTHLLPLADVITPNLPEAEALTGVK
FT                   IIDDTTAYQAAKKLQDLGVSTVVIKGGHLADSQSAHCRDWVFTPTEHFTLECPRFPTRH
FT                   THGTGCTFSACITVELAKGQAVENAIKVAKEYISAAISHPLNIGQGHGPTNHWAYQELS
FT                   K"
FT   gene            642126..642782
FT                   /gene="thiE"
FT                   /locus_tag="APP7_0582"
FT   CDS_pept        642126..642782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiE"
FT                   /locus_tag="APP7_0582"
FT                   /product="thiamine monophosphate synthase"
FT                   /EC_number="2.5.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61234"
FT                   /db_xref="GOA:B3GX82"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR034291"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3GX82"
FT                   /protein_id="ACE61234.1"
FT                   /translation="MYDIRQMLQLYFIAGTQDCPNPTEDRSQNLLLILEQALQAGITCF
FT                   QFRDKSKNSLEDQPNAQKALAIQCRDLCRLYNVPFIVDDNVALAIEIDADGVHVGQKDM
FT                   SPIMIRQMTDKPLIIGLSNNTLEDLWRSEQMIEVDYCGLGPVFPTNSKEKHNPPIGLDF
FT                   VKKAREAGIRKPIVSIGGVKAEHVATLKQNGADGVAVITAISLASDVSQAVKRLL"
FT   gene            642955..644754
FT                   /gene="lepA"
FT                   /locus_tag="APP7_0583"
FT   CDS_pept        642955..644754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lepA"
FT                   /locus_tag="APP7_0583"
FT                   /product="GTP-binding protein LepA"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61235"
FT                   /db_xref="GOA:B3GX83"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006297"
FT                   /db_xref="InterPro:IPR013842"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035654"
FT                   /db_xref="InterPro:IPR038363"
FT                   /db_xref="UniProtKB/TrEMBL:B3GX83"
FT                   /protein_id="ACE61235.1"
FT                   /translation="MKMQNIRNFSIIAHIDHGKSTLSDRLIQTCGGLSDREMEAQVLDS
FT                   MDLERERGITIKAQSVTLNYKAKDGETYQLNFIDTPGHVDFSYEVSRSLAACEGALLVV
FT                   DAGQGVEAQTLANCYTAIEMDLEVVPILNKIDLPAAEPERVAEEIEDIVGIDAMDAVRC
FT                   SAKTGLGIEDVLEDIVKKIPAPEGDPDAPLQALIIDSWFDNYLGVVSLVRVKNGTIKKG
FT                   DKIKVMSTGQSYNVDRLGIFTPKQVDTAELKTGEVGWVVCAIKDILGAPVGDTLTHHHN
FT                   SATEVLPGFKKVKPQVYAGLFPISSDDYEAFRDALGKLSLNDASLFYEPENSTALGFGF
FT                   RCGFLGLLHMEIIQERLEREYDLDLITTAPTVVYEVVQTNGETIYVDSPSKLPPISNIA
FT                   EIREPIAECNMLVPQEYLGNVITLCVEKRGVQTNMVYHGNQIALTYEIPMGEVVLDFFD
FT                   RLKSTSRGYASLDYGFKRFQTADMVRVDIMINGDRVDALALIVHKDNAPYRGRELVEKM
FT                   KELIPRQQFDIAIQAAIGNHIIARSTVKQLRKNVLAKCYGGDVSRKKKLLQKQKEGKKR
FT                   MKSLGNVDVPQEAFLAILHVGKD"
FT   gene            644859..645818
FT                   /gene="lepB"
FT                   /locus_tag="APP7_0584"
FT   CDS_pept        644859..645818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lepB"
FT                   /locus_tag="APP7_0584"
FT                   /product="Signal peptidase I"
FT                   /EC_number="3.4.21.89"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61236"
FT                   /db_xref="GOA:B3GX84"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019533"
FT                   /db_xref="InterPro:IPR019756"
FT                   /db_xref="InterPro:IPR019757"
FT                   /db_xref="InterPro:IPR019758"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:B3GX84"
FT                   /protein_id="ACE61236.1"
FT                   /translation="MAQIIPIIFIAILYGVWKTLDSMQLPNTISILLVALVVICGGFWA
FT                   FYKFSADPRRNAAIAREEKRLNRPLTEEEKAEIQPRSAIGDFFASLFGVLFFVTVLRSF
FT                   IFEPFQIPSGSMEPTLRVGDFLVVNKFSYGIKDPIWQNTLIETGHPERGDVIVFKAPKQ
FT                   AHVDYIKRVVGVGGDRVKYDSHTQQLTVTHADGKQTVFEYGEGKPNADFFYHGEMQIER
FT                   TEKGDVTHQILNNPFAFNYEPYLFAQEGMPSGEWIVPEGHYFVMGDNRDNSEDSRFWGF
FT                   VPEQNVVGKATFIWLSLDKKPNEYPSGLRFDRMFTSIN"
FT   gene            645906..646586
FT                   /gene="rnc"
FT                   /locus_tag="APP7_0585"
FT   CDS_pept        645906..646586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnc"
FT                   /locus_tag="APP7_0585"
FT                   /product="ribonuclease III"
FT                   /EC_number="3.1.26.3"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61237"
FT                   /db_xref="GOA:B3GX85"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR011907"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="UniProtKB/TrEMBL:B3GX85"
FT                   /protein_id="ACE61237.1"
FT                   /translation="MNNMQLERLQKKLSYQFTNLDYLLQALTHRSAGAKNNERLEFLGD
FT                   SILNFAIGKALFEKFPKANEGELSRMRATLVREQTLAILARQFGLGEYMKLGAGELKSG
FT                   GYRRESILSDCVEAIIAAIYLDAGMDKAIEQVHLWYQDLLAEMKPGDAQKDPKTRLQEF
FT                   LQGRKLPLPTYEVLDIKGEAHNQTFKVTCKIEMLEEIFIGIGTSRRKAEQNAAEQVLVK
FT                   LTTK"
FT   gene            646666..647580
FT                   /gene="era"
FT                   /locus_tag="APP7_0586"
FT   CDS_pept        646666..647580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="era"
FT                   /locus_tag="APP7_0586"
FT                   /product="GTP-binding protein Era-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61238"
FT                   /db_xref="GOA:B3GX86"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005662"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030388"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3GX86"
FT                   /protein_id="ACE61238.1"
FT                   /translation="MTEQNQQPKTYCGFIAIVGRPNVGKSTLLNKILGQKISITSRKAQ
FT                   TTRHRIVGIHTEDQYQAIYVDTPGLHIEEKRAINRLMNRAASSAIGDVDLIIFVVEGTK
FT                   WTDDDEMVLNKLRSAKAPVVLAINKVDNIKEKDELLPHITELSQKFDFAEILPISAQRG
FT                   KNVHILQKIVRKSLREGVHHFPEEYVTDRSQRFMASEIIREKLMRFTGEELPYSVTVEI
FT                   EQFKLNERGTYEINGLILVEREGQKKMVIGAKGQKIKTIGMEARADMERLFDNKVHLEL
FT                   WVKVKAGWADDERALRSLGYMDE"
FT   gene            647592..648314
FT                   /gene="recO"
FT                   /locus_tag="APP7_0587"
FT   CDS_pept        647592..648314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recO"
FT                   /locus_tag="APP7_0587"
FT                   /product="DNA repair protein RecO"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61239"
FT                   /db_xref="GOA:B3GX87"
FT                   /db_xref="InterPro:IPR003717"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022572"
FT                   /db_xref="InterPro:IPR037278"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3GX87"
FT                   /protein_id="ACE61239.1"
FT                   /translation="MIENWHRGFVLHRREYSETSLLVDFFTEEHGRITLLAKGARRPRS
FT                   PLKAVLQPFTPLLLRWSGKGDLKTLTKAEPASLTLPMQTLALYSGFYVNEVLARVLENQ
FT                   TAYPELFQHYLQCMTRLATQPEQIEPILRTFEFQMLKALGYGVNFSICAATGDPVSPSM
FT                   TYQFKENEGFIASLLRNNASFLGKDLLAFEQLDFSDKATLQAAKRFTRMALKPYLGSQP
FT                   LKSRELFQSILPNKLKSG"
FT   gene            complement(648408..650000)
FT                   /gene="tadG"
FT                   /locus_tag="APP7_0588"
FT   CDS_pept        complement(648408..650000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tadG"
FT                   /locus_tag="APP7_0588"
FT                   /product="tight adherence protein G"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61240"
FT                   /db_xref="GOA:B3GX88"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:B3GX88"
FT                   /protein_id="ACE61240.1"
FT                   /translation="MKIISLSQARRFIQDESGVYTVMGGLLALPILALIFVSLESAGII
FT                   QDQARLSDSLEQAVLSLTAENNSGRKANDYKLGGSNPNDDSFNISSEVGKRDHAIVTTF
FT                   VKTFLPQTNDDKMNLIPVCKTVNNTSGKGHTSSSEVTCTVSGTVEHKSWFPLKVGNLEV
FT                   IPKQVDVASKSKAFKKNTFNIPIDLMVVADLSGSMNFDLDNNETKKTGKPSKISILKEV
FT                   LVELADKTLLSEDANQHNRIYVTPFALGAEINKNSCALPYSWDIESSSKIENIKKILNK
FT                   ENSQYNRADLINNLVYRISTKETLNNINGKQKYNVTFPKNTFCLKDMKTSNQGWYTRSD
FT                   KSKFTSYVQSIKASGATLASSGVLVAANNMIKDGSRTEQLKEQTKRVILVLSDGNDEII
FT                   KSDPNSKVPFLNYTRITENLIYGKQEVFLSQKQKISLSLSHSTIETYLTDTQPRNETDG
FT                   MCKVIRDRLDTLNNDKNTKIVFVEFGYASKAKQAWQHCVGNGNYYSANDKESLLNSFKQ
FT                   AIGETDDVGRSIN"
FT   gene            complement(650024..650785)
FT                   /gene="tadF"
FT                   /locus_tag="APP7_0589"
FT   CDS_pept        complement(650024..650785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tadF"
FT                   /locus_tag="APP7_0589"
FT                   /product="tight adherence protein F"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61241"
FT                   /db_xref="GOA:B3GX89"
FT                   /db_xref="InterPro:IPR031582"
FT                   /db_xref="UniProtKB/TrEMBL:B3GX89"
FT                   /protein_id="ACE61241.1"
FT                   /translation="MLIPLMIWLNNDLKTNQKVPLSHNTHFSIDTRRYSSGFLKAQLNL
FT                   YLTVISWYFKNMKKIKQLLNNNQGSVTVEFIFIFFLFSVLLIFLVDVAILQSTTGKLQR
FT                   TSYSLLNVVKERNISDGGKEEVTEADVKKLKQLAVKLMGETDDKLIDVTVTYYGSEPIK
FT                   PQDPSGSAARPEKKLKSSEYSTSSQCKAAYSTNITDAAPLTENFKGSNRYAAIYYVTVC
FT                   RKMTNLFKGLTLAKQDYESGWLRASALGVGR"
FT   gene            complement(651077..651829)
FT                   /gene="tadD"
FT                   /locus_tag="APP7_0590"
FT   CDS_pept        complement(651077..651829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tadD"
FT                   /locus_tag="APP7_0590"
FT                   /product="tight adherence protein D"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61242"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:B3GX90"
FT                   /protein_id="ACE61242.1"
FT                   /translation="MSSKLLKTIFVSTVLLSLSACSNLTANLSPAQKAEQEKLYEDTKN
FT                   YSALISLYRNQLKLNQDPLVQYKLAKSYYLSGDSKSSLLYLEPLRFKQLPFNEDIELLY
FT                   IRNQIQAGAYNEAYLAATDLIFQSPRSSEAYNLRAISLAQLGKLAAAEKDLNKSRELFI
FT                   HDTIAINNLAMLSILNNDYRNAANLLLPQYLNGSKDSRLIHNLVFALVKAGDTEYALDI
FT                   IRKEHLNSSPEDLVNALQKTEKSPKVGR"
FT   gene            complement(651819..652664)
FT                   /gene="tadC"
FT                   /locus_tag="APP7_0591"
FT   CDS_pept        complement(651819..652664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tadC"
FT                   /locus_tag="APP7_0591"
FT                   /product="tight adherence protein C"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61243"
FT                   /db_xref="GOA:B3GX91"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:B3GX91"
FT                   /protein_id="ACE61243.1"
FT                   /translation="MNLILFFLGIIVFGIFVLTMAFSHKKKIDKNKEILEGTRPKDNVE
FT                   DNSQKGKTKQQIELELLLVNKNPLLKFLGLVDKNIKVKLLVIALLTLINYIVSDDQTTF
FT                   LLGCAVVVVLAIMFPSITIGVILKSKIKRIMNDIPGFIDLVAVNVQTGISIEAAFKQVA
FT                   IDFEHLNADLTYVILRIIRKAELTSLSAALQDMAISLPTKEIRMFCTVMQQSLNFGSSL
FT                   YEHLTQLSADIREMQLLVMEEKLGTLSAKMSIPLILFIMFPIIILIVAPGAMRVLPNVF
FT                   "
FT   gene            complement(652664..653551)
FT                   /gene="tadB"
FT                   /locus_tag="APP7_0592"
FT   CDS_pept        complement(652664..653551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tadB"
FT                   /locus_tag="APP7_0592"
FT                   /product="tight adherence protein B"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61244"
FT                   /db_xref="GOA:B3GX92"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:B3GX92"
FT                   /protein_id="ACE61244.1"
FT                   /translation="MTLLYYFVFAFGVLLLLFTASAWFKTHKKINARETGFTEKLNKTT
FT                   KKVNDTVQLWIYYFTSGDKNNLVRNIIIHFLIFIGLYYLNANYIRFPNQAFMIAEVIGF
FT                   IFVIWKLGQRRNRKLFNEKFPEVIQVLNSATSSGVSLLQALERCGKDITGPIGEEFTII
FT                   YKRLARGEDVMAVFQDSYSRYPYKEFYFFISIIRTNLSRGGQMREVISRLGRAIADSNK
FT                   MEQKKKAMTSEARMSAAIVACFPVGFFLFMKVTTPENFDFVVNDPAGRIILYYVVGSEL
FT                   LGMFIIWWLMRKST"
FT   gene            complement(653551..654828)
FT                   /gene="tadA"
FT                   /locus_tag="APP7_0593"
FT   CDS_pept        complement(653551..654828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tadA"
FT                   /locus_tag="APP7_0593"
FT                   /product="tight adherence protein A"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61245"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3GX93"
FT                   /protein_id="ACE61245.1"
FT                   /translation="MLTKEQQIFFRTELLSNLDVEKLDEIQNERNKLIDELTQSLYRIS
FT                   NLHSIYLTPADAAYMAGLVADEIGGYGPIRELMEDEGVNDILVNGPDNIWVERAGILEK
FT                   TDKKFINNEQLTDIAKRLVARVGRRIDEGMPLVDSRLPDGSRLNVVIQPIALDGTSISI
FT                   RKFSKSKKSLQDLVNYGSMTLDMANFLIIAARSRVNIIVSGGTGSGKTTLLNALSHYIS
FT                   HTERVLTLEDTAELRLEQPHVVRLETRLAGVERTGEISMQDLVINALRMRPERIIVGEC
FT                   RGAEAFQMLQAMNTGHDGSMSTLHANSPRDALARLESMVMMSNASLPLEAIRRNIASAV
FT                   NIIIQASRLNDGSRKVTNITEVMGMENGQIVLQDIFSYEPSKYRDEDNKIIGQFTNHGL
FT                   LTRSVVYQNAQMFNLSDELQNIFKEK"
FT   gene            complement(654837..655964)
FT                   /gene="tadZ"
FT                   /locus_tag="APP7_0594"
FT   CDS_pept        complement(654837..655964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tadZ"
FT                   /locus_tag="APP7_0594"
FT                   /product="flp operon protein D"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61246"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3GX94"
FT                   /protein_id="ACE61246.1"
FT                   /translation="MLLLDQEGHGKEGVDSIRKIVIISETNRINNQIAQQLRSRGLENV
FT                   EIINTNFLDADSLAFSAEETLGVIIDIKNETQLPKIIERIHSVIPQNVWCCVVGESDSI
FT                   SLSQKFLEQGVLYFHAETQLTQMVARILAGVNIPLVRHTIKISVLGCKGGIGASFISAH
FT                   IAQTISTEKKVPVLLAQGNNGSQDLDLLFDKKIQNDVTEYSASLDLYRGMPSQLTGETL
FT                   HKYNFIIYDQPIFNVSKEDYANMLQHSNTFVLVIERKISSLRVAKQFLDECERMRANTG
FT                   RLIRTFICISDHKQETAKLMATADIERLLKCEIDGVMPYSKRSTNSDTVNIANLDRKGQ
FT                   KEVQTLAMKVIGTLSRQAAKRNKKMEMSFFQKLFK"
FT   gene            complement(656127..656630)
FT                   /gene="rcpB"
FT                   /locus_tag="APP7_0595"
FT   CDS_pept        complement(656127..656630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rcpB"
FT                   /locus_tag="APP7_0595"
FT                   /product="rough colony protein B"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61247"
FT                   /db_xref="InterPro:IPR031579"
FT                   /db_xref="UniProtKB/TrEMBL:B3GX95"
FT                   /protein_id="ACE61247.1"
FT                   /translation="MKKLIAILCSGLGLALTTHAIANAELLENIHPVQPTHSNLVANKS
FT                   LLVQRFVLADKSDVGFENLVTEIKRHAASDKDSQAIHIISNTQSAKDLAKKISKRLKAL
FT                   NVKPNIHITHNKTKNGLYPLYVEIRQIAKRNSLCRIETAEDHMGYDPYYDCALKHNNQI
FT                   QLKY"
FT   gene            complement(656627..658015)
FT                   /gene="rcpA"
FT                   /locus_tag="APP7_0596"
FT   CDS_pept        complement(656627..658015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rcpA"
FT                   /locus_tag="APP7_0596"
FT                   /product="rough colony protein A"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61248"
FT                   /db_xref="GOA:B3GX96"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR032789"
FT                   /db_xref="UniProtKB/TrEMBL:B3GX96"
FT                   /protein_id="ACE61248.1"
FT                   /translation="MQINKFSKTLLSSALLGLLALSHSAMAKTFTLEQGQSQLIKTNAK
FT                   IDTIFVSSSEVADYEILDDNSFMLYAKAEGRSEVIAFDANGTPLTEDFVNVNNAINNIA
FT                   ATNQQIQTRFPNSNLTVKKVGKAYVLEGKAKNAAESDEINRIVGESLGAGKKVIETKLK
FT                   HNNSEENVPFLDKYQYEGVINNANEENATQINVKLTVAEVNKTFSDEIGINWSNLSGNF
FT                   FRNLGNAAIQGNFNKNGGQLALVNSNNLNVLISALDNQNNGKILAEPNISMLSGETADI
FT                   LVGGEVPFVQRDKDGELSVLYKEFGIKLAVGAKVQKSDRIRLVLSQSVSTIAGNYEIVN
FT                   SRIPIFNTRRSKSTFEVGNGESFIISGLLNKQDIEGIKKVPVLGDIPILGAFFRNASSS
FT                   RESKELVVVATVNLVKPVDGSQVLYPTFENTGTMERFFNSSSLKNVYHKTLTTNFLKNG
FT                   GFIQ"
FT   gene            complement(658005..658823)
FT                   /gene="rcpC"
FT                   /locus_tag="APP7_0597"
FT   CDS_pept        complement(658005..658823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rcpC"
FT                   /locus_tag="APP7_0597"
FT                   /product="flp operon protein C"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61249"
FT                   /db_xref="GOA:B3GX97"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="UniProtKB/TrEMBL:B3GX97"
FT                   /protein_id="ACE61249.1"
FT                   /translation="MNYRVLLIISLVIIVLGFGGLFMLPTNEGTTTENVGTTTTLEESS
FT                   NSPVTEKVITTVTLNRDLEKGTLIQPEDYTLSELTVAETSPLVDSDLKALLDAEPNHSL
FT                   QGFLVTENLKAGSLLTPNLIITPEDPRFILLSLDPSQEVAYRIYVQDAEQYILDSVRGG
FT                   DLVSVYSVQQDLAHPEREQNSLVKIADNLKVLQVKSFTQEEVKQGESQNKKDFLGYISL
FT                   KIDATMLKEFYSLDKQAKLIALPSGLEATEKPLNHRGMFIRQLRGKNNAN"
FT   gene            complement(658852..659280)
FT                   /gene="tadV"
FT                   /locus_tag="APP7_0598"
FT   CDS_pept        complement(658852..659280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tadV"
FT                   /locus_tag="APP7_0598"
FT                   /product="flp operon protein B"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61250"
FT                   /db_xref="GOA:B3GX98"
FT                   /db_xref="InterPro:IPR000045"
FT                   /db_xref="UniProtKB/TrEMBL:B3GX98"
FT                   /protein_id="ACE61250.1"
FT                   /translation="MTLFISTLIAIMVCLLLVVCWTDLRYRLISNRVIMALLLVIIPFS
FT                   YLMYGTLSWLPAVLCLVIGFVLFLLNAIGAGDVKLLTVLMLAIPSPLAIFFLFLTACSG
FT                   LLLIIIGWLFYRKTIREKGLPYGIAISTGFLTTLLLFN"
FT   gene            complement(659325..659522)
FT                   /locus_tag="APP7_0599"
FT   CDS_pept        complement(659325..659522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0599"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61251"
FT                   /db_xref="GOA:B3GX99"
FT                   /db_xref="InterPro:IPR007047"
FT                   /db_xref="UniProtKB/TrEMBL:B3GX99"
FT                   /protein_id="ACE61251.1"
FT                   /translation="MKIKKLLQFCRQQQGITSLEYGLIAVAMAVFVVAVLYGDSSFTDE
FT                   TLKKFKQLSELVTSALLSTS"
FT   gene            complement(659578..659814)
FT                   /gene="flp1"
FT                   /locus_tag="APP7_0600"
FT   CDS_pept        complement(659578..659814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flp1"
FT                   /locus_tag="APP7_0600"
FT                   /product="flp operon protein Flp1"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61252"
FT                   /db_xref="GOA:B3GXA0"
FT                   /db_xref="InterPro:IPR007047"
FT                   /db_xref="UniProtKB/TrEMBL:B3GXA0"
FT                   /protein_id="ACE61252.1"
FT                   /translation="MLSNLTTKAYISVTEGIRRFKENQQGVTAIEYGLIAVAVAILIVA
FT                   VFYNDNGFIQQLKDKFEALTKTINDAKSGLSKQ"
FT   gene            660411..661631
FT                   /gene="rhlB"
FT                   /locus_tag="APP7_0601"
FT   CDS_pept        660411..661631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rhlB"
FT                   /locus_tag="APP7_0601"
FT                   /product="ATP-dependent RNA helicase RhlB"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61253"
FT                   /db_xref="GOA:B3GXA1"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR023554"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3GXA1"
FT                   /protein_id="ACE61253.1"
FT                   /translation="MSKHLTEQRFIDFPIHENVLAALDSKGFEFCTPIQAKTLPITLAG
FT                   QDIAGQAQTGTGKTLAFLIATFHYLLTNDSETNKNQPRAIILAPTRELAVQIGSDAELL
FT                   VKHSDLKLALAYGGDGYDKQVQAIEQGVDILVGTTGRVIDYVKQGIINLDKVQVVVLDE
FT                   ADRMFDLGFIKDIRYLMRKCPKPEQRLTMLFSATLSPRVRELAYEDMDNAQYIEIEPLQ
FT                   RTGHRIKEELFYPSNEDKMALLLTLLEEEWPDRCMIFANTKHKCEEIWNYLVADGHRVG
FT                   LLTGDIAQKKRLALLDSFTKGQLDILVATDVAARGLHIPEVTHVFNYDLPDDCEDYVHR
FT                   IGRTGRAGESGHSISFACERYAVNLPAIEAYIGHHIPVSQYDSGALLTLPKPTRSRTTR
FT                   SYQTKKR"
FT   gene            661749..662171
FT                   /locus_tag="APP7_0602"
FT   CDS_pept        661749..662171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0602"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61254"
FT                   /db_xref="UniProtKB/TrEMBL:B3GXA2"
FT                   /protein_id="ACE61254.1"
FT                   /translation="MKKLVFLTIPFGLSACGSADLQTVWQDVSNLDKLFEPEQRKGVAV
FT                   TKGYPIPNASVYSPSVKQDKKVAIKQSITHERINTTQCKDADDWYLDGYRVGRSFASQK
FT                   AVMYQQRVSYCKGMLSHADQFQQNWEKGFKVGVKKA"
FT   gene            662222..663721
FT                   /locus_tag="APP7_0603"
FT   CDS_pept        662222..663721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0603"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61255"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033186"
FT                   /db_xref="UniProtKB/TrEMBL:B3GXA3"
FT                   /protein_id="ACE61255.1"
FT                   /translation="MAQYALAQTKTGQIISLNSKMANRHCLIAGATGTGKTVTLRKFAE
FT                   AFSDNGVPVFLVDVKGDLSGLAQAGSLSGKIAERVEQFQLGGESYLSGYPVSYWDVFGE
FT                   TGIPLRTTISEMGPMLLSRLLNLNDTQEGLLNLVFRVADDRGLLLIDLKDLRALLKFVA
FT                   ENAKEFQVEYGNVSAASVGAIQRALLALENEGATNLFGEPALNLQDWMQTRDGKGVINV
FT                   LNSEKLINSPRMYGAFLLWFMAELFETLPEVGDPEKPKFVLFFDEAHLLFDDAPKVLVD
FT                   KIEQVVRLIRSKGVGVYFVTQNPLDLPDSVLGQLGNRVQHALRAFTPRDQKAVKSAAET
FT                   FRANKGVDVVEAITQLGVGEALISVLDEKGMPTPVEVAYIYPPKSQLTPLAAVERDALV
FT                   KQDDLYAYYSQYVDNESAYELLNAQVAQAQAVQQQAEAEKAEEESDFFGGMIASIFGTK
FT                   KKKDQTVAEQVVSEVTKSVAKKLTNQVSKQIMRGILGAITK"
FT   gene            663921..664952
FT                   /gene="afuA_2"
FT                   /locus_tag="APP7_0604"
FT   CDS_pept        663921..664952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="afuA_2"
FT                   /locus_tag="APP7_0604"
FT                   /product="Fe3+ ABC transporter, iron-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61256"
FT                   /db_xref="InterPro:IPR026045"
FT                   /db_xref="UniProtKB/TrEMBL:B3GXA4"
FT                   /protein_id="ACE61256.1"
FT                   /translation="MKAKLTTLALIASAASALLSANTAQAEGRLTVYCTVQNEVCENLT
FT                   QKFAKQYQVETQFIQGGTGTIFGKIKAEKDNPQADIWVGGTIEPHFQAGELGLLESYRS
FT                   PKQAEILPQFKSLMEKRGDKTSIIYMLVLGFGVNSEKLQKLGVKAPQNWEDLLNPQFKG
FT                   EIQLPDPRSSGTTYTIMATLIQKLGEEKAFEYLKKLNENVSQYVKSNLVTANLSRGESS
FT                   ASIGFVHAYATEKEKGAPVETVIPAGKVGYALGGASIIKNARNLENAKLFMDYVLSAET
FT                   QELPWREHGVYQIPTNVNAKASPSSVDPKKLDLLDFDFDKFGSSEEGKRLIDKWLTEIK
FT                   LAK"
FT   gene            665084..667084
FT                   /gene="afuB_2"
FT                   /locus_tag="APP7_0605"
FT   CDS_pept        665084..667084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="afuB_2"
FT                   /locus_tag="APP7_0605"
FT                   /product="Ferric transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61257"
FT                   /db_xref="GOA:B3GXA5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B3GXA5"
FT                   /protein_id="ACE61257.1"
FT                   /translation="MLQRFSHSYFWILLALLAFACLPSQALDYGLFGATKSELAAAMGW
FT                   SNVNISWLWFGGLLIFPAFRFIKDRILRSRIELGLVLLLTLFLLSSAVYLNYRFGYAII
FT                   FLAFALLAISSNALANLKVLQADRFMIVSLLVVILTIALFILYPITTIFSTMFSEGNAF
FT                   AILEQSYILRIIWNSLSVSATVGVLSTVFGLCFALYTTRMASKRTRLLSKFFSVLPIVT
FT                   PPFVVSLGIALMLGRSGYITEFLVEYFGFSASWLYGFTGITVSHTLALTPMAFMILEGA
FT                   LKSSNVTLEEASYTLRANNWQTFRFILLPLLKPALANSFLVITVQSLADFSTPFVLGGN
FT                   FDVLASQIYFYLVGTQLDYAAASGLGAILLGFSLLFFLIQYWWISNGSYVTVSGKGYRG
FT                   TFQPLPSGLKSLIFCILAVWVGFTVLLYGSIFYGSFTVNWGVDHSFTLENYRNLFGQGL
FT                   DQGGFPSLIQTVLFSLIAAPISAVLGLLIAYLLTRRNFVGKQSLEFVTLLCFAVPGTVA
FT                   GVSYVLAFNHSPFYLTGTAVIIVLSMVTRNMPIGMRACMAALQQLDKSLDEASFSLKGS
FT                   SLKTLLFVTLPLLKPAFLSALVTSFVRSMTTISAIVFLVSPSTRVATSYILNRVEDGAY
FT                   GLAVAYGSTLIIVMMSIIGLFGWLMKDKRQF"
FT   gene            667373..668161
FT                   /gene="cirA"
FT                   /locus_tag="APP7_0606"
FT   CDS_pept        667373..668161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cirA"
FT                   /locus_tag="APP7_0606"
FT                   /product="hypothetical ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61258"
FT                   /db_xref="GOA:B3GXA6"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR030149"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:B3GXA6"
FT                   /protein_id="ACE61258.1"
FT                   /translation="MQADEAATLEQVDVVAQFEKAKAAGDKQKEIVNLSLLGRQTAFTS
FT                   PISVVNYDEKAFEYKAPRNVVDAIAKTDASVMNFGGESNTLSGVYVRNLQLDMRQVSVN
FT                   GLAGLYSTYNSPTVAVASAQLIKGASTATTGMDPEGSAGASMNIETKRATDEDINKIGF
FT                   GWYSNNRLQETFDFGRRSGANNEWGVRVSGKYRDGDTARHDYDEMNKELAIGADYQGDK
FT                   LRVGLDYMYSKRDTDGGRARLQDLQDLAYTVPAHQTVKPT"
FT   gene            668203..669456
FT                   /gene="cirA"
FT                   /locus_tag="APP7_0607"
FT   CDS_pept        668203..669456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cirA"
FT                   /locus_tag="APP7_0607"
FT                   /product="hypothetical ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61259"
FT                   /db_xref="GOA:B3GXA7"
FT                   /db_xref="InterPro:IPR030149"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:B3GXA7"
FT                   /protein_id="ACE61259.1"
FT                   /translation="MGTFEYDLPYGMMLSGGLGHMESRYSGAFGQITSPKQNGEFEVSG
FT                   IRGIDFRSRTTSGNLKLQGDFEAGAISYNWNLAFDSEIRQRDHDQSSKTNGKIKGGTIY
FT                   APNFAQLKNFDLTANTQGVDSKLSANSLAFADTLGFVENTVRLTLGGRFQWIKQQDKKA
FT                   GTEVKADRFSPMVTLAYVPNPDLVLYGNYLEDLEPGNIDVETGEMNSSRVSKQIEVGVR
FT                   KNWDNWLTTTLSAYEIRRPGIIRGNKAALKAQAGKEHGKERNRGIEFNTYASLLNNTLR
FT                   PSLGLTYNQAKVFDFPTYADVITDGVQVTSPRWMAKANVEWDTPFVANLTLNAALQYYG
FT                   KSYQDSTANYRLPSYTTVDFGTKYVVKVADKQTLTLRGGVENAFNKHYWQVQRGQYDRS
FT                   FAVLGMPRTYWANMEYSF"
FT   gene            669465..669575
FT                   /locus_tag="APP7_0608"
FT   CDS_pept        669465..669575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0608"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61260"
FT                   /db_xref="GOA:B3GXA8"
FT                   /db_xref="UniProtKB/TrEMBL:B3GXA8"
FT                   /protein_id="ACE61260.1"
FT                   /translation="MASGRILQKICQFRPLVFLCSLLGYVFLNELVNRIK"
FT   gene            669763..671343
FT                   /gene="cirA"
FT                   /locus_tag="APP7_0609"
FT   CDS_pept        669763..671343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cirA"
FT                   /locus_tag="APP7_0609"
FT                   /product="hypothetical ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61261"
FT                   /db_xref="GOA:B3GXA9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:B3GXA9"
FT                   /protein_id="ACE61261.1"
FT                   /translation="MRISVLNTFFYNGLYKSLQDKAVETFWFFAGINALLVIVKIIHSI
FT                   INYFLTQSFEIKWLEKLNSEMLHRWLQNKNYYLLQYEKNLPDNIDQRIEQDAAAFVSGT
FT                   VEVTRGVINSIVATIEFTIILWGLSGLLTLFGVDIPKGVVFFIYLFIIFATALSIWIGR
FT                   PLIRLNFNKEKLQGDYRYSLIRVRDNAESIAFYSGESREQRNLTAKFDYIIANRWKIVR
FT                   KMLGLDGFNTGVTQVAMILPLMLQAPRFFAGQATLGDMHQTVQSFNRLMRALSFFRLFY
FT                   EEFTLYQARLNRLYGFFTTLDKLDQMPVNAPYPCSRGFVLKDFGVKDASGQILLKNINI
FT                   ELHAGDSLLIQGASGTGKTTLLKALAGIYPFETFGVAERACLEQPLFLPQRPYVPQGSL
FT                   RDAICYPNLSVTDEQLKAAMQECCLHKYVDSLDFDTDWQATLSPGELQRVAFVRILLAK
FT                   PELIFLDETTSALDEPTEAILYRTIRERLPNSLIISVGHRCTLQQFHNKQINLSERERC
FT                   ECMDCGYCS"
FT   gene            671608..672324
FT                   /gene="rpsB"
FT                   /locus_tag="APP7_0610"
FT   CDS_pept        671608..672324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsB"
FT                   /locus_tag="APP7_0610"
FT                   /product="30S ribosomal protein S2"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61262"
FT                   /db_xref="GOA:B3GXB0"
FT                   /db_xref="InterPro:IPR001865"
FT                   /db_xref="InterPro:IPR005706"
FT                   /db_xref="InterPro:IPR018130"
FT                   /db_xref="InterPro:IPR023591"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3GXB0"
FT                   /protein_id="ACE61262.1"
FT                   /translation="MAQVSMRDMLNAGVHYGHQTRYWNPKMKPFIFGARNGVHVINLEK
FT                   TLPLFNEALAELTRISSNNGKILFVGTKRAASEAVKAAAVDCQQFYVNHRWLGGMLTNW
FT                   KTVRQSIKRLKDLETQTQDGTFDKITKKEALMRTRELEKLELSLGGIKDMAGLPDAIFV
FT                   IGADHEHIAIKEANNLGIPVFAIVDTNSTPDGVNYIIPGNDDATRAIQLYLDAAAAAVK
FT                   EGRGSNVEAELEATAE"
FT   gene            672420..673271
FT                   /gene="tsf"
FT                   /locus_tag="APP7_0611"
FT   CDS_pept        672420..673271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tsf"
FT                   /locus_tag="APP7_0611"
FT                   /product="elongation factor Ts"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61263"
FT                   /db_xref="GOA:B3GXB1"
FT                   /db_xref="InterPro:IPR001816"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR014039"
FT                   /db_xref="InterPro:IPR018101"
FT                   /db_xref="InterPro:IPR036402"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3GXB1"
FT                   /protein_id="ACE61263.1"
FT                   /translation="MAEITASLVKELRERTGAGMMECKKALVEANGDIELAIDNMRKSG
FT                   QAKAAKKAGRVAAEGVILARIGAGFGVLVEMNCETDFVAKDAGFLGLANEVADFALANK
FT                   GTTIETLAAQFEEKRAALVAKIGENMNIRRVQYLDGQVIAQYLHGAKIGVLVAGEGSDE
FT                   ELKKVAMHVAASRPEFVNPEDVSAEVVAHERQIQIDIAINSGKPKEIAEKMVEGRMKKF
FT                   TGEVSLTGQAFVMDPSQSVGDYLKSVNTKVTNFIRLEVGEGIEKVEEDFAAEVAKITGG
FT                   NA"
FT   gene            complement(673399..674952)
FT                   /locus_tag="APP7_0612"
FT   CDS_pept        complement(673399..674952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0612"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61264"
FT                   /db_xref="GOA:B3GXB2"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR040423"
FT                   /db_xref="UniProtKB/TrEMBL:B3GXB2"
FT                   /protein_id="ACE61264.1"
FT                   /translation="MIQKLTKQQIIYTVIAVLLAIFSGYVMLKGSGFFPSPTLAEILFA
FT                   VILIIALGSSKLSFYGLLLPIAIGYALYTPIGLSFGAPSYQYIASLFATDLLEGREFLS
FT                   QLPLTDYLLAVGMLVAVIFFRKITKKHRINFLNNRAFIVCSLVISLFSLAPFKFFHEFF
FT                   NESMKVKQELEALNNGTEIPSEWGTSTLSADSKYDDYVLVIGESARKDYHHAYGYPVEN
FT                   TPFMSNAKGTLIDGFTAGGTNTIASLKLLLTKPNTQTWEGNYRLNLVELVKSAGIKTYW
FT                   ISNQGYLGRFDTPISSLANKSDEKIFLKTGDSFSQNISDFALLPKFNQIVSQNAQGKRF
FT                   IVVHLYGSHPITCDRLTDYPKIFDDAKIAQKYHNVNCYLSSMKKTDELLEKLYNELNQN
FT                   KAKTGRSFSMVYFSDHGLIHSEDDKGIHILNTAQGKLHFDVPLFKISSDDTERHVYKVF
FT                   KSGLNFTDGIGKWIGITNEKLNPQADLFSNQSDKDDYGLKQVIEKIPAKADPAIVIPIK
FT                   "
FT   gene            675064..675777
FT                   /gene="pyrH"
FT                   /locus_tag="APP7_0613"
FT   CDS_pept        675064..675777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrH"
FT                   /locus_tag="APP7_0613"
FT                   /product="uridylate kinase"
FT                   /EC_number="2.7.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61265"
FT                   /db_xref="GOA:B3GXB3"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR011817"
FT                   /db_xref="InterPro:IPR015963"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:B3GXB3"
FT                   /protein_id="ACE61265.1"
FT                   /translation="MSNPIYKRILLKLSGEALQGDEGFGIDPSILDRMALEIKELIEMG
FT                   VEVGVVLGGGNLFRGAKLAKAGMNRVVGDHMGMLATVMNGLAMRDALHRADVNAKLMSA
FT                   FQLNGICDTYNWSEAIKMLREKRVVIFSAGTGSPFFTTDSAACLRGIEIEADIVLKATK
FT                   VDGVYDKDPAKFADAKLYNQLTYAEVIEQELQVMDLAAFTLARDHGMPIRVFNMVKPGA
FT                   LKQVITGTTEGTIIS"
FT   gene            675961..676518
FT                   /gene="frr"
FT                   /locus_tag="APP7_0614"
FT   CDS_pept        675961..676518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frr"
FT                   /locus_tag="APP7_0614"
FT                   /product="ribosome recycling factor"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61266"
FT                   /db_xref="GOA:B3GXB4"
FT                   /db_xref="InterPro:IPR002661"
FT                   /db_xref="InterPro:IPR023584"
FT                   /db_xref="InterPro:IPR036191"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3GXB4"
FT                   /protein_id="ACE61266.1"
FT                   /translation="MINEIKKDTQDRMEKSLEALKSHISKIRTGRAQPSLLDGIQVEYY
FT                   GSATPLRQLANVVAEDARTLAVNVFDRSLISAVEKAILTSDLGLNPSSAGATIRVPLPP
FT                   LTEERRRDLIKIVKGEGEQGKIAIRNVRRDANDQIKALLKDKEISEDEERKAQDEIQKI
FT                   TDGYVKKVDEVLAAKEKELLDF"
FT   gene            complement(676596..677996)
FT                   /gene="gntR"
FT                   /locus_tag="APP7_0615"
FT   CDS_pept        complement(676596..677996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gntR"
FT                   /locus_tag="APP7_0615"
FT                   /product="HTH-type transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61267"
FT                   /db_xref="GOA:B3GXB5"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B3GXB5"
FT                   /protein_id="ACE61267.1"
FT                   /translation="MRSEVKKLSYLLNKQQTMPLYLQLYQQIKRSIYSQELQLSDKLPS
FT                   KRHLCEYLQISQNTVESAYAQLLAEGYIESKPRSGFFVCFQAELTYPSANVVKNFINST
FT                   ASTEYEIDFNSNKIDSQSFPLNRWKKCANWTNKDFLNMGDKQGDLNLRQQISQYLLASR
FT                   GVNCEPEQIVIGAGVESCLQQLILLFQQLNPAMNWAMESYGYPTVEKLLNLYQKPIFKM
FT                   PFSSENYQLDISFLEQNQINVAYLTPSHLYPFGHILTIGQRQQLLEWAVAQDGRYIIED
FT                   DYDSEFRYTGKPIPSLQSLDRQDKVIYLGSFSKLLMPSLRITFLVLPRNLLSEYQQYCE
FT                   FFNASVSRLEQQRLAKFIQSGEFEKHINRMRKIYRRKMELLCELLSPYTKQINYYGEHS
FT                   GFYLLIELLNETRTLDQLVELAKAQKIKVYPIHHQQRRLFSLGFGHLSEEQLREGLDKL
FT                   LYCWDITC"
FT   gene            678084..678971
FT                   /gene="pdxS"
FT                   /locus_tag="APP7_0616"
FT   CDS_pept        678084..678971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxS"
FT                   /locus_tag="APP7_0616"
FT                   /product="pyridoxal biosynthesis lyase PdxS"
FT                   /EC_number="4.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61268"
FT                   /db_xref="GOA:B3GXB6"
FT                   /db_xref="InterPro:IPR001852"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033755"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3GXB6"
FT                   /protein_id="ACE61268.1"
FT                   /translation="MTKILGSDPVKRGMAQMQKGGVIMDVVNAEQARIAEAAGAVAVMA
FT                   LERVPSDIRAAGGVARMANTTIVREVMEAVSIPVMAKARIGHIVEARVLEAMGVDYIDE
FT                   SEVLTPADEEFHLLKSDYTVPFVCGCRDLGEALRRIGEGASMLRTKGEPGTGNVVEAVR
FT                   HLRKVNAQLRKVINMSHDELMTEAKYLGAPFELLLQIKTLGKLPVVNFAAGGIATPADA
FT                   ALMMELGADGVFVGSGIFKSENPEKFAKAIVQATTHYQDYDLIARLSADLGEPMRGVEI
FT                   SELAVQDRMQERGW"
FT   gene            678971..679546
FT                   /gene="pdxT"
FT                   /locus_tag="APP7_0617"
FT   CDS_pept        678971..679546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxT"
FT                   /locus_tag="APP7_0617"
FT                   /product="glutamine amidotransferase subunit PdxT"
FT                   /EC_number="2.6.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61269"
FT                   /db_xref="GOA:B3GXB7"
FT                   /db_xref="InterPro:IPR002161"
FT                   /db_xref="InterPro:IPR021196"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3GXB7"
FT                   /protein_id="ACE61269.1"
FT                   /translation="MNDYTKYTIGVLSLQGAVSEHIAQIETLGAKAIAVKSLSELQQVD
FT                   ALVLPGGESTAMRRLMHSSGLFQALKSFDKPILGTCAGLILLANKLEGGEPPHLAKMNI
FT                   QVQRNAFGRQVDSFQTDLMIKGFADPFPAVFIRAPYISRIGSEVEVLAEWQGNVVFAKQ
FT                   GNLLACAFHPELTSDTRVVELFLQQLKE"
FT   gene            complement(679620..680210)
FT                   /locus_tag="APP7_0618"
FT   CDS_pept        complement(679620..680210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0618"
FT                   /product="tRNA-specific adenosine deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61270"
FT                   /db_xref="GOA:B3GXB8"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/TrEMBL:B3GXB8"
FT                   /protein_id="ACE61270.1"
FT                   /translation="MPRFWGILLLEQAVSFFLFFAIMFIKPQITQCSLTISEQDIHFMR
FT                   YALELADRAEAIGEIPVGAVLVDQEGNIIGEGWNQVIQLSDPSAHAEMLAIRQAGKVQR
FT                   NYRLLDCTLYVTLEPCTMCAGAILHSRLRRLVFGASDYKTGAIGSRFHLFEDYKMNHFL
FT                   EIRGGVLAEECSQKISRFFQRRRQEQKRQKQAV"
FT   gene            complement(680227..682086)
FT                   /gene="deaD"
FT                   /locus_tag="APP7_0619"
FT   CDS_pept        complement(680227..682086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="deaD"
FT                   /locus_tag="APP7_0619"
FT                   /product="cold-shock DEAD box protein A-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61271"
FT                   /db_xref="GOA:B3GXB9"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005580"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028618"
FT                   /db_xref="InterPro:IPR034415"
FT                   /db_xref="UniProtKB/TrEMBL:B3GXB9"
FT                   /protein_id="ACE61271.1"
FT                   /translation="MTTNSLTFADLGLPQSILDAVNDMGFVTPSPIQQETIPHLLAGRD
FT                   VLGMAQTGSGKTAAFSLPLLAQIDPTKRHPQMLVMAPTRELAIQVADACEQFTKNMKGV
FT                   NVVTVYGGQRYDIQLRALKQGSQVVVGTPGRILDHIRRGTLDLSALQSIVLDEADEMLR
FT                   MGFIDDVETVMAELPENHQTALFSATMPEPIRRITRRFMQDPQEVKIQATQRSAPDITQ
FT                   SYWLVNGFRKNDALLRFLEVEEFDAAIIFTRTKTGTIDITELCERNGYRTAALNGDMTQ
FT                   QAREQTLDKLKSGRLDILVATDVAARGIDIERISLVVNFDIPLDAESYVHRIGRTGRAG
FT                   RSGRALLFVEPRERRLLRNIEHLMKKPIDEVAIPNHEILMAKRREKFKARVSKQLEHHD
FT                   LEKYRELLEDLFTADQDHEELAAAMMMMLQEKQKLILPPDPEIRAARGERGRRDRDDRR
FT                   GGRDERRGGREHRENNGVAMDLYRIELGREDGVEVRHIVGAIANEGDISSRYIGHIKLH
FT                   DTYSTIELPQGMPNHIVQHFAQKARVLNKQMQMSLLGPAGGVNSQPFEERRGGGRRNDR
FT                   NDRNDRRSDRGGRSDRREGGFNDRKKGGFKEKRFNDKGRGRRD"
FT   gene            complement(682308..683249)
FT                   /gene="nlpI"
FT                   /locus_tag="APP7_0620"
FT   CDS_pept        complement(682308..683249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nlpI"
FT                   /locus_tag="APP7_0620"
FT                   /product="lipoprotein NlpI-like precursor"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61272"
FT                   /db_xref="GOA:B3GXC0"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR023605"
FT                   /db_xref="UniProtKB/TrEMBL:B3GXC0"
FT                   /protein_id="ACE61272.1"
FT                   /translation="MCLLIFKVFHLRFLMLNLLALLFLTGCISRHSSEMVSSNRLALAE
FT                   LNPQLRFEQEVMVVRLTQVLQEAKLNPDERAALHFERGVLYDSLGLWSLARYDFTQAIG
FT                   LNQKMVAAYNYMGLYLLLEDDYDSAIDAFNAVLELDPNYNYTYLNRGLAFYYSGRYSEA
FT                   QRDLLRFYDAEKQDPYRALWLYFNELELKPTEAKNNLIKRAETLSPEFWGTNVVHYFLG
FT                   DLTLSELRARMDAEAQPNTASYAEILTETYFYLAKQKLKLNKTDEAITLFRLSLANQVF
FT                   NFVEYRFALFELSQLRGGSNVAVQDDPVVGKN"
FT   gene            complement(683310..685367)
FT                   /gene="pnp"
FT                   /locus_tag="APP7_0621"
FT   CDS_pept        complement(683310..685367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pnp"
FT                   /locus_tag="APP7_0621"
FT                   /product="polyribonucleotide nucleotidyltransferase"
FT                   /EC_number="2.7.7.8"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61273"
FT                   /db_xref="GOA:B3GXC1"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR012162"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR015848"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="InterPro:IPR036456"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3GXC1"
FT                   /protein_id="ACE61273.1"
FT                   /translation="MASMDDTTVFVTVVAKKEVKEGQDFFPLTVDYQERTYAAGRIPGG
FT                   FFKREGRPSEGETLIARLIDRPVRPLFPEGFFNEIQVIATVVSVNPQISPDLVAMIGAS
FT                   AALSLSGVPFNGPIGAARVGFINDQFVLNPTTSEQKISRLDLVVAGTDKAVLMVESEAD
FT                   ILSEEQMLSAVVFGHQQQQVVIENIKEFVKEAGKPRWDWVAPEPNTALINQVKALAEAR
FT                   IGDAYRITEKQARYEQIDAIKADVIAQLTAQDETVSEGAIIDIITALESSIVRGRIIAG
FT                   EPRIDGRTVDTVRALDICTGVLPRTHGSAIFTRGETQALAVATLGTERDAQIIDELTGE
FT                   KSDRFLFHYNFPPYSVGETGRIGSPKRREIGHGRLAKRGVLAVMPTAEEFPYVVRVVSE
FT                   ITESNGSSSMASVCGASLALMDAGVPIKAAVAGIAMGLVKEEEKFVVLSDILGDEDHLG
FT                   DMDFKVAGTREGVTALQMDIKIEGITPEIMQIALNQAKGARMHILSVMEQAIPAPRADI
FT                   SDFAPRIHTMKIDPKKIKDVIGKGGAVIRALTEETGTSIDIDDDGTVKIAATDNNAAKA
FT                   VMARIEDIVAEVEVNAIYKGKVTRVVDFGAFVSILGGKEGLVHISQITNERVERVADYL
FT                   SVGQEVTVKVVEIDRQNRIRLTMKDLNNDTPVAENVTEEAEVSSEQQAEI"
FT   gene            685758..688004
FT                   /gene="parC"
FT                   /locus_tag="APP7_0622"
FT   CDS_pept        685758..688004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="parC"
FT                   /locus_tag="APP7_0622"
FT                   /product="DNA topoisomerase 4 subunit A"
FT                   /EC_number="5.99.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61274"
FT                   /db_xref="GOA:B3GXC2"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005742"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:B3GXC2"
FT                   /protein_id="ACE61274.1"
FT                   /translation="MSIEINYEGVEQMPIKRFTEDAYLNYSMYVIMDRALPFIGDGLKP
FT                   VQRRIIYAMSELGLNASAKYKKSARTVGDVLGKFHPHGDSACYEAMVLMAQPFSYRYPL
FT                   IDGQGNWGAPDDPKSFAAMRYTESKLSKMAEVLLGELGQGTVDYQPNFDGSLEEPKYLP
FT                   ARLPHILLNGTMGIAVGMATDIPPHNINELAEASVMLLENPKASLAELMTVVQGPDYPT
FT                   EAEIITPKADIAKMYEQGKGSIKMRAVWKKEDGEIVISALPHQASPSKVIEQIATQMRN
FT                   KKLPMVDDIRDESDHENPIRIVIVPRSNRIDFEALMDHLFATTDLEKSYRVNMNMIGLD
FT                   GKPAVKTLHTILTEWLVFRRTTVTRRLNHRLDKILNRLHILEGLMIAFLNIDEAIEIIR
FT                   NEDEPKTALMARFNLSEAQAEAILNLRLRHLAKLEEHELQAEKSQLEKERDELQLTLGS
FT                   ERRLNTLIKKEIQADAKVFASPRRSPLVERAEAKAISESDLTPTEDVTVILSEKGWVRC
FT                   AKGHDIDVQGLSYRAGDGYLAHAYGRSNQPVVFLDSTGRAYALDPTSLPSARSQGEPLT
FT                   GKITLPDGATVQQVLMANSDTKVLMASDSGYGFICSFEDLVSRNKAGKAVISLTENAKV
FT                   LPPQLIDNEAELSLVAMSSVGRMLVFPITELPQLSKGKGNKIINISAQAAKEGNELLAR
FT                   LLLVKPTQSLVFVSGKRKITLKPSDIDNYRGERARKGSQLVRGLSATSTVEIIE"
FT   gene            688550..689881
FT                   /gene="mukF"
FT                   /locus_tag="APP7_0623"
FT   CDS_pept        688550..689881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mukF"
FT                   /locus_tag="APP7_0623"
FT                   /product="chromosome partition protein MukF"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61275"
FT                   /db_xref="GOA:B3GXC3"
FT                   /db_xref="InterPro:IPR005582"
FT                   /db_xref="InterPro:IPR033439"
FT                   /db_xref="InterPro:IPR033440"
FT                   /db_xref="InterPro:IPR033441"
FT                   /db_xref="InterPro:IPR036141"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR038198"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3GXC3"
FT                   /protein_id="ACE61275.1"
FT                   /translation="MQNELAQTIPELINWTKEREFSLSLSSDRLAFLLAISIYNNEQTD
FT                   GELLESDLIDLFRYVSEVFDQSEATLTQRANNAINDLVKQRFLNRFSSEFTEGLAIYRI
FT                   TPLGVGVADYYVRQREFSTLRLSIQLSIVADEIQRASSAAEEGGDERFWRNNVFAPLKY
FT                   SVAEIFDSIDLSQRMMDENQHQIRERIAELLSQNWHEAILSCEQLLDETSGNLRELQDT
FT                   LNAAGDKLQAQLLRIQSCLIGRDDLDFVDQLIVNLQNKLDRIISWGQQAIDLWIGYDRH
FT                   VHKFIRTAIDMDKNRVFGQRLRQSIQDYFNAPWLLYTAKAESLLDLRDDETMLNETEAV
FT                   GELPSELEYESLSDVQEQIISVMQAHLAPFRAEGKPIDLGAVLREQLALYPQSRHFDVA
FT                   RIIVDQAVKLGMASLDSQAVYPEWQAINDNGAEVQANVIDQYNK"
FT   gene            689961..690674
FT                   /gene="mukE"
FT                   /locus_tag="APP7_0624"
FT   CDS_pept        689961..690674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mukE"
FT                   /locus_tag="APP7_0624"
FT                   /product="chromosome partition protein MukE"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61276"
FT                   /db_xref="GOA:B3GXC4"
FT                   /db_xref="InterPro:IPR007385"
FT                   /db_xref="InterPro:IPR042037"
FT                   /db_xref="InterPro:IPR042038"
FT                   /db_xref="UniProtKB/TrEMBL:B3GXC4"
FT                   /protein_id="ACE61276.1"
FT                   /translation="MTEQIQDVISPKLAVAIANPIFPELDSQLRAGRHINTEQLDEHAF
FT                   LMDFQAELESFYRRYHVELIRAPEGFFYLRPKASTLIARSAMSEMEMLVGKVLCYLYLS
FT                   PERLAQQGIFSQDDVYEELMNLADESKLLKAVNPRSTGSDLDKAKLAEKVGGALRRLAR
FT                   IGIITRIGEQNSKKFVISESVFRFGADVRVGDDPREAQLRLIRGGEATTPAILAEQAVE
FT                   FAENSATDELEDETE"
FT   gene            690695..695185
FT                   /gene="mukB"
FT                   /locus_tag="APP7_0625"
FT   CDS_pept        690695..695185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mukB"
FT                   /locus_tag="APP7_0625"
FT                   /product="chromosome partition protein MukB"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61277"
FT                   /db_xref="GOA:B3H108"
FT                   /db_xref="InterPro:IPR007406"
FT                   /db_xref="InterPro:IPR012090"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032520"
FT                   /db_xref="InterPro:IPR042501"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3H108"
FT                   /protein_id="ACE61277.1"
FT                   /translation="MTDTNELFEDQTTALQNSAPIAPLANPQHTVSRGKFRSLTLINWN
FT                   GFFARTFDLDELVTTLSGGNGAGKSTTMAGFVTALIPDLTLLNFRNTTEAGSTSSSRDK
FT                   GLYGKLKAGVCYAVLESLNSRGQRVITGVRLQQVAGRDKKVDIRSFSLQNVPMSDSIIS
FT                   ILTEQVGEKARVLPLADLKDKFDGSEVLFKQYHSITDYHSFMFDLGVIPKRLRSSADRS
FT                   KFYKLIEASLYGGISSVITKSLRDYLLPENTGVRQAFQDMESALRENRMTLEAIKVTQS
FT                   DRDMFKHLITESTNYVSADYMRNANERRGNVQIALEQRRAWYESKSKLELEQQRLIEFS
FT                   REVADISENESGLEAEYNSANDHLNLVMNALRHQEKIERYQDEVAELNEKLEEQQIALE
FT                   EVSEQVETAQARADDADDQVEELRSQMADYQQALDAQQTRALQYQQAIAALEKAKQLCG
FT                   LPHLDLHNVEDYHAEFAAQADDLTDQVFELEQRLSVSDMAKTQFEKAYELVCKISGEID
FT                   RSGAWNEARSLLTAFTDQKMQATQAVALRQKLADLEQRLHQQQNAERLLAEFNQKAQTQ
FT                   FETAEELEGYFEQQQARLEDVEAELAEFVEVRSTQRQQREQLNQQYNQLAKTAPAWHTA
FT                   QSALARLEEQCGEKFEASQSVMQFMQNMLIKEREATLARDELARREAALDAQITRLSQP
FT                   DGSDDVRLNQLAERFGGVLLSELYDDVSIDDAPYFSALYGEARHAIVVRDLESVKSQLE
FT                   KLDDCPTDLYLIEGDPSAFDDAVFTAEELAEGVVVKVSDRQWRYSKFPEVPLFGRAARE
FT                   KHLETLKAERDEVSEQHAERAFDVQKCQRLHQHLSQFVGTHLSLAFQPNPEEQMQEIAA
FT                   ERTEIERELNQAAGNEQQLRTQLDSAKAKLQMLNKILPLVSLLEDETLADRAEECRAQL
FT                   DEAEEDEQFVRQFGNYLTQLEPIAASLKSDPAKFEQLEQDYQQAKAEQKQVQQKVFALS
FT                   DVIQRRVHFSYEEAIGSEGSALTEQLRARLESAQREREQARDQLRQAQAQFTQYNQVLT
FT                   GLRSSCDAKTQMLQELIREIDDLGVRGDIGAEERARSRRDELQQRLSQQRSRKGYLDKQ
FT                   LGTIEAEIDNLTRTLRKAERDYHTQRELVVQAKVSWCLVLKLSRNSDVEKRLNRRELAY
FT                   QSAEELRSISDKALGALRTAVADNEYLRDSLRASEDSRKPENKVAFFIAVYQHLRERIR
FT                   QDIIKTDDPIDAIEQMEIELSRLTNELTSREKKLAISAESVANILRKTIQREQNRILQL
FT                   NQGLQNIAFGQVKGVRLVVNIRDTHAILLNALSNGREEHKDLFDSQKLSFSEALAMLYK
FT                   RVNPHIEMGQRTPQTIGEELLDYRNYLDLEVETFRGADGWMRAESSALSTGEAIGTGMS
FT                   ILLMVVQSWEEESRRMRAKDILPSRLLFLDEAARLDATSINTLFELCERLDMQLLIAAP
FT                   ENISPERGTTYKLVRKITNNQEYVHVVGLKGFGQQ"
FT   gene            695262..696437
FT                   /gene="sotB"
FT                   /locus_tag="APP7_0626"
FT   CDS_pept        695262..696437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sotB"
FT                   /locus_tag="APP7_0626"
FT                   /product="putative sugar efflux transporter"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61278"
FT                   /db_xref="GOA:B3H109"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B3H109"
FT                   /protein_id="ACE61278.1"
FT                   /translation="MITRKEHRKLSFLRVFVFSLSAFIFNTTEFIPVALLSDIAVSFEM
FT                   ETATTGLMITAYAWVVFLAALPFMLLTAKVERKRLLLVLFAIFIVGHIVSYFATSFTML
FT                   LISRMGIALTHAIFWSITASLVIRVAPKDKKQQALGLLALGNSLAMIFGLPLGRMIGQA
FT                   FGWRETFALIGIIALGIMLIMWKLLPHLPSKNSGSLASLPILIKRPMLVGIYLLTAVVI
FT                   SGHFTGYSYIEPFMVKISQMSEQTGTAILLVFGLAGVAASFLFGRLYPKAPKKFIISNM
FT                   ALIMLMQMCLLPFSNHIAAMFGIVFIWGIGITAMSIALQMQVLDLAPDATDVATAIYSG
FT                   IYNVGIGGGALIGSQVIQHIGLPYIGWIGGGLAGFAILWFVFISLRYRVIK"
FT   gene            complement(696489..698228)
FT                   /locus_tag="APP7_0627"
FT   CDS_pept        complement(696489..698228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0627"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61279"
FT                   /db_xref="GOA:B3H110"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR012159"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024588"
FT                   /db_xref="UniProtKB/TrEMBL:B3H110"
FT                   /protein_id="ACE61279.1"
FT                   /translation="MLNRLRRLLPSNSLQYREETSQRITWGHWFALFNVVLALLIASRY
FT                   AFNADWPNTLSGKLYFFTSLFGHFSFIVFAVYLLLLFPLSFLIKNERTFRGLSVILATI
FT                   GQTVLLLDTEVFKQFYLHLSPLVWDLLVNPDQGELTRQWQLLFVPMPLILLVEMLYSRW
FT                   CWQKLRSFNRQTWGKYVAYFFVSCFTATHLVYAWADMTLYRPITAQKANYPLSHPMTAR
FT                   TFLQKHGLIDQAELQQEIEESGRLDSFYLNYPKHTLIFTQKPTTNLLFINLSGLNNDAI
FT                   TAEYMPTLTEISRKSHRFMQHYSSGDSAAAGVLGLFYSLSGKYLDAVLGNKETSPLLLA
FT                   FRQSGYQLGLFSHNGFADPIYHQAVFAGILLSESQNNLDAIAQWKQWVTQRSLNEPFFS
FT                   YLDLAMPSANDYVQQTKLLDWQLNEIWTQLETHALLANTLVILTADQAIPSDKQSENSF
FT                   AKQHIQVPMMMYWQGEGKQYDFLSSHVDILPTLLNQFFKIKNPLSDYAQGIDLTTQNKR
FT                   LWLLASNHKWDVAIMPDGEQYHIDKRGHFENFNAQGEKVKSERPPLALFLHMIQQSNQF
FT                   VEK"
FT   gene            complement(698231..698491)
FT                   /locus_tag="APP7_0628"
FT   CDS_pept        complement(698231..698491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0628"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61280"
FT                   /db_xref="InterPro:IPR009857"
FT                   /db_xref="InterPro:IPR023202"
FT                   /db_xref="UniProtKB/TrEMBL:B3H111"
FT                   /protein_id="ACE61280.1"
FT                   /translation="MLILLIFFYEIFTMATQSKYQSKQFDALSGDLIAILEKHKAPVDL
FT                   SLMALGNMVTNILLENVQTGAQRLALAEAFSNALKNSLKIK"
FT   gene            698662..699240
FT                   /locus_tag="APP7_0629"
FT   CDS_pept        698662..699240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0629"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61281"
FT                   /db_xref="GOA:B3H112"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="UniProtKB/TrEMBL:B3H112"
FT                   /protein_id="ACE61281.1"
FT                   /translation="MSKKERLNDMARQILSAAELLIAKEGLQNLSMRKIASEAGIATGT
FT                   LYLYFKTKDELLDCLAEQLHERYYRYLNIQFNPNSSFFDQYREIWNRKRHFLTDNPIIA
FT                   ANLSQYQAMLGFNSILCRIMNDSEFIWNRFVEEGKKQGVIIPLPNDLLYCMSIGVATDI
FT                   AYLEQVKQEPVSTEFFEETILRTWKAIAC"
FT   gene            699273..700478
FT                   /locus_tag="APP7_0630"
FT   CDS_pept        699273..700478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0630"
FT                   /product="putative RND efflux membrane fusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61282"
FT                   /db_xref="GOA:B3H113"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:B3H113"
FT                   /protein_id="ACE61282.1"
FT                   /translation="MTTENQKPGKGRKFLIAITLVVVLVAFVGVAGMQKFIAGKKAEAA
FT                   ANMPETVSEITAMTISTQEWTPSISAVGYIRPNQGAMLSAEASGTVTKVHVRSGQRVNK
FT                   GDLLVEFDSAVEEATLRASQAQLPNVKANYERYRNLIASNSASKAEFDNAQSAYNQLLA
FT                   NIESLKASIARRKVYAPFNGLAGIVNVNVGQYITTGTQIVRVEDQSSMKVRFTLPQTDV
FT                   EKIVVGQKVTAVVDALPGQTFPASIVAIDPAVDHTTGLINVEAVITENQNKLLSGMFAR
FT                   LNVALPTEKDQIVVPQIAVTYTMYGETLYVLQPLSEADKQLATKMAEQNPKLKVEKMYR
FT                   VKQVEVKTLDRSGIYAQLAKGVKTGDLIVTGGFQRLSNNALVIVSNQEAVGVTQPAKES
FT                   RL"
FT   gene            700491..701219
FT                   /gene="acrB"
FT                   /locus_tag="APP7_0631"
FT   CDS_pept        700491..701219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acrB"
FT                   /locus_tag="APP7_0631"
FT                   /product="acriflavine resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61283"
FT                   /db_xref="GOA:B3H114"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="UniProtKB/TrEMBL:B3H114"
FT                   /protein_id="ACE61283.1"
FT                   /translation="MKFTDIFIKRPVLAVCISLLITILGLQSINKLQVREYPEMTISIV
FT                   TVKVNYSGADASLMQALVTSQIEEAVAQADNIDYVTSSSGPSSSTTTIKMKLNTNPQMA
FT                   LADISAKVNAIRANLPSGIDDPSISVSSGSNDALMYIRFVSDELSTPQITDYINRVVKP
FT                   QFFTVNGVSSVDIFGAANFGLRIWLDPDKMAGNNLSGAAVLSALSANNLNTAAGNANGI
FT                   TRFIRTKWNPVRRLSKNWKT"
FT   gene            701177..703609
FT                   /gene="acrB"
FT                   /locus_tag="APP7_0632"
FT   CDS_pept        701177..703609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acrB"
FT                   /locus_tag="APP7_0632"
FT                   /product="acriflavine resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61284"
FT                   /db_xref="GOA:B3H115"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:B3H115"
FT                   /protein_id="ACE61284.1"
FT                   /translation="MESSTPSVEELENVTISTTSDGRIVKLKDIAKVELDKYQDASRAI
FT                   ADGKEAVVLAVSAATTANSLTVAKDIYPVFDLITKNLPSSVNGQIMYDKTVAINSSINE
FT                   VIKTIGEATVIVLAVIILFLGSLRAMIVPIITIPISLIGVLFFLQMFGFSINLLTLLAL
FT                   VLAIGLVVDDAIVVLENVERHVKEGKTPFDAAIIGTREIALPVISMTITLAAVYSPMAL
FT                   MEGVTGSLFKEFALTLAGAVFISGIAALTLSPMMSSRVLKEHNEENESRFSKCINTMLD
FT                   KMTACYTNMLRGVMSVRWLVVIFAMSIFAVLPTLLTSLSSEVAPTEDRGFVVGIGNGPS
FT                   NTNLDYTQAATEKFNEEVGKIPEVASMMTVSGFNGANSALSIISLKDWSERERERKPIS
FT                   ADVSAIAKNVVGMDINAISFPEISTGENGLPFSLVITTADNYVKLADVANDFLKKAQAS
FT                   GQFFFSSLDLKFDTVTMKWKFDREKMGTYGVTMQQVSGTLGAYLSGAIITRVDIDSRAY
FT                   PIVSQAVRQDRLNPQDLVNYYVTTASGESVPLSSFVSLELSTEPAALPRMNQLNSATIS
FT                   GVVSSSIGDAVNWAKAELDRSLPQGYQYDFKSEARQYVQEGNAMAMTFALAVVIIYLVL
FT                   AIQFESWRDPMVILVSVPLALSGALVVLNVLGIAGIAGATLNIYSQVGLVTLVGLITKH
FT                   GILMCEVAKEEQLHNGLSRFDAIVHSATIRLRPIMMTTAAMVAGLIPLLFAMGAGAIAR
FT                   FSMGMVIVAGLSIGTLFTLFVLPVIYTFLGQEHKPLREFDEEKYAKASVEKIEHTGM"
FT   gene            703827..705191
FT                   /gene="glmU"
FT                   /locus_tag="APP7_0633"
FT   CDS_pept        703827..705191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmU"
FT                   /locus_tag="APP7_0633"
FT                   /product="bifunctional protein GlmU"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61285"
FT                   /db_xref="GOA:B3H116"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3H116"
FT                   /protein_id="ACE61285.1"
FT                   /translation="MTQLSVVILAAGKGTRMYSDLPKVLHTVAGKPMVQHVIDTAKQID
FT                   AKQIHLIYGHGGELLQQRLSSEPVNWVLQAEQLGTGHAMQQAAPFFADDENILMLYGDA
FT                   PLITKETLERLIAAKPENGIALLTVELENPTGYGRIIRENGSVVAIVEQKDANAEQLKI
FT                   REVNTGVMVASGASFKKWLANLNNNNAQGEYYITDVIAMANQDGYKVQAVQASEFMEVE
FT                   GANNRLQLAALERFYQKTQAEKLLLAGVRLIDQARFDIRGSLTHGKDVEIDVNVIIEGE
FT                   VKLGNRVRIGAGCVLKNCEIGDDVEIKPYSVIEDAVVGKAAQIGPFSRLRPGANLAEET
FT                   HVGNFVEIKNAQVGKGSKVNHLTYVGDAEVGSNCNIGAGVITCNYDGANKFKTIIGNNV
FT                   FVGSDSQLVAPVTIADGATIGAGATVTKDVAENELVISRVPQRHIQGWQRPTKKK"
FT   gene            complement(705298..705615)
FT                   /locus_tag="APP7_0634"
FT   CDS_pept        complement(705298..705615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0634"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0634"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61286"
FT                   /db_xref="GOA:B3H117"
FT                   /db_xref="InterPro:IPR008913"
FT                   /db_xref="InterPro:IPR016694"
FT                   /db_xref="InterPro:IPR037274"
FT                   /db_xref="UniProtKB/TrEMBL:B3H117"
FT                   /protein_id="ACE61286.1"
FT                   /translation="MFKVYGLTVDDQTRCQHYHSVLDIIAIKFKCCNKFYPCYQCHQAC
FT                   ETHDIERWQATEFDKHAILCGNCRQTLTIRQYMQVTHCPYCQAQFNSGCQKHYSIYFEV
FT                   E"
FT   gene            complement(705619..706239)
FT                   /locus_tag="APP7_0635"
FT   CDS_pept        complement(705619..706239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0635"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0635"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61287"
FT                   /db_xref="InterPro:IPR015037"
FT                   /db_xref="InterPro:IPR037226"
FT                   /db_xref="UniProtKB/TrEMBL:B3H118"
FT                   /protein_id="ACE61287.1"
FT                   /translation="MLKLAKKALNKFLRKTINRRNRQQLQNHTMSVLSINCNGAFILHD
FT                   LNEQFRSPFVNLYLSPTDFLKYLKNMPHYMQAELTFIASEKNYPVGKLDDLTIHFMHYN
FT                   SEQEAASKWAERSKRINLDNLFVMMTDRDGCTYQDLQEFDRLPFANKVVFTHKPYPELK
FT                   SAFYIEGFENQTQVGDLFEFSGWDGKKYYDQLDYVNWFNGKGF"
FT   gene            706533..708191
FT                   /gene="pgm"
FT                   /locus_tag="APP7_0636"
FT   CDS_pept        706533..708191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgm"
FT                   /locus_tag="APP7_0636"
FT                   /product="phosphoglucomutase/phosphomannomutase"
FT                   /EC_number="5.4.2.8"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0636"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61288"
FT                   /db_xref="GOA:B3H119"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:B3H119"
FT                   /protein_id="ACE61288.1"
FT                   /translation="MSTIFTIAQNWLAQDPDQETRAELVRLIEAAQAGDEKALAELTAR
FT                   FDGRLQFGTAGLRGRLQAGSMGMNRVLVAQAAGGLADYLKGYDKAPSIVIGYDGRKNSD
FT                   VFARDTAEIMAGAGIKAYLLPRKLPTPVLAYAIKYFDTTAGVMVTASHNPPEDNGYKVY
FT                   LGKANGGGQIVSPADKDIAALIDKVAAGNIADLPRSQDFTVLDDEIVEAYIAKTAALAK
FT                   EQAAEINYVYTAMHGVGYEVLSKTLEKAGLPQPHLVAEQIQPDGSFPTVNFPNPEEKGA
FT                   LDLAIKLAKEKNAEFIIANDPDADRLAVAMPDAQGNWKGLHGNVVGCLLGWYLAKQYHA
FT                   QGKQGVLACSLVSSPALAEIAKKYGLQSEETLTGFKYIGKVNGLLFGFEEALGYLVDPD
FT                   KVRDKDGISAAIVFLDFIRNLKAQGKTLQDAITDFNNEFGAYVSGQIAIRVSDLSEIGK
FT                   LMTALRNNPPSAIGGFNVAQLIDHTKTDRQSDILVFVLENGSRLITRPSGTEPKIKFYL
FT                   DAKGKDAADADKVLSQFDESVRELLRQEQYGKQDC"
FT   gene            complement(708273..709844)
FT                   /gene="guaA"
FT                   /locus_tag="APP7_0637"
FT   CDS_pept        complement(708273..709844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaA"
FT                   /locus_tag="APP7_0637"
FT                   /product="GMP synthase (glutamine-hydrolyzing)"
FT                   /EC_number="6.3.5.2"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0637"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61289"
FT                   /db_xref="GOA:B3H120"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022955"
FT                   /db_xref="InterPro:IPR025777"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3H120"
FT                   /protein_id="ACE61289.1"
FT                   /translation="MTNIHNHKILILDFGSQYTQLIARRVREIGVYCELWAWDVTEEQI
FT                   REFNPTGIILSGGPESTTEENSPRAQEYVFNAGVPVLGICYGMQTMAMQLGGLTETSDH
FT                   REFGYASVDLQATDALFAKLNDNLTASEPKLDVWMSHGDKVTRLAQGFQVTGITPTCPI
FT                   AAMSDESRRFYGVQFHPEVTHTKSGLELLTNFVVGICGCECKWTAENIIEDAVARIKEQ
FT                   VGDDEVILGLSGGVDSSVTALLLHRAIGKNLHCVFVDNGLLRLNEGDQVMEMFGDKFGL
FT                   NIIRVNAEDRFLDALKGIDEPEAKRKTIGKVFVDVFDDESKKLTSVKWLAQGTIYPDVI
FT                   ESAASKTGKAHVIKSHHNVGGLPDYMKLGLVEPLRELFKDEVRKIGLALGLPAEMLNRH
FT                   PFPGPGLGVRVLGEIKKEYCDLLRKADAIFIEELYKADWYYKVSQAFTVFLPVKSVGVM
FT                   GDGRKYDWVVSLRAVETIDFMTAHWAHLPYDLLGKISNRIINEVNGISRVVYDVSGKPP
FT                   ATIEWE"
FT   gene            complement(709859..710173)
FT                   /locus_tag="APP7_0638"
FT   CDS_pept        complement(709859..710173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APP7_0638"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APP7_0638"
FT                   /db_xref="EnsemblGenomes-Tr:ACE61290"
FT                   /db_xref="UniProtKB/TrEMBL:B3H121"
FT                   /protein_id="ACE61290.1"
FT                   /translation="MKKLSTLVTLLLSGCAIFGPSYSGNTTADYFLKFDTEMMINTFFR
FT                   ADHNCIPDSIYTEIIEIPKQGNAHEIWTATGCNHTEKFDIYYIADPKGGTYLSIKPIKQ
FT                   "
FT   gene            complement(710263..711726)
FT                   /gene="guaB"
FT                   /locus_tag="APP7_0639"
FT