(data stored in ACNUC7421 zone)

EMBL: CP001096

ID   CP001096; SV 1; circular; genomic DNA; STD; PRO; 5744041 BP.
XX
AC   CP001096; ABJR01000000-ABJR01000016;
XX
PR   Project:PRJNA20167;
XX
DT   27-JUN-2008 (Rel. 96, Created)
DT   11-SEP-2019 (Rel. 142, Last updated, Version 3)
XX
DE   Rhodopseudomonas palustris TIE-1 chromosome, complete genome.
XX
KW   .
XX
OS   Rhodopseudomonas palustris TIE-1
OC   Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales;
OC   Bradyrhizobiaceae; Rhodopseudomonas.
XX
RN   [1]
RP   1-5744041
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Pitluck S., Chain P., Malfatti S., Shin M., Vergez L., Lang D., Schmutz J.,
RA   Larimer F., Land M., Hauser L., Kyrpides N., Mikhailova N., Emerson D.,
RA   Newman D.K., Roden E., Richardson P.;
RT   "Complete sequence of Rhodopseudomonas palustris TIE-1";
RL   Unpublished.
XX
RN   [2]
RP   1-5744041
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Pitluck S., Chain P., Malfatti S., Shin M., Vergez L., Lang D., Schmutz J.,
RA   Larimer F., Land M., Hauser L., Kyrpides N., Mikhailova N., Emerson D.,
RA   Newman D.K., Roden E., Richardson P.;
RT   ;
RL   Submitted (28-MAY-2008) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 7e0cf1f233e7dd21bfa1186d1402c61a.
DR   BioSample; SAMN00000049.
DR   EnsemblGenomes-Gn; EBG00001456266.
DR   EnsemblGenomes-Gn; EBG00001456267.
DR   EnsemblGenomes-Gn; EBG00001456268.
DR   EnsemblGenomes-Gn; EBG00001456269.
DR   EnsemblGenomes-Gn; EBG00001456270.
DR   EnsemblGenomes-Gn; EBG00001456271.
DR   EnsemblGenomes-Gn; EBG00001456272.
DR   EnsemblGenomes-Gn; EBG00001456273.
DR   EnsemblGenomes-Gn; EBG00001456274.
DR   EnsemblGenomes-Gn; EBG00001456275.
DR   EnsemblGenomes-Gn; EBG00001456276.
DR   EnsemblGenomes-Gn; EBG00001456277.
DR   EnsemblGenomes-Gn; EBG00001456278.
DR   EnsemblGenomes-Gn; EBG00001456279.
DR   EnsemblGenomes-Gn; EBG00001456280.
DR   EnsemblGenomes-Gn; EBG00001456281.
DR   EnsemblGenomes-Gn; EBG00001456282.
DR   EnsemblGenomes-Gn; EBG00001456283.
DR   EnsemblGenomes-Gn; EBG00001456284.
DR   EnsemblGenomes-Gn; EBG00001456285.
DR   EnsemblGenomes-Gn; EBG00001456286.
DR   EnsemblGenomes-Gn; EBG00001456287.
DR   EnsemblGenomes-Gn; EBG00001456288.
DR   EnsemblGenomes-Gn; EBG00001456289.
DR   EnsemblGenomes-Gn; EBG00001456290.
DR   EnsemblGenomes-Gn; EBG00001456291.
DR   EnsemblGenomes-Gn; EBG00001456292.
DR   EnsemblGenomes-Gn; EBG00001456293.
DR   EnsemblGenomes-Gn; EBG00001456294.
DR   EnsemblGenomes-Gn; EBG00001456295.
DR   EnsemblGenomes-Gn; EBG00001456296.
DR   EnsemblGenomes-Gn; EBG00001456297.
DR   EnsemblGenomes-Gn; EBG00001456298.
DR   EnsemblGenomes-Gn; EBG00001456299.
DR   EnsemblGenomes-Gn; EBG00001456300.
DR   EnsemblGenomes-Gn; EBG00001456301.
DR   EnsemblGenomes-Gn; EBG00001456302.
DR   EnsemblGenomes-Gn; EBG00001456303.
DR   EnsemblGenomes-Gn; EBG00001456304.
DR   EnsemblGenomes-Gn; EBG00001456305.
DR   EnsemblGenomes-Gn; EBG00001456306.
DR   EnsemblGenomes-Gn; EBG00001456307.
DR   EnsemblGenomes-Gn; EBG00001456308.
DR   EnsemblGenomes-Gn; EBG00001456309.
DR   EnsemblGenomes-Gn; EBG00001456310.
DR   EnsemblGenomes-Gn; EBG00001456311.
DR   EnsemblGenomes-Gn; EBG00001456312.
DR   EnsemblGenomes-Gn; EBG00001456313.
DR   EnsemblGenomes-Gn; EBG00001456314.
DR   EnsemblGenomes-Gn; EBG00001456315.
DR   EnsemblGenomes-Gn; EBG00001456316.
DR   EnsemblGenomes-Gn; EBG00001456317.
DR   EnsemblGenomes-Gn; EBG00001456318.
DR   EnsemblGenomes-Gn; EBG00001456319.
DR   EnsemblGenomes-Gn; EBG00001456320.
DR   EnsemblGenomes-Gn; EBG00001456321.
DR   EnsemblGenomes-Gn; EBG00001456322.
DR   EnsemblGenomes-Gn; EBG00001456323.
DR   EnsemblGenomes-Gn; EBG00001456324.
DR   EnsemblGenomes-Gn; EBG00001456325.
DR   EnsemblGenomes-Gn; EBG00001456326.
DR   EnsemblGenomes-Gn; EBG00001456327.
DR   EnsemblGenomes-Gn; EBG00001456328.
DR   EnsemblGenomes-Gn; EBG00001456329.
DR   EnsemblGenomes-Gn; EBG00001456330.
DR   EnsemblGenomes-Gn; EBG00001456331.
DR   EnsemblGenomes-Gn; EBG00001456332.
DR   EnsemblGenomes-Gn; EBG00001456333.
DR   EnsemblGenomes-Gn; EBG00001456334.
DR   EnsemblGenomes-Gn; EBG00001456335.
DR   EnsemblGenomes-Gn; EBG00001456336.
DR   EnsemblGenomes-Gn; EBG00001456337.
DR   EnsemblGenomes-Gn; EBG00001456338.
DR   EnsemblGenomes-Gn; EBG00001456339.
DR   EnsemblGenomes-Gn; Rpal_R0001.
DR   EnsemblGenomes-Gn; Rpal_R0002.
DR   EnsemblGenomes-Gn; Rpal_R0003.
DR   EnsemblGenomes-Gn; Rpal_R0004.
DR   EnsemblGenomes-Gn; Rpal_R0005.
DR   EnsemblGenomes-Gn; Rpal_R0006.
DR   EnsemblGenomes-Gn; Rpal_R0007.
DR   EnsemblGenomes-Gn; Rpal_R0008.
DR   EnsemblGenomes-Gn; Rpal_R0009.
DR   EnsemblGenomes-Gn; Rpal_R0010.
DR   EnsemblGenomes-Gn; Rpal_R0011.
DR   EnsemblGenomes-Gn; Rpal_R0012.
DR   EnsemblGenomes-Gn; Rpal_R0013.
DR   EnsemblGenomes-Gn; Rpal_R0014.
DR   EnsemblGenomes-Gn; Rpal_R0015.
DR   EnsemblGenomes-Gn; Rpal_R0016.
DR   EnsemblGenomes-Gn; Rpal_R0017.
DR   EnsemblGenomes-Gn; Rpal_R0018.
DR   EnsemblGenomes-Gn; Rpal_R0019.
DR   EnsemblGenomes-Gn; Rpal_R0020.
DR   EnsemblGenomes-Gn; Rpal_R0021.
DR   EnsemblGenomes-Gn; Rpal_R0022.
DR   EnsemblGenomes-Gn; Rpal_R0023.
DR   EnsemblGenomes-Gn; Rpal_R0024.
DR   EnsemblGenomes-Gn; Rpal_R0025.
DR   EnsemblGenomes-Gn; Rpal_R0026.
DR   EnsemblGenomes-Gn; Rpal_R0027.
DR   EnsemblGenomes-Gn; Rpal_R0028.
DR   EnsemblGenomes-Gn; Rpal_R0029.
DR   EnsemblGenomes-Gn; Rpal_R0030.
DR   EnsemblGenomes-Gn; Rpal_R0031.
DR   EnsemblGenomes-Gn; Rpal_R0032.
DR   EnsemblGenomes-Gn; Rpal_R0033.
DR   EnsemblGenomes-Gn; Rpal_R0034.
DR   EnsemblGenomes-Gn; Rpal_R0035.
DR   EnsemblGenomes-Gn; Rpal_R0036.
DR   EnsemblGenomes-Gn; Rpal_R0037.
DR   EnsemblGenomes-Gn; Rpal_R0038.
DR   EnsemblGenomes-Gn; Rpal_R0039.
DR   EnsemblGenomes-Gn; Rpal_R0040.
DR   EnsemblGenomes-Gn; Rpal_R0041.
DR   EnsemblGenomes-Gn; Rpal_R0042.
DR   EnsemblGenomes-Gn; Rpal_R0043.
DR   EnsemblGenomes-Gn; Rpal_R0044.
DR   EnsemblGenomes-Gn; Rpal_R0045.
DR   EnsemblGenomes-Gn; Rpal_R0046.
DR   EnsemblGenomes-Gn; Rpal_R0047.
DR   EnsemblGenomes-Gn; Rpal_R0048.
DR   EnsemblGenomes-Gn; Rpal_R0049.
DR   EnsemblGenomes-Gn; Rpal_R0051.
DR   EnsemblGenomes-Gn; Rpal_R0052.
DR   EnsemblGenomes-Gn; Rpal_R0053.
DR   EnsemblGenomes-Gn; Rpal_R0054.
DR   EnsemblGenomes-Gn; Rpal_R0055.
DR   EnsemblGenomes-Gn; Rpal_R0056.
DR   EnsemblGenomes-Gn; Rpal_R0057.
DR   EnsemblGenomes-Gn; Rpal_R0058.
DR   EnsemblGenomes-Gn; Rpal_R0059.
DR   EnsemblGenomes-Gn; Rpal_R0060.
DR   EnsemblGenomes-Gn; Rpal_R0061.
DR   EnsemblGenomes-Gn; Rpal_R0062.
DR   EnsemblGenomes-Tr; EBT00001610009.
DR   EnsemblGenomes-Tr; EBT00001610010.
DR   EnsemblGenomes-Tr; EBT00001610011.
DR   EnsemblGenomes-Tr; EBT00001610012.
DR   EnsemblGenomes-Tr; EBT00001610013.
DR   EnsemblGenomes-Tr; EBT00001610014.
DR   EnsemblGenomes-Tr; EBT00001610015.
DR   EnsemblGenomes-Tr; EBT00001610016.
DR   EnsemblGenomes-Tr; EBT00001610017.
DR   EnsemblGenomes-Tr; EBT00001610018.
DR   EnsemblGenomes-Tr; EBT00001610019.
DR   EnsemblGenomes-Tr; EBT00001610020.
DR   EnsemblGenomes-Tr; EBT00001610021.
DR   EnsemblGenomes-Tr; EBT00001610022.
DR   EnsemblGenomes-Tr; EBT00001610023.
DR   EnsemblGenomes-Tr; EBT00001610024.
DR   EnsemblGenomes-Tr; EBT00001610025.
DR   EnsemblGenomes-Tr; EBT00001610026.
DR   EnsemblGenomes-Tr; EBT00001610027.
DR   EnsemblGenomes-Tr; EBT00001610028.
DR   EnsemblGenomes-Tr; EBT00001610029.
DR   EnsemblGenomes-Tr; EBT00001610030.
DR   EnsemblGenomes-Tr; EBT00001610031.
DR   EnsemblGenomes-Tr; EBT00001610032.
DR   EnsemblGenomes-Tr; EBT00001610033.
DR   EnsemblGenomes-Tr; EBT00001610034.
DR   EnsemblGenomes-Tr; EBT00001610035.
DR   EnsemblGenomes-Tr; EBT00001610036.
DR   EnsemblGenomes-Tr; EBT00001610037.
DR   EnsemblGenomes-Tr; EBT00001610038.
DR   EnsemblGenomes-Tr; EBT00001610039.
DR   EnsemblGenomes-Tr; EBT00001610040.
DR   EnsemblGenomes-Tr; EBT00001610041.
DR   EnsemblGenomes-Tr; EBT00001610042.
DR   EnsemblGenomes-Tr; EBT00001610043.
DR   EnsemblGenomes-Tr; EBT00001610044.
DR   EnsemblGenomes-Tr; EBT00001610045.
DR   EnsemblGenomes-Tr; EBT00001610046.
DR   EnsemblGenomes-Tr; EBT00001610047.
DR   EnsemblGenomes-Tr; EBT00001610048.
DR   EnsemblGenomes-Tr; EBT00001610049.
DR   EnsemblGenomes-Tr; EBT00001610050.
DR   EnsemblGenomes-Tr; EBT00001610051.
DR   EnsemblGenomes-Tr; EBT00001610052.
DR   EnsemblGenomes-Tr; EBT00001610053.
DR   EnsemblGenomes-Tr; EBT00001610054.
DR   EnsemblGenomes-Tr; EBT00001610055.
DR   EnsemblGenomes-Tr; EBT00001610056.
DR   EnsemblGenomes-Tr; EBT00001610057.
DR   EnsemblGenomes-Tr; EBT00001610058.
DR   EnsemblGenomes-Tr; EBT00001610059.
DR   EnsemblGenomes-Tr; EBT00001610060.
DR   EnsemblGenomes-Tr; EBT00001610061.
DR   EnsemblGenomes-Tr; EBT00001610062.
DR   EnsemblGenomes-Tr; EBT00001610063.
DR   EnsemblGenomes-Tr; EBT00001610064.
DR   EnsemblGenomes-Tr; EBT00001610065.
DR   EnsemblGenomes-Tr; EBT00001610066.
DR   EnsemblGenomes-Tr; EBT00001610067.
DR   EnsemblGenomes-Tr; EBT00001610068.
DR   EnsemblGenomes-Tr; EBT00001610069.
DR   EnsemblGenomes-Tr; EBT00001610070.
DR   EnsemblGenomes-Tr; EBT00001610071.
DR   EnsemblGenomes-Tr; EBT00001610072.
DR   EnsemblGenomes-Tr; EBT00001610073.
DR   EnsemblGenomes-Tr; EBT00001610074.
DR   EnsemblGenomes-Tr; EBT00001610075.
DR   EnsemblGenomes-Tr; EBT00001610076.
DR   EnsemblGenomes-Tr; EBT00001610077.
DR   EnsemblGenomes-Tr; EBT00001610078.
DR   EnsemblGenomes-Tr; EBT00001610079.
DR   EnsemblGenomes-Tr; EBT00001610080.
DR   EnsemblGenomes-Tr; EBT00001610081.
DR   EnsemblGenomes-Tr; EBT00001610082.
DR   EnsemblGenomes-Tr; Rpal_R0001-1.
DR   EnsemblGenomes-Tr; Rpal_R0002-1.
DR   EnsemblGenomes-Tr; Rpal_R0003-1.
DR   EnsemblGenomes-Tr; Rpal_R0004-1.
DR   EnsemblGenomes-Tr; Rpal_R0005-1.
DR   EnsemblGenomes-Tr; Rpal_R0006-1.
DR   EnsemblGenomes-Tr; Rpal_R0007-1.
DR   EnsemblGenomes-Tr; Rpal_R0008-1.
DR   EnsemblGenomes-Tr; Rpal_R0009-1.
DR   EnsemblGenomes-Tr; Rpal_R0010-1.
DR   EnsemblGenomes-Tr; Rpal_R0011-1.
DR   EnsemblGenomes-Tr; Rpal_R0012-1.
DR   EnsemblGenomes-Tr; Rpal_R0013-1.
DR   EnsemblGenomes-Tr; Rpal_R0014-1.
DR   EnsemblGenomes-Tr; Rpal_R0015-1.
DR   EnsemblGenomes-Tr; Rpal_R0016-1.
DR   EnsemblGenomes-Tr; Rpal_R0017-1.
DR   EnsemblGenomes-Tr; Rpal_R0018-1.
DR   EnsemblGenomes-Tr; Rpal_R0019-1.
DR   EnsemblGenomes-Tr; Rpal_R0020-1.
DR   EnsemblGenomes-Tr; Rpal_R0021-1.
DR   EnsemblGenomes-Tr; Rpal_R0022-1.
DR   EnsemblGenomes-Tr; Rpal_R0023-1.
DR   EnsemblGenomes-Tr; Rpal_R0024-1.
DR   EnsemblGenomes-Tr; Rpal_R0025-1.
DR   EnsemblGenomes-Tr; Rpal_R0026-1.
DR   EnsemblGenomes-Tr; Rpal_R0027-1.
DR   EnsemblGenomes-Tr; Rpal_R0028-1.
DR   EnsemblGenomes-Tr; Rpal_R0029-1.
DR   EnsemblGenomes-Tr; Rpal_R0030-1.
DR   EnsemblGenomes-Tr; Rpal_R0031-1.
DR   EnsemblGenomes-Tr; Rpal_R0032-1.
DR   EnsemblGenomes-Tr; Rpal_R0033-1.
DR   EnsemblGenomes-Tr; Rpal_R0034-1.
DR   EnsemblGenomes-Tr; Rpal_R0035-1.
DR   EnsemblGenomes-Tr; Rpal_R0036-1.
DR   EnsemblGenomes-Tr; Rpal_R0037-1.
DR   EnsemblGenomes-Tr; Rpal_R0038-1.
DR   EnsemblGenomes-Tr; Rpal_R0039-1.
DR   EnsemblGenomes-Tr; Rpal_R0040-1.
DR   EnsemblGenomes-Tr; Rpal_R0041-1.
DR   EnsemblGenomes-Tr; Rpal_R0042-1.
DR   EnsemblGenomes-Tr; Rpal_R0043-1.
DR   EnsemblGenomes-Tr; Rpal_R0044-1.
DR   EnsemblGenomes-Tr; Rpal_R0045-1.
DR   EnsemblGenomes-Tr; Rpal_R0046-1.
DR   EnsemblGenomes-Tr; Rpal_R0047-1.
DR   EnsemblGenomes-Tr; Rpal_R0048-1.
DR   EnsemblGenomes-Tr; Rpal_R0049-1.
DR   EnsemblGenomes-Tr; Rpal_R0051-1.
DR   EnsemblGenomes-Tr; Rpal_R0052-1.
DR   EnsemblGenomes-Tr; Rpal_R0053-1.
DR   EnsemblGenomes-Tr; Rpal_R0054-1.
DR   EnsemblGenomes-Tr; Rpal_R0055-1.
DR   EnsemblGenomes-Tr; Rpal_R0056-1.
DR   EnsemblGenomes-Tr; Rpal_R0057-1.
DR   EnsemblGenomes-Tr; Rpal_R0058-1.
DR   EnsemblGenomes-Tr; Rpal_R0059-1.
DR   EnsemblGenomes-Tr; Rpal_R0060-1.
DR   EnsemblGenomes-Tr; Rpal_R0061-1.
DR   EnsemblGenomes-Tr; Rpal_R0062-1.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00442; ykkC-yxkD.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00517; serC.
DR   RFAM; RF00518; speF.
DR   RFAM; RF00519; suhB.
DR   RFAM; RF00521; SAM_alpha.
DR   RFAM; RF01068; mini-ykkC.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01723; Rhizobiales-2.
DR   RFAM; RF01736; flg-Rhizobiales.
DR   RFAM; RF01750; pfl.
DR   RFAM; RF01793; ffh.
DR   RFAM; RF01849; alpha_tmRNA.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP001096.
DR   SILVA-SSU; CP001096.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4042952
CC   Source DNA and bacteria available from David Emerson
CC   (demerson@bigelow.org)
CC   Contacts: David Emerson (demerson@bigelow.org)
CC             David Bruce (microbe@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LLNL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5744041
FT                   /organism="Rhodopseudomonas palustris TIE-1"
FT                   /strain="TIE-1"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:395960"
FT   gene            220..1638
FT                   /locus_tag="Rpal_0001"
FT   CDS_pept        220..1638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="KEGG: bbt:BBta_0001 chromosomal replication
FT                   initiation protein; TIGRFAM: chromosomal replication
FT                   initiator protein DnaA; PFAM: Chromosomal replication
FT                   initiator DnaA domain; Chromosomal replication initiator
FT                   DnaA; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98563"
FT                   /db_xref="GOA:B3QJZ9"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3QJZ9"
FT                   /protein_id="ACE98563.1"
FT                   /translation="MSNMEQDRWSRVKGRLRSSVGEDVYSSWFARMDLESVHDESVHLS
FT                   VPTRFLKSWIQTHYSDKVLSCWQAELPEVNRVDLTVRSPVRCAAPAKEAPAPVESRRDE
FT                   QRPSAERSNGATPVSANHDALGGSPLDPRLTFASFVVGRSNTLAHAAAKQVAEGRRGDP
FT                   VMFNPLYIHSGVGLGKTHLLQAVTWAGNAGTERKVLYLTAEKFMYGFVAALKTQTSLAF
FT                   KEALRGIDVLVIDDLQFLQGKTTQAEFCHTLNALIDAGRQVVVAADRPPADLESLDERV
FT                   RSRLAGGLVVEMAPLGEDLRLGILRSRVVAARTHHASFDVPQPVLEYLARTITHNGRDL
FT                   EGAINRLLAHSKLNNQPVTLEMAEHEVRDLIRPSEPKRIKIEDIQRIVARQYNVSRSDL
FT                   LSSRRTANVVRPRQVAMYLAKTLTLRSLPEIGRRFGGRDHTTVLHAVRKIEGLVSKDTT
FT                   LSDEVESLKRQLQE"
FT   gene            1872..2990
FT                   /locus_tag="Rpal_0002"
FT   CDS_pept        1872..2990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: nha:Nham_0002 DNA polymerase III subunit beta;
FT                   TIGRFAM: DNA polymerase III, beta subunit; PFAM: DNA
FT                   polymerase III beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98564"
FT                   /db_xref="GOA:B3QK00"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:B3QK00"
FT                   /protein_id="ACE98564.1"
FT                   /translation="MKVTVERAQLLKSLSHVHRVVERRNTIPILGNVLVRAENAQLALK
FT                   ATDLDLEVTETLPAETATAGSTTVPAHMFYDIVRKLPDGSQIVLESDGDRSVLAIRAGR
FT                   SRFTLQTLPESDFPDLAAGEMSHAFRLPASDVKRLIDRTQFAISTEETRYYLNGIYLHT
FT                   AGSPKASSLRAVATDGHRLAQLDLTLPSGADGMPGLIVPRKTVGEVQRLIEDTEAEIGI
FT                   ELSTGKIRFTLGNVVLTSKLIDGTFPDYGRVIPQNNDKELRVDKKDFEAAVDRVSTISS
FT                   ERGRAVKLALSAGKLVLSVTNPDSGSATEELEVEYASDPLDIGFNSRYLLDIAAQIEGE
FT                   VAVLKLADPGSPTLIQDRDSKSALYVLMPMRV"
FT   gene            3234..4373
FT                   /locus_tag="Rpal_0003"
FT   CDS_pept        3234..4373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0003"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="TIGRFAM: DNA replication and repair protein RecF;
FT                   PFAM: SMC domain protein; KEGG: bra:BRADO0003 recombination
FT                   protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98565"
FT                   /db_xref="GOA:B3QK01"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:B3QK01"
FT                   /protein_id="ACE98565.1"
FT                   /translation="MTAARITRLTLTHFRNYRGASLTTTADQVVLVGPNGAGKTNCLEA
FT                   ISFLSPGRGLRRATLEDVANHEGDGSWAVSAEVEGALGLATLGTGIEPPRGDTPTTRRC
FT                   RIDREPVGSAAAFGDHLRMVWLTPSMDGLFMGAASERRRFFDRLVLAIDSGHSARVSAL
FT                   DRSLRSRNRLLEDIRNADSHWLDAIERETAELAIAVAAQRGQTALKLAAMLDARGATSA
FT                   FPSAKLMLDGWMENALTSEPATAVEDRYRAILRDSRGRDAAAGRTLDGPHLTDLEVIYA
FT                   PKAMPARDASTGEQKALLIGLVLAHAQLVAETTSITPLLLLDEVVAHLDPGRREALFTE
FT                   LGKLGAQVWMTGADPMAFAEIGPAAGIFDVESGRIRPRG"
FT   gene            4590..7031
FT                   /locus_tag="Rpal_0004"
FT   CDS_pept        4590..7031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0004"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.6.2.3"
FT                   /note="KEGG: nha:Nham_0004 DNA gyrase subunit B; TIGRFAM:
FT                   DNA gyrase, B subunit; PFAM: DNA gyrase subunit B domain
FT                   protein; ATP-binding region ATPase domain protein; TOPRIM
FT                   domain protein; DNA topoisomerase type IIA subunit B region
FT                   2 domain protein; SMART: DNA topoisomerase II"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98566"
FT                   /db_xref="GOA:B3QK02"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B3QK02"
FT                   /protein_id="ACE98566.1"
FT                   /translation="MTEPARQPSAESVHPAPAEYGAESIRVLKGLDAVRKRPGMYIGDT
FT                   DDGSGLHHMVYEVVDNAIDEALAGHASRVEVILNADGSVTVRDDGRGIPVDIHKGEGVS
FT                   AAEVIMTQLHAGGKFDQNSYKVSGGLHGVGVSVVNALSSKLLLRVWRNDKEHYIEFAHG
FT                   DAVAPLKVVGDANGKRGTEVTFYASAETFTHIEYDFATLEHRLRELAFLNSGVYIVLSD
FT                   MRHAVEKREEMRYEGGVTEFVKYLDRNKKPIVPTPVVIGAELNGIMVEAALWWNDTYHE
FT                   NVLCFTNNIPQRDGGTHLAGFRAALTRQITGYAEAGSKKEKVALTGDDCREGLTAVLSV
FT                   KVPDPKFSSQTKDKLVSSEVRPVVENVINEALAAWLEEHPSEAKIVIGKVVEAAAAREA
FT                   ARKARELTRRKGALDIASLPGKLADCQERDPAKSELFIVEGDSAGGSAKQGRNREFQAV
FT                   LPLRGKILNVERARFDKMLSSEQIGTLITALGTGIGREDFDLSKLRYHKIILMTDADVD
FT                   GAHIRTLLLTFFFRQMPALIEGGYLYIAQPPLYKVTRGKSEQYLKDERALEDYLIATGL
FT                   DDCAFKLANGEVRGGRDLLALVEDARAIRSTLHNLHSRYNRSVVEQAAIAGVLSPRITT
FT                   DIATANEAAAYIARRLDALADEVERGWVGHFTEGEGFRFERTVRGVKEVAAIDDALLGS
FT                   ADARKLDEYAAVLQEVYPRPGVLRRKEAETAIHGPISLFEAVTDAGRKGVALQRYKGLG
FT                   EMNPSQLWETTLDTNARSLLQVKVREVDEADDIFTKLMGDVVEPRREFIQENSLHATVD
FT                   V"
FT   gene            complement(7213..8331)
FT                   /locus_tag="Rpal_0005"
FT   CDS_pept        complement(7213..8331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0005"
FT                   /product="4-hydroxyphenylpyruvate dioxygenase"
FT                   /EC_number="1.13.11.27"
FT                   /note="KEGG: bja:bll0339 4-hydroxyphenylpyruvate
FT                   dioxygenase; TIGRFAM: 4-hydroxyphenylpyruvate dioxygenase;
FT                   PFAM: Glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98567"
FT                   /db_xref="GOA:B3QK03"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR005956"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="InterPro:IPR041735"
FT                   /db_xref="InterPro:IPR041736"
FT                   /db_xref="UniProtKB/TrEMBL:B3QK03"
FT                   /protein_id="ACE98567.1"
FT                   /translation="MGPFPHDAQPATISADNPMGTDGFEFVEFAHPDPAQLHSLFKLMG
FT                   FSLVAKHRTKAISVYRQGDVNYLVNEQPGTHGTDFVTAHGPCAPSMAFRVVDAKQAYER
FT                   AISLGAEPAGVTAAEATLDVPAIKGIGGSLLYFVDRYGAKGSAYDAEFDWVGARDVRPA
FT                   GAGLYYIDHLTHNVHRGRMDVWTGFYAKLFNFRQIRFFDIEGRASGLFSRALTSPDGKI
FT                   RIPINEDAGDSGQIEEYLSLYRGEGIQHIACGCRDIYSTVEGLRAAGLPFMPSPPETYF
FT                   ERVDARLPEHGEDVARLQRNGILIDGEGVVDGGQTKVLLQIFSANAIGPIFFEFIQRKG
FT                   DDGFGEGNFKALFESIEEDQIRRGVLKAERAA"
FT   gene            8457..8936
FT                   /locus_tag="Rpal_0006"
FT   CDS_pept        8457..8936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0006"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="PFAM: regulatory protein AsnC/Lrp family; KEGG:
FT                   bja:blr0340 transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98568"
FT                   /db_xref="GOA:B3QK04"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B3QK04"
FT                   /protein_id="ACE98568.1"
FT                   /translation="MMSVDAFDLKILSALQDDGRLTNQELADRVQLSPSQCSRRRMRLE
FT                   QDNIITGYRAELSGDALGFGVVAFIQITLATHSPDNAEKFRSLIGRIDEVQEAYSLTGD
FT                   ADYVLKAVLRDLKGLSELVNNVLMPHQSVAHVRSSIVLDRLKESTRLPLKQPANG"
FT   gene            complement(8982..10430)
FT                   /locus_tag="Rpal_0007"
FT   CDS_pept        complement(8982..10430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0007"
FT                   /product="signal transduction histidine kinase"
FT                   /note="KEGG: rru:Rru_A2544 signal transduction histidine
FT                   kinase; TIGRFAM: PAS sensor protein; PFAM: HWE histidine
FT                   kinase; PAS fold-4 domain protein; PAS fold domain protein;
FT                   SMART: PAS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98569"
FT                   /db_xref="GOA:B3QK05"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR011102"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B3QK05"
FT                   /protein_id="ACE98569.1"
FT                   /translation="MSAVSALSRAELEARLEEAEETLRAIRDGEIDAVVVRAADEEQVF
FT                   TLEGGGQSYRTFMETMDVGAAAFDQDGQLLYANQALCALLDCAHGSLTASALIALLDPA
FT                   NQAAFRRLLAQAQRERQSAEIHLRVGDAERSMLLTGTPLEFGIVHGAAITFTDISEREQ
FT                   AAAARESERLARAILASANEAVIVCDRAGRVTHLNGAAMRICAEAPVGKTFAEAIALSF
FT                   PEASELMSSDDIVTMATAGLPVQGLEAAVRIPSAAITDVMISAAPLVVSGERTQGCVVT
FT                   LVDLSQRKAAERHQALLMGELDHRVKNTLTMVMAICARTAAHERTIEDFQKSFTGRIQA
FT                   LAATHTLLSNASWQNLHIRDVLAAELAPFASLSSGRIVTDGLDIAVDAKTAVSLGLVFH
FT                   ELTTNAVKYGALSVPSGRISVRRVGATDEALTIEWQEHDGPPVTPPQSSGFGQTLISRS
FT                   LGNGGAKLEFDPAGVVCQISIPRS"
FT   gene            complement(10430..10714)
FT                   /locus_tag="Rpal_0008"
FT   CDS_pept        complement(10430..10714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0008"
FT                   /product="KaiB domain protein"
FT                   /note="PFAM: KaiB domain protein; KEGG: rru:Rru_A2543 KaiB"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98570"
FT                   /db_xref="GOA:B3QK06"
FT                   /db_xref="InterPro:IPR011649"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR039022"
FT                   /db_xref="UniProtKB/TrEMBL:B3QK06"
FT                   /protein_id="ACE98570.1"
FT                   /translation="MADPIKLVLYVAGETPKSLAAIRNLEKICAEHLAGKYKVEVIDLK
FT                   KSPQLAREHGIVAIPTLVKELPVPIRKIIGDLSDTPKVLVHLAVEESSS"
FT   gene            complement(10724..12415)
FT                   /locus_tag="Rpal_0009"
FT   CDS_pept        complement(10724..12415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0009"
FT                   /product="putative circadian clock protein, KaiC"
FT                   /EC_number="2.7.11.1"
FT                   /note="KEGG: rsq:Rsph17025_3311 KaiB domain protein; PFAM:
FT                   Circadian clock protein KaiC central region; KaiA binding;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98571"
FT                   /db_xref="GOA:B3QK07"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010624"
FT                   /db_xref="InterPro:IPR014774"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030665"
FT                   /db_xref="UniProtKB/TrEMBL:B3QK07"
FT                   /protein_id="ACE98571.1"
FT                   /translation="MADGISKSLTGIEGFDDLTLGGLPSGRPSLVCGSAGCGKTLFAST
FT                   FLINGARLYDEPGVFVTFEERPVDIVDNVASLGFDLQGLIAQERVLIEHIAIDPTEVAE
FT                   VGDYDLEALFLRLEFAVDQIGAKRIVLDTIESLFSAFQNPAVLRAEIRRLFDWLKQKGL
FT                   TAVITGERGDGTLTRQGLEEYVSDCVILLDHRVDNQISTRRLRIVKYRGTAHGTNEYPF
FT                   LIDEEGFSVLPVSSLGLSHKVHEERISSGVPDLDAMLSGGGFYRGTSVLITGVAGSGKS
FT                   SLACMMVDAACRRGEKALYLSFEESEAQTVRNMKSVGTDLGRWLSTGQLRYIGARPTFY
FT                   SLEMHLAVMLREVARFKPDLVVLDPISAFTESGQIGEVQSMLLRIVDYLKSNGITGAFT
FT                   HLAHGAQTETDAGLSSLMDAWILLLNREAHGEFNRELYLLKARGIAHSNQVREFVMSDD
FT                   GIHLLPPYLGEGGALTGSARRAEEAKERRVESERRTEVARLQDQIEQRRRRALAQIEAL
FT                   KADLAVDEAELQRLTQAEASFRAQSERDVTEMARRRGFIGSADDTD"
FT   gene            complement(12809..13318)
FT                   /locus_tag="Rpal_0010"
FT   CDS_pept        complement(12809..13318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0010"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="PFAM: regulatory protein AsnC/Lrp family; KEGG:
FT                   bra:BRADO0760 putative transcriptional regulatory protein,
FT                   AsnC/Lrp family"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98572"
FT                   /db_xref="GOA:B3QK08"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B3QK08"
FT                   /protein_id="ACE98572.1"
FT                   /translation="MTDIDSVVAESNRRLDAIDRKILTVLQQDASLSVAEIGDRVGLSS
FT                   TPCWKRIQRLEADGVIIKRVALVDQDKIGLGLSVFVSIESGDHSDAWLKTFADAVSAMP
FT                   EVIEFYRMAGDVDYMLRVVVADMRAYDQFYKKLIGTVPLKNVTSRFAMEKIKSVTALPV
FT                   PPMPVS"
FT   gene            complement(13458..13667)
FT                   /locus_tag="Rpal_0011"
FT   CDS_pept        complement(13458..13667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0011"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bbt:BBta_2219 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98573"
FT                   /db_xref="UniProtKB/TrEMBL:B3QK09"
FT                   /protein_id="ACE98573.1"
FT                   /translation="MSHAFIIEVNSRAAGIVVRDGRSFRFHAACDDFSGLEGQGFRSPG
FT                   DAQKAAVRHLEASPSGRGPKLRVA"
FT   gene            complement(13806..14054)
FT                   /locus_tag="Rpal_0012"
FT   CDS_pept        complement(13806..14054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0012"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98574"
FT                   /db_xref="UniProtKB/TrEMBL:B3QK10"
FT                   /protein_id="ACE98574.1"
FT                   /translation="MAMLTYDDRPRIAVAFEPPAKPAAAAVIEPAPTSDAAEAPTEPDD
FT                   DVQERWLQAQPWPRRWFARFYRALRKLQPAFPPMSCC"
FT   gene            complement(14056..14232)
FT                   /locus_tag="Rpal_0013"
FT   CDS_pept        complement(14056..14232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0013"
FT                   /product="cytochrome oxidase maturation protein, cbb3-type"
FT                   /note="TIGRFAM: cytochrome oxidase maturation protein,
FT                   cbb3-type; PFAM: cytochrome oxidase maturation protein
FT                   cbb3-type; KEGG: bra:BRADO2445 nitrogen fixation protein
FT                   FixS"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98575"
FT                   /db_xref="InterPro:IPR004714"
FT                   /db_xref="UniProtKB/TrEMBL:B3QK11"
FT                   /protein_id="ACE98575.1"
FT                   /translation="MVILVPLALGLGLLGLVAFLWSLKSGQYEDLDGAAWRAIADDDPP
FT                   LPPPANVPAEKRG"
FT   sig_peptide     complement(14170..14232)
FT                   /locus_tag="Rpal_0013"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.731) with cleavage site probability 0.260 at
FT                   residue 21"
FT   gene            complement(14232..16430)
FT                   /locus_tag="Rpal_0014"
FT   CDS_pept        complement(14232..16430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0014"
FT                   /product="copper-translocating P-type ATPase"
FT                   /note="TIGRFAM: ATPase, P-type (transporting), HAD
FT                   superfamily, subfamily IC; copper-translocating P-type
FT                   ATPase; heavy metal translocating P-type ATPase; PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase; Heavy metal
FT                   transport/detoxification protein; E1-E2 ATPase-associated
FT                   domain protein; KEGG: bbt:BBta_2797 nitrogen fixation
FT                   protein FixI"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98576"
FT                   /db_xref="GOA:B3QK12"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B3QK12"
FT                   /protein_id="ACE98576.1"
FT                   /translation="MLQTRDFSHYVKDVDGRIAHLDLAVEGVHCASCMAKIERGLQSIP
FT                   DVTLARVNLTDRRLAVEWNKGSTLEPGQFIDRLAELGYKAYPYEPVRAEVEEAERTKFL
FT                   LRCLGVAVFATMNVMMLSVPVWYGGDLSPEARDFFHWLSALVALPCAAYAGQPFFQSAF
FT                   RALKAKSVNMDVPITIGITLALGMSLVETINHAEHAYFDAAVMLIAFLLAGRFLDQKMR
FT                   QKTRAVAGNLAALKAETATKFVGPDEISEVPIAAVRAGDIVLLRPGERCAVDGTVIEGR
FT                   SEIDQSLITGETLYVPAERGTQVYAGTLNISGTLRVRVAAAAEGTLLSEITRLLDHALQ
FT                   ARSRYVRLADRASQLYAPVVHATALLTIIGWVLAGASWHDAIVIGIAVLIITCPCALGL
FT                   AIPAVQTVASGAMFRAGVLLNAGDAIERAASVDTIVFDKTGTLTLPELDVVNAAGIPLE
FT                   VFDLAGRLALASHHPVAAAVARAAHAKSPLPNVVEEPGRGVRTVFGGQELRLGSPAFCG
FT                   ADAEANQILSEDPEVSVVAFSRGEQRVVFAVRQLLRPDAAKTIDALTNRGIAVELLSGD
FT                   REPAVRHAAAALGVSAWRASVTPAEKIAHIEALKKQGRIVMMVGDGMNDAPSLAAAHVS
FT                   MSPISATHLSQATADLVFLGKELAPVLAAVDYSRKAMAVMRENLGLAIGYNVLAVPIAI
FT                   AGYATPLIAALAMSGSSLLVMLNAMRARRVRRGAASWK"
FT   gene            complement(16465..16965)
FT                   /locus_tag="Rpal_0015"
FT   CDS_pept        complement(16465..16965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0015"
FT                   /product="FixH family protein"
FT                   /note="PFAM: FixH family protein; KEGG: bra:BRADO2443
FT                   nitrogen fixation protein FixH"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98577"
FT                   /db_xref="InterPro:IPR008620"
FT                   /db_xref="InterPro:IPR018037"
FT                   /db_xref="UniProtKB/TrEMBL:B3QK13"
FT                   /protein_id="ACE98577.1"
FT                   /translation="MSRSKSSPRPLTGKVVLAVLVAFFGIVFGVNGLMMTLAIKTLPGT
FT                   EVDSAYAASLAYEREIAAARDQDQRGWKVEAKVERKPDGAAVLQVEARDKAGLPLAGLN
FT                   FFGRLERPSDKRYDREVALAEVGSGVYRGDADGVLPGRWDLVLEGDQGGVRMFLSKNKL
FT                   LLN"
FT   sig_peptide     complement(16876..16965)
FT                   /locus_tag="Rpal_0015"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.972) with cleavage site probability 0.868 at
FT                   residue 30"
FT   gene            complement(16985..18442)
FT                   /locus_tag="Rpal_0016"
FT   CDS_pept        complement(16985..18442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0016"
FT                   /product="cytochrome c oxidase accessory protein CcoG"
FT                   /note="TIGRFAM: cytochrome c oxidase accessory protein
FT                   CcoG; KEGG: bbt:BBta_2795 nitrogen fixation protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98578"
FT                   /db_xref="GOA:B3QK14"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014116"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR032879"
FT                   /db_xref="UniProtKB/TrEMBL:B3QK14"
FT                   /protein_id="ACE98578.1"
FT                   /translation="MNKPLRATDLQPDDDGPLYTAQKKIFPQSVSGPFRRIKWILMAVC
FT                   LGIYYFLPFVRWNRGLGAPDQAVLIDLANNRFYFFAIELWPQEIYYFTGLLIVAAIVLF
FT                   LMNALGGRVWCGYLCPQTVWTDLFYAVERFVEGDRRERMRKAGEGFKMQRAAELALKHS
FT                   IWLMIAWWTGGAWVLYFADAPTLIKELVTFDAPMVAYIWIGILTFTTYTLAGFMREQVC
FT                   VYMCPWPRIQAALTDEWALNVTYKYDRGEKRSSLKKAAQLRALGEPVGDCVDCNQCVAV
FT                   CPTGIDIRNGPQLDCIQCGLCIDACDNVMTKIGRPTRLIGYDNDINIHRRMEGKPEIFK
FT                   PVRARTVIYSLIIVAIGGAMLYKLATRSLLDVNVLHDRNPVAVRLSDGSVRNGYTIRFL
FT                   NKRGFDRVVAVDVEGPPNAMIHIVGADSITPARPMIILGRDTTTELRVLVDSNTNDDVP
FT                   QSVPVTFHVTDIGLGEVASTKDVFVTP"
FT   gene            complement(18559..19440)
FT                   /locus_tag="Rpal_0017"
FT   CDS_pept        complement(18559..19440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0017"
FT                   /product="cytochrome c oxidase, cbb3-type, subunit III"
FT                   /note="TIGRFAM: cytochrome c oxidase, cbb3-type, subunit
FT                   III; PFAM: cytochrome c class I; KEGG: bra:BRADO2441
FT                   cytochrome-c oxidase FixP chain"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98579"
FT                   /db_xref="GOA:B3QK15"
FT                   /db_xref="InterPro:IPR004678"
FT                   /db_xref="InterPro:IPR008168"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR032858"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="InterPro:IPR038414"
FT                   /db_xref="UniProtKB/TrEMBL:B3QK15"
FT                   /protein_id="ACE98579.1"
FT                   /translation="MADHAHHGEIDKVTGTATTGHEWDGIQELNTPLPRWWIWTFYATI
FT                   IWSIGYFIVYPAWPLMNGYTHGLFGYSSRAELDVDLAKLNQVRGEKMQALATASLEEIE
FT                   KNPALLALARAKGKVVFGDNCAPCHGSGAAGGKGFPNLNDDDWLWGGSLEQIEKTIKYG
FT                   ARSGNDEGHMGNMLAFGKDGTLTKDQIVQVANFVRSLSGQSTRPGVDLAAGKQIFAENC
FT                   VACHGEDAKGNPELGAPNLTDKIWLYGGDEATIIETITNGRGGVMPAWIGRLDPTTIKA
FT                   MAVYVHSLGGGK"
FT   gene            complement(19448..19612)
FT                   /locus_tag="Rpal_0018"
FT   CDS_pept        complement(19448..19612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0018"
FT                   /product="Cbb3-type cytochrome oxidase component"
FT                   /note="PFAM: Cbb3-type cytochrome oxidase component; KEGG:
FT                   bra:BRADO2440 cytochrome oxidase subunit, FixQ"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98580"
FT                   /db_xref="GOA:B3QK16"
FT                   /db_xref="InterPro:IPR008621"
FT                   /db_xref="UniProtKB/TrEMBL:B3QK16"
FT                   /protein_id="ACE98580.1"
FT                   /translation="MKAIIYFDNIASSLVTTWWTPLFMAIFVAIVVYALWPKNKEAFDE
FT                   AAQMPLRED"
FT   gene            complement(19622..20356)
FT                   /locus_tag="Rpal_0019"
FT   CDS_pept        complement(19622..20356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0019"
FT                   /product="cytochrome c oxidase, cbb3-type, subunit II"
FT                   /note="TIGRFAM: cytochrome c oxidase, cbb3-type, subunit
FT                   II; PFAM: cytochrome C oxidase mono-heme subunit/FixO;
FT                   KEGG: bbt:BBta_2793 cytochrome-c oxidase FixO chain"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98581"
FT                   /db_xref="GOA:B3QK17"
FT                   /db_xref="InterPro:IPR003468"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:B3QK17"
FT                   /protein_id="ACE98581.1"
FT                   /translation="MSIWARHKIFETNSVVLIVGILLVIAIGGLVEITPLFYLKSTIEK
FT                   VDGVRPYTPLELAGRNIYIREGCYLCHSQMIRPLRDEIERYGHYSLAAESMYDHPFQWG
FT                   SKRTGPDLARVGGKYSDDWHVAHLKNPRSIVPQSVMPNYAFLADNKVDVASLSDHLKTN
FT                   RTLGVPYSDEDIAKAAADAKAQVDPEGAAAADLQKRYPKAVVRNFDGQPGDPTELDALV
FT                   SYLQMLGTLVDFKLYDEKANLR"
FT   gene            complement(20369..22015)
FT                   /locus_tag="Rpal_0020"
FT   CDS_pept        complement(20369..22015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0020"
FT                   /product="cytochrome c oxidase, cbb3-type, subunit I"
FT                   /EC_number="1.9.3.1"
FT                   /note="KEGG: bja:blr2763 cytochrome-c oxidase; TIGRFAM:
FT                   cytochrome c oxidase, cbb3-type, subunit I; PFAM:
FT                   cytochrome c oxidase subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98582"
FT                   /db_xref="GOA:B3QK18"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR004677"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:B3QK18"
FT                   /protein_id="ACE98582.1"
FT                   /translation="MNQALNSKRITLGEGGLTVVFALTTILSIYAAIYAKDAPFAFHAA
FT                   LAAAFSAWAVFAIIVRHRSRSGLPPQEINGAPNYNLGPIKFLSFMAMFWGIAGFSAGLY
FT                   IALELAYPGLNIAQWVNFGRLRPLHTSAVIFAFGGNVLLATSFYVVQKTTRARLAGDLA
FT                   PWFVAIGYNFFIVIAGTGYLLGVTQSKEYAEPEWYADLWLTIVWVTYLLVFLATLMKRK
FT                   EPHIYVANWFYLAFIITIAVLHLGNNPTLPVSFLGSKSYIAWSGVQDAMFQWWYGHNAV
FT                   GFFLTAGFLAIMYYFIPKRAERPVYSYRLSIIHFWALIFLYIWAGPHHLHYTALPDWTQ
FT                   TLGMTFSIMLWMPSWGGMINGLMTLSGAWDKLRTDPVLRMMVVSVAFYGMSTFEGPMMA
FT                   IKAVNSLSHYTDWTIGHVHSGALGWVGFVSFGALYCLVPWVWGRKQLYSIRLVNWHFWI
FT                   ATLGIVLYISAMWVSGILQGLMWRAYTSLGFLEYSFIESVEAMHPFYAIRAAGGGLFLI
FT                   GALIMAYNLWMTVRVGERSEAQPRVALQPAE"
FT   gene            complement(22326..23246)
FT                   /locus_tag="Rpal_0021"
FT   CDS_pept        complement(22326..23246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0021"
FT                   /product="2-dehydropantoate 2-reductase"
FT                   /EC_number="1.1.1.169"
FT                   /note="KEGG: bbt:BBta_0313 2-dehydropantoate 2-reductase;
FT                   TIGRFAM: 2-dehydropantoate 2-reductase; PFAM: Ketopantoate
FT                   reductase ApbA/PanE domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98583"
FT                   /db_xref="GOA:B3Q5V4"
FT                   /db_xref="InterPro:IPR003710"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR013332"
FT                   /db_xref="InterPro:IPR013752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q5V4"
FT                   /protein_id="ACE98583.1"
FT                   /translation="MRILIVGAGAIGGYFGGRLLQLGRDVTFLVRPGRAAELTRDGLVI
FT                   KSPHGDATIQNPPAVQAAALTPDYDLVVLSCKAFDLDDAIASFRGGVSPRTAILPLLNG
FT                   MKHLDVLDTAFGRDRVLGGQCVIAATLDAQRHVVQLAPMSAITFGERDGASSERVAQIA
FT                   VALGGSDFGVNASPVIMQEMWEKWVFLATLAGSTSLMRGAVGEILVAPGGADFMLGVLD
FT                   EITSIAAAAGHPPRPVAVERTRNMLLAEGSTLTASMFRDILAGARIEADHVVGDLIDRA
FT                   DEAKVPVPRLRVIYTHLKTYERRRG"
FT   gene            complement(23320..24057)
FT                   /locus_tag="Rpal_0022"
FT   CDS_pept        complement(23320..24057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0022"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   bra:BRADO0329 putative acetoin(diacetyl) reductase (acetoin
FT                   dehydrogenase) (AR) (meso-2,3-butanediol dehydrogenase);
FT                   oxidoreductase, short chain dehydrogenase; putative short
FT                   chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98584"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q5V5"
FT                   /protein_id="ACE98584.1"
FT                   /translation="MTPRNATVAVIGAGDYIGAEIAKKFAAEGFTVFAGRRNGEKLAPL
FT                   VAEIEAAGGRIVARSLDARNEEEVTAFLNAADAHAPLEVTIFNVGANVNFPILETTDRV
FT                   FRKVWEMACWAGFVSGRESARLMLARGQGKIFFTGATASLRGGSGFAAFASAKFGLRAV
FT                   AQSMARELMPKNIHVAHLIIDSGVDTAWVRERREQMFGKDALANPDLLMPPAAVAGAYW
FT                   QLYQQPKSAWTFEMEIRPYGEKW"
FT   gene            complement(24176..24778)
FT                   /locus_tag="Rpal_0023"
FT   CDS_pept        complement(24176..24778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0023"
FT                   /product="DSBA oxidoreductase"
FT                   /note="PFAM: DSBA oxidoreductase; KEGG: bja:blr0588
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98585"
FT                   /db_xref="GOA:B3Q5V6"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR014440"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q5V6"
FT                   /protein_id="ACE98585.1"
FT                   /translation="MTQPPPQFLFDFGSPNAFLAHEAIPAIEQRIGVKFDYVPVLLGGI
FT                   FKATNNKSPAETLAGIKNKREFLVVETERFLKRYAVKPYVWNPHFPVNTLNLMRAAVAA
FT                   QLEGVFEKYVEAAFHHMWVEPKKMDDLEVAAAALSSSGLDGKALLTRAQEPEVKAKLIA
FT                   NTEDAVQRGVFGSPTFFVGKEMFFGKEQLRDVEELYG"
FT   gene            24994..25662
FT                   /locus_tag="Rpal_0024"
FT   CDS_pept        24994..25662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0024"
FT                   /product="Glutathione S-transferase domain"
FT                   /note="PFAM: Glutathione S-transferase domain; KEGG:
FT                   bja:bll0585 glutathione S-transferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98586"
FT                   /db_xref="GOA:B3Q5V7"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q5V7"
FT                   /protein_id="ACE98586.1"
FT                   /translation="MLTVHHLNNSRSQRVLWLLEELDTPYEIKRYQRQPDMMAPKELRA
FT                   VHPLGKSPVITDNGNTIAESGAIVEYIVGTYGNGRLIPPPNTPERLRYTYWLHYAEGSA
FT                   MPPLLLKLLFSMMPQRAPALVRPLVKMVASGALTGFVDPQLKLHMDYWESELGKAAYFA
FT                   GDQFTAADIQMSFPLEAAASRGGLDQRYPKAQAWLERIHARPAYNRALEKGGPYEIGKA
FT                   "
FT   gene            complement(25778..26653)
FT                   /locus_tag="Rpal_0025"
FT   CDS_pept        complement(25778..26653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0025"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   mex:Mext_3612 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98587"
FT                   /db_xref="GOA:B3Q5V8"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q5V8"
FT                   /protein_id="ACE98587.1"
FT                   /translation="MASLQGKTLFITGASRGIGLAIALRAARDGANVAIAAKTTEPHPK
FT                   LKGTIYTAAEEIVAAGGKALPMVCDIRDEAQVIDAIGKTVAEFGGIDICVNNASAISLT
FT                   NSQATDMKRYDLMMGINTRGTFMVSKYCIPHLKKAANPHILMLSPPLDMKAKWFAASTA
FT                   YTMAKFGMSMVALGLSGELKHAGVAVNALWPRTTIATAAVGNLLGGDAMIRASRTPEIM
FT                   GDAAHAILARPSREFTGQFCIDDSVLYEAGVRDFEPYRVDPSVPLMSDFFVPDDSVPPP
FT                   GVTVTPLPMG"
FT   gene            complement(26926..28659)
FT                   /locus_tag="Rpal_0026"
FT   CDS_pept        complement(26926..28659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0026"
FT                   /product="gamma-glutamyltransferase"
FT                   /EC_number="2.3.2.2"
FT                   /note="KEGG: nha:Nham_0191 gamma-glutamyltransferase;
FT                   TIGRFAM: gamma-glutamyltransferase; PFAM:
FT                   gamma-glutamyltranspeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98588"
FT                   /db_xref="GOA:B3Q5V9"
FT                   /db_xref="InterPro:IPR000101"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q5V9"
FT                   /protein_id="ACE98588.1"
FT                   /translation="MITLRVPQRILMTLAALVLVVIPLAAPAQDMRSGMARGPTQAVVA
FT                   KHGMVVAQERLAAKIGAGFLSRGGNAIDAAVATGFAMAVTYPRAGNLGGGGFMVIHSAV
FT                   KNEDVAIDYRETAPQAATQDMFLTDGKPDPDKSRKSALGIGVPGTVAGLALALEKYGSG
FT                   KFKLADVIAPAIALARDGITVADDTADTLPDWHAWLSRWPSTRKVFARPDGSPLQAGDR
FT                   LVQPDLAATLEAIAKQGPDGFYRGPIAEKLSRGIRDAGGLITPEDLAGYQPMLRSPLRG
FT                   NYRGYDIVAMPQPSSGGVVLIESLNILEGYAMRDLGQGTPPSLHLLIEAMKRAYADRAR
FT                   YLGDPAFSEAPMTKLLSKDYAASLRAGIDPQRATPVAEPLPQPREGQNTTHFSVADAEG
FT                   NAVSNTYTLNFSYGVGLVADGTGVLLNNELDDFTAAPGASNAYGLVGFAANLPAPGKRP
FT                   LSSMSPTILLKDGKPVLVTGSPGGSRIISAVLQVIVDVIDYRMNVADAVAAPRLHHQWL
FT                   PDEVRVEGGFPEATLDTLRAMGHRIVTPLGQTSANSILIDADGFHGAPDPRTRGATAAG
FT                   N"
FT   sig_peptide     complement(28582..28659)
FT                   /locus_tag="Rpal_0026"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.993 at
FT                   residue 26"
FT   gene            28765..30162
FT                   /locus_tag="Rpal_0027"
FT   CDS_pept        28765..30162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0027"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   nha:Nham_0192 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98589"
FT                   /db_xref="GOA:B3Q5W0"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR024671"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q5W0"
FT                   /protein_id="ACE98589.1"
FT                   /translation="MSSSLAEGIAQTREPIRYPPQSAVVGWILFDWAAQPYFTLITTFI
FT                   FAPYFATYVAPDPATGQSLWGFATAASGFVIALASPVLGAIADASGRRKPWIALFGGML
FT                   VIGSMLMWFGKPGEPNTILPLLIAYALATIGVEFATVFNNAMMPNLVPPEKIGRLSGTG
FT                   WATGYVGGILSLILVLGFLAASPETGKTLLGITPWFGLDPALHEGDRISGPLTGMWFVV
FT                   FVLPMFLLTPDFPAKLAPRAAIREGLRELGETLRDLPRRRSLAIFLLANMIYTDGLVSL
FT                   FAFGGIYATGTFGWSTIQIGTFGVILAIAATIGAFTGGRLDDAFGSKRVITGSLLLLLV
FT                   AIAGILLIDPSHVLLIEVTPPQPGAALFASPAERAYLLLGCLIGIAGGPLQAASRTLLI
FT                   RIAPRDRIAQYFGLFALTGKVTSFIGPLLIASVTALASSQKAGMAVLVLFFVAGLALLT
FT                   QVRRSAD"
FT   gene            30377..31471
FT                   /locus_tag="Rpal_0028"
FT   CDS_pept        30377..31471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0028"
FT                   /product="phospho-2-dehydro-3-deoxyheptonate aldolase"
FT                   /EC_number="2.5.1.54"
FT                   /note="KEGG: mlo:mll4988 phospho-2-dehydro-3-heoxyheptonate
FT                   aldolase; TIGRFAM: phospho-2-dehydro-3-deoxyheptonate
FT                   aldolase; PFAM: DAHP synthetase I/KDSA"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98590"
FT                   /db_xref="GOA:B3Q5W1"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006219"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q5W1"
FT                   /protein_id="ACE98590.1"
FT                   /translation="MLTTTDDLRLQKITELSTPAEVMGEIPRTLTATRTVAASRSAIHA
FT                   ILTGADDRLLVVVGPCSIHDPAAAMDYASRLAALRETLADRLEIVMRVYFEKPRTTVGW
FT                   KGLINDPDLDGSFRIDKGLRLAREVLSAVNNLGLPAATEFLDLITPQYIADLVAWGAIG
FT                   ARTTESQIHRELASGLSCPIGFKNGTDGNVRIAAEAVKSAAQPHHFMAVTKGGRNAIAA
FT                   TTGNSDCHVILRGGVTPNYDAASVETAAAVLGKIGLPPRLMIDASHANSSKQPDNQPKV
FT                   TADIGRQMAAGESRIIGVMIESNLVAGRQDVAPGRPLQYGQSITDGCIDWATTETVLHE
FT                   LADAVESRRAARHAASAQQKGAAA"
FT   gene            complement(31529..33121)
FT                   /locus_tag="Rpal_0029"
FT   CDS_pept        complement(31529..33121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0029"
FT                   /product="phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase/IMP cyclohydrolase"
FT                   /EC_number="2.1.2.3"
FT                   /note="KEGG: bja:blr0581 bifunctional
FT                   phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase/IMP cyclohydrolase; TIGRFAM:
FT                   phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase/IMP cyclohydrolase; PFAM: MGS domain
FT                   protein; AICARFT/IMPCHase bienzyme formylation region"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98591"
FT                   /db_xref="GOA:B3Q5W2"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q5W2"
FT                   /protein_id="ACE98591.1"
FT                   /translation="MTQNPRRVTRALLSVSDKTGLIDFARALAGHGVELVSTGGTAKAI
FT                   AAAGLPVKDVSELTGFPEMMDGRVKTLHPKVHGGLLAIRDNDEHTQAMAAHGIPQIDLL
FT                   VVNLYPFEATVDKGASYEDCIENIDIGGPAMIRAAAKNHDDVAVVVEASDYQAVLDELT
FT                   ANNGATTLPLRKRLAAKAYARTAAYDAAISNWFALQLKTDAPDFRAIGGRLIQSLRYGE
FT                   NPHQTAAFYATPEKRPGVATARQVQGKELSYNNINDTDAAYECVGEFDAARTAACVIVK
FT                   HANPCGVAEGSSLLDAYKKALACDSVSAFGGIVALNRTLDAEAARAITEIFTEVIIAPD
FT                   ATDEAIAIVAAKKNLRLLLAGALPDPRANGLTYKTVAGGLLVQSRDNAVVDDMALKVVT
FT                   KRQPTEAELRDLKFAFRVGKHVKSNTIIYAKDLATVGIGAGQMSRVDSARIAARKAQDA
FT                   AEAMKLAAPMTKGSVVASDAFFPFADGMLACIEAGATAVIQPGGSVRDDEVIKAADDAG
FT                   IAMVFTGTRHFRH"
FT   gene            complement(33307..35061)
FT                   /locus_tag="Rpal_0030"
FT   CDS_pept        complement(33307..35061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0030"
FT                   /product="Heparinase II/III family protein"
FT                   /note="PFAM: Heparinase II/III family protein; KEGG:
FT                   bja:blr0580 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98592"
FT                   /db_xref="GOA:B3Q5W3"
FT                   /db_xref="InterPro:IPR008929"
FT                   /db_xref="InterPro:IPR012480"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q5W3"
FT                   /protein_id="ACE98592.1"
FT                   /translation="MSATPRRGISALIVGRFARTVMARASGGSVAVTRLWPGRTDRLII
FT                   APHDLRTADATRAAEIYAGRFVFAGKIVTCHGRSIFDLEPPSDDWEAALLGFGWLRHLR
FT                   AADTAITRANARSLVDDWLSNMSRTGPVGRRPDVLARRVISLLSQAPLVLSDTDGKFYR
FT                   RYLRGLTREIRALRYALLDVQDGVPRLQVLIALCYASLCLANQARQIRGATKKLSDELQ
FT                   RQILPDGGHISRNPSALIELLIDLLPLRQTFAARNIAPPPALLNAIDRMMPMLRFFRHG
FT                   DGNFALFNGMSATPSDLLATLLAYDDSQGTPLASMPHSGYQRIDAGTTLVIVDAGTPPP
FT                   ANVSQEAHAGCLSFELSSGPCRIVINSGMPTTNRESWRGFARSTVAHSTVTCHDTSSCS
FT                   FVERSAMKRFLHGAPVVGGPRQVENRREEVAGGVLLTTSHDGYRDKFGVLHRRVLMVKH
FT                   DGSRVDGEDSLSPVQGGRHRAAQADYAVRFHLHPLVKASRLHDARGVMLVLPNREVWTF
FT                   EAADDKVDLEETVFLAGNDGPRRSTQIVIRQNSIEAPNLRWSFIRSNASPQATSARRAA
FT                   RHEPELPL"
FT   sig_peptide     complement(34990..35061)
FT                   /locus_tag="Rpal_0030"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.748) with cleavage site probability 0.698 at
FT                   residue 24"
FT   gene            complement(35360..36712)
FT                   /locus_tag="Rpal_0031"
FT   CDS_pept        complement(35360..36712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0031"
FT                   /product="Fmu (Sun) domain protein"
FT                   /note="PFAM: Fmu (Sun) domain protein; NusB/RsmB/TIM44;
FT                   KEGG: bja:blr0579 SUN protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98593"
FT                   /db_xref="GOA:B3Q5W4"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q5W4"
FT                   /protein_id="ACE98593.1"
FT                   /translation="MPAPRFAQASEVPGLAARRIAADILDGVLQKRRMLDDQLEGPAAH
FT                   PGLKTLSDRDRALMRRLVATILRRLGTLEGLLAKLLDRGVPTDAPRAKSALLIGAAQIL
FT                   WMDVPDHAAVDLSVRLVQSDRRAAKYAGLVNAVLRRCAREGQPLVEELAAGTPDVPQWL
FT                   LARWSEHYGAETARAIAHAISHEPSLDLTVKSDPAHWAARLHGEVLPTGTVRTLLQGSV
FT                   RMLPGFDEGQWWVQDAAAALPARLFGDIAGKSVADLCAAPGGKTAQLAAAGARVTAIDR
FT                   SPARVARLRENLARLSFEVETGVADAAEWRGDETAEFDAVLIDAPCASTGTIRRHPDVA
FT                   WLKQESDIGALAAVQNRLLKKAASLLRPGGTLVYCTCSLEPEEGEQAIAALLDAESSMR
FT                   RQPIDPAEVAGLAEIVTADGALRTLPCHLPHSDPRLAGLDGFYAARLVKSL"
FT   gene            36865..37083
FT                   /locus_tag="Rpal_0032"
FT   CDS_pept        36865..37083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0032"
FT                   /product="protein of unknown function DUF1674"
FT                   /note="PFAM: protein of unknown function DUF1674; KEGG:
FT                   bbt:BBta_0326 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98594"
FT                   /db_xref="InterPro:IPR012875"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q5W5"
FT                   /protein_id="ACE98594.1"
FT                   /translation="MTNPDPKSATMDAAPPRKDLPEAAKRALAEAEARRVEAAKHAEAR
FT                   AKEVQGPKGPEPTRYGDWEVKGIASDF"
FT   gene            37169..37744
FT                   /locus_tag="Rpal_0033"
FT   CDS_pept        37169..37744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0033"
FT                   /product="nuclease (SNase domain protein)"
FT                   /note="PFAM: nuclease (SNase domain protein); KEGG:
FT                   nwi:Nwi_0154 staphylococcus nuclease (SNase-like)"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98595"
FT                   /db_xref="GOA:B3Q5W6"
FT                   /db_xref="InterPro:IPR016071"
FT                   /db_xref="InterPro:IPR035437"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q5W6"
FT                   /protein_id="ACE98595.1"
FT                   /translation="MSPYPRTNPVRISRLPWRSRLWPWVFVLGVAAGTMLPARHWLLHL
FT                   PWLQPPASQGIDNDSETVWRRAGNPTTRHPVDVLYTIDGDTFDARVHLWPGTDLRTRVR
FT                   LRGIDAPELKAQCARELRMAEAAAEALRRLLAEGEVAIYNIGPDKYQGRVVADVATKRT
FT                   ANVSNALLDGGYARAYGGGHRDGWCGGR"
FT   gene            complement(37748..38632)
FT                   /locus_tag="Rpal_0034"
FT   CDS_pept        complement(37748..38632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0034"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bra:BRADO0145 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98596"
FT                   /db_xref="InterPro:IPR024453"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q5W7"
FT                   /protein_id="ACE98596.1"
FT                   /translation="MGVVLETIGKLIASYLQKEEPGYEPFTPSDPDHLRTIMEPGDVLL
FT                   VEGNSRIAGIIKYLTQSTWSHAALYVGPIDGVTEPDGEPHVLVEANIGEGVSSSPLSRH
FT                   LAYHTRVCRPVGLSYEDRHTVCRYAINRIGFGYDTKNIIDLMRYLVPLPVPQRWRRRMI
FT                   ALGSGDPTKIICSALIAQAFEAVRYPILPKITKAGSRAARREILHIRHSTLYMPRDFDI
FT                   SPYFEVVKPTIVNGFDYTALHWADKPKPVVESDSPFASPIEGSESAPSLATQTAEADPA
FT                   LDLAGPPKLGAVA"
FT   gene            38980..40437
FT                   /locus_tag="Rpal_0035"
FT   CDS_pept        38980..40437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0035"
FT                   /product="amine oxidase"
FT                   /note="PFAM: amine oxidase; FAD dependent oxidoreductase;
FT                   KEGG: bja:blr0703 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98597"
FT                   /db_xref="GOA:B3Q5W8"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q5W8"
FT                   /protein_id="ACE98597.1"
FT                   /translation="MTISRRSLLEGLLGATAGLALLPVLGGRANAALPREAEVVVVGAG
FT                   AAGIAAARRIVAAGRKVIVVEAASEIGGRCVTDTTSFAAPFDRGARWLHNPDSNPLVRL
FT                   ARSSGFAVTPVAPGQKVRIGRRNARSRETEDFLAAFVRASRAISDASRGKSDISCAAAL
FT                   PNDLGDWAATIEYVLGPATTSKDLRALSAMDAVRTLDRTALLGCPQGVGSLLTQLASSL
FT                   PIALSTPVKRIVWSGRDLAVETAAGRIGARAIIVTASTNVLTSGNLGFSPELPKRQLDA
FT                   AARLSLGSIDRIALQFKGNPLGLSRDETIIERADDIRTATLVGNIGGTSLCTVDVAGSF
FT                   GRQLAAQGEAAMQDFAIEWLGKLFGSDIAGAVERKAVTRWNEMPYVLGAMSAAEPGGQP
FT                   SRKVLGEPLGNLFFAGEATHETLFGTVQGAWESGERAADAALKKIGAVKEPAPEKPLRK
FT                   QKPRREPQRQREQRPPATASGTPSWWR"
FT   sig_peptide     38980..39075
FT                   /locus_tag="Rpal_0035"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.981 at
FT                   residue 32"
FT   gene            complement(40444..42855)
FT                   /locus_tag="Rpal_0036"
FT   CDS_pept        complement(40444..42855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0036"
FT                   /product="phenylalanyl-tRNA synthetase, beta subunit"
FT                   /EC_number="6.1.1.20"
FT                   /note="KEGG: bbt:BBta_0212 phenylalanyl-tRNA synthetase
FT                   subunit beta; TIGRFAM: phenylalanyl-tRNA synthetase, beta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98598"
FT                   /db_xref="GOA:B3Q5W9"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004532"
FT                   /db_xref="InterPro:IPR005121"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="InterPro:IPR005147"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR020825"
FT                   /db_xref="InterPro:IPR033714"
FT                   /db_xref="InterPro:IPR036690"
FT                   /db_xref="InterPro:IPR041616"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q5W9"
FT                   /protein_id="ACE98598.1"
FT                   /translation="MKLTLSWLKDHLDTDEPLEKLADKLTMIGLEVEGIEDKAKVLAPF
FT                   TIAKVLTAAKHPNADKLQVCTVDVGDGAAPVQVVCGAPNARAGLVTVFAPPGTYIPAKD
FT                   FTLGIGNIRGVESRGMLCSAAELQISEDHDGIIELPADAPVGAAYAAWAGLGDPVLDIN
FT                   LTPNRQDCAGVHGIARDLAAADMGKFKDPGIKPIKGEFPCPVSVTVEDSTLCPGFALRL
FT                   VKGVKNGPSPEWLQKRLTAIGLRPINALVDITNYLTFDRSRPLHVFDAAKVKGNLVVRR
FT                   AKDGETLLALDGRTYTLDSSVCVIADDHGVESLAGIMGGELSGCSAETTDVLIESALWN
FT                   EINIAQSGRKLGINTDARYRFERGVDPAFMLPGLELATKLVMEFCGGTPSEAVVVGNPF
FT                   ADDKIIDFPLAEVKRLAGIEVSLTEIRRILNHLGFTVVGQAPVVKVAVPSWRSDVHGKA
FT                   DIVEEIVRIVGVDKVPLTPFERGDAPRKPVLTQIQNRTRRAKRALAARGLTEAVTWSFI
FT                   SKPFAEAFGGGQPELALANPIASDLSDMRPSLLPGLIAAAQANADRGSPDLSLFEVGQV
FT                   FKGDRPQDQFMAASGVRRGVASSAGLGRHWSGSAQATALDAKADAFAVLAAAGAPMAGL
FT                   QIATNKLPAWLHPGRSGAIQIGPQNVLGYFGELHPRVLEQLGADGPLVAFEVILEKIPD
FT                   PKQRPTRAKPALELSAFHPVSRDFAFIVDRKVAVADIVRAAQGVDKKLITSVSVFDVYE
FT                   GKGIDPDKKSVAIAVTLQPRDKTMTDQEIEAVAAKIVAEVTKKTGGSLRG"
FT   gene            complement(43000..43479)
FT                   /locus_tag="Rpal_0037"
FT   CDS_pept        complement(43000..43479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0037"
FT                   /product="protein of unknown function DUF559"
FT                   /note="PFAM: protein of unknown function DUF559; KEGG:
FT                   bbt:BBta_0213 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98599"
FT                   /db_xref="InterPro:IPR007569"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q5X0"
FT                   /protein_id="ACE98599.1"
FT                   /translation="MDDPKQPTWNVSPSQRRHARELRKKSTEAERLMWGELRDKRLNGV
FT                   SFKRQVPIGPYIADFACHAKKLVVELDGGQHFPDDGERSDAARTAAIEARGFRVIRFSN
FT                   HEVMTNRAGVLQSIADVLAARALPPTLSRKRERVRAKRAAKPRSDAGAANDQGDE"
FT   gene            complement(43710..44792)
FT                   /locus_tag="Rpal_0038"
FT   CDS_pept        complement(43710..44792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0038"
FT                   /product="phenylalanyl-tRNA synthetase, alpha subunit"
FT                   /note="TIGRFAM: phenylalanyl-tRNA synthetase, alpha
FT                   subunit; PFAM: phenylalanyl-tRNA synthetase class IIc;
FT                   aminoacyl tRNA synthetase class II domain protein; KEGG:
FT                   bra:BRADO0139 phenylalanyl-tRNA synthetase subunit alpha"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98600"
FT                   /db_xref="GOA:B3Q5X1"
FT                   /db_xref="InterPro:IPR002319"
FT                   /db_xref="InterPro:IPR004188"
FT                   /db_xref="InterPro:IPR004529"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR022911"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3Q5X1"
FT                   /protein_id="ACE98600.1"
FT                   /translation="MSNLENLQSQILADIAAAADEAALEAVRVGALGKKGSISALLATL
FT                   GKMDPEQRKTEGAAINRAKEAVTDALTARRDVLKAAALDAKLAAETIDVTLPMREPAAE
FT                   QGRLHPLSQVWDELTAIFADMGFSIAEGPDIETDDYNFTKLNFPEGHPAREMHDTFYFN
FT                   PKEDGSRLLLRTHTSPVQVRTMLSQRPPIRVICPGRTYRSDSDQTHTPMFHQVEGLVID
FT                   KGSHLGHLKWILHEFCKAFFEVDNVNMRFRPSFFPFTEPSLEVDIQCRRGKDEIRFGEG
FT                   EDWLEILGCGMVHPNVLTACGLDPDEYQGFAWGMGIDRIAMLKYGMSDLRQLFEADVRW
FT                   LNHYGFKPLDIPTLAGGLSS"
FT   gene            complement(44936..45295)
FT                   /locus_tag="Rpal_0039"
FT   CDS_pept        complement(44936..45295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0039"
FT                   /product="ribosomal protein L20"
FT                   /note="TIGRFAM: ribosomal protein L20; KEGG: nha:Nham_0075
FT                   50S ribosomal protein L20"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98601"
FT                   /db_xref="GOA:B3Q5X2"
FT                   /db_xref="InterPro:IPR005813"
FT                   /db_xref="InterPro:IPR035566"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3Q5X2"
FT                   /protein_id="ACE98601.1"
FT                   /translation="MARVKRGVTAHAKHKKVYKLAKGYRGRRKNTIRTAKAAVDKAGQY
FT                   AFRDRKRKKRTFRALWIQRLNAAVRPFGMTYSVFINGLSKSGIVVDRKVLSDLAINEPA
FT                   AFQAIAEKAKAALAA"
FT   gene            complement(45379..45579)
FT                   /locus_tag="Rpal_0040"
FT   CDS_pept        complement(45379..45579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0040"
FT                   /product="ribosomal protein L35"
FT                   /note="PFAM: ribosomal protein L35; KEGG: bbt:BBta_0216 50S
FT                   ribosomal protein L35"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98602"
FT                   /db_xref="GOA:B3Q5X3"
FT                   /db_xref="InterPro:IPR001706"
FT                   /db_xref="InterPro:IPR018265"
FT                   /db_xref="InterPro:IPR021137"
FT                   /db_xref="InterPro:IPR037229"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3Q5X3"
FT                   /protein_id="ACE98602.1"
FT                   /translation="MPKLKTKSGAKKRFKVTATGKVMSAQRGKRHGMIKRTKKQIRQLR
FT                   GTRAIFKTDGDNIKKYFLPNA"
FT   gene            complement(45913..46491)
FT                   /locus_tag="Rpal_0041"
FT   CDS_pept        complement(45913..46491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0041"
FT                   /product="translation initiation factor IF-3"
FT                   /note="TIGRFAM: translation initiation factor IF-3; PFAM:
FT                   initiation factor 3; KEGG: bbt:BBta_0218 translation
FT                   initiation factor IF-3"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98603"
FT                   /db_xref="GOA:B3Q5X4"
FT                   /db_xref="InterPro:IPR001288"
FT                   /db_xref="InterPro:IPR019814"
FT                   /db_xref="InterPro:IPR019815"
FT                   /db_xref="InterPro:IPR036787"
FT                   /db_xref="InterPro:IPR036788"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q5X4"
FT                   /protein_id="ACE98603.1"
FT                   /translation="MFAVNVHKCGEAPIRRPNRAPPPVAKDGPRTNDEIRNFEIQLIDQ
FT                   TGVNQGKVETIVAIKMAMDAGMDLVEISPTSSPPVCKIMDYGKYKYSAQKKAAEARKKQ
FT                   KIVEIKEIKLRPMIDDHDYEVKMKAMQRFFEEGDKVKITLRYRGREMAHQEIGTKLLEK
FT                   VKNDVAEIAKVEQDPRFEGRQVVMVLAPR"
FT   gene            46773..47558
FT                   /locus_tag="Rpal_0042"
FT   CDS_pept        46773..47558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0042"
FT                   /product="conserved hypothetical protein, putative
FT                   alpha/beta hydrolase superfamily"
FT                   /note="KEGG: bra:BRADO0132 conserved hypothetical protein,
FT                   putative alpha/beta hydrolase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98604"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q5X5"
FT                   /protein_id="ACE98604.1"
FT                   /translation="MTKSPEPAPDFVTVGDGAPARRIAVRARPGASPGLFWLGGFNSDM
FT                   TGTKATALDQWAEARGRACVRFDYSGHGESSGSFADGTIGRWLEESLAVFDAYARGPQI
FT                   VVGSSMGGWMALLLARALRRRGGDAAAKLAGLVLIAPAPDFTEALMWKGFSLEIRAEIE
FT                   TKGVWHRPSEYGEPYPITKALIEDGRNHLVLDGMIEVGCPVRILQGKQDEDVPWRHAFE
FT                   LAERLPTDDVVLTMIQDGDHRLSRPQDIARMLAAVEELG"
FT   gene            complement(47716..48828)
FT                   /locus_tag="Rpal_0043"
FT   CDS_pept        complement(47716..48828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0043"
FT                   /product="domain of unknown function DUF1730"
FT                   /note="PFAM: domain of unknown function DUF1730; KEGG:
FT                   bja:bll0714 iron-sulfur cluster binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98605"
FT                   /db_xref="GOA:B3Q5X6"
FT                   /db_xref="InterPro:IPR004453"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR013542"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q5X6"
FT                   /protein_id="ACE98605.1"
FT                   /translation="MKARLAEQARALGFDAFGICAPDSIPEAPARLRAFLDAGYHGEMA
FT                   WLADRPERRSDPRVMWSEVQSVILLGFNYGPDADPRAVLTQKDRGAISVYAQGDDYHDV
FT                   IKARLKQFARWLVATGGGDVKVFIDTAAVMEKPLAQAAGLGWQGRHTNLVSKGRGSWMF
FT                   LGAVFTTLDLPRDAAEGDHCGSCRACLDACPTAAFPAPYQLDARRCISYLTIEHKGPIP
FT                   REFRARLGNRIYGCDDCLAACPWNKFAQAGREAKLAARDALRAPALGELVRLDDPSFRA
FT                   LFTKSPVKRIGRDRFIRNALIAIGNSGDAELAPEAERLLADPSPTIRGAAAWALAQLLP
FT                   PERVATLKAVHLAAEVDDGVRAEWGGFAAE"
FT   gene            complement(48873..49565)
FT                   /locus_tag="Rpal_0044"
FT   CDS_pept        complement(48873..49565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0044"
FT                   /product="Glutathione S-transferase domain"
FT                   /note="PFAM: Glutathione S-transferase domain; KEGG:
FT                   bbt:BBta_0222 putative glutathione S-transferase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98606"
FT                   /db_xref="GOA:B3Q5X7"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q5X7"
FT                   /protein_id="ACE98606.1"
FT                   /translation="MYTLFHHPFCPLSRFIRLALGEHGLDLRLVEERSWERRTAFLALN
FT                   PAGTTPVLVAEGRPPIPGAGVIVEFLDEVHGVEMGDRRLLPQSTAERIEVRRLLSWFND
FT                   KFFEEASGPLMTERIYKRFMSEEDGGGPPAMDVIRAANANVRYHLAYIGWLARTRNFLA
FT                   GDRMTYADLAAAAHLSAIDYLGDVPWIEDEAAKAWYARIKSRPSFRPLLSEWLAGVPAS
FT                   RTYVDLDF"
FT   gene            49765..50571
FT                   /locus_tag="Rpal_0045"
FT   CDS_pept        49765..50571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0045"
FT                   /product="undecaprenol kinase"
FT                   /EC_number="3.6.1.27"
FT                   /note="KEGG: bja:blr0716 undecaprenyl pyrophosphate
FT                   phosphatase; TIGRFAM: undecaprenol kinase; PFAM: Bacitracin
FT                   resistance protein BacA"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98607"
FT                   /db_xref="GOA:B3Q5X8"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3Q5X8"
FT                   /protein_id="ACE98607.1"
FT                   /translation="MLIDIIRAVILGIVEGVTEFLPVSSTGHLLLAERFFNLGEGNFWK
FT                   SFAVLIQLGAILAILALYFVKLWRIALGMFTDANARRFVIGVLVAFLPAAVIGAAFGGY
FT                   IKHYLFNPWVVCFSLIVGGAILLWVDQLDLKPRYHDATAFPLLTYFYIGCAQCTAMIPG
FT                   VSRSGASIVAAMLLGTDKRSAAEFSFFLAIPTMLGAFVYDLYKNHADMTADNLIIVAIG
FT                   FVVSFITAIIVVKTFLTYVTRHGFELFAWWRVIVGTLGLIALALGL"
FT   gene            complement(50621..51586)
FT                   /locus_tag="Rpal_0046"
FT   CDS_pept        complement(50621..51586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0046"
FT                   /product="NADH dehydrogenase (ubiquinone)"
FT                   /EC_number="7.1.1.2"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase;
FT                   dTDP-4-dehydrorhamnose reductase; NmrA family protein; Male
FT                   sterility domain; KEGG: bra:BRADO0128 conserved
FT                   hypothetical protein; putative NAD dependent
FT                   epimerase/dehydratase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98608"
FT                   /db_xref="GOA:B3Q5X9"
FT                   /db_xref="InterPro:IPR029903"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q5X9"
FT                   /protein_id="ACE98608.1"
FT                   /translation="MTSNIDTLVTVFGGSGFLGRHVVSALARRDYRIRVAVRRPELAGH
FT                   LQPLGRVGQIHAVQANLRYPESVAAAMRGSHVAINLVGILAEGGAQKFDAVQGSGAATV
FT                   AQAAASVGARMVHISAIGADANSPARYARSKAAGEQAVLAAVPQATIFRPSVVFGPEDQ
FT                   FTNRFAMLARMSPVLPLVGADTKLQPVYVGDVATAIADAVDDLAKPGATYELGGPEELT
FT                   MREIMRIILQTTDRNPLLVPLPFGLASLQAMLLQFAPGAFKLTPDQVRMLEVDNVVSEA
FT                   AKSAGLTLQGLGIQPDSLQAIVPSYLWRFRKTGQFARKTA"
FT   gene            51747..51831
FT                   /locus_tag="Rpal_R0001"
FT                   /note="tRNA-Leu1"
FT   tRNA            51747..51831
FT                   /locus_tag="Rpal_R0001"
FT                   /product="tRNA-Leu"
FT   gene            52000..52614
FT                   /locus_tag="Rpal_0047"
FT   CDS_pept        52000..52614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0047"
FT                   /product="3'-5' exonuclease"
FT                   /note="PFAM: 3'-5' exonuclease; KEGG: bja:blr0719
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98609"
FT                   /db_xref="GOA:B3Q5Y0"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q5Y0"
FT                   /protein_id="ACE98609.1"
FT                   /translation="MTIRLHRGDLPDLSRYTNSVAIDTETMGLHPHRDRLCVVQLSNGD
FT                   GSADVVQIPQGATDAPNLKKLLGDPAVVKIFHFARFDLAALYKAFGVMPQPVYCTKIAS
FT                   RLTRTYTDRHGLKDLVRELLGIDLSKQQQSSDWGADSLSDAQLAYAASDVLHLHALRDK
FT                   LDTMLARENRTDLAAACFGFLPIRARLDLDGWSEEDIFAHS"
FT   gene            52844..53584
FT                   /locus_tag="Rpal_0048"
FT   CDS_pept        52844..53584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0048"
FT                   /product="protein of unknown function DUF1239"
FT                   /note="PFAM: protein of unknown function DUF1239; KEGG:
FT                   bja:blr0720 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98610"
FT                   /db_xref="GOA:B3Q5Y1"
FT                   /db_xref="InterPro:IPR010664"
FT                   /db_xref="InterPro:IPR026265"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q5Y1"
FT                   /protein_id="ACE98610.1"
FT                   /translation="MTAVQLSSYQTGMEARFAAAARHSRLVRTLRLAVPLVVVLSMAVI
FT                   IAISIFNPFRYLSKLPIDVGDLVVSGTKITMESPHLAGFTNDGRPYEMWARTATQDLTS
FT                   QDHVDLHTLRAKVQSEDQSTVIIESREGQFETKAQLLKLNKDVYLHNSTGTEAWMTQAD
FT                   IDMGKGTVTSDSPVDVKWDGGTLRGQRMRITEKGDLIRFEGGVVMNIDNASLGEPPPAA
FT                   QPAPPPAPTKPRAAPNSGQRAVAR"
FT   gene            53593..54258
FT                   /locus_tag="Rpal_0049"
FT   CDS_pept        53593..54258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0049"
FT                   /product="OstA family protein"
FT                   /note="PFAM: OstA family protein; KEGG: nha:Nham_0177
FT                   OstA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98611"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q5Y2"
FT                   /protein_id="ACE98611.1"
FT                   /translation="MPIAVWFRRLRGPVALASAALVALYVGGTVPATAQSAVQGVPNAM
FT                   QGFSQNRDKPIQIESDTLEVRDKNKEATFTGNVKVVQGDTTMTSQTLVVFYDQDQAPAK
FT                   GAKGKPMPAAAPGPDGASSIRRLEAKGHVVVTQKDQVVTGDKAVFETKTNLVTMTGNVV
FT                   LTQARNVVRGDRLLVDMTTGVSRVESDSGRVQGLFQSSGANGGGPLPLGPPTSSGKPK"
FT   sig_peptide     53593..53697
FT                   /locus_tag="Rpal_0049"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.877 at
FT                   residue 35"
FT   gene            54394..55344
FT                   /locus_tag="Rpal_0050"
FT   CDS_pept        54394..55344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0050"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: nwi:Nwi_0174 ABC transporter, ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98612"
FT                   /db_xref="GOA:B3Q5Y3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030921"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q5Y3"
FT                   /protein_id="ACE98612.1"
FT                   /translation="MFRRRGPKAPGFGGARNDITGYGNEVGDLLTTPVRDAPPIARSDA
FT                   YATPQRQPAAAAPPRRAAAAAQSAAPQAVPASSYLAVHSVEKSFGTRKIVRGVSIYVRR
FT                   GEAVGLLGPNGAGKTTVFYMITGLIKADNGAIELDGHDVTKLPMYQRARLGIGYLPQEA
FT                   SIFRGLTVEQNIRAVLEAVEPDKRKREAQLDNLLQEFNIERLRKSPSIALSGGERRRVE
FT                   IARALASRPNYMLLDEPFAGIDPIAVGDIQDLVRHLTNRGIGVLITDHNVRETLGLTDR
FT                   AYIVYAGEILTEGTPEEIVNDPDVRRLYLGEEFRL"
FT   gene            55375..55515
FT                   /locus_tag="Rpal_0051"
FT   CDS_pept        55375..55515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0051"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98613"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q5Y4"
FT                   /protein_id="ACE98613.1"
FT                   /translation="MITVAGLVVRRDQHYRDTAKTSRPKGVRLYSKFPIRQGVYNRSGK
FT                   A"
FT   gene            55551..57197
FT                   /locus_tag="Rpal_0052"
FT   CDS_pept        55551..57197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0052"
FT                   /product="RNA polymerase, sigma 54 subunit, RpoN"
FT                   /note="TIGRFAM: RNA polymerase sigma-54 factor, RpoN; PFAM:
FT                   sigma-54 factor; sigma-54 factor core-binding region;
FT                   sigma-54 DNA-binding domain protein; KEGG: bbt:BBta_0121
FT                   RNA polymerase factor sigma-54"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98614"
FT                   /db_xref="GOA:B3Q5Y5"
FT                   /db_xref="InterPro:IPR000394"
FT                   /db_xref="InterPro:IPR007046"
FT                   /db_xref="InterPro:IPR007634"
FT                   /db_xref="InterPro:IPR038709"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q5Y5"
FT                   /protein_id="ACE98614.1"
FT                   /translation="MALSQRLEFRQTQSLVMTPQLMQAIKLLQLSNLDLAAFVEDEIEK
FT                   NPLLDRAGDNAEPPVAGEASAEGAEGGGEFGGSGGEDLGGEGTSDFVDPAGASAFEPGT
FT                   EEWMHRDLGSRSDIEQTLDTGMENVFPEEPAEAAARAAQDAAPASYTEWGGGASSDEGY
FT                   NLEAFVAAESSLADHLAEQLAVAVTTPSQRLIGQYLIDLVDDAGYLPADLGDAAERLGA
FT                   SQAEVEALVQVLQTFDPPGICARNLSECLAIQLRERDRYDPAMQALVEHLDLLAKRDVA
FT                   SLRKICGVDDEDLVDMIGEIRHLDPKPGLKFGSSRVQTVVPDVFVRPGPDGGWLVELNS
FT                   DTLPKVLVNQSYYSELSKTIRKDGDKSYFSDCLQNATWLVRALDQRARTILKVATEIVR
FT                   QQDGFFTHGVKHLRPLNLKAVADAIQMHESTVSRVTANKYMATNRGTFELKYFFTASIA
FT                   SADGGEAHSAEAVRHQIRQLIDSEDPSAILSDDTIVERLREAGIDIARRTVAKYREAMR
FT                   IPSSVQRRRDKQNMLGTQAGSASRSRDTAPA"
FT   gene            57255..57860
FT                   /locus_tag="Rpal_0053"
FT   CDS_pept        57255..57860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0053"
FT                   /product="sigma 54 modulation protein/ribosomal protein
FT                   S30EA"
FT                   /note="TIGRFAM: ribosomal subunit interface protein; PFAM:
FT                   sigma 54 modulation protein/ribosomal protein S30EA; KEGG:
FT                   bbt:BBta_0120 putative sigma (54) modulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98615"
FT                   /db_xref="GOA:B3Q5Y6"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR032528"
FT                   /db_xref="InterPro:IPR034694"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="InterPro:IPR038416"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q5Y6"
FT                   /protein_id="ACE98615.1"
FT                   /translation="MTIRISGKSISIGEALRSRVSERTEEVLRKYFDGNYSGHFTLSKD
FT                   GFGFRTDCALHLDSGITLEAESNAADAYVSADQALVQIEKRLRRYKSRLKDRSSRKAHA
FT                   EANVLAELSTPVDAASYVIEAPGDEEHHEDAYNPVIIAEATTAMKRLSVSEAVVELDLT
FT                   GAPVVVFLHGSSGRVNIIYRRADGNIGWIDPPVLNGAN"
FT   gene            58136..58597
FT                   /locus_tag="Rpal_0054"
FT   CDS_pept        58136..58597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0054"
FT                   /product="PTS IIA-like nitrogen-regulatory protein PtsN"
FT                   /note="TIGRFAM: PTS IIA-like nitrogen-regulatory protein
FT                   PtsN; PFAM: phosphoenolpyruvate-dependent sugar
FT                   phosphotransferase system EIIA 2; KEGG: bra:BRADO0111
FT                   nitrogen regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98616"
FT                   /db_xref="GOA:B3Q5Y7"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR006320"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q5Y7"
FT                   /protein_id="ACE98616.1"
FT                   /translation="MTITDLVAPEAVIPALKVISKKQALQELAARAAELTGQNERTIFE
FT                   VLLQREKLGTTAVGYGVAIPHGKLPKLEKLFGLFARLERPIDFEAMDGQPVDLIFLLLA
FT                   PEGAGADHLKALARIARLLRDQDVAKKLRASRDAHAIYSVLALPPATAA"
FT   gene            complement(59203..59469)
FT                   /locus_tag="Rpal_0055"
FT   CDS_pept        complement(59203..59469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0055"
FT                   /product="protein of unknown function DUF1150"
FT                   /note="PFAM: protein of unknown function DUF1150; KEGG:
FT                   bbt:BBta_0116 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98617"
FT                   /db_xref="InterPro:IPR009531"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q5Y8"
FT                   /protein_id="ACE98617.1"
FT                   /translation="MTEAGTTHGNVGVTPEALAHLGEGHIAYVKQIRSEDVPGLFPQAP
FT                   EIAPGLKLFALHSADGTPIMLTDSREAAIANAWSQELQAVSVH"
FT   gene            complement(59520..59945)
FT                   /locus_tag="Rpal_0056"
FT   CDS_pept        complement(59520..59945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0056"
FT                   /product="heat shock protein Hsp20"
FT                   /note="PFAM: heat shock protein Hsp20; KEGG: bja:bll0729
FT                   small heat shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98618"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR037913"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q5Y9"
FT                   /protein_id="ACE98618.1"
FT                   /translation="MSRVPSLSSPFLLGFDEIERALDRVVKGADGYPPYNIERCERSNG
FT                   DPEKLRITLAVAGFTRDQLDVTVEENQLVIRGRQQDDKTRQYIHRGIAARHFQRTFVLA
FT                   DGMQVLGADLKNGLLSIDLIRPEPERVIKTIAITEHE"
FT   gene            complement(60099..61190)
FT                   /locus_tag="Rpal_0057"
FT   CDS_pept        complement(60099..61190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0057"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; Transport-associated
FT                   OB domain protein; SMART: AAA ATPase; KEGG: bja:bll0730
FT                   glycerol-3-phosphate ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98619"
FT                   /db_xref="GOA:B3Q5Z0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017922"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q5Z0"
FT                   /protein_id="ACE98619.1"
FT                   /translation="MADVVLRNVRKTYPGGFEAIKGVDFAVGDGQFCVLVGPSGCGKST
FT                   LLRMVAGLETITAGEIEIGGRVVNDVEPADRDIAMVFQNYALYPHMTVYNNMAYGLRNR
FT                   GMAKAEIDARVQEAARILELGPMLTRKPRQLSGGQRQRVAMGRAIVRHPKVFLFDEPLS
FT                   NLDAKLRVAMRVEIRKLQRRLATTAIYVTHDQLEAMTLADVLVVMNGGQVEQIGSPLDV
FT                   YAKPATTFVASFIGAPPMNLLTLADDLRNELGGTPAEAGILGVRPEDLVIGPGAAAQGG
FT                   LALDITVEAIERVGPETFVYGVRAGHEARPVVAGKPGEGAGGDVIVRIPGQAAPPVGER
FT                   ITVAAAPHSLHLFSADGRRRIAG"
FT   gene            complement(61193..62041)
FT                   /locus_tag="Rpal_0058"
FT   CDS_pept        complement(61193..62041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0058"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bja:bll0731
FT                   glycerol-3-phosphate ABC transporter membrane spanning
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98620"
FT                   /db_xref="GOA:B3Q5Z1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR030165"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q5Z1"
FT                   /protein_id="ACE98620.1"
FT                   /translation="MVERRKFGNLVPHLILWIGVAIVAFPVYLAFVASTQDNATIANGQ
FT                   MSLLPGSHFLETYYKTIFVGSSGTTREPVASMLFNSFVMAMSIALGKIAISIISAYAIV
FT                   YFRFPFRMTIFWIIFITLMLPVEVRIYPTYKIAADLNLLDSYAGLALPLIASATATLLF
FT                   RQFFMTVPDELLEASRIDGAGPLRFFWDTLLPLSRTNMAALFVILFILGWNQYLWPLLI
FT                   TTRDDMQTIQIGIRKMIVTSDALTEWPIVMATAVLAMLPPVAVVVLMQKLFVRGLVETE
FT                   K"
FT   gene            complement(62041..62922)
FT                   /locus_tag="Rpal_0059"
FT   CDS_pept        complement(62041..62922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0059"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bja:bll0732
FT                   glycerol-3-phosphate ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98621"
FT                   /db_xref="GOA:B3Q5Z2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q5Z2"
FT                   /protein_id="ACE98621.1"
FT                   /translation="MLKHAVFQSKFLPYLLVLPQLVVVLVFFYWPAVQAVIQSFLLQDA
FT                   FGLSTVFVWFDNYRELLEQPDYFDAIIRTFVFSFAIALSSLSLALLLAVMADRPLRGST
FT                   FYRTMLIWPYAVAPPVVGVLWVFMLNPSLGVIAHGLRALGVDWNPLLDGDQAALLIVLA
FT                   AAWKQISYNFLFFLAGLQAIPSSVIEAAAIDGARPMRRFWTIIFPLLSPTIFFLMIVNV
FT                   VYAFFDTFGIIDTMTRGGPAKATETLVYKVYQDGLLGSNLGSSAAQSVILMAIVIALTA
FT                   IQFRFVERKVNY"
FT   gene            complement(63087..64415)
FT                   /locus_tag="Rpal_0060"
FT   CDS_pept        complement(63087..64415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0060"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: bja:bll0733 ABC transporter
FT                   glycerol-3-phosphate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98622"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q5Z3"
FT                   /protein_id="ACE98622.1"
FT                   /translation="MAFRSFGLTAAAATAIAATLAMAAPAYAVTEIQWWHAMTGGNNDV
FT                   IVKLANEFNAAQGDYKVVPTYKGGYADTMNAGIAAFRAGNAPHILQVFEVGTATMMAAT
FT                   GAVKPVYKLMQETGEPFDPKAYLPAITGYYSTSKGEMLSFPFNSSSMVMWVNLDALKKA
FT                   DIAEIPKTWPEVFEDAKKLKAAGYATCGFSTAWVTWANLEQLSAWHNVPLASKANGLDG
FT                   FDTKLEFNGPVQVKHLQKLIELQKDKTYDYSGRTNTGEGRFTSGECPLFLTSSGFFGNV
FT                   KSQAKFNWTNAPMPYYPDVKGAPQNSIIGGASLWVMGGKNAAEYKGVAKFLAFLSDTDR
FT                   QVAIHKASGYLPITKAAYEKAKADGFYKEQPYLETPIKELTNKPPTENSRGLRLGNMVQ
FT                   LRDVWAEEIEQALAGKKTAQEALDAAVTRGNTMLRQFEKTAVK"
FT   sig_peptide     complement(64329..64415)
FT                   /locus_tag="Rpal_0060"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.669 at
FT                   residue 29"
FT   gene            complement(64647..65852)
FT                   /locus_tag="Rpal_0061"
FT   CDS_pept        complement(64647..65852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0061"
FT                   /product="L-carnitine dehydratase/bile acid-inducible
FT                   protein F"
FT                   /note="PFAM: L-carnitine dehydratase/bile acid-inducible
FT                   protein F; KEGG: bja:bll0734 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98623"
FT                   /db_xref="GOA:B3Q5Z4"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q5Z4"
FT                   /protein_id="ACE98623.1"
FT                   /translation="MTSASMPGAIAGLRVIDLTRVLGGPYCTQILADHGANVIKVEPPA
FT                   GDEVRDWGPPFHDEDAAYFLGVNRNKRSIGLDLASPGGREVLLKMLEDADVLIENFKPG
FT                   TLDKWGLSNEVIREKFPRLVHCRISGFGADGPRGGNPGYDAIIQAMTGMIAATGSPETG
FT                   PVRIGVPLVDITTGLYATIGILMALAERERSGKGQFVETTLYETGLAIMHPHTANYFLH
FT                   GKPPALTGNEHPNLVPYSTFNARDGQIFTGVGNDGTFRKLCKEIGKPELGTDPRFARNK
FT                   DRIANRAALRAELEAVFSQHDAVPLCDRLLNAGLPAGPVQTIDKALTSPHTAYRGDVIE
FT                   KDWYKGVASPIRFERTKASLRGLPPKFSQHASEVLGEFGYSADDISKLVADGIVSGPER
FT                   KR"
FT   gene            complement(65898..66134)
FT                   /locus_tag="Rpal_0062"
FT   CDS_pept        complement(65898..66134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0062"
FT                   /product="Excinuclease ABC C subunit domain protein"
FT                   /note="PFAM: Excinuclease ABC C subunit domain protein;
FT                   KEGG: rle:RL0110 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98624"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q5Z5"
FT                   /protein_id="ACE98624.1"
FT                   /translation="MKYVYILQSEIDEHFYVGITDNLPARIGKHNAGEVPHTSKFRPWK
FT                   LKTYVAFSNTRQAVAFEKYLKSASGRAFAKKRL"
FT   gene            complement(66535..66610)
FT                   /locus_tag="Rpal_R0002"
FT                   /note="tRNA-Ala4"
FT   tRNA            complement(66535..66610)
FT                   /locus_tag="Rpal_R0002"
FT                   /product="tRNA-Ala"
FT   gene            complement(66681..67082)
FT                   /locus_tag="Rpal_0063"
FT   CDS_pept        complement(66681..67082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0063"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   bja:bll0737 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98625"
FT                   /db_xref="InterPro:IPR012644"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q5Z6"
FT                   /protein_id="ACE98625.1"
FT                   /translation="MAKSDLGTKRICPTTGKKFYDLNKNPVISPYTGEVVPIAPVTAPR
FT                   TRADQRSPVVDTEAPEAMEAEELVSLEEADAEENTGKVKAVVPESEDDIEIDEAIDDDD
FT                   DDSTFIADEEEEDEDVTDIIGDVSGDEET"
FT   gene            67223..68560
FT                   /locus_tag="Rpal_0064"
FT   CDS_pept        67223..68560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0064"
FT                   /product="3-phosphoshikimate 1-carboxyvinyltransferase"
FT                   /note="TIGRFAM: 3-phosphoshikimate
FT                   1-carboxyvinyltransferase; PFAM: EPSP synthase
FT                   (3-phosphoshikimate 1-carboxyvinyltransferase); KEGG:
FT                   bra:BRADO0098 3-phosphoshikimate 1-carboxyvinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98626"
FT                   /db_xref="GOA:B3Q5Z7"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR006264"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR023193"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3Q5Z7"
FT                   /protein_id="ACE98626.1"
FT                   /translation="MTDSNQPTPLQARKSGALHGTARVPGDKSISHRALILGALAVGET
FT                   RISGLLEGEDVINTAKAMRALGAKVERTGDCEWRVHGVGVAGFATPEAPLDFGNSGTGC
FT                   RLAMGAVAGSPIVATFDGDASLRSRPMRRIVDPLELMGAKVVSSSEGGRLPLALQGARD
FT                   PLPILYRTPVPSAQIKSAVLLAGLSAPGVTTVIEAEASRDHTELMLQHFGATIVTEAEG
FT                   AHGRKISLTGQPELRGAPVVVPADPSSAAFPMVAALVVPGSDIELTDVMTNPLRTGLIT
FT                   TLREMGALIEDSDVRGDAGEPMARFRVRGSKLKGVEVPPERAPSMIDEYLVLAVAAAFA
FT                   EGTTVMRGLHELRVKESDRLEATAAMLRVNGVAVEIAGDDLIVEGKGHVPGGGVVATHM
FT                   DHRIAMSALAMGLASDKPVTVDDTAFIATSFPDFVPMMQRLGAEFG"
FT   gene            complement(68564..69238)
FT                   /locus_tag="Rpal_0065"
FT   CDS_pept        complement(68564..69238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0065"
FT                   /product="protein of unknown function DUF374"
FT                   /note="PFAM: protein of unknown function DUF374; KEGG:
FT                   mag:amb4091 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98627"
FT                   /db_xref="InterPro:IPR007172"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q5Z8"
FT                   /protein_id="ACE98627.1"
FT                   /translation="MATPAFVKRITRSDAVLSLGVNFSKIYFKFVMWTGRYDRQAVPIP
FT                   EPYILAMWHGRLIMAPMLQTKSKPLVALISGHRDGKIISRVGAAFGIQTAVGSSSKGGM
FT                   RAAREMMRLGKSGHSLFVTPDGPRGPRMRINSEGVLDLARLTGLPILPVSVSLSRHKLL
FT                   RSWDRLMLPGLFAKVAIRFGEPITVEAGSPTAEMAERLQAALTAAQNETDRIVGLQPVE
FT                   VA"
FT   gene            69403..70041
FT                   /locus_tag="Rpal_0066"
FT   CDS_pept        69403..70041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0066"
FT                   /product="cytidylate kinase"
FT                   /EC_number="2.7.4.14"
FT                   /note="KEGG: bbt:BBta_0104 cytidylate kinase; TIGRFAM:
FT                   cytidylate kinase; PFAM: cytidylate kinase region"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98628"
FT                   /db_xref="GOA:B3Q5Z9"
FT                   /db_xref="InterPro:IPR003136"
FT                   /db_xref="InterPro:IPR011994"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3Q5Z9"
FT                   /protein_id="ACE98628.1"
FT                   /translation="MIIAIDGPAASGKGTLAKRLAAHYGFRHLDTGVIYRAVAKAMLDA
FT                   GADLTDEARAAEVARTLDPSRFDDPALKSHAVGEAASVVSAHPQVRAALVEFQKTFAAA
FT                   PPGAVLDGRDIGTVICPDAEVKIFVVASPEVRAHRRFLEAQSRGEPADEAVILSDIVKR
FT                   DERDKNRSAAPLKQAPDAVLLDNSYLDIEGGVRAAIDIVEAVRAGRRRV"
FT   gene            70342..72039
FT                   /locus_tag="Rpal_0067"
FT   CDS_pept        70342..72039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0067"
FT                   /product="ribosomal protein S1"
FT                   /note="TIGRFAM: ribosomal protein S1; PFAM: RNA binding S1
FT                   domain protein; KEGG: nha:Nham_0163 30S ribosomal protein
FT                   S1"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98629"
FT                   /db_xref="GOA:B3Q600"
FT                   /db_xref="InterPro:IPR000110"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q600"
FT                   /protein_id="ACE98629.1"
FT                   /translation="MASTDTYNPTRDDFAAMLDESFAGGNLQESSVIKGKVVAIEKDMA
FT                   VIDVGLKTEGRVPLREFAGPGRDNEIKVGDTVEVFLDRIENALGEAVLSRDKARREESW
FT                   GKLEKAFQNNEKVFGVIFNQVKGGFTVDLDGAVAFLPRSQVDIRPIRDVAPLMNNSQPF
FT                   QILKMDRRRGNIVVSRRTVLEETRAEQRQELVQNLEEGQVIDGVVKNITDYGAFVDLGG
FT                   IDGLLHVTDIAWRRVNHPTEVLTIGQTVKVKIIKINHETHRISLGMKQLLDDPWQGIEA
FT                   KYPLNARFTGRVTNITDYGAFVELEPGIEGLIHVSEMSWTKKNMHPGKIVSTSQEVEVQ
FT                   VLEVDSVKRRISLGLKQTMRNPWEVFVEKHPVGSTVEGEVKNKTEFGLFLGLDGDVDGM
FT                   VHLSDLDWKLPGEQVIDNFKKGDMVKAVVLDVDVEKERISLGVKQLEGDPFAEPGDVKK
FT                   GAVVTCEVLDVKESGIDVQIVGTDFNTFIKRSELARDRNDQRSDRFAVGEKVDARVIQF
FT                   DKKARKVQVSIKALEVAEEKEAIAQYGSSDSGATLGDILGTALKQRDK"
FT   gene            72268..73248
FT                   /locus_tag="Rpal_0068"
FT   CDS_pept        72268..73248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0068"
FT                   /product="signal peptide peptidase SppA, 36K type"
FT                   /note="TIGRFAM: signal peptide peptidase SppA, 36K type;
FT                   PFAM: peptidase S49; KEGG: bra:BRADO0095 putative peptidase
FT                   S49 family; putative signal peptide peptidase SppA"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98630"
FT                   /db_xref="GOA:B3Q601"
FT                   /db_xref="InterPro:IPR002142"
FT                   /db_xref="InterPro:IPR004635"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q601"
FT                   /protein_id="ACE98630.1"
FT                   /translation="MSLDSDVIVDRRRMRRKLTFWRVAAVLVAIVAVVAIGAMVSPAGR
FT                   GALTSTGSIARIKIEGLIRSNDERVQALDRLGKSSYSAVIVHINSPGGTTAGSEELHDA
FT                   LARLKAKKPMVVVVEGLAASGGYIAALASEHIVAQQTSLVGSIGVLFQYPNVSELLKTV
FT                   GVKVEEVKSSPLKAAPNGFEPTSPEARAAIEALVKDSYAWFRGMVQQSRKMTDDQLNVV
FT                   ADGRVFTGRQAVGLKLIDELGDERTAIAWLEKAKNVKAGLPVRDYKLAPQFGDLTFLRA
FT                   AASVAFDAAGLGVIARRVEQTGAMQSVERLGLDGMLALWAPSAGQ"
FT   sig_peptide     72268..72390
FT                   /locus_tag="Rpal_0068"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.855) with cleavage site probability 0.337 at
FT                   residue 41"
FT   gene            73414..73728
FT                   /locus_tag="Rpal_0069"
FT   CDS_pept        73414..73728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0069"
FT                   /product="integration host factor, beta subunit"
FT                   /note="TIGRFAM: integration host factor, beta subunit;
FT                   PFAM: histone family protein DNA-binding protein; KEGG:
FT                   bra:BRADO0094 integration host factor subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98631"
FT                   /db_xref="GOA:B3Q602"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR005685"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3Q602"
FT                   /protein_id="ACE98631.1"
FT                   /translation="MIKSELVQRIAEHNPHLYQRDVENIVNAILDEIVDALARGDRVEL
FT                   RGFGAFSVKHRPARAGRNPRTGAHVPVDQKTVPFFKTGKEMRERLNRDSGDDAPTSDTA
FT                   "
FT   gene            73766..74152
FT                   /locus_tag="Rpal_0070"
FT   CDS_pept        73766..74152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0070"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bja:blr0743 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98632"
FT                   /db_xref="GOA:B3Q603"
FT                   /db_xref="InterPro:IPR010445"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q603"
FT                   /protein_id="ACE98632.1"
FT                   /translation="MQKFLTALVLIPLGLILVVFAVANRHMVDVSFDPLDPTNPLGHIR
FT                   LPLFVVIIVTAIIGVILGGIATWFGQRRWRRAARRHQAEAIEAQNQLASLRASIATPAQ
FT                   SEPRRLLLESGSSGAGRDKSRATL"
FT   sig_peptide     73766..73831
FT                   /locus_tag="Rpal_0070"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.956 at
FT                   residue 22"
FT   gene            74211..74852
FT                   /locus_tag="Rpal_0071"
FT   CDS_pept        74211..74852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0071"
FT                   /product="Phosphoribosylanthranilate isomerase"
FT                   /EC_number="5.3.1.24"
FT                   /note="PFAM: N-(5'phosphoribosyl)anthranilate isomerase
FT                   (PRAI); KEGG: bja:blr0744 N-(5'-phosphoribosyl)anthranilate
FT                   isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98633"
FT                   /db_xref="GOA:B3Q604"
FT                   /db_xref="InterPro:IPR001240"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3Q604"
FT                   /protein_id="ACE98633.1"
FT                   /translation="MSTIVKICGLTTADTLEAAVETGADMVGFVFFPASPRHLDIDFAD
FT                   ALGRQVRSRAAKVALTVDADDDLLDAIVEQLRPNWLQFHGSESPERVRSIKRIYGLPVM
FT                   KAIAVAGPEDLSVLPDYAAVADRILFDARPPKDATRPGGLGAAFDWKLLDGVNLKLPFL
FT                   VSGGINAGNVAEALRVTRAQGVDVSSGVETSPGEKDPDLIRDFIRAARAA"
FT   gene            74866..76080
FT                   /locus_tag="Rpal_0072"
FT   CDS_pept        74866..76080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0072"
FT                   /product="tryptophan synthase, beta subunit"
FT                   /EC_number="4.2.1.20"
FT                   /note="KEGG: bja:blr0745 tryptophan synthase subunit beta;
FT                   TIGRFAM: tryptophan synthase, beta subunit; PFAM:
FT                   Pyridoxal-5'-phosphate-dependent protein beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98634"
FT                   /db_xref="GOA:B3Q605"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR006653"
FT                   /db_xref="InterPro:IPR006654"
FT                   /db_xref="InterPro:IPR023026"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3Q605"
FT                   /protein_id="ACE98634.1"
FT                   /translation="MNQALPNSFRSGPDERGHFGIYGGRFVAETLMPLILDLEKAYAEA
FT                   KADPAFRAEMDNHLKHYVGRPSALYFAERLTEHFGGAKIYFKREDLNHTGAHKVNNVLG
FT                   QIMLAKRMGKPRVIAETGAGMHGVATATMCAKFGLECVVFMGAVDVERQQPNVLRMKAL
FT                   GAEVRPVTSGANTLKDAMNEALRDWVTNVHDTFYCIGTVAGPHPYPMMVRDFQAVIGQE
FT                   VREQIMQAEGRLPDSLVACIGGGSNAMGLFHPFLDDPGVAIYGVEAAGHGLDKLHAASI
FT                   AGGKPGVLHGNRTYLLMDADGQIEEAHSISAGLDYPGVGPEHSWLHDVGRVNFLSATDT
FT                   EALDAFKLCCRLEGIIPALEPSHALAKVADLAPKLPKDHLMVVNMSGRGDKDLASVAEH
FT                   LGGKF"
FT   gene            76080..76916
FT                   /locus_tag="Rpal_0073"
FT   CDS_pept        76080..76916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0073"
FT                   /product="tryptophan synthase, alpha subunit"
FT                   /EC_number="4.2.1.20"
FT                   /note="KEGG: bbt:BBta_0096 tryptophan synthase subunit
FT                   alpha; TIGRFAM: tryptophan synthase, alpha subunit; PFAM:
FT                   tryptophan synthase alpha chain"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98635"
FT                   /db_xref="GOA:B3Q606"
FT                   /db_xref="InterPro:IPR002028"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018204"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3Q606"
FT                   /protein_id="ACE98635.1"
FT                   /translation="MTTRIDTRFADLKQQGRPALVTFVMAGDPDLDTSLQILKALPAAG
FT                   ADVIEIGMPFTDPMADGPAIQAAGLRALKAGTTLKKTLGLVRDFRATDNATPLVLMGYY
FT                   NPIYIYGVDAFLADAKAAGVDGLIIVDLPPEEDEELCLPAMKAGLNFIRLATPTTDEKR
FT                   LPAVLANTSGFVYYVSITGITGSASADASAVGAAVQRIKRHTNLPVCVGFGIRTPDAAQ
FT                   AIAAQANGAVVGSALIDALKASLDAEGRATKGTVGAVADLVASLAAGVRGAKQAAE"
FT   gene            77026..78009
FT                   /locus_tag="Rpal_0074"
FT   CDS_pept        77026..78009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0074"
FT                   /product="acetyl-CoA carboxylase, carboxyl transferase,
FT                   beta subunit"
FT                   /note="TIGRFAM: acetyl-CoA carboxylase, carboxyl
FT                   transferase, beta subunit; KEGG: nha:Nham_0061 acetyl-CoA
FT                   carboxylase subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98636"
FT                   /db_xref="GOA:B3Q607"
FT                   /db_xref="InterPro:IPR000438"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3Q607"
FT                   /protein_id="ACE98636.1"
FT                   /translation="MNWLTNVVRPKIRNILRRETPENLWIKCPDTGQLVFYKDVEQNQF
FT                   VIPGSNYHMRMGAVARLRAIFDNETWYDVALPEVVADPLKFRDERKYADRIKDARTKTG
FT                   AHDAVRVGFGKLETSPVVVAVQDFDFMGGSLGMAAGEAIIRGMELAVEKHAPFIMFAAS
FT                   GGARMQEGILSLMQMPRTTVAVQMLREAKLPYIVVLTNPTTGGVTASYAMLGDIHIAEP
FT                   GALIGFAGARVIEQTIREKLPDGFQRAEYLKEHGMVDMVVHRHDLRPTLARLCRLLTKS
FT                   PALTVTTAVEAPAEAAAKAEPEATTTEQPVAPAPTEPPAQPAAPQA"
FT   gene            78006..79334
FT                   /locus_tag="Rpal_0075"
FT   CDS_pept        78006..79334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0075"
FT                   /product="FolC bifunctional protein"
FT                   /EC_number="6.3.2.17"
FT                   /note="KEGG: nha:Nham_0060 FolC bifunctional protein;
FT                   TIGRFAM: FolC bifunctional protein; PFAM: cytoplasmic
FT                   peptidoglycan synthetase domain protein; Mur ligase middle
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98637"
FT                   /db_xref="GOA:B3Q608"
FT                   /db_xref="InterPro:IPR001645"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q608"
FT                   /protein_id="ACE98637.1"
FT                   /translation="MSEGSAPPAPLGELRSRLTRLHPVAIDLTLGRIERLLAVLGHPER
FT                   KLPPVIHVAGTNGKGSTVAFLRAILEATGLKVHAYTSPHLVRVNETIRIAGRLVGDDEL
FT                   LAALAHCERVNAGAPITLFEIETAAALWLFAQHPADVTLLEVGLGGRLDATNVIEHPLA
FT                   CVLTPIGIDHTEFLGPTIADIAAEKAGILRRGAPVIVAEQRDEAMEVIERDAKRLRAPL
FT                   FACGQQWHVQLEHGRLAYQDERGLLDLTAPKLFGRHQIDNAGLAIATLRAQSRFTIPQD
FT                   AYQAGLLAAEWPARMQRITSGKLLDDAPAGCELWLDGGHNADGGRVAAAALGDLEERVS
FT                   RPLVLIAGMMANKDAAAFLANFTGLTRHLIVVPIPNRDGAMPPERLADAGRALGLRVEL
FT                   ADDVRAALRRIASLAYELPPRILITGSLYLAGHVLSLNGTPPN"
FT   gene            complement(79508..79828)
FT                   /locus_tag="Rpal_0076"
FT   CDS_pept        complement(79508..79828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0076"
FT                   /product="thioredoxin"
FT                   /note="TIGRFAM: thioredoxin; PFAM: Thioredoxin domain;
FT                   KEGG: bbt:BBta_0091 thioredoxin 1, redox factor"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98638"
FT                   /db_xref="GOA:B3Q609"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q609"
FT                   /protein_id="ACE98638.1"
FT                   /translation="MAVGKVSDADFENEVLNAQGPVVVDFWAEWCGPCRMIAPALDEIA
FT                   GAMGDKVKIVKLNVDESPVTASKYGVMSIPTLMIFKGGEMASRQVGAAPKAKLQQWISA
FT                   AV"
FT   gene            complement(79925..83410)
FT                   /locus_tag="Rpal_0077"
FT   CDS_pept        complement(79925..83410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0077"
FT                   /product="double-strand break repair helicase AddA"
FT                   /note="TIGRFAM: double-strand break repair helicase AddA;
FT                   PFAM: UvrD/REP helicase; KEGG: bja:bll0752 putative
FT                   helicase 2"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98639"
FT                   /db_xref="GOA:B3Q610"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR014151"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q610"
FT                   /protein_id="ACE98639.1"
FT                   /translation="MSRLIPNEARARQEIASDPSASVFVSANAGSGKTHVLVQRVIRLL
FT                   LDGVSPERILCITFTKAAAANMAERVFTTLGHWVKLDDEELSAAIHATGVKTVGPSLLA
FT                   QARKLFACALETPGGLKVQTIHALCTRLLQQFPFEANVPARFSVLDDRDQAELMQRASL
FT                   DVLLRAAAAPDSDAGRALAFAMTSAADVTFRDVVQEACMSRDRFMAWVAQAGSVERAMA
FT                   QLSATLGVAPGDSCEAADRDIVDGPNLPRSEWAAVAAIFEGGSANDQAQARRLREALAL
FT                   TDAAQIDAYLQVFFTKDSGLRKSLITKKLGDSAPGLAERLQREGARLAGLLERRRALAL
FT                   RERTRALLVIAAQVAGNIAREKRERGLLDYDDLIDKTLAMLDSGAAGWVHFKLDRGVDH
FT                   VLIDEAQDTSPKQWKIVARLIDEFTAGEGARDGVRRTIFAVGDEKQSIFSFQGAVPKEF
FT                   AEWRDLLQRRFTGAGLTFEKVSFNYSFRSGAAILQSVDHVFRDPAIYRSIHADSTYPLH
FT                   QSLADAGPSSIDLWPLEVPDDRQQIEGWQAPFDAVSETSPEVRLADKVRAEIGALIARG
FT                   TQTGPMGRRRPLSYGDVLILVRRRGSAFDAVIQALKRGGIPVAGADRLKLTEHIAIIDL
FT                   MKLADALLLPQDDLALAVALKSPLFGLDDDDLFKLAWQRKGSLSAALADHAAGDSKFAA
FT                   VQRRLESYAARAQAETPFGFYAWLLGGDGSDSGRARILRRLGPEANDALDEFLELALSF
FT                   EQKRAPSLQGFVAWLREADTEIKRDMEISRDEVRVMTVHGAKGLEAPVVFLIDTTSSPA
FT                   DTQRLNLIRLPGGNAAPGSVAAMVWAGRKADDPHIVEQARSAMIEETEDEYRRLLYVAM
FT                   TRAADRLIVGGCMPGNRNEVRPHSWYDLISKGLESSGLVMQPVPPEGVIKRYCRPEDVI
FT                   EEIGTVSQGQELAVTHLPDWLRRPAPGLPSAEQVLRPSDAEDDDRRRLRPGESDASRSR
FT                   ALQRGTLVHRLLQSLPEIAVADRPAAAGRFLARNASDWSEEDRAALAAQVLGLIADARF
FT                   AAVFGSGSRAEVPIVGRLQWRGGPVLVSGQIDRLVVTETEVLIVDYKTNHAPPRVEAEA
FT                   PRSYVRQLARYRAVLGAIYPQRTVRAALLWTEAAEIMELSASALDAEQADLTVP"
FT   gene            complement(83407..86556)
FT                   /locus_tag="Rpal_0078"
FT   CDS_pept        complement(83407..86556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0078"
FT                   /product="double-strand break repair protein AddB"
FT                   /note="TIGRFAM: double-strand break repair protein AddB;
FT                   KEGG: bbt:BBta_0089 putative helicase-exonuclease type V
FT                   protein family, AddB subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98640"
FT                   /db_xref="GOA:B3Q611"
FT                   /db_xref="InterPro:IPR014153"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q611"
FT                   /protein_id="ACE98640.1"
FT                   /translation="MHLFSVPSSAPFLRTTIAALVDGRLVEGFDVRTAPERLADATLYL
FT                   PTRRAGRMAREIFLDVLGADAVLLPRIVALGDIDEDELAFAQAASGLADLEIPPALDGL
FT                   PRRLLLTQLIASWAARLKPDDPTQAPLVVGGPASALALADDLARLIDDMSTRGVDWSAL
FT                   ETLVPDAFDRYWSLTLDFLKIAGHAWPQYLKETDRIEPAARRDRLIDAEAQRLATQRSG
FT                   PVIAAGSTGSMPATAKLLTAIARLPHGAVVLPGLDIDLDDAAWDLIGGSRDRQGKLVTP
FT                   PSPNHPQYAMHGLLDRMGVTRRDVQQLGTPARHGRELLSSEALRPSSATAVWHDRLKDA
FT                   EVDRLIGEGTDGLTLIEAPNSEAEALAIAVVLREAREQGKTAALVTPDRALARRVVAAL
FT                   GRWHLPVDDSGGDSLMETQPGIFARLAAETALDGCEPATLLALLKHPLLRLGRTGYGWR
FT                   GAIETLELALLRGPRPSAGCDGLAKEFAIFRGELAKLKRGEASALHPSEPRTRLSEPSL
FT                   DEAQDLIAQLKAALAPLETVGPNPLDLCEIGARHCAALKALTTDDEGIAEVFEGPQGSA
FT                   LLRAFDDLAAVGPASGVLVAARDYGEVFETAFGDRVVRRPELAEAPIRIYGPLEARLTQ
FT                   QDRVVLGGLVEGVWPPAPRIDPWLSRPMRHELGLDLPERRIGLSAHDFAQALGADEVFI
FT                   THAAKVGGAPAVASRFLHRLEAVAGEDRWKAMKARGQIYLDYTHELDRPESVTPIAQPA
FT                   PRPPRIARPLKLPVTAIEDWLRDPYTIYAKYILRLSPLDPVDMPLSGADRGSAIHAALG
FT                   EFTERYQDALPDDPVTALRQIGQKHFAPLMDHAEARALWWPRFLRIATWFAAWEQQRRT
FT                   GVVQVQAERRGTLMIPLGGERNFELSARADRIERRDDGSYAILDYKTGHPPTGKQVRMG
FT                   LSPQLTLEAAILRDGGFEDIPAAASVSELTYVKLSGNTPPGDERVLELKIERKDEPQHP
FT                   DDAADEARAKLEGLVRRFEDEKQSYRSLVLSMWSQRYGTYDDLARIKEWSAAGGRGDAS
FT                   S"
FT   gene            complement(86632..87354)
FT                   /locus_tag="Rpal_0079"
FT   CDS_pept        complement(86632..87354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0079"
FT                   /product="Nucleotidyl transferase"
FT                   /note="PFAM: Nucleotidyl transferase; KEGG: nha:Nham_0056
FT                   nucleotidyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98641"
FT                   /db_xref="GOA:B3Q612"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q612"
FT                   /protein_id="ACE98641.1"
FT                   /translation="MTVRPHKAMVLAAGLGLRMRPLTDHMPKPLVRVAGRPLLDHVLDR
FT                   LAEVDVTEAVVNVHYLPDQIIDHVAGRTSPRVIISDERDQVLDTGGAVVKALPLLGDAP
FT                   FYHLNADTMWIDGVRPNLARLAEAFDPARMDILLLMAPTANSIGYAGKGDFAMSPDGSL
FT                   HKRKETEVVPFVYAGAAIMSPAIFKNAPQGEFSLTKMFDRAGQQHRLHGLRLDGLWMHV
FT                   GTPDAVPAAERAYLASVA"
FT   gene            complement(87512..87820)
FT                   /locus_tag="Rpal_0080"
FT   CDS_pept        complement(87512..87820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0080"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bbt:BBta_0087 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98642"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q613"
FT                   /protein_id="ACE98642.1"
FT                   /translation="MVAERNKDGRVVFDRGLRAQMMAIDGTWRRPCLIEDVSELGAKLT
FT                   VEGTVEGLNLKEFFLLLSSTGLAYRRCELSWINGDQIGVTFLRLDRKKKRAAQAENA"
FT   gene            complement(87924..89444)
FT                   /locus_tag="Rpal_0081"
FT   CDS_pept        complement(87924..89444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0081"
FT                   /product="protein of unknown function UPF0079"
FT                   /note="PFAM: aminoglycoside phosphotransferase; protein of
FT                   unknown function UPF0079; KEGG: nha:Nham_0054 protein of
FT                   unknown function UPF0079"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98643"
FT                   /db_xref="GOA:B3Q614"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR012180"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q614"
FT                   /protein_id="ACE98643.1"
FT                   /translation="MSAVATFSVALANEVATVRLMAEVALLIGPGDVVTLSGDLGAGKT
FT                   AAARAMIRYLADDDALEVPSPTFTLVQTYDLPPYPLLHADLYRVEDPSELEEIGLSPLP
FT                   DGTVALIEWPERAGAALPEDRIDIALSHRPALGPSARAAEITGHGKAVKQVERLAALRS
FT                   FIETAGYADAERRHMPGDASTRSYARLQRGAESVILMNAPRRPDGPALYAGKSYSAAVH
FT                   LAEDVRPFVAIGQGLRERGFSAPAIHHADLDAGFLITEDLGRIGFVEGDPPAPVVARYQ
FT                   AATDMLAALHAKPLPDHLPLSTRESYAVPTFDEAAMMIEVGLMPEWYLPDRGAPPSEAL
FT                   RAEFVALWRKLLAGIATAPRTWVLRDYHSPNLIWLEDRPGIERVGVIDFQDTVLGPAAY
FT                   DVVSLLQDARIDVPEATELSLLGRYVKARLAADPEFDAPGFARLYAVMSAQRNTRLLGT
FT                   FARLNRRDGKPQYLKHQPRVWAYLARSLAHPALAEVRAWYRDHVPPPL"
FT   gene            complement(89441..91954)
FT                   /locus_tag="Rpal_0082"
FT   CDS_pept        complement(89441..91954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0082"
FT                   /product="PAS/PAC sensor signal transduction histidine
FT                   kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; SMART: PAS domain
FT                   containing protein; KEGG: nwi:Nwi_0045 histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98644"
FT                   /db_xref="GOA:B3Q615"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q615"
FT                   /protein_id="ACE98644.1"
FT                   /translation="MSGVLGSIRRTSLSCTSLVHGLAGTAVMVASSPARAADDHLAAIT
FT                   SSLLLDLNRHEMMTLIIALAALGFSVMSAIMLVRTRQRAVAREAGLRADLQGLQAESDR
FT                   FQALLFAEPQVLISWAAGDSRPQVSGDTALFLPLETQSRQPQRVLAFGTWLPPEPALQM
FT                   DHAVDALLDKGEGFLLQLVTSNGRSIEAMGRAVGGQAVVRIRELSGVRRELADMTRRFK
FT                   ALQEETEMLRGFATAAPWPIWTRRSDGTLSFANAAYARATDASDAADAIGRNLELLDSG
FT                   DRAALARALGDGYEYSGRLPIVVGGERRYYDVRALKVSGGSAGIAVDATETAALGAALE
FT                   RMADAHRRTLDQLSSGVAVFDAQRRLSFYNDSYRKLWDLDRIFLDSHPDDSTVLDRLRA
FT                   ERKLPEERDFKAWKNKLHEAYRAVEAEKDVWYLPDGRAVSIVTTPNPEGGVTYLFDDVT
FT                   ESLDLKRRYGGLIDVQRETLDNLSEAVAVFGSNGCAQLFNPPFARMWNLSAEALQSQPH
FT                   IEAIEEWCRPLFDDDVFWQALRGAITGIDDRRHVLLKIERKDGSVLACKTMPLPDGATM
FT                   LTFQDITDTENVERALRERNEALETADRIKIDFVHHVSYELRSPLTTIIGFAHFLSDSS
FT                   TGPLTEKQAEYVNYITTSTNALMAIINNILDLASIDAGAMTLNLGPIDIRKAIDAAAEG
FT                   IQDRLARDQIALQIDVDPAIESFVGDERRVVQVLYNLLANAIDFSPSQGTVRLTVRRGE
FT                   TRVAFTVTDSGPGIAPAFKEKMFDLFESDPQGSRHRGAGLGLSLVRSFVELHGGKVLVE
FT                   SAVGRGTSVTCEFPIEPAAQRHAAE"
FT   sig_peptide     complement(91844..91954)
FT                   /locus_tag="Rpal_0082"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.997 at
FT                   residue 37"
FT   gene            complement(92174..92632)
FT                   /locus_tag="Rpal_0083"
FT   CDS_pept        complement(92174..92632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0083"
FT                   /product="deoxyuridine 5'-triphosphate nucleotidohydrolase
FT                   Dut"
FT                   /note="TIGRFAM: deoxyuridine 5'-triphosphate
FT                   nucleotidohydrolase Dut; PFAM: deoxyUTP pyrophosphatase;
FT                   KEGG: bja:bll0758 deoxyuridine 5'-triphosphate
FT                   nucleotidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98645"
FT                   /db_xref="GOA:B3Q616"
FT                   /db_xref="InterPro:IPR008181"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3Q616"
FT                   /protein_id="ACE98645.1"
FT                   /translation="MTQKITVSIRHLPHGEGLPLPEYQTAHAAGLDLIAAVPQDAPLTL
FT                   QPGRYVLVPTGLTIALPENYEAQVRPRSGLAAKHGVTVLNAPGTIDADYRGEIGVLLIN
FT                   HGTEPFAIRRGERIAQMVIAPVSRAQFVAVEALPESGRGAGGFGSTGR"
FT   gene            complement(92629..94074)
FT                   /locus_tag="Rpal_0084"
FT   CDS_pept        complement(92629..94074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0084"
FT                   /product="phosphopantothenoylcysteine
FT                   decarboxylase/phosphopantothenate/cysteine ligase"
FT                   /EC_number="4.1.1.36"
FT                   /EC_number="6.3.2.5"
FT                   /note="KEGG: bja:bll0759 bifunctional
FT                   phosphopantothenoylcysteine
FT                   decarboxylase/phosphopantothenate synthase; TIGRFAM:
FT                   phosphopantothenoylcysteine
FT                   decarboxylase/phosphopantothenate/cysteine ligase; PFAM:
FT                   flavoprotein; DNA/pantothenate metabolism flavoprotein
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98646"
FT                   /db_xref="GOA:B3Q617"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR005252"
FT                   /db_xref="InterPro:IPR007085"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="InterPro:IPR035929"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q617"
FT                   /protein_id="ACE98646.1"
FT                   /translation="MANLTIRKLDDVLKSELRQRAAANGRSMEDEVRVILRDACHKRLG
FT                   FAEPASADLSVPAPPAADEPADGPRAQPQAGTVRVTLIVGGGIAAYKAMDLIRRLKERG
FT                   ADVRVVLTKAAQQFVTPLTASALSHQRCYTDLFDPSSEFDAGHIRLARDCDLIVVAPAT
FT                   ADLMAKIAGGHADDLATAILLATNRQILLAPAMNPLMWNNAATRRNVAQLKQDGVAMVG
FT                   PNAGEMAERGEAGIGRMAEPTEIAVAAEALWRPQPPKPLLGKRVLITAGPTHEPIDPVR
FT                   YIANRSSGKQGYAIAAAAAAAGAEVALISGPVELRAPAGVDCIRVESAREMLAAVQSAL
FT                   PADVAIFAAAVADWRVAAEGMQKLKKGAAGPPPLQLTENPDILAMISKLTEGRPPLVIG
FT                   FAAETENLIDNATAKLARKGCDWIVANDVSPATGVMGGDRNTVHLLMRHDAATDLESWP
FT                   LMTKDEVATALVARIAQAMAVHA"
FT   gene            complement(94128..95705)
FT                   /locus_tag="Rpal_0085"
FT   CDS_pept        complement(94128..95705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0085"
FT                   /product="2-polyprenylphenol 6-hydroxylase"
FT                   /note="TIGRFAM: 2-polyprenylphenol 6-hydroxylase; PFAM:
FT                   ABC-1 domain protein; KEGG: bbt:BBta_0082 ubiquinone
FT                   biosynthesis protein UbiB"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98647"
FT                   /db_xref="GOA:B3Q618"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR010232"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q618"
FT                   /protein_id="ACE98647.1"
FT                   /translation="MIAALTHVARLGRAAFVFAREGVFGVVDPALIPPAGQVPVRLARL
FT                   IERRGAKSGARLSRALTRLGPAYLKLGQFLATRPDVVGVAMARDLESLQDRLPPFSQDE
FT                   AEQVIAISLERPVRDLFVSLSPPVAAASIAQVHRGEIELDGVRKQVAVKVLRPNVSSRF
FT                   RRDLSDFFYVAEKAELYSAEARRLRLVEVINTMSRSVAMEMDLRLEAAAASEMAENTKD
FT                   DPDFRVPTVDWDRTSHNVLTMEWIDGIPLNDHARLKEANVDTVELGRKVIQSFLRHALR
FT                   DGFFHADMHPGNLFLDRDGKLVAVDFGIMGRLLPKERRFLAEILLGFITRNYRRVAEVH
FT                   FEAGYVPPHHSVENFAQAIRAIGEPIHNRLAEEISMAKLLTLLLEVTGLFDMRTRPELI
FT                   LLQKTMVVVEGVARSFDPKLDIWKVADPVVREWIQRNLGPIGKVEGALAGAGELGHTLT
FT                   SLPTIVSRAVTVLNQLEVMTKDGLVLAPETIAAIGRTERGRTRGRTVALWVIAATFIGV
FT                   LIALSRMI"
FT   gene            complement(95702..96463)
FT                   /locus_tag="Rpal_0086"
FT   CDS_pept        complement(95702..96463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0086"
FT                   /product="ubiquinone/menaquinone biosynthesis
FT                   methyltransferase"
FT                   /note="TIGRFAM: ubiquinone/menaquinone biosynthesis
FT                   methyltransferase; PFAM: UbiE/COQ5 methyltransferase;
FT                   Methyltransferase type 11; Methyltransferase type 12; KEGG:
FT                   bja:bll0761 ubiquinone/menaquinone biosynthesis
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98648"
FT                   /db_xref="GOA:B3Q619"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR023576"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3Q619"
FT                   /protein_id="ACE98648.1"
FT                   /translation="MTEPGETTHFGYRDVPLDEKQTLVNDVFHSVAGRYDLMNDLMSGG
FT                   MHRLWKDVMITTLNPPRDDTPFRLLDVAGGTGDISFRAAKASGAGFHSTVCDINTDMLE
FT                   VGRQRAVERNLDDKVDFVEGNAESLQFDDRSFDAYTIAFGIRNVPRIDLALKEAYRVLK
FT                   PGSRFLCLEFSSVDVPGLSKLYDLFSFKVIPEIGRVVTGDADSYQYLVESIRKFPKPYD
FT                   FAEMMRDAGFARANWQVMSGGIVALHSGWRL"
FT   gene            96707..97582
FT                   /locus_tag="Rpal_0087"
FT   CDS_pept        96707..97582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0087"
FT                   /product="formamidopyrimidine-DNA glycosylase"
FT                   /EC_number="3.2.2.23"
FT                   /note="KEGG: bbt:BBta_0080 formamidopyrimidine-DNA
FT                   glycosylase/DNA-(apurinic or apyrimidinic site) lyase MutM;
FT                   TIGRFAM: formamidopyrimidine-DNA glycosylase; PFAM:
FT                   Formamidopyrimidine-DNA glycosylase catalytic domain
FT                   protein; DNA glycosylase/AP lyase, H2TH DNA-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98649"
FT                   /db_xref="GOA:B3Q620"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR015887"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3Q620"
FT                   /protein_id="ACE98649.1"
FT                   /translation="MPELPEVETVRRGLQPAMEGFRIDRAVAHRENLRFPLQKDFAARL
FT                   TGQTVTGLGRRAKYLLADLSSGDVLLMHLGMSGSFRVIGADGETTPGEFHYPRSEDRTH
FT                   DHVVFEMASGARVVFNDPRRFGFMKVFPRSEIETEPHLKGLGPEPLGNAFDASLLAKAC
FT                   AGKQTSLKAALLDQRVVAGLGNIYVCEALFRAHLSPKRKASTLANRKEEPTDHAVRLTE
FT                   AIREVLGEAIKAGGSSLRDHRQTSGELGYFQHAFKVYDREGKPCPTCGGTVQRFVQNGR
FT                   STFWCPKCQK"
FT   gene            complement(97634..98980)
FT                   /locus_tag="Rpal_0088"
FT   CDS_pept        complement(97634..98980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0088"
FT                   /product="Peptidoglycan-binding domain 1 protein"
FT                   /note="PFAM: Peptidoglycan-binding domain 1 protein; KEGG:
FT                   bja:bll0764 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98650"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q621"
FT                   /protein_id="ACE98650.1"
FT                   /translation="MRSMLAATLIVAGAATLPVHGAHAAPPKQAAAAPPAAQTPAETAK
FT                   TLAQAERQAIQSDLAWTGDYNGLINGEVSDRMIAAIKQFQTNQGHKPTGVLNPQERGQL
FT                   AAAARKLQASVGWKLVADPVTGARIGVPTKLVPQQASDAGGTRWSSSTGTIQVALSRRK
FT                   EADLSIAKLAEQEKKQPGRKVEYSAVRPDFFVLSGTQGQKKFYIRGSFKNAEVRILTVM
FT                   YDQATEGTMQPVVVAMSSAYDPFPGGVQAGPPPRKKVEYSTGTIVGADGAILADREAVE
FT                   GCLSIVVAGYGPADLADRSKEHELALLRIYGASELKPLPIGSGAAKPGAVEITGVADPQ
FT                   SQGGGAAVTTVKAQLTAAVTTDGLIVTPPPSLGFSGAPARDADGRFAGLTTLRLPLVAG
FT                   AAESAAPPQATLITADTVRSYLTGVGVKPVEGTTKDPKASVVRVICVRK"
FT   sig_peptide     complement(98906..98980)
FT                   /locus_tag="Rpal_0088"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.981 at
FT                   residue 25"
FT   gene            99189..99989
FT                   /locus_tag="Rpal_0089"
FT   CDS_pept        99189..99989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0089"
FT                   /product="UBA/THIF-type NAD/FAD binding protein"
FT                   /note="PFAM: UBA/THIF-type NAD/FAD binding protein;
FT                   MoeZ/MoeB domain protein; KEGG: bja:blr0765 molybdopterin
FT                   biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98651"
FT                   /db_xref="GOA:B3Q622"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q622"
FT                   /protein_id="ACE98651.1"
FT                   /translation="MLSAEELERYARHIVLRDVGGPGQAALKGARVLVVGAGGLGAPVL
FT                   MYLAAAGIGTLDIVDDDIVTLSNLQRQVIHATPDIGARKADSAASRILALNPHVRVVQH
FT                   RVRLDGSNALTLIGGCDLVLDGSDNFATRYLVSDACYLAKKPLITAALGQFDGSLTTIR
FT                   AHECNAAGEPNPTYRCLFPEPPPAGTVPSCEEAGVMGALAGVLGSMMALEAIREIVGFG
FT                   EGLVGRLVMIDARAMRFETLRYSRDPQNPLNGDAPTITDLSRHL"
FT   gene            100114..101802
FT                   /locus_tag="Rpal_0090"
FT   CDS_pept        100114..101802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0090"
FT                   /product="protein of unknown function DUF894 DitE"
FT                   /note="PFAM: protein of unknown function DUF894 DitE; major
FT                   facilitator superfamily MFS_1; KEGG: bja:blr0559 MFS
FT                   permease"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98652"
FT                   /db_xref="GOA:B3Q623"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q623"
FT                   /protein_id="ACE98652.1"
FT                   /translation="MAGTAKRGLFSGDGIAAPLRHALFRRIWLASLLSNLGLMINGVGA
FT                   AWAMTQMTASADKVALVQTALMLPIMLVAMPAGAIADMYDRRLVALAALGIGLAGATTL
FT                   AALAHLGLVTPNTLLLFCFVIGTGMALFGPSWQASVSEQVPAETLPAAVALNGISYNIA
FT                   RSFGPAVGGIVVAAAGAVAAFAANAVLYLPLLIVLLLWRRDSEPPRLPPERLNRAIVSG
FT                   VRYITNSPAIRIVLTRTLVTGIAGSSVLALMPLVARDLLHSGAETYGLLLGAFGIGAVI
FT                   GALNVGIARQRLSSEAAVRLCAMIMGVAMAVIAISRSPLLTAAALVVAGAVWMLAIALF
FT                   NIGVQLSAPRWVAGRSLAAFQASISGGIAIGSWGWGHVADLSGVAPSMLLSGLAMLASP
FT                   VLAFLLPMPPVGTRTEDAELLADPELKLALTSRSGPVVIEIEYRIDADEARAFHNVMQE
FT                   VQLSRQRNGAYGWSIARDVADPELWTERYHCPTWLDYLRQRSRSTQDDRALHRRAIAFH
FT                   RGPEPVRVRRMLERPFGSVRWKEESPDRTTATEVLPVAGVSGGST"
FT   gene            complement(101783..101881)
FT                   /locus_tag="Rpal_0091"
FT   CDS_pept        complement(101783..101881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0091"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98653"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q624"
FT                   /protein_id="ACE98653.1"
FT                   /translation="MSKTRPTMRPDEIDPEISPEINPEINPMSNRR"
FT   gene            complement(101934..102152)
FT                   /locus_tag="Rpal_0092"
FT   CDS_pept        complement(101934..102152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0092"
FT                   /product="conserved hypothetical protein; putative signal
FT                   peptide"
FT                   /note="KEGG: bra:BRADO0286 conserved hypothetical protein;
FT                   putative signal peptide"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98654"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q625"
FT                   /protein_id="ACE98654.1"
FT                   /translation="MLKIIGPLVCLTLIAGAAQAQERRPDPGCGRDVSRLCRAVMNESD
FT                   GAILNCLQQHRAKLSAKCAKVLTDNGQ"
FT   sig_peptide     complement(102090..102152)
FT                   /locus_tag="Rpal_0092"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 21"
FT   gene            complement(102281..102622)
FT                   /locus_tag="Rpal_0093"
FT   CDS_pept        complement(102281..102622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0093"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bja:blr3464 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98655"
FT                   /db_xref="InterPro:IPR018968"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q626"
FT                   /protein_id="ACE98655.1"
FT                   /translation="MADKNSSDVILNVMTKNLEQARGAMTNYLEFISKSMSVVPMGQSS
FT                   QATTLKGYVDRNVQATFDFSQQLLHAKDFQDVVRIQTEFLQTQFRVLTDQAKDVVEMTK
FT                   PTVIVPNDG"
FT   gene            complement(102861..103265)
FT                   /locus_tag="Rpal_0094"
FT   CDS_pept        complement(102861..103265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0094"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98656"
FT                   /db_xref="GOA:B3Q627"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q627"
FT                   /protein_id="ACE98656.1"
FT                   /translation="MQNWFIALAVAVLLLIGFAAGPMSVVVAFLAFWVTLYLVWARELG
FT                   FKDTWSRYGLQRVKPPFWAAENKVWFFPIFDDRAKVVKAAAVPLLIIALSLMLPTSVVR
FT                   IGTLLVLAWYCLEIYRSQKGMDQLDRARFN"
FT   sig_peptide     complement(103179..103265)
FT                   /locus_tag="Rpal_0094"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.597 at
FT                   residue 29"
FT   gene            complement(103344..103685)
FT                   /locus_tag="Rpal_0095"
FT   CDS_pept        complement(103344..103685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0095"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mex:Mext_0878 collagen triple helix repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98657"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q628"
FT                   /protein_id="ACE98657.1"
FT                   /translation="MRSSSMILLGAIALVAALSVVNQVGVPHPALIEPAVAATPIAPPV
FT                   SAFRTVTSSTCSSNGCPTSCEADEALISAICIGPSSAKFSDNLSLENGQMTASCGPSSS
FT                   TIVVSCARK"
FT   sig_peptide     complement(103617..103685)
FT                   /locus_tag="Rpal_0095"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.601 at
FT                   residue 23"
FT   gene            complement(104226..104501)
FT                   /locus_tag="Rpal_0096"
FT   CDS_pept        complement(104226..104501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0096"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bra:BRADO2381 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98658"
FT                   /db_xref="InterPro:IPR024476"
FT                   /db_xref="InterPro:IPR038194"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q629"
FT                   /protein_id="ACE98658.1"
FT                   /translation="MRHHYEIAVTKLIPDGATLSPPISFAAESHDDLADIIRRVTDKGL
FT                   FDPEETKAFCVGLKLLGGVMLQHRDKELFKDFAPAFGALMKTLKAR"
FT   gene            104632..105279
FT                   /locus_tag="Rpal_0097"
FT   CDS_pept        104632..105279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0097"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: bbt:BBta_2740
FT                   putative transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98659"
FT                   /db_xref="GOA:B3Q630"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039536"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q630"
FT                   /protein_id="ACE98659.1"
FT                   /translation="MPRPRKQQAIDPNGENRKLRQVLAAARKLFADHGFDVTSMDAIAR
FT                   EAGVSKATLYVHFASKDALLLALVDDECRNFGPQMLWQPDGQPIELEPALRAIARGYTS
FT                   FFLDDRGLKLHRLVMSNAARFPQMAAVFMAAGPRRCEEEVANFLRAAVAQQLLTIPDIG
FT                   LAAVQFLSLVQGRLQLQWELQLGRPSEADVQALIDGGIRVFLTAYRNPEVSS"
FT   gene            105276..106193
FT                   /locus_tag="Rpal_0098"
FT   CDS_pept        105276..106193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0098"
FT                   /product="PepSY-associated TM helix domain protein"
FT                   /note="PFAM: PepSY-associated TM helix domain protein;
FT                   KEGG: bja:bll3835 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98660"
FT                   /db_xref="GOA:B3Q631"
FT                   /db_xref="InterPro:IPR005625"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q631"
FT                   /protein_id="ACE98660.1"
FT                   /translation="MNNVLLLKLHRWTSLVFALPLLAIIVTGLILSVEPMLQGRGLPAG
FT                   TLDAARLTGLIERYDPQGQARGLAINATGQQMRLLGVNAPPIDLATGEAAAASDATGDL
FT                   LLWARRTHERLLGYEWLVIASTIAMTVLMTIGVLMGLPRLRNSLAGWHKGAAWFTLPLL
FT                   LLSPLTALCMAFGLTFSSGPPPSRVTIKLPDAVQQIAQSHDVSHLAMIANRGGRMMARI
FT                   YQDGELRAYTFTPDGVTALPRNWPRLLHEGNWSTWLSGTLNVITSVVLIVLLITGVWLW
FT                   TRRKLRRRPPSARSAGPVLAAPLS"
FT   sig_peptide     105276..105374
FT                   /locus_tag="Rpal_0098"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.904) with cleavage site probability 0.786 at
FT                   residue 33"
FT   gene            106242..107468
FT                   /locus_tag="Rpal_0099"
FT   CDS_pept        106242..107468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0099"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   nha:Nham_0992 secretion protein HlyD"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98661"
FT                   /db_xref="GOA:B3Q632"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q632"
FT                   /protein_id="ACE98661.1"
FT                   /translation="MTRLFHANLCPTRAKTLHFLPSVRSLFMSPVVRRPALALVALLAA
FT                   SPALAQMPGGGPPAVGTITARPQAITETTEINGRIQAIGRVDLTARVNAYLQEQLFVEG
FT                   AEVKKGDLLFRLEQPPFEADAEAKRAAVDQAQAQLDYADLALGRAEQLLKTSSGSQSTA
FT                   DNARAAQRTAAAQLRSAQAQLRQSEINLGYTEIRSPIDGRIGRIQVTLGNVVGPSSGAL
FT                   ATVVSQDPAYVVFPISVNRLLQLREEFAAQGGLEAMKIRLRLPDGRLYREVGKLQFVDV
FT                   AVARDTDSIILRGTIANPPLAGGGRELTHDEMVRVLLEGSKPREVLAIPRAAILTDQQG
FT                   DYVYVVSDKNVAERRRVKLGQSTAQIASVIDGLKAGDQVIVEGVQRARPNAPVTPTPAA
FT                   ATTALPTPR"
FT   sig_peptide     106242..106394
FT                   /locus_tag="Rpal_0099"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 51"
FT   gene            107472..110621
FT                   /locus_tag="Rpal_0100"
FT   CDS_pept        107472..110621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0100"
FT                   /product="transporter, hydrophobe/amphiphile efflux-1
FT                   (HAE1) family"
FT                   /note="TIGRFAM: transporter, hydrophobe/amphiphile efflux-1
FT                   (HAE1) family; PFAM: acriflavin resistance protein; KEGG:
FT                   nha:Nham_0993 hydrophobe/amphiphile efflux-1 HAE1"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98662"
FT                   /db_xref="GOA:B3Q633"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004764"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q633"
FT                   /protein_id="ACE98662.1"
FT                   /translation="MIADTFIDRPRLAAVIALVTTLVGALALLRIPVAQLPDIVPPQVR
FT                   VSTTYPGASAEVLESTVAQPIEAKVVGVDKMIYMKSSSGNDGSYTLDVSFALGTNPDIN
FT                   TVNVNNRVQNALSQLPSEVRLQGVTVQKRSSSMLQVINMSSTGQKYDQLFLTNYGLINV
FT                   LDELARVPGVGEAALFGRYAYSMRIWFDIEKLSSLGLVPSDVVAAISAQNVQAPVGRIG
FT                   ARPVPDDQKFQFNLQTQGRLTKPEEFGAIVLRANADGSVLKVSDVARVELGAQNADTYA
FT                   RLNGDPTIGIGIFLAPGANAINTAAAINAKLDTLRPRFPESVQARVVYDATVFVNDTIS
FT                   AVLHTLFEAFALVAVVVFLFLGNLRATLIPIIAVPVSLIGTFAVLIAFGTSVNTVSMLA
FT                   LVLAIGIVVDDAIVVVENVERVMEEEPELSPADATKKAMAQVTAPIIAITLVLLSVFVP
FT                   IGFLPGIMGELFRQFAVTISAAMLISAVNALTLSPAMCALFLRHEGQRRGFMQKVGRGI
FT                   DRARDGYTSTVRIALRRPALSVLAVAACGAGIWGLSLTTPSGFLPEEDQGAFFINVQLP
FT                   DGASVARTEATVIEVEKIVKQMPEVRDVLSIVGLSLLDNYSASNNAFMIVQLKPFADRK
FT                   AASSSAQTLIGKTFGATQAVRTATVLPFNLPPVVGLSTAGGFQYQLESLEGAEPAAIAG
FT                   VTNGLVAAGNQNPLLTRVFSTYNANAPSLYLDIDREKAQSLGITINDIFSALQISLGGL
FT                   YINNFNLFGRTWQVNLQGDASARRDLPNLWDIYVRNTKGAMVPLQSIATVRTVTGPAVI
FT                   TRYNNYRSVTINGSPAPGVSSGTAMAAMAEVSAKTLPPGYAFEWTGTAYQEHEAVGKTG
FT                   YILALAVIFAYLFLVALYESWVIPVPVLLSVSIAVLGAFAGILVGRVTLDLYAQIGLVV
FT                   LIALAAKNGILIVEFAKEQREAGLSIKAAAEMGAKLRFRAVMMTSIAFILGLVPLVWAD
FT                   GAAMLARRNLSTPVFAGMLTASLIGIILIPMLYVVFQSLREKVAEPGVLTPLSLKRLLK
FT                   R"
FT   gene            110760..111170
FT                   /locus_tag="Rpal_0101"
FT   CDS_pept        110760..111170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0101"
FT                   /product="protein of unknown function DUF1078 domain
FT                   protein"
FT                   /note="PFAM: protein of unknown function DUF1078 domain
FT                   protein; KEGG: bra:BRADO6624 putative flagellar basal-body
FT                   rod protein (FlgC)"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98663"
FT                   /db_xref="GOA:B3Q634"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q634"
FT                   /protein_id="ACE98663.1"
FT                   /translation="MSAIASIAVSGLNAATRRLEVSASNIANQRSTGALPGADGTVPPG
FT                   APQAYKPLQVNQTDTPTGGTQTSLATTSPATVPVSDPQAPFADADGMVAAPNVDLAQEF
FT                   IGQMVAKYSYTANLASLQADRDMTKALLDAKV"
FT   gene            complement(111313..112371)
FT                   /locus_tag="Rpal_0102"
FT   CDS_pept        complement(111313..112371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0102"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="KEGG: mrd:Mrad2831_4760 oligopeptide/dipeptide ABC
FT                   transporter, ATPase subunit; TIGRFAM:
FT                   oligopeptide/dipeptide ABC transporter, ATPase subunit;
FT                   PFAM: ABC transporter related; Oligopeptide/dipeptide ABC
FT                   transporter domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98664"
FT                   /db_xref="GOA:B3Q635"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q635"
FT                   /protein_id="ACE98664.1"
FT                   /translation="MMIHEDLRPADGDPYLLDVNDLVVHFRTGRKRPWGKPSFVHAVDG
FT                   VSFRVKRGTTFGIVGESGSGKSTTAQAIMRLVQATSGQVVFRGEDIMPLTGEPLRKARK
FT                   HLQIVFQDPFSALDPRRRAGDQIREPLDLLEIGSRSERDARVRKLLAEVGLPPEAADLF
FT                   PHQFSGGQRQRLCIARALAPEPELIVCDEAVSALDVAIQAQILNLLKKLQRERGLTYIF
FT                   ISHDLGVIQQFCDEIAVMYLGKIAEQAPASALFTAPRHPYTWSLVSAAVPPGPLRDELK
FT                   AKYLVKGEPPSPVDPPPGCRFAQRCPFAEARCRAELPFLDAAGHEHYVACHRKDEIGVP
FT                   DFAPRVASGPIG"
FT   gene            complement(112368..113366)
FT                   /locus_tag="Rpal_0103"
FT   CDS_pept        complement(112368..113366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0103"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="KEGG: mrd:Mrad2831_4761 oligopeptide/dipeptide ABC
FT                   transporter, ATPase subunit; TIGRFAM:
FT                   oligopeptide/dipeptide ABC transporter, ATPase subunit;
FT                   PFAM: ABC transporter related; Oligopeptide/dipeptide ABC
FT                   transporter domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98665"
FT                   /db_xref="GOA:B3Q636"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q636"
FT                   /protein_id="ACE98665.1"
FT                   /translation="MAPVLSVENLSVSMTNRDGDLVPVLENLSFTVQKSRTIALVGESG
FT                   CGKSMTALAIMRLLPEGFVVTGGRIVLDGEDLLTARPKRMRALRGDAMSMVFQEPMTAL
FT                   NPLYTVGDQIAEVLYYHRRLSRKDAAEQAVQFLKAVQIPAAEQRAKAYPHQMSGGMRQR
FT                   VMIAMALACRPKLLIADEPTTALDVTVQAQIFDLLAQLQDETEAAIVLITHDLGAVAEL
FT                   AYDIAVLYAGRCIETGPAHEIAARPRHPYTRGLLGCVPHLTVGVAKPEEWVDLGEIPGM
FT                   VPALGNRGPDCAFLARCANASEACRSRPQPPLGTIAAGHAVSCWRAEEIAA"
FT   gene            complement(113369..114277)
FT                   /locus_tag="Rpal_0104"
FT   CDS_pept        complement(113369..114277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0104"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: mrd:Mrad2831_4762
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98666"
FT                   /db_xref="GOA:B3Q637"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q637"
FT                   /protein_id="ACE98666.1"
FT                   /translation="MSTMESSLAMAQKPLPSVSKVPKAVSPARAALRQFMKSPSGVAGA
FT                   LLLLLLLAGTALGPWLHPVDPLDIVGLPFAAPAADAPLGTDYLGRDVLAGLIYGGRATL
FT                   TVGAVAALITIVIGVTVGALAGFFGGWVDALLVKIAEFFQVLPPLLFAMVLVTLFGPKL
FT                   STITLAIGAVSWTSAARLTRAEFMRLRDLDFIKASRAAGAGSLHLILRVVLPNALPPII
FT                   VSATLAIGTAILFEGGLSFLGLGDPNTMSWGLMIGQNRNYVLDAWWAVTFPGAAIFLAV
FT                   LAVSLVGDGVNDAVNPRLRRR"
FT   gene            complement(114274..115254)
FT                   /locus_tag="Rpal_0105"
FT   CDS_pept        complement(114274..115254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0105"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: mrd:Mrad2831_4763
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98667"
FT                   /db_xref="GOA:B3Q638"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q638"
FT                   /protein_id="ACE98667.1"
FT                   /translation="MALLTHLFGKLANAVALLLAVLVMNFCLIHLAPGDPVQVIAGEMG
FT                   GASPEVIAALRAKYGLDHSLLEQMFTYLGKVAHGDFGYSYYFNQPVLGLILQRLPATLY
FT                   LAAASLVVAVLIGTVLGVISARRPNGLLSHGVTVLSLAGHAAPIFWTGLLLLLLFGSVW
FT                   PILPVNGMTDVVNPKTGFAYAADVAKHLVLPSITLGLVFVAQYSRLARVNMIDVLSADY
FT                   IRTARAKGLPERVVLVKHALRNTLIPIVTVVGLQFGNLFAGAVLVETVYSWPGMGRLVF
FT                   DSILRRDYPTLMGVLFFSAVMVIAANILTDLVYRLIDPRIRAGAR"
FT   gene            complement(115283..116884)
FT                   /locus_tag="Rpal_0106"
FT   CDS_pept        complement(115283..116884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0106"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: mrd:Mrad2831_4764 extracellular solute-binding
FT                   protein family 5"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98668"
FT                   /db_xref="GOA:B3Q639"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q639"
FT                   /protein_id="ACE98668.1"
FT                   /translation="MMLTKRSFVVGALGGIALMGLPLETKAEGAGSGGTLVIGSTQVPR
FT                   HFNGAVQSGIATALPSTQIFASPLRYDDNWNPQPYLAESWDVSKDGLTVTLKLVKNATF
FT                   HDGKPVTSEDVAFSIMTIKANHPFKTMLAAVESVDTPDPHTAVIKLAHPHPALLLAMSP
FT                   ALMPILPKHVYGDGQDVKSHPANLKPIGSGPYKLTEYKQGDYYTLEKFDKFFIPGRPKL
FT                   DKIVVRLISDPNALMVSAERGDVHMVPYFTGVRDIERLEKAPNVVVTDKGFAGIGALNW
FT                   LAFNTKKKPLDDVRVRQAIGYAANREFIVKKLMGGKALPSTGPIAPGSPLEEKNVEQYK
FT                   FDIAKANKLLDEAGLKPDGSGVRTTLTIDYIPGNDEQQRNVAEYLRSALKRVGINLEVR
FT                   AAPDFPTWAQRVASFDFDMTMDTVFNWGDPVIGVDRTYLSSNIRKGIIWSNTQQYANPK
FT                   VDEILGQAAQESSPDKRKALYSEFQKIVVEDAPIFYINATPYHTSFAKGLGNLPTTVWG
FT                   VASPLDELYWVTPPKN"
FT   sig_peptide     complement(116801..116884)
FT                   /locus_tag="Rpal_0106"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.906) with cleavage site probability 0.492 at
FT                   residue 28"
FT   gene            complement(116974..117930)
FT                   /locus_tag="Rpal_0107"
FT   CDS_pept        complement(116974..117930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0107"
FT                   /product="cobalamin synthesis protein P47K"
FT                   /note="PFAM: cobalamin synthesis protein P47K; cobalamin
FT                   synthesis CobW domain protein; KEGG: mrd:Mrad2831_4765
FT                   cobalamin synthesis protein P47K"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98669"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q640"
FT                   /protein_id="ACE98669.1"
FT                   /translation="MTAASATISVTVIGGFLGAGKTTFVNHLLRSGGPRTAVLVNDFGE
FT                   VNVDATLIQSHDGTTMTLTNGCICCSIGTSFIDTMCQVLDAAVPFERIVIEASGVGDPW
FT                   KIAEIALIEPSLRLDRVIVLADASRIAQLIEDSKVGDTVRGQFERCDIVLLNKTDLVNA
FT                   EALTAARTAVRSLRLDVGIVATAQGAMPTLAELKTAASSSGFRADAVDAAAIDHGATFK
FT                   SWAYRRAGRFDRVRLACAVDKLPPQLLRLKGSCRLAGEDDVKVFQMVESVWSLSPADAG
FT                   PVEPGIVLVGVGTADLPPPAELDAILDRALAPAGALS"
FT   gene            complement(117927..119570)
FT                   /locus_tag="Rpal_0108"
FT   CDS_pept        complement(117927..119570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0108"
FT                   /product="Amidohydrolase 3"
FT                   /note="PFAM: amidohydrolase; Amidohydrolase 3; KEGG:
FT                   mrd:Mrad2831_4766 amidohydrolase 3"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98670"
FT                   /db_xref="GOA:B3Q641"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="InterPro:IPR033932"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q641"
FT                   /protein_id="ACE98670.1"
FT                   /translation="MTSETVVYSARKIITMNPSRPSATHVAVRDGRIVATGSADELMVT
FT                   GARLDTRFADKVLMPGFVEGHSHIMEGLMWKQPYVGAFDRRSPEGKVVAGVPDIEAIVA
FT                   RLQQAEAAMPDDGSPLYAWGFDPLHIGGTMLTRQDLDKVSTKRPVLVVHASFHINNVNT
FT                   LTLERAELLHATNISGVVAGADGLASGELQGIPARMRLFRALGHNPLAGTITEADVRRY
FT                   AASCCVQGVTTITDLHNDLADPTIEVYRAATSQADFGVRLVPALAAVSHTPEQAIAKLE
FT                   TLRGHASDKLHYGIVKLVVDGSIQGFTARLRWPGYHNGAANGLWYIAPEELPRLVEAYH
FT                   RAGVQLHIHTNGDEATEVALDAIEAAQTVAPRPDHRHTLQHCQMASAAQFRRMKNLGVC
FT                   ANLFANHLYYWGDAHYELTMGPERAARLDATGTAQRIGVPFAIHSDAPVTPLAPLFTAW
FT                   CAVNRVSSSGRVLGRDTEALTTEQALAAITIGAAYTLKMDHLVGSIETGKYADFVVLDE
FT                   DPLAVPPERLKEIAVWGTVVGGMIKEAPRA"
FT   gene            119809..121350
FT                   /locus_tag="Rpal_0109"
FT   CDS_pept        119809..121350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0109"
FT                   /product="transcriptional regulator, GntR family with
FT                   aminotransferase domain"
FT                   /note="PFAM: regulatory protein GntR HTH; aminotransferase
FT                   class I and II; KEGG: mrd:Mrad2831_4755 transcriptional
FT                   regulator, GntR family with aminotransferase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98671"
FT                   /db_xref="GOA:B3Q642"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q642"
FT                   /protein_id="ACE98671.1"
FT                   /translation="MARTPNGGAIACSDAAALGKDELFWGALFRGLNRGGSFLQLQIRQ
FT                   IIVTAIEDGRLPLGMKMPSSRDLATVLKVSRNTVVIAYEQLVDQNFLVSRQRSGYFVAG
FT                   LPKKFATEAPGLAEVTSRGDEHWVDRFAVRPSAHRNIVKPLDWQTHPYPFIFGQFDPSL
FT                   FPTNDWRESARAALSVPEINNWARDLIDGDDPALIEQLQLQVLPRRGIHARADEIMMTI
FT                   GAQHALYLIATLFINGQTKVGIEEPGYPDARNIFRMLTPNVVPLSVDSEGLVPDAMFQS
FT                   CALAYVTASHQCPTAVTMPLPRRIELLKAAATGDVVVVEDDYEGELMPESATLPPLKSI
FT                   DRASNVLYVGSLSKALAPGLRLGYVVAPAPVIRELRALRRLMLRHPPLNNQRVAALFIG
FT                   LGHYRAHLAQVGRVLLERAKLLDQLLPKHLPSCSFSRGPGSTNFWVTCPTSIDATALAQ
FT                   AALEQGVVIEPGAVFSMDETASRHCFRLGFSSIRTDRIEVGIQRLGEVIAQHLKA"
FT   gene            complement(121366..122574)
FT                   /locus_tag="Rpal_0110"
FT   CDS_pept        complement(121366..122574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0110"
FT                   /product="putative ABC transporter, substrate-binding
FT                   protein; putative branched-chain amino acid transporter"
FT                   /note="KEGG: bra:BRADO6883 putative ABC transporter,
FT                   substrate-binding protein; putative branched-chain amino
FT                   acid transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98672"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q643"
FT                   /protein_id="ACE98672.1"
FT                   /translation="MTAMDRRCFLLGTATTMLVATSMKAQAADTTGITPTSIRIGSTSP
FT                   QSGPVSAYGVQARCQAAYFKMINDRGGIAGRKIDFIYYDDAFNPAKTVEQTRKLVESDE
FT                   VALLFSNLGTATNSAIVKYANAKKIPHLFLSVNGDKWSDYKAHPWSIGFAPSARTEAAI
FT                   FVKHMLAEKPDAKFAVLYQNDDFGKDFVLGAKDVLGDRESRQLVTISHETSDPTIDSQI
FT                   LQLRAAAPDALISGTTAKFTAQAIRKVAETRWQVRHYITGGSSSYAGTIGPAGPENAVG
FT                   VISSAYLKDVADPAWKDDQGIKDFLAFMQSYFPEGNKDDFYNLYAYTVASALVKVLTQC
FT                   GDGWTRENIMAQATNLKDVELPTLLPGIRVNTSPTDYRPLTQVQLQKWDGKAWVRFGDV
FT                   LGA"
FT   sig_peptide     complement(122491..122574)
FT                   /locus_tag="Rpal_0110"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 28"
FT   gene            complement(122594..123634)
FT                   /locus_tag="Rpal_0111"
FT   CDS_pept        complement(122594..123634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0111"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   gme:Gmet_2235 alcohol dehydrogenase superfamily,
FT                   zinc-containing"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98673"
FT                   /db_xref="GOA:B3Q644"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q644"
FT                   /protein_id="ACE98673.1"
FT                   /translation="MKAAVFEKTGERLVVRDVAAPALGDNELLLKVAFTGICGSDLHAA
FT                   ETPGMLQSGTVMGHEFTGEIVQSTAPDWPVGARVAANPYWLCDACAAGGSCSGGGDAAC
FT                   ANGSFMGFRPDLPGAYADYVRIRAGQAIRLPDKVSLRDGALMEPLAVARHAVDVCGPMQ
FT                   GADVLVIGGGPIGLGVVLMARDAGAARVVVSEPDPNRRACALQVGAVAAIDPIAEDLPT
FT                   ALGGLGLGAPGIVFECVGAPGFLQQTIDVMALRGRAVIVGVCMTEDRVLPRAAIRKEAT
FT                   LKFVLGYTMADFHHVSRYLEEHAATAAAMISRVVSLSELPEIFDRLRAEKSLIKVLVRP
FT                   DQGSGT"
FT   gene            complement(123664..125412)
FT                   /locus_tag="Rpal_0112"
FT   CDS_pept        complement(123664..125412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0112"
FT                   /product="thiamine pyrophosphate domain protein
FT                   TPP-binding"
FT                   /note="PFAM: thiamine pyrophosphate protein domain protein
FT                   TPP-binding; thiamine pyrophosphate protein central region;
FT                   thiamine pyrophosphate protein TPP binding domain protein;
FT                   KEGG: mjl:Mjls_2332 thiamine pyrophosphate enzyme TPP
FT                   binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98674"
FT                   /db_xref="GOA:B3Q645"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q645"
FT                   /protein_id="ACE98674.1"
FT                   /translation="MSAATSSAGDWLEGGELLARTLRDAGVDTVFALHGGHLESFYRGC
FT                   IANDIRLVDFRHESSAGHAADGYARATGKLGVCVITAGPGFTNGVTAILNAQLDSIPTL
FT                   FIVGSPPLREAETNALQGGVDQIAVTLPMVKYAHRITNTERIPDLTALAIRKATTGRRG
FT                   AVLLDVPIDVLHMRAHKDDVRPAHGLNINPRPAPHPDEIKAAIAILKASERPVIVVGGE
FT                   ARYSNCRDDLVALAEATQIPVVSNTRGMGVFPSSHPLNGQVVGNLALLSARRPDAALLL
FT                   GTRFGFRLAGRSTAFFPDDAKLIQVHSDAAELGRLRHVELPIVADVGAALTTLRTAAAA
FT                   ETWPQRPAWIEAVTKAPAKMLDMFPNKQGPKGIHPFWAAEAAVRAAGPDAAIVLDGGEA
FT                   ASWAAFHLRSNQPGHVQGVGYLGCLGTGPGQSIGAQLVDPDKRVMQITGDGAMGFHIQE
FT                   FDTMSRHRLPICTIVLNNEIWGMSIHGQQIMYGANYSAISELRGTNYASVAAAFGCHAE
FT                   RVTEFDEIEPAIARAYASGQPSCIEIMIDPDVVHPVTVAALGTISDEKREIMIPYYENI
FT                   PIRPQA"
FT   gene            complement(125453..126241)
FT                   /locus_tag="Rpal_0113"
FT   CDS_pept        complement(125453..126241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0113"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: hne:HNE_0924 oxidoreductase, short
FT                   chain dehydrogenase/reductase family"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98675"
FT                   /db_xref="GOA:B3Q646"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q646"
FT                   /protein_id="ACE98675.1"
FT                   /translation="MRFNGKVAVVTAAASGIGAATAARLAREGAYVYLSDIDQDALGRQ
FT                   AESLVDVAERISTVVADVTVPEQVSALIDGAARERGRLDILINNAGMGAFGRITEVTPE
FT                   AWHRVFGICVDSIFHASRAAIPHLIKARGTIVNTASISGLFGDYGFAAYNAAKGAVINL
FT                   TRNMALDYSRDGLRVNAVCPGLIATPLSLKLRDNAAVMAEYDRLIPLGRAGSPEEVAGA
FT                   IAFLASDDASYITGVAFAVDGGLTARTGQPNFLGHLAPKP"
FT   sig_peptide     complement(126173..126241)
FT                   /locus_tag="Rpal_0113"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.895 at
FT                   residue 23"
FT   gene            126442..127104
FT                   /locus_tag="Rpal_0114"
FT   CDS_pept        126442..127104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0114"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: hne:HNE_2415
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98676"
FT                   /db_xref="GOA:B3Q647"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q647"
FT                   /protein_id="ACE98676.1"
FT                   /translation="MPPREQTREELRQKIIAGARALLSETESAEFSMRALAARANVAHM
FT                   TPYNVFGSKQAVLLAVLDADMADFTRAVQERDVADPLSELYEVVGLCAEFWFSEPVFYK
FT                   TLYRELLDLKGAPHQATATPLRDGFWRRLTHALAEQGYLQSFVAEEPLSMNLRRIALQA
FT                   ISVWIARDLSKREVEAELGYSISLALLGVTAPASSSLVLTRLLNYQAIIEEAGARDG"
FT   gene            complement(127157..127945)
FT                   /locus_tag="Rpal_0115"
FT   CDS_pept        complement(127157..127945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0115"
FT                   /product="protein of unknown function DUF81"
FT                   /note="PFAM: protein of unknown function DUF81; KEGG:
FT                   mrd:Mrad2831_4756 protein of unknown function DUF81"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98677"
FT                   /db_xref="GOA:B3Q648"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q648"
FT                   /protein_id="ACE98677.1"
FT                   /translation="MHELIAEASASFLSTLPSPMAIVGVLSAVLAAALLRGFTGFGFAL
FT                   AAVPLMGMFMPPAKAVPVAVLLQLLGGLNDLRRNHRDAHWASLRWLIVGAVIGSPIGAL
FT                   ALSVAPAPVARIVIATITAAAVVVLGRGFAIEKIPSRPVTTAVGMLCGLFNGLAAMPSP
FT                   PAIVYYMSGPFRAVAVRASLLVFFLATSIAGFTSIALVGLATVNVLWLAAMALPVMMLG
FT                   TWIGEQGFRRGTERLHRRVSIASLGGVALLSAAKGLSELM"
FT   sig_peptide     complement(127805..127945)
FT                   /locus_tag="Rpal_0115"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.839) with cleavage site probability 0.586 at
FT                   residue 47"
FT   gene            complement(127954..129465)
FT                   /locus_tag="Rpal_0116"
FT   CDS_pept        complement(127954..129465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0116"
FT                   /product="Aldehyde Dehydrogenase"
FT                   /note="PFAM: Aldehyde Dehydrogenase_; KEGG:
FT                   mrd:Mrad2831_4757 aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98678"
FT                   /db_xref="GOA:B3Q649"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q649"
FT                   /protein_id="ACE98678.1"
FT                   /translation="MINIATRINPAIAPAVSEVISQLQARHLIGNTLVPSVGGATLDVI
FT                   DPATGQVIGKAPAASGDDVARAVEAASAAFPGWAATPARQRGKLIAAAASAIAERSDVI
FT                   ATVLALETGKAIRTECRGEVATAIDITTMYAGLASELKGETLPFDPQILTYTSREPLGV
FT                   VAAILPWNVPLVLMMLKIAPALVAGNTVVVKASEEAPYATIEMARLMARLLPDGVLNVI
FT                   CGTGRDCGAALVEHPAVAKVTFTGSQAVGELIYQMAAKKIIPVSLELGGKSPMIVYPDA
FT                   DMARVVAGAIAGMRFTRQGQSCTAASRIYVHTTLIDAFVAALREAVSKLKIGDPLDEAT
FT                   DIGTVISPRQKAKVESYIDLGARTAGAKVDRCGELPGAAHLKDGLFLQPTIITGVPEDS
FT                   PLMREEIFGPVVCVQPWDDEDDVIARANDSDFGLAATVWTNDLRSALRTVQRLDAGYVQ
FT                   VNQNLTIQPNLSYGGFRKSGLGKEASLEAMLEHFTKKKTVVIDMR"
FT   gene            129677..130084
FT                   /locus_tag="Rpal_0117"
FT   CDS_pept        129677..130084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0117"
FT                   /product="protein of unknown function DUF1486"
FT                   /note="PFAM: protein of unknown function DUF1486; KEGG:
FT                   mrd:Mrad2831_4758 protein of unknown function DUF1486"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98679"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q650"
FT                   /protein_id="ACE98679.1"
FT                   /translation="MSDLDTQRLQTLDQLFDAFNRHDGAAVMAAMTDDIVFDAAAGPEA
FT                   CGRRIVGTADVRAAFETTFTTFPDVSWECTRHAVFGDRGISEWIFRATTKDGGRIEAEG
FT                   VDLFGFRGNKICSKSAFRKDRPVLPPTGASA"
FT   gene            130081..131475
FT                   /locus_tag="Rpal_0118"
FT   CDS_pept        130081..131475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0118"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   mrd:Mrad2831_4759 FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98680"
FT                   /db_xref="GOA:B3Q6Z2"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q6Z2"
FT                   /protein_id="ACE98680.1"
FT                   /translation="MNKPVKTPPLAAYDPHYDPLVSEGPGRNRDYAPTYWTATCGPLPE
FT                   DDGPISRDTDVDVAIVGSGFTGLASAVFLAREHGIKAAVLEANRVAWGCSTRNGGQGQN
FT                   AAGRLTRSQWIERWGRDVALKLHAEISDGFETFEELIRQSPIDSEPQRGGHLYIAHRQR
FT                   NFEKIAAEAKVLSEVFGEPTKVISADELRRDYVNEAEAVGATLEPRGTGVHPAKLAFGY
FT                   QQMARDLGATVHPGSPVIEIEHRGGAFYLRTPGGTVKARAVGIATGAYTAPGLTPLLRG
FT                   RCMPILSNSIVTRPLTPAELEATGFKTKLVLTDTRTLRYYYRLLPDNRIQIGSRSSITG
FT                   ADADAPKHLQLLIDGLHRKFPALQGIEIDYSWWGWVDVSHDMMPRIFQPDPAQKLVYAL
FT                   GYGGNGVSYSAQAGRRMAQMIAGQRFKGQDLPIFTSPLPTHSFSPFRRIGQRMLYRWYH
FT                   FRDEAA"
FT   gene            complement(131599..131952)
FT                   /locus_tag="Rpal_0119"
FT   CDS_pept        complement(131599..131952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0119"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: xau:Xaut_4360 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98681"
FT                   /db_xref="GOA:B3Q6Z3"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q6Z3"
FT                   /protein_id="ACE98681.1"
FT                   /translation="MHPFRWQRSRQRSSALSFLKKAFYQIPVIGWLVKDAAHGSPEAPY
FT                   FFLFNAVVVGAALIYTFGYPLVITVAVAGAFAGIAGLVVLTAGDAFDKRAKQPATDVRR
FT                   AKTATVRPLKKAA"
FT   gene            132295..133356
FT                   /locus_tag="Rpal_0120"
FT   CDS_pept        132295..133356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0120"
FT                   /product="dTDP-glucose 4,6-dehydratase"
FT                   /note="TIGRFAM: dTDP-glucose 4,6-dehydratase; PFAM:
FT                   NAD-dependent epimerase/dehydratase; short-chain
FT                   dehydrogenase/reductase SDR; 3-beta hydroxysteroid
FT                   dehydrogenase/isomerase; polysaccharide biosynthesis
FT                   protein CapD; dTDP-4-dehydrorhamnose reductase; Male
FT                   sterility domain; KEGG: azc:AZC_1833
FT                   dTDP-D-glucose-4,6-dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98682"
FT                   /db_xref="GOA:B3Q6Z4"
FT                   /db_xref="InterPro:IPR005888"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q6Z4"
FT                   /protein_id="ACE98682.1"
FT                   /translation="MTKRFLVTGGAGFIGSAVVRRLIGTTPHEVLVVDKLTYAGNLDSL
FT                   APVSDDPRFRFVRADIVEQGTMRLLFEEFSPDVVMHLAAESHVDRSIDGPGDFIQTNIV
FT                   GTYSLLQAALAHWRSLPAARKSGFRFHHISTDEVFGSLGAEGLFREDTPYQPKSPYSAS
FT                   KAGSDHLVRAWHHTYGLPVVITNCSNNYGPYHFPEKLIPLAIIKALHGEAIPVYGTGAN
FT                   VRDWLHVEDHADALLLAAERGENGESYNIGGRNERTNLEVVQAICRLLDELAPDAAIGS
FT                   RAKLISFVADRPGHDARYAIDASKVERELGWRARYNFDDGLRQTVQWYLDNRTWWERVR
FT                   SGVYRGERLGVAV"
FT   gene            133382..133939
FT                   /locus_tag="Rpal_0121"
FT   CDS_pept        133382..133939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0121"
FT                   /product="dTDP-4-dehydrorhamnose 3,5-epimerase"
FT                   /EC_number="5.1.3.13"
FT                   /note="KEGG: rru:Rru_B0038 dTDP-4-dehydrorhamnose
FT                   3,5-epimerase; TIGRFAM: dTDP-4-dehydrorhamnose
FT                   3,5-epimerase; PFAM: dTDP-4-dehydrorhamnose 35-epimerase
FT                   related"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98683"
FT                   /db_xref="GOA:B3Q6Z5"
FT                   /db_xref="InterPro:IPR000888"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q6Z5"
FT                   /protein_id="ACE98683.1"
FT                   /translation="MLTVTSTAIEAVKIITPRAFADSRGTFSETYNRQRFVDHGVALEF
FT                   VQDNQSISAAVGTVRGLHFQSAPFAQDKLVRVAKGRILDVAVDLRRSSPTYGQWVAEEL
FT                   SAEDGKQLLIPIGFAHGFCTLEPDTVLAYKVTNYYSPPHDLGIAWNDPDLAVRWPVTAD
FT                   QAVLSDKDLKLPPFASLPNYFE"
FT   gene            133944..134837
FT                   /locus_tag="Rpal_0122"
FT   CDS_pept        133944..134837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0122"
FT                   /product="dTDP-4-dehydrorhamnose reductase"
FT                   /EC_number="1.1.1.133"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase;
FT                   dTDP-4-dehydrorhamnose reductase; Male sterility domain;
FT                   KEGG: rle:RL1624 putative dTDP-4-dehydrorhamnose reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98684"
FT                   /db_xref="GOA:B3Q6Z6"
FT                   /db_xref="InterPro:IPR005913"
FT                   /db_xref="InterPro:IPR029903"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q6Z6"
FT                   /protein_id="ACE98684.1"
FT                   /translation="MRIVVTGRHGQVAQALHERAAGTNAEIILLARPEIDLTRPSEIEG
FT                   VLIALKPDAVVNAAAYTAVDQAESEHDLAYAINAEGAGAVARTAAKLGVPMVQLSTDYV
FT                   FDGTAEQPYRETDPTNPLSAYGASKLAGERAVAEAAPDHAVLRTSWVYSPFGKNFVRTM
FT                   LALARQRDEVRVVCDQVGSPTSALDIADGVLGVVRNLLAEPTRSDMRGIFHMTADGTAT
FT                   WAAFAEAIFAASRAAGGPSAKVIPIPTTEYPTPAKRPTNSRLDSSALATAHGIRLPHWR
FT                   QSLQPCIERLLAQDAN"
FT   gene            134839..135714
FT                   /locus_tag="Rpal_0123"
FT   CDS_pept        134839..135714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0123"
FT                   /product="glucose-1-phosphate thymidylyltransferase"
FT                   /note="TIGRFAM: glucose-1-phosphate thymidylyltransferase;
FT                   PFAM: Nucleotidyl transferase; KEGG: ccr:CC_1141
FT                   glucose-1-phosphate thymidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98685"
FT                   /db_xref="GOA:B3Q6Z7"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005907"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q6Z7"
FT                   /protein_id="ACE98685.1"
FT                   /translation="MITKGIILAGGSGTRLHPMTAAVSKQLMPIYDKPLIYYPLATLMM
FT                   AGIRDILVISTPADLPRFHQLLGDGASWGMSFSYAEQPKPEGLAQAFIIGADFVAGQPS
FT                   ALVLGDNLFYGHDLIPLLRNAARHPEGATVFAYQVSDPERYGVVEFDSDQVARSIEEKP
FT                   ARPRSNWAVTGLYFYDQDVVEIAANLKPSARGELEITDVNRTYLERGKLRVEKMGRGFA
FT                   WLDTGTPDSLIEAGEFVRVLEKRQGFKICCPEEIAFRFGWIDARQLERLAQPLAKSNYG
FT                   GYLLKLAASP"
FT   gene            135802..136692
FT                   /locus_tag="Rpal_0124"
FT   CDS_pept        135802..136692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0124"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: azc:AZC_3956 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98686"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q6Z8"
FT                   /protein_id="ACE98686.1"
FT                   /translation="MPKKLSDYTLADWTHLRPLSQGLKTARYNRIDRRYRQQPAKVGDP
FT                   AAVAKMITGRRALFTVAYQDPQAIDLQIPLIRLFVPGALYIVVDNSPDDDRAAEIERIS
FT                   AAHGVPYLRAPENPWQKSSRSHGIVLNWIWHNIIRPGAPEMFGLLDHDLFPTAPDDPFA
FT                   PLATQDVYGYVRTTEPPSERWFLWAGFTMMRFSAVRDLPLDFGQDWFLGLDTGGGNWGP
FT                   LYSKLDLAKLQQSPSRFVPYREGLATYDGPFQWCGTWLHEVGQMGEPEIMRDKRRVVVE
FT                   LLAPHLEAARNLPPR"
FT   gene            136785..139064
FT                   /locus_tag="Rpal_0125"
FT   CDS_pept        136785..139064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0125"
FT                   /product="GAF sensor signal transduction histidine kinase"
FT                   /note="PFAM: GAF domain protein; ATP-binding region ATPase
FT                   domain protein; histidine kinase A domain protein;
FT                   Phytochrome central region domain protein; PAS fold-2
FT                   domain protein; KEGG: ava:Ava_1003 multi-sensor signal
FT                   transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98687"
FT                   /db_xref="GOA:B3Q6Z9"
FT                   /db_xref="InterPro:IPR001294"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013515"
FT                   /db_xref="InterPro:IPR013654"
FT                   /db_xref="InterPro:IPR016132"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q6Z9"
FT                   /protein_id="ACE98687.1"
FT                   /translation="MGEADSGGIVTARNVDLSSCDRELVQYPEAIQPHGAMLTVDEQSD
FT                   RVLHASANCAAFIGKPPEAVIGAPIAAVLGAGWHELLGSLHRMPLDSGPVNIARESFLG
FT                   SDQGWHLFAHRCGGLIILEFEKAEPEAAGTTSNLYSEVRADLAALQATEGVQAFFDLAV
FT                   ERIRSFTGYDRVMAYRFAEDGSGQVIAEARRDDLEPYLGLHYPATDIPAPARRLFALSW
FT                   VRHLPDVGYTPVPLLAAKSPLVTGPVDMSFASLRSVSVMYTGYLKNMGVQSTLVMPLVK
FT                   EGRLWGLISAMHHAAPRHISHQMRMAAEFLAHTLSLLMSAKEDAEQFERSSARKAAAEA
FT                   LTRLLDSEADIGAALHAAGALDLLSALIDAGGVVVQTGDEVATRGEAPAAAPLHELTSW
FT                   LRERARPVFATDRLPSLDPAAQAIASQASGVLALRPLPDQPILIAWLRPEQIEDVQWAG
FT                   DPRKPVEISEADGMQRLRPRNSFALWKESVQGRAVPWRDDEKDAATQLAAAIAEIAAAR
FT                   KGRIERINRALDASHSELSRYTDVASAELKEHLRGIHHLTTSLRRRQGEVLDEEGRQQV
FT                   ATILKLTQRMDALVDALLDRSRGGSEAASETVDLDAVVDDALAPFARRIAEDRIDVRRP
FT                   MRLGTAQGHREWIGEVFTNLIGNAIRYNDKPERWIEIGVEDGSPPRYYVRDNGIGIADT
FT                   DQQLVFQMFHRVDQSEQKAEGAGVGLAMTRRIVAHHGGRIWVQSRLGDGATFYFTLAPD
FT                   EEQHDA"
FT   gene            139057..140697
FT                   /locus_tag="Rpal_0126"
FT   CDS_pept        139057..140697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0126"
FT                   /product="TrkA-N domain protein"
FT                   /note="PFAM: TrkA-N domain protein; Ion transport 2 domain
FT                   protein; KEGG: eba:ebA5259 putative KTN NAD-binding domain
FT                   involved with K+ transport precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98688"
FT                   /db_xref="GOA:B3Q700"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q700"
FT                   /protein_id="ACE98688.1"
FT                   /translation="MRSIVRLGLSRLRPPLILLALVFAASTLGLMLIPGVDAQGHPWRM
FT                   TLFDAFYFVTYTATTIGFGELPHPFTNQQRGFVTVIIYLSVIGWAWLLGSLLSLVQEKA
FT                   FQQALVDRRFRRAVEKLDQPFYLVCGLGDTGMTVVHALRQLGCRLIAIDKDERTVQQLE
FT                   IEGLNGKAPALIADARSPETLTAAGLMKAECKGVLTLCNDDEVNLAVAITASILRPGLP
FT                   VIGRADTSATAASMSSLGTHRVINPFREFAEHLTLAMRAPDVYRLIAWLTSAPGAYLFP
FT                   SAPARMPAAPGHWIVCGYGRFGREVVAAVQRGGFTSAVIDPVGSRIDGHHAVHGRGADV
FT                   AALHEAGIGHASGIVAGTDDDAENLAIALAARRLKPEIFVITRQNQRSSRMLFAKLGAD
FT                   ITMVPSEIIANQCLAALRTPLLADFLEAARHQDAFWAFTLSERLRAALGNETPQFWSTV
FT                   LDADHAPNLVGSDGALKQPLTVAELCVDPEHQDAAHPLRRRAIVLRLIRGDSTIETPAD
FT                   DAVLQPGDTLLCVGSAAVRATQQRRLGGR"
FT   sig_peptide     139057..139173
FT                   /locus_tag="Rpal_0126"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.991) with cleavage site probability 0.820 at
FT                   residue 39"
FT   gene            complement(140704..141528)
FT                   /locus_tag="Rpal_0127"
FT   CDS_pept        complement(140704..141528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0127"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: bja:bll4141
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98689"
FT                   /db_xref="GOA:B3Q701"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR026575"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q701"
FT                   /protein_id="ACE98689.1"
FT                   /translation="MKFVVLTDTHFVARGRRIYGLDPAERLSAAVARINREHPDIAFVI
FT                   VTGDLAHWGEEPAYDNLASVLAGLRAPTILMMGNHDKREAFAKFFPGVPRDASGFVQTV
FT                   QVFEAATIVTLDTLNEAAPNHEGLLCEARLAFLEHALAEAPADRPLLLFQHHPPFDTGL
FT                   RYMDTIRLANPDAEWEVIARTRKPDYLFMGHLHRPISGVWRGIPFHIQRGLAHQVAFDL
FT                   VAEGHIPGSHEPPDYAHVSVEADRIVIHQCSFMYDGPLFSLHDSVALHRVSF"
FT   gene            complement(141525..142349)
FT                   /locus_tag="Rpal_0128"
FT   CDS_pept        complement(141525..142349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0128"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: mlo:mll3631
FT                   3',5'-cyclic-nucleotide phosphodiesterase, CpdA"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98690"
FT                   /db_xref="GOA:B3Q702"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR026575"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q702"
FT                   /protein_id="ACE98690.1"
FT                   /translation="MKLIHLSDIHLTTPGGTIGGRNPRLNFERALTHILRDHHDAELMV
FT                   ITGDLSDWGDAEDYRWLKAQLGAFPIPVRLCIGNHDRRENFLSVFPEFADDDGLVQGVC
FT                   DTPAGRCLLLDTAEAGTHAGRYCETRRAWLTRQLAEHPGPFLLFMHHNPMPTHLGPMDQ
FT                   IRLLDDGAFGQIVGRHRDRIRHIFFGHCHLPLAGSVAGVPVSSLRGTNHASYPLFSERR
FT                   MLSASDLPESYGVVFFGDDYVTVHMVEFGYTGEVRVEGSPDYNAWNRETMLR"
FT   gene            complement(142414..143694)
FT                   /locus_tag="Rpal_0129"
FT   CDS_pept        complement(142414..143694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0129"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: bcs:BCAN_B1211 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98691"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q703"
FT                   /protein_id="ACE98691.1"
FT                   /translation="MLKRWIAAAAMTLVAGIAHAQQQTEVVLQFPYPELFSETHKRIAE
FT                   EFAKVHPEIKVTFRAPYESYEEATQKVLREAVTNQLPDVTFQGLNRIRVLVDKTIPAPL
FT                   DGYIAAEKDFDKQGFHQAMYDIGTASGKVYALPFAISLPIVYVNLDLVKQAGGDVNNLP
FT                   TTWDGLLDLAKKVKALGPDTNGITYAWDITGNWLWQAPVFARGGTMLNADETKVAFDGP
FT                   EGQFAMRTIARLVTEGGMPNLDQPSMRATFAAGKTGIHITSTSDLKKTTDMIGGKFALK
FT                   TIAFPDVVKPNGRLPAGGNVVLITAKDKAKRDAAWEVVKFWTGPKGAAIMAETTGYMPP
FT                   NKVANDVYLKDFYAKNPNNYTAVSQLALLTKWYAFPGDNGLKITDVIKDHLNSIVSGAR
FT                   AKEPDAVLADMTRDVQNLLPKTVGAAK"
FT   sig_peptide     complement(143632..143694)
FT                   /locus_tag="Rpal_0129"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 21"
FT   gene            complement(143717..144553)
FT                   /locus_tag="Rpal_0130"
FT   CDS_pept        complement(143717..144553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0130"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bcs:BCAN_B1212 lactose
FT                   transport system permease protein LacG"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98692"
FT                   /db_xref="GOA:B3Q704"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q704"
FT                   /protein_id="ACE98692.1"
FT                   /translation="MSAARPSLIRSSFRHAALMVGAVLMLAPFVWMLSTASKPPEEIYS
FT                   SDLHLIPHHFALWENLRIAFGKADLGRFLLNGVIVTVAIFTCQVLIALPAAYALAKLRF
FT                   LGRKALFALVLFGILIPPQATAIPVFLLLHQLGALDSYAALVLPFTISVFGIFLMRQFF
FT                   MTVPDDLLDAARMDGMSEFAIVWRVMLPTAIPAVTAFGIFSVVAHWNDYFWPLIVLNSQ
FT                   QYYTPPLAVAHFRNAEAGTSYGPLMAAAIVIITPLVVAFLLAQRRFIEGITLTGLK"
FT   sig_peptide     complement(144440..144553)
FT                   /locus_tag="Rpal_0130"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.987) with cleavage site probability 0.506 at
FT                   residue 38"
FT   gene            complement(144550..145509)
FT                   /locus_tag="Rpal_0131"
FT   CDS_pept        complement(144550..145509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0131"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: oan:Oant_1668
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98693"
FT                   /db_xref="GOA:B3Q705"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q705"
FT                   /protein_id="ACE98693.1"
FT                   /translation="MSEVAMSDAAVSLRDLDALTTARASAKPRRRGRGTVAYGLVAPAF
FT                   TLMLLMLLGPLAGVIALSFTDYQLGAPSFAWIGLANYQQLFADRVFWISLINTLTYAVI
FT                   VVPGSVALGLGVAMLIESGTHLRAFYRTIYFLPVMATLIAMAIVWEFMLHPQFGLVNGL
FT                   IKMVGLAPHPWLQDRGTALYALCAIGIWQAVGFNMVLFLAGLMSIPKHLYDAAEIDGAA
FT                   SAWSRFRLVTWPMLGPVTLFVVVITGIRSFQVFDTVHVLTKGGPSKSTEVLIHTMYMEG
FT                   FEFFRSGYAAAVTVVFLGLVLLLTLVKSRLAAKQVHYA"
FT   gene            complement(145502..146656)
FT                   /locus_tag="Rpal_0132"
FT   CDS_pept        complement(145502..146656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0132"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; TOBE domain protein;
FT                   Transport-associated OB domain protein; SMART: AAA ATPase;
FT                   KEGG: sil:SPO1823 sugar ABC transporter, ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98694"
FT                   /db_xref="GOA:B3Q706"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q706"
FT                   /protein_id="ACE98694.1"
FT                   /translation="MAKIELSAIRKSFGDTEVLKGVDLSIHDGEFVSLVGPSGCGKSTL
FT                   LRVIAGLEPQSSGEVKIGGVAVDHVRPSARNLAMVFQSYALYPHLSVFDNIAVPLRMKR
FT                   LSALERASLLGRLIPNRYRVERGIRADVERVASQLEISPLLARKPGQLSGGQRQRVAVG
FT                   RALVREPVGFLFDEPLSNLDAKLRVHMRAEIAQLHRRLKATFVYVTHDQAEAMTMSGRI
FT                   AVMIGGELVQVGTPSDVYDNPRDIRVAEFIGSPKINVLPGAVQTDGRFVMLDRVLAARA
FT                   TAGAGPCRVAIRPERLSLGGGDLSGVVVHVENMGAEAFVHLSCDGLTDPVVIRLDDPLR
FT                   LPAIGSTQRFGFAPEAIRLFDAGGKRIAIRTEASVEIIREVAHV"
FT   gene            146784..147662
FT                   /locus_tag="Rpal_0133"
FT   CDS_pept        146784..147662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0133"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: sme:SMb21535 putative
FT                   transcriptional regulator, LysR family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98695"
FT                   /db_xref="GOA:B3Q707"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q707"
FT                   /protein_id="ACE98695.1"
FT                   /translation="MALTSARVRAVNAVFDAGSFAAAARRIGVTQSAVAQSVRELEGEF
FT                   GVTLFERHGANLIPTSLCRQLYGATSRMQAVETDALSILSQREELAGGELRVGLGNSMP
FT                   GMALIATFKQMYPKVQVAIEIGSWSAIVAAVVDQRVDIGVLPDVPADRRFRREICLEQR
FT                   VVALCHPSHPLKKKQQVPIAELMRYPLVFRTRDSSTQRAVDRAFRAASLRPIPSIVVNT
FT                   REGMLEAVANHLGVGFMWEHGSSRVDRIAKVPIAELDAESPECIFALAGKKGRLVELFF
FT                   LANGAHSPPRE"
FT   gene            complement(147668..148363)
FT                   /locus_tag="Rpal_0134"
FT   CDS_pept        complement(147668..148363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0134"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: smd:Smed_4541 sulfate ABC transporter, ATPase
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98696"
FT                   /db_xref="GOA:B3Q708"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q708"
FT                   /protein_id="ACE98696.1"
FT                   /translation="MSQPLLQFRDVQFGYQAPLLHGISFDVAAGSITAVMGPSGSGKST
FT                   LLALAAGLLTPDAGAVHRRSARLGMVFQDPALLPWRTALDNVAFPLIALGLRQRERRDR
FT                   ARAMLAAVGLSGDDAGKYSRQLSGGMRQRVALARALVIEPDLLLCDEPFSALDALVRAE
FT                   LWRIVRDIHDRSGLTMLIVTHDGPEAMQCDRLAILSAGRLEQVGAPAEILRHPASDVVR
FT                   TFVAAATGN"
FT   gene            complement(148360..149133)
FT                   /locus_tag="Rpal_0135"
FT   CDS_pept        complement(148360..149133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0135"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: xau:Xaut_4037
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98697"
FT                   /db_xref="GOA:B3Q709"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q709"
FT                   /protein_id="ACE98697.1"
FT                   /translation="MRGSARVSWAWSLVGIALLLALWEAGHRAYGPLVLPGLGDTVLTL
FT                   WRMIRAGQVGPALLETAGNAGLGWIIGVLIGSCAGMLAGLREEAQRALQPVAIILLGVP
FT                   AIAWVVLALLWFGGRWAVVVTVAAATGPMLFAAALEGVRSLDGTLARMAQVYQVPLSAR
FT                   LTEVYGPQLLSHLFPALVTTLAMSWKVAVMAELLAGAGGIGDGLATARAHVDTAETMAW
FT                   VVVVVGVLIVVDVGVLQPLQRRLWLWRDDERGGGR"
FT   gene            complement(149123..150115)
FT                   /locus_tag="Rpal_0136"
FT   CDS_pept        complement(149123..150115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0136"
FT                   /product="ABC transporter substrate-binding protein"
FT                   /note="KEGG: sth:STH760 ABC transporter substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98698"
FT                   /db_xref="InterPro:IPR027024"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q710"
FT                   /protein_id="ACE98698.1"
FT                   /translation="MSPPQHLIPTRRDVVRGLAALPALGLTRTFAAEPLTLWGIPATPS
FT                   ALFVRAVASEQLQQAAPGIRFQLWKSTDQMRAGIASGQFRLFATSTYAAANFFNRGAGT
FT                   RMLNVVTWGVLYVMARDPAIRSVADLAGRSILLSNKNEAPDLLFRLVLRWAGLDPDRDV
FT                   RCEYVGSPGEAVPLFLAGRSDVAVLHEPAATTALLRAKQEGKPVYRVLDIAELYGRHAG
FT                   RGPRIPQVGLAVSADLLDTQPGLVAAVQAACVEASTWIAAHPAEAAELAAPALGLPAEV
FT                   IAASLPHVRLDVVPARQARDDIEMYFKNLMELDPGIVGGRLPDAAFYAG"
FT   sig_peptide     complement(150020..150115)
FT                   /locus_tag="Rpal_0136"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.793) with cleavage site probability 0.793 at
FT                   residue 32"
FT   gene            complement(150131..151990)
FT                   /locus_tag="Rpal_0137"
FT   CDS_pept        complement(150131..151990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0137"
FT                   /product="hydrogenase, Fe-only"
FT                   /note="TIGRFAM: hydrogenase, Fe-only; PFAM: ferredoxin;
FT                   4Fe-4S ferredoxin iron-sulfur binding domain protein; iron
FT                   hydrogenase small subunit; hydrogenase large subunit domain
FT                   protein; KEGG: dvu:DVU1771 [Fe] hydrogenase gamma"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98699"
FT                   /db_xref="GOA:B3Q711"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR003149"
FT                   /db_xref="InterPro:IPR004108"
FT                   /db_xref="InterPro:IPR009016"
FT                   /db_xref="InterPro:IPR013352"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019574"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036991"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q711"
FT                   /protein_id="ACE98699.1"
FT                   /translation="MCTPDQASLSARDPAEATITLSINGVACAGFANETILSCARRYDV
FT                   YIPTLCELEDIDHTPGACRVCLVEILQAGKDTPQIVTACNTPVRDGMEVQTRSKKARDM
FT                   QRLQVELLMADHLQDCATCIRHGSCELQDLAQFVGLQQNRFFDRERTESRPVDHSSPSM
FT                   VRDMRRCVRCQRCVAICRYHQKIDALAIEGSGLERMVALRDADGYPNSVCVSCGQCVLV
FT                   CPTGALGERDETDRALDYICDPEVVTVVQFAPAVRVAFGEEFGLPAGTNVEGQIIAACR
FT                   KLGVDVVLDTNFAADVVIMEEGAELLARLKQGRRPTFTSCCPAWINFAEIHYPDVLPLL
FT                   SSTKSPQQVLSTIAKSYLPAQLGVPAERIRVISIMPCIAKKDEAVRPQMVHDGQPETDL
FT                   VLTTREFARLLRREGIDLKDLPSSQFDRPFLSAYSGAGAIFGTTGGVMEAAVRTIYALV
FT                   NGRELDRIELTQLRGFEGLREATVDLGGPVGEVKVAMVHGLGDTRRLVESVLSGEANYD
FT                   FIEVMACPGGCVDGGGSLRSKKAYLPLALKRRETIYNVDRAAKVRQSHNNPQVQVLYRE
FT                   LLQAPNSEIAHRLLHTHYASRKRELQHTVKEIWDDLTMSTILY"
FT   gene            complement(151995..153986)
FT                   /locus_tag="Rpal_0138"
FT   CDS_pept        complement(151995..153986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0138"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: dvl:Dvul_1383 FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98700"
FT                   /db_xref="GOA:B3Q712"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR019575"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037207"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q712"
FT                   /protein_id="ACE98700.1"
FT                   /translation="MTQVVYGVWDGVAYDSRAAEALAANYALANFDEFDEGNAIRAFIA
FT                   DRGFFVFDPTVSLVDALFHYLKAAAEQSCGACTPCRIGTVLVRDALDQMRRGLDAALTL
FT                   DDIVMLGEQIRQTSLCGLGQTCAVALLAALRDFRGRIEQELAQHRPIPAQHGMAYVTAP
FT                   CIEACPSKVNVPRYIDYIRDGKPENSLGVLLQKYPMAATCGRVCVRYCEQACRRKFVDE
FT                   AVGIKTLKRYVADQQSGPHALKFTRDMIRKPLADGMRVAVVGAGPAGISCAYHLLLRGY
FT                   HVDVFDKAGQAGGMAQIGIPSYRLPKDTLALETDIIVDLGGRFLFDQRLGRDFSVDDLF
FT                   ARGYRAVFLGLGCQQGARLGVDGEDAAHGGYFSGIDFLLKVHDHVDGIAPLVLQGEVVV
FT                   VGGGNVAMDCVRSAIRLGAEKVHVVYRRTLADMPADPAEIEAARAEGVEFHVLTAPAEI
FT                   VTDHGKVTGVVLTRMQASEPDAGGRRSVKPVPGSETSMRCDVLIAAIGQQVEDGPLIES
FT                   DGIAFDRWRCVATDRVLATSRPGVFAGGDCVTGPSTLVYAMAAGLKAARNIDDWIQRGS
FT                   VRFFKRSRMRKLIADNHMLANEIVAAPVRNAYRVHNPEIDPELRKHMFGEVEQTIDARA
FT                   AYAETQRCMRCYRVYSVVTKHPIPEGAA"
FT   gene            complement(154156..155865)
FT                   /locus_tag="Rpal_0139"
FT   CDS_pept        complement(154156..155865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0139"
FT                   /product="putative methyl-accepting chemotaxis sensory
FT                   transducer"
FT                   /note="KEGG: bja:blr2350 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98701"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q713"
FT                   /protein_id="ACE98701.1"
FT                   /translation="MSSLKHPIADAVASIELVASRIETTFAQVGGQLGEGHGIFQGLNE
FT                   ALADLARELSSAQIEGASGALRDIAGRLKSLADTLPAESALLDQLRRNVAEAGALLKQL
FT                   LKHVEMITTIARSAKIESASLEGDREGFIAFTREAYDLGRAVQSSIEACVKDQQLLAAA
FT                   VETTWGRQSEFERRYRPQLGASGGELMSAFADLGRQRNDSVGVAELAGSSARTISDVVG
FT                   RSIISLQAGDSTRQRLEHVCEGLRRAADPEPTLVPDMTEVQPLPRLLVNLEAVQLHDTQ
FT                   QEFDAGIGDIVRALSTILTEVATLVEKGRSLHGGREGGSASFLSRVRQTLAQASSLIAM
FT                   CEDGGRSIDEALSVVENTLEKFRDAIANLSDSVVDISLIGMNAGLRAGHLGAKGRAFVV
FT                   IAHEMKLTADQMTGAAVRLRPLLSEIAKVGDDLRKSRVSSDQTKLTSMENAILQTLHDV
FT                   EAGNDRLGGLIGRLIEEGAKFDAVMNGAREQMTSLGSSASTLPTVAKCLEDAVGDLGRA
FT                   SFGDQDEAVLDELYARYTMERERDVHRQFLLPFGITAKQAAPAANDCDFELF"
FT   gene            complement(155870..156961)
FT                   /locus_tag="Rpal_0140"
FT   CDS_pept        complement(155870..156961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0140"
FT                   /product="response regulator receiver modulated CheB
FT                   methylesterase"
FT                   /EC_number="3.1.1.61"
FT                   /note="PFAM: CheB methylesterase; response regulator
FT                   receiver; KEGG: bja:blr2349 chemotaxis two-component
FT                   response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98702"
FT                   /db_xref="GOA:B3Q714"
FT                   /db_xref="InterPro:IPR000673"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR008248"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035909"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q714"
FT                   /protein_id="ACE98702.1"
FT                   /translation="MAKQKIRVLIVDDSASVRQVLGTILAEDPEIEVIGTASDPFVAAK
FT                   RLQNELPDVILLDIEMPRMDGITFLRKIMAQHPIPVVICSSLTPEGSDLMFEALEAGAV
FT                   DIVPKPRVDTRQALMESSGRLREAIKSAARARVRPRAARKVIEQKLTADAIIPPPVAGR
FT                   SRPTTERIVCIGVSTGGTEALYDVLEVLPPNCPGILIVQHMPQGFTAAFAKRLNAGCQI
FT                   NVKEAEDGDPVLPGWAYIAPGARHMLLVRSGLRYQIAIKDGPPVSRHRPSADVLFRSAA
FT                   QYAGANALGIIMTGMGDDGARGLLEMRKLGAYTCAQDEESCVVFGMPKEAIACGAVEKV
FT                   VSLNQIPREIMAWQQAKQPASAD"
FT   gene            complement(156982..157824)
FT                   /locus_tag="Rpal_0141"
FT   CDS_pept        complement(156982..157824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0141"
FT                   /product="MCP methyltransferase, CheR-type"
FT                   /EC_number="2.1.1.80"
FT                   /note="PFAM: MCP methyltransferase CheR-type; KEGG:
FT                   bja:blr2348 protein-glutamate O-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98703"
FT                   /db_xref="GOA:B3Q715"
FT                   /db_xref="InterPro:IPR000780"
FT                   /db_xref="InterPro:IPR022641"
FT                   /db_xref="InterPro:IPR022642"
FT                   /db_xref="InterPro:IPR026024"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036804"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q715"
FT                   /protein_id="ACE98703.1"
FT                   /translation="MVHAKRQLSDRQFRSLAELIEDQVGIKMPNAKRLMLEGRLHKRVR
FT                   ALNYSGVSEYVDNLFDKAVLDDELTHLIDVVTTNKTDFFREPQHFDFLKTVAVPELLKL
FT                   PNRKSNDLKVWSAACSTGMEAYTTAMVLDDMVRAGARFQFRILGTDISTAVLRVATAAI
FT                   YNREVTAPVPPQFVERYFLTSRDRSREEVRVVPELRRLTNFTRMNLMDSSYPVDRDVDV
FT                   IFCRNVLIYFDRETQRKVVEQLCSHLRPGGYLLVGHSESMIHSALPKLRQVQPTVFKL"
FT   gene            complement(157985..160186)
FT                   /locus_tag="Rpal_0142"
FT   CDS_pept        complement(157985..160186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0142"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: histidine kinase HAMP region domain protein;
FT                   chemotaxis sensory transducer; KEGG: bbt:BBta_7837 putative
FT                   methyl-accepting chemotaxis protein (MCP)"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98704"
FT                   /db_xref="GOA:B3Q716"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q716"
FT                   /protein_id="ACE98704.1"
FT                   /translation="MRLTVKAKLAGAFGVVILLSAITGGIAYVKLTQLAETSEGLVSRS
FT                   QRIDKAGELQNNILYQTRAQRDIIIASTEAELQKVADEVKQYRKDALRIRDEIAAVATE
FT                   AGKRMIEKFSTAYDKMNATEDQIIKFGTLNSNNRGAQLWTSEGAPVVKDWSEAVDSSLA
FT                   EARKLPVSAERANALISILSIRADGEAVQKDLALSFYASNLEDLSSTIKALGDATERLR
FT                   SSSQQSVAALSAVGLSSSAITSQSERFAKIAGRVSDIVKEGGNIRAAALAGTEGRATSM
FT                   AAIQAATDYVNYVKKAMAEMSEQAASDAANAKLLLISIVIASLLAAVASALWIAINISR
FT                   GLAQAVELANAVAIGDLSHKINSTSDDEVGDLVKSLNAMTANLNATAGVADEIARGNLT
FT                   IEAKRLSEKDTLGIALEQMVEKLRQIVSEALTAAQNVSAGSQELSASAEQLSQGATEQA
FT                   SSAEEASSSMEEMAANIKQNAENASQTEKIAAQSAKDAEASGTAVGRAVQAMQTIAEKI
FT                   TIVQEIARQTDLLALNAAVEAARAGEHGKGFAVVASEVRKLAERSQASATEIGELSGET
FT                   VKVAQEAGEMLAKLVPDIKKTSELVQEISSACREQDVGSSQINQAIQQLDKVGQQNASA
FT                   SEQVSSTSEELASQAEQLQSTIAFFRIDQDKAKAHGAPIDKAVNQLRAKAAHMASVDRS
FT                   NKKPQAAKPQRQLKAAGGGGGFAFALGDGEDDRDADFQR"
FT   sig_peptide     complement(160097..160186)
FT                   /locus_tag="Rpal_0142"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.955) with cleavage site probability 0.585 at
FT                   residue 30"
FT   gene            complement(160253..160741)
FT                   /locus_tag="Rpal_0143"
FT   CDS_pept        complement(160253..160741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0143"
FT                   /product="CheW protein"
FT                   /note="PFAM: CheW domain protein; KEGG: bbt:BBta_7835
FT                   chemotaxis protein CheW"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98705"
FT                   /db_xref="GOA:B3Q717"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR039315"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q717"
FT                   /protein_id="ACE98705.1"
FT                   /translation="MAETAQYLTLGLAGETFGMAIRNVREILDMRPISRLPHAPEFMLG
FT                   MIDVRGTGYPILDLRLKLDLPAVPPTEATRIIILDVPVAGRVVGVGFVADCVYEVTDIE
FT                   ESSLEQVPDVGGKWKSDYIAGIGRKGDRFVIIFDLARLMAGTDVSAGAAETPSNDLAA"
FT   gene            complement(160802..161272)
FT                   /locus_tag="Rpal_0144"
FT   CDS_pept        complement(160802..161272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0144"
FT                   /product="CheW protein"
FT                   /note="PFAM: CheW domain protein; KEGG: bja:blr2344
FT                   probable chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98706"
FT                   /db_xref="GOA:B3Q718"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR039315"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q718"
FT                   /protein_id="ACE98706.1"
FT                   /translation="MSSDRVQGATDGDADAMQVVMIGLGDEKFAIDAGLVREIIDPIPA
FT                   TKVAGAKAFVPGVINVRGNVIPFADLRIRFGMPVQTHTADSRIVVLEVRLDNEAVLVGV
FT                   SADRVYEVTEISRTDVQQTPRVGMHWKPEYIRFITKWRDEFVVVPNMERILN"
FT   gene            complement(161272..163338)
FT                   /locus_tag="Rpal_0145"
FT   CDS_pept        complement(161272..163338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0145"
FT                   /product="CheA signal transduction histidine kinase"
FT                   /note="PFAM: CheW domain protein; ATP-binding region ATPase
FT                   domain protein; Signal transducing histidine kinase
FT                   homodimeric; Hpt domain protein; KEGG: bbt:BBta_6737
FT                   chemotaxis protein CheA"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98707"
FT                   /db_xref="GOA:B3Q719"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004105"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037006"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q719"
FT                   /protein_id="ACE98707.1"
FT                   /translation="MTTIDPAAVFRQEAAELFEVLEAALLDLGQNPDDRELVDSAFRAL
FT                   HTIKGSGAMFGFDKVATFTHEFETAFERVRKGEIKPTQDLVSVALAAKDFIRALIETPD
FT                   EADAIIGEAILADLSRFVSPTEAVEAPVSLPAQEPAPAPASERRQVGWHLRFEFDSQIL
FT                   RNGSNPLDLLDDLSKLGSCFAMPLTDGIPFLDELVPEDCYLKWDVSLHSDCDKAAIDDV
FT                   FMFVQDEMQLSLEPLFEGETPQPVPVLELPDVSILPPEPPQAAEETKPAPQAATAAPAA
FT                   PTVERRSGEPRRADDRGIATVRVQAERLDELMDRVGELVIAQARLTQLAASGNDISIKL
FT                   IAEEIERLASSLRDTTMGARMVPIGSLFGRFRRLVHDLSRDLGKPVEFITSGEDTELDK
FT                   TMIECLADPLVHLIRNAIDHGIEAPAARVAAGKPEQGRIELAAVHAGAQVLVTVKDNGG
FT                   GLNTARIRAKAEEQGLIAPGATASDQEIHQFLFHPGFSTAQTVSALSGRGVGMDVVKRT
FT                   IENMRGSIDLSTVPGDGTTVTLRLPLTLAIIEGLLIRVGSGRYIIPLSAVEECVELTAE
FT                   DERSRSRNFLNVRGNLVPFLRLRQIFDADGEPDQHQKTIIISTGETRVGLVADQIIGNH
FT                   QTVIKSLSKLHSDVTMFSGATILGDGTAALILDVVQLVGLAQAQSEKQMSEAA"
FT   gene            complement(163335..163700)
FT                   /locus_tag="Rpal_0146"
FT   CDS_pept        complement(163335..163700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0146"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG: bja:blr2342
FT                   chemotaxis two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98708"
FT                   /db_xref="GOA:B3Q720"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q720"
FT                   /protein_id="ACE98708.1"
FT                   /translation="MATILTVDDSPSIRQMIKVTLEPAGHSVVEAGDGAQGLSKAQATK
FT                   VDLVITDLNMPVMNGLELIKALRKQPNLVGLPIVFLTTESNDAVKQEAKSCGATGWITK
FT                   PFKPEQLLSVVSKLVRS"
FT   gene            complement(163700..164023)
FT                   /locus_tag="Rpal_0147"
FT   CDS_pept        complement(163700..164023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0147"
FT                   /product="anti-sigma-factor antagonist"
FT                   /note="PFAM: Sulfate transporter/antisigma-factor
FT                   antagonist STAS; KEGG: bja:blr2341 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98709"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q721"
FT                   /protein_id="ACE98709.1"
FT                   /translation="MTFDPTEAGAALRLPSDCSISSIRSIHETIQEALGRQGPLEIDCS
FT                   KVNRADLTSIQLLLSTAKTGEAQGRPVVLTELSEVLLNTIQRAGFTGDEIIDKHFPQKK
FT                   GGS"
FT   gene            164312..165469
FT                   /locus_tag="Rpal_0148"
FT   CDS_pept        164312..165469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0148"
FT                   /product="response regulator receiver modulated metal
FT                   dependent phosphohydrolase"
FT                   /note="PFAM: response regulator receiver; metal-dependent
FT                   phosphohydrolase HD sub domain; SMART: metal-dependent
FT                   phosphohydrolase HD region; KEGG: bja:bll2340 two-component
FT                   response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98710"
FT                   /db_xref="GOA:B3Q722"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q722"
FT                   /protein_id="ACE98710.1"
FT                   /translation="MLIQALVVDDSRSALDYLKRTIEFDGQVQVIGFTDPVLALASARN
FT                   LDIDIVFADYEMPNMDGISLIRRLRSLPKFSDIPIVMITSIESDEVRLQALDAGATDFL
FT                   PKRPKSLETQVRLRNMIRLGSAVRKLNDRAALLASEVARATHALQEREEEIILRLALSV
FT                   EYRDNDTGDHTLRVAKYSRMIAEGLGLPERLCRDIYLAAPLHDVGKVATPDHILLKPGK
FT                   LTPDEIAVMQTHTTIGASILAGSRCELIQLAADIAIGHHERWDGKGYPNKLKGAEIPIA
FT                   ARIVAVADVFDALATARPYKVAMPLPVARQHLENGRGQHFDPTCVDVFLARWDDVVAIA
FT                   TERLKLQQTHDAPLQPSLPADAQEPTITLPASNRKAGQTGLVPSE"
FT   gene            complement(165638..165820)
FT                   /locus_tag="Rpal_0149"
FT   CDS_pept        complement(165638..165820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0149"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98711"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q723"
FT                   /protein_id="ACE98711.1"
FT                   /translation="MNQFKLGDEVCKDNGRRGVVRAIFVNREAARMCAVEINGALDFIE
FT                   ESRLSPQQQRADLAA"
FT   gene            complement(166045..166134)
FT                   /locus_tag="Rpal_R0003"
FT                   /note="tRNA-Ser5"
FT   tRNA            complement(166045..166134)
FT                   /locus_tag="Rpal_R0003"
FT                   /product="tRNA-Ser"
FT   gene            complement(166287..167450)
FT                   /locus_tag="Rpal_0150"
FT   CDS_pept        complement(166287..167450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0150"
FT                   /product="conserved hypothetical protein; putative
FT                   glucokinase"
FT                   /note="KEGG: bra:BRADO0437 conserved hypothetical protein;
FT                   putative glucokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98712"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q724"
FT                   /protein_id="ACE98712.1"
FT                   /translation="MAEDSLTTTNAGIAAHGATRLPSVEIDSYNIEIKDEDGFLGDRAS
FT                   KGAFQRLLDDWRKALRETGDDPFGRRDTKNIAKSALDEVLTSDDVAAAAVVHSAIEDFA
FT                   QELAYVTKRFLRTKAWAETECIVVGGGFRQSRVGELAIARTDILLKADGHAVDLVPIRF
FT                   HPDEAGLIGCLHLAPSWIFEAHDSILAVDIGGSNIRCGVVETAWKKAPDLSKASVWKSD
FT                   LWRHADDEPTREGAVKRLTRMLKDLISEAEDEGFKLAPFIGISCPGVINADGSIEKGAQ
FT                   NLPGNWESSKFHLPRSLLEGIPTIGSHDTAILMHNDGVAQGLSEVPFMQEFERWGVLTI
FT                   GTGLGNARFTNRRDKDKAKKEREKDKEKDKEKDKEKGKKDKDSKEKA"
FT   gene            167773..168153
FT                   /locus_tag="Rpal_0151"
FT   CDS_pept        167773..168153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0151"
FT                   /product="ribosomal protein L21"
FT                   /note="PFAM: ribosomal protein L21; KEGG: nwi:Nwi_0439 50S
FT                   ribosomal protein L21"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98713"
FT                   /db_xref="GOA:B3Q725"
FT                   /db_xref="InterPro:IPR001787"
FT                   /db_xref="InterPro:IPR028909"
FT                   /db_xref="InterPro:IPR036164"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3Q725"
FT                   /protein_id="ACE98713.1"
FT                   /translation="MFAVIKTGGRQYRVVPEDVLEVGKIDGDVGSIIQLGEVLVLGGDT
FT                   PVLGAPTVAGATVAAEVLDHKRGPKVIAFKKRRRKHSKRKRGYRDEITVLRITEILADG
FT                   KKPSVGPRAKRTKAAPAAEAAE"
FT   gene            168243..168515
FT                   /locus_tag="Rpal_0152"
FT   CDS_pept        168243..168515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0152"
FT                   /product="ribosomal protein L27"
FT                   /note="PFAM: ribosomal protein L27; KEGG: nha:Nham_0515 50S
FT                   ribosomal protein L27"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98714"
FT                   /db_xref="GOA:B3Q726"
FT                   /db_xref="InterPro:IPR001684"
FT                   /db_xref="InterPro:IPR018261"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3Q726"
FT                   /protein_id="ACE98714.1"
FT                   /translation="MAHKKAGGSSRNGRDSAGKRLGVKAFGGEHVIPGNIIARQRGTQW
FT                   HPGLNVGMGTDHTLFAKVEGRVEFRAKANGRTYVSVLPIAMQAAE"
FT   gene            168650..169249
FT                   /locus_tag="Rpal_0153"
FT   CDS_pept        168650..169249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0153"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   nha:Nham_0516 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98715"
FT                   /db_xref="GOA:B3Q727"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q727"
FT                   /protein_id="ACE98715.1"
FT                   /translation="MLQEIPTTTPSLREARPCVLETERLTLRKPVLADVQAIASLANDR
FT                   RVVEMTRRMPFPYTRDDAARFVTALPKSSDSVFLIEAEDLEPIGLVGVDWSDRDAPELG
FT                   YWLGVQHWGNGYATEAARAVIDFTFEVHGAKQMISGARVINPASRNVLEKCGFQWTGVE
FT                   LHRFESIGSSTPVDCFRLTRGVWSSLKKWGTTKRRC"
FT   gene            169461..169652
FT                   /locus_tag="Rpal_0154"
FT   CDS_pept        169461..169652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0154"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98716"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q728"
FT                   /protein_id="ACE98716.1"
FT                   /translation="MSAHRYIQAVLARDLAEEIKPLAPATIAQVELTAERAAEAEQHRE
FT                   RTEQLSFRFVDLDRRFGI"
FT   gene            169782..169955
FT                   /locus_tag="Rpal_0155"
FT   CDS_pept        169782..169955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0155"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98717"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q729"
FT                   /protein_id="ACE98717.1"
FT                   /translation="MSDSPDQAVAVRDVRDEFRADLDAFEATERKLLIEERRERARVLS
FT                   ERFSGLALRVGE"
FT   gene            complement(169956..170861)
FT                   /locus_tag="Rpal_0156"
FT   CDS_pept        complement(169956..170861)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0156"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: bja:bll0423 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98718"
FT                   /db_xref="GOA:B3Q730"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q730"
FT                   /protein_id="ACE98718.1"
FT                   /translation="MGLFAKITTASDPRTARIAGILLMLLAMLAFSFADAAGKTVVAIY
FT                   SVGQLLVLRALAGLLVLSPLIWRQRKAFLQLERPGLQLARTLIAACEVAVFYLATAYLP
FT                   LADVITFYLASSLFVSVGAALFLGETIDRPRGIAIVVGFVGVLIALQPSTQTMSWPALI
FT                   AILASVLFAGLLLLTRFLRQTPDMVLASQQFAGTLLLGLVLAPSGWITPSATDLVWFAI
FT                   SGAVSAVGLLCVNRSLRLAPASVVVPYQYTMIIFAAAFGWLLFGDVPSRATVAGVAIII
FT                   AAGLYLGWRERSTSRPPVGG"
FT   sig_peptide     complement(170751..170861)
FT                   /locus_tag="Rpal_0156"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.829 at
FT                   residue 37"
FT   gene            171013..172074
FT                   /locus_tag="Rpal_0157"
FT   CDS_pept        171013..172074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0157"
FT                   /product="GTP-binding protein Obg/CgtA"
FT                   /note="TIGRFAM: small GTP-binding protein; GTP-binding
FT                   protein Obg/CgtA; PFAM: GTP-binding protein HSR1-related;
FT                   GTP1/OBG sub domain protein; KEGG: bra:BRADO0432 GTPase
FT                   ObgE"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98719"
FT                   /db_xref="GOA:B3Q731"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006074"
FT                   /db_xref="InterPro:IPR006169"
FT                   /db_xref="InterPro:IPR014100"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR035101"
FT                   /db_xref="InterPro:IPR036726"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3Q731"
FT                   /protein_id="ACE98719.1"
FT                   /translation="MKFLDEAKVYIRSGDGGNGCVAFRREKFIEFGGPNGGNGGRGGDI
FT                   IVEAADGLNTLIDYRYQQHFKAQKGGNGMGSDRHGAGGKDIVMKVPVGTQIFDEDKETL
FT                   IHDFTKVGERFVLAKGGNGGFGNAHFKSSTNRAPRHANPGLPGEERWIWLRLKLIADAG
FT                   LVGLPNAGKSTFLSKVSAAKPKIADYPFTTLHPQLGVVNSDGREFVLADIPGLIEGAHE
FT                   GAGLGDRFLGHIERCRVLLHLIDATCEHAGKAYKTVRGELEAYAETLVDKIEIVALNKI
FT                   DAVEPDELKKQKDRLKRAAKKTPLLLSGVTGQGVPEVLRALVAVIGEAPVSDKAIGTAD
FT                   NPAEAKPWAPQDA"
FT   gene            172213..173343
FT                   /locus_tag="Rpal_0158"
FT   CDS_pept        172213..173343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0158"
FT                   /product="glutamate 5-kinase"
FT                   /EC_number="2.7.2.11"
FT                   /note="KEGG: bbt:BBta_0422 gamma-glutamyl kinase; TIGRFAM:
FT                   glutamate 5-kinase; PFAM: aspartate/glutamate/uridylate
FT                   kinase; PUA domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98720"
FT                   /db_xref="GOA:B3Q732"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR005715"
FT                   /db_xref="InterPro:IPR011529"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR019797"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR041739"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3Q732"
FT                   /protein_id="ACE98720.1"
FT                   /translation="MASPKLHDFRHIVVKVGSSLLIDSAAGEVRAGWLAALAADIAELH
FT                   RGGRDVMVVSSGSIALGRSRLKLPRGPLKLEESQAAAAVGQIELARTWSEVLGAHGIGA
FT                   GQILVTFQDTEERRRYLNARSTIAKLLEWRAVPVINENDTVATTEIRYGDNDRLAARVA
FT                   TMASADLLILLSDIDGLYTAPPGNDPDATLIPVVEAITAEIEGMAGAAGSELSRGGMRT
FT                   KIEAAKIATSAGTHMLIASGKIDHPLRAIAEGGKCTWFLTPANPVTARKRWIAGTLEPK
FT                   GTLTIDAGAVSALRAGKSLLPAGVIRVDGQFSRGDAVIVRGPDTHEIGRGLVAYDAEDA
FT                   EKIKGHSSPDVMMILGITGRAEMIHRDDLVVGTAPT"
FT   gene            173547..174839
FT                   /locus_tag="Rpal_0159"
FT   CDS_pept        173547..174839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0159"
FT                   /product="gamma-glutamyl phosphate reductase"
FT                   /EC_number="1.2.1.41"
FT                   /note="TIGRFAM: gamma-glutamyl phosphate reductase; KEGG:
FT                   bja:blr0429 gamma-glutamyl phosphate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98721"
FT                   /db_xref="GOA:B3Q733"
FT                   /db_xref="InterPro:IPR000965"
FT                   /db_xref="InterPro:IPR012134"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR020593"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3Q733"
FT                   /protein_id="ACE98721.1"
FT                   /translation="MTASLKAIDGSAELTTLMTDLGRQARAAARILALAPPEQKNRALE
FT                   AMERAIRAGADKILAANAEDVDDAKAAGTTSAFLDRLTLTPARVEAMAEGIAVVRGIAD
FT                   PVGTVTESWQRPNGMTIERVRVPLGVVAVIFESRPNVAADAGVLCLKSGNAVILRGGSE
FT                   SFRSCRAIHDCLVQGLREAGLPDAAITLVPTRDRAAVGLLLAGLDGSVDVIVPRGGKSL
FT                   VARVESEARVPVFAHLEGVNHVYVDRSADLEMAKSIVLNAKMRRTGVCGAAETLLIDRA
FT                   AATTHLAPLVTMLIDSGCEVRGDQTVQKVDPRVKPASDEDWDTEYLDAVIAAKLVDGVD
FT                   GAIAHIHNHGSHHTDAIVAEDVQAAAKFLGEVDSAIVLHNASTQFADGGEFGFGAEIGI
FT                   ATGKFHARGPVGAEQLTTFKYRIHGSGQTRP"
FT   gene            174864..175493
FT                   /locus_tag="Rpal_0160"
FT   CDS_pept        174864..175493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0160"
FT                   /product="nicotinate (nicotinamide) nucleotide
FT                   adenylyltransferase"
FT                   /note="TIGRFAM: nicotinate (nicotinamide) nucleotide
FT                   adenylyltransferase; PFAM: cytidylyltransferase; KEGG:
FT                   bja:blr0430 nicotinic acid mononucleotide
FT                   adenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98722"
FT                   /db_xref="GOA:B3Q734"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR005248"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q734"
FT                   /protein_id="ACE98722.1"
FT                   /translation="MTTDLAAARRAIPPFAPGMRIGLLGGSFNPPHLAHRAISQFAIKR
FT                   LKLDRVWWLVSPGNPLKDISSLREIDARVAAAQAIADDPRIQVSRLEAVIGTRYTADTL
FT                   RYLRRHCPGARFVWIMGADNLAQFHRWQQWQQIAAEVPIAVIDRPPTSFRALAAPAAQR
FT                   LMRMRIPNSKAATLADREPPAWVYLTGLKSPVSSTALRNPDGSWKT"
FT   gene            175708..176160
FT                   /locus_tag="Rpal_0161"
FT   CDS_pept        175708..176160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0161"
FT                   /product="iojap-like protein"
FT                   /note="TIGRFAM: iojap-like protein; PFAM: Iojap-related
FT                   protein; KEGG: bbt:BBta_0417 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98723"
FT                   /db_xref="GOA:B3Q735"
FT                   /db_xref="InterPro:IPR004394"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q735"
FT                   /protein_id="ACE98723.1"
FT                   /translation="MPKSVAAKASRSASTRTAPVPTPEAIAPDTSQFKAAPDAEATLKL
FT                   ILSRLDDMKAEETVTIDLRGKSAMFDYVVVTTGRANRHVGAIAENVVKALKQAGIAAPH
FT                   VEGLPNCDWVLIDSGDVVLHVFRPEVREFYNLERLWTQGPSPAKTL"
FT   gene            176250..176732
FT                   /locus_tag="Rpal_0162"
FT   CDS_pept        176250..176732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0162"
FT                   /product="protein of unknown function DUF163"
FT                   /note="PFAM: protein of unknown function DUF163; KEGG:
FT                   nha:Nham_0523 protein of unknown function DUF163"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98724"
FT                   /db_xref="GOA:B3Q736"
FT                   /db_xref="InterPro:IPR003742"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3Q736"
FT                   /protein_id="ACE98724.1"
FT                   /translation="MRLLILAVGKLKQGPERELAERYRARFDDLGRKLGFRGLDVHEIA
FT                   ESRAREAPARMAEEAAAIIAQVQDGAVLVTLDERGQSLGSTAFAAQLGRWRDEQVPGTI
FT                   FVIGGADGLLPELRRKAKLSMSFGGATWPHQMVRVMLLEQIYRAATILAGHPYHRA"
FT   gene            176752..178143
FT                   /locus_tag="Rpal_0163"
FT   CDS_pept        176752..178143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0163"
FT                   /product="Peptidase M23"
FT                   /note="PFAM: Peptidase M23; KEGG: nha:Nham_0524 peptidase
FT                   M23B"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98725"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q737"
FT                   /protein_id="ACE98725.1"
FT                   /translation="MHAPRNTAARHHVAAGSWRPAVLLSAGLAAGLWANDVARPNGVLI
FT                   SSAKAQTAPAATTTAPSMADLIKQHEQELEAARAQQKSAAEQQDKLKADLAAIGADRTK
FT                   LNQELIDVAAKVRAVETRISDAEARLRPLDAREAEIRTSLDARRGEIGEVLAALQRAGR
FT                   RAPPALLVRPEDALESLRTAILLGAVVPELRTRAERLATDLGELIAVRQRIAAERDQLA
FT                   ADRSHLTTDQTRLAALVEERQRQQSAVEKDIEAERGRALTLSRQVDSLQGLIAKMEQDL
FT                   KSAAKAAAAADQKGAPAAGKANLAALKDPGRLSPAIAFASAKGMLPLPVNGTKIREFGR
FT                   PDGVGGVERGISLSTRAGAQITTPCDGWVVYAGPFRSYGQLLILNAGGGYHVLIAGMER
FT                   ISVNIGQFVLTGEPVATMGSTSRVASILAANASQPVLYVEFRKDGTPIDPGPWWAANEG
FT                   EKVRG"
FT   sig_peptide     176752..176856
FT                   /locus_tag="Rpal_0163"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.701) with cleavage site probability 0.670 at
FT                   residue 35"
FT   gene            178140..179516
FT                   /locus_tag="Rpal_0164"
FT   CDS_pept        178140..179516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0164"
FT                   /product="carboxyl-terminal protease"
FT                   /EC_number="3.4.21.102"
FT                   /note="KEGG: bja:blr0434 carboxy-terminal protease;
FT                   TIGRFAM: carboxyl-terminal protease; PFAM: PDZ/DHR/GLGF
FT                   domain protein; peptidase S41"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98726"
FT                   /db_xref="GOA:B3Q738"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q738"
FT                   /protein_id="ACE98726.1"
FT                   /translation="MMRKTSVILLSAVTGAALTLFVTQPRTMLMGATARAATSDTYRQL
FT                   NLFGDVFERVRSDYVEKPDDSKLVESAISGMLAGLDPHSSYMDAKSFRDMQVQTRGEFG
FT                   GLGIEVTMEDGLIKVVSPIDDTPASKAGILANDIITNLDDEAVQGLTLNQAVEKMRGPV
FT                   NTKIRLKIVRKGQDNPIEVTLVRDNIRVRSVRARVEDSDIGYIRITTFNEQTTEGLKKE
FT                   IANLTNQIGADKLKGFILDLRNNPGGLLEEAVTVSDAFLDRGEIVSTRGRNAEETQRRS
FT                   AHAGDLTKGKPVIVLINGGSASASEIVAGALQDHKRATVVGTRSFGKGSVQTIIPLGSG
FT                   NGALRLTTARYYTPSGKSIQAKGITPDIEVMQDVPADLKARTDTKGEASLRGHLKGADG
FT                   DEKTGSQSYVPPEAKDDKALKAAADLLHGIKVNASAPADKQTTGDKAAIDKPAGNKAAN
FT                   "
FT   sig_peptide     178140..178250
FT                   /locus_tag="Rpal_0164"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.779 at
FT                   residue 37"
FT   gene            179667..180905
FT                   /locus_tag="Rpal_0165"
FT   CDS_pept        179667..180905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0165"
FT                   /product="protein of unknown function DUF610 YibQ"
FT                   /note="PFAM: protein of unknown function DUF610 YibQ; KEGG:
FT                   nha:Nham_0526 protein of unknown function DUF610, YibQ"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98727"
FT                   /db_xref="GOA:B3Q739"
FT                   /db_xref="InterPro:IPR006837"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q739"
FT                   /protein_id="ACE98727.1"
FT                   /translation="MAADELSTPLGQKRNRWQRLRHYRLPFNATQGIAALLGLFVLTFL
FT                   GFALFGNDPFGGEPVVRVEIKASPDEAKQAAAEAGKDQGGKPENAAAAGAEKKDAEPKE
FT                   AAAGQKTITIIDGSKGTRQDVVVGTDSPDKAEPPAGPTTSDGINPKLLEQSRYGMIPVM
FT                   AGGLKPFSAYAMTTDADRAKAERMPTVTIVVGGLGIGAARTNDAVMKLPAAVALAFTPY
FT                   GSDPGKLATEARAKRHEVILQIPMEPFDYPDNDPGPQTLLTSSAPEQNLDRLNWHLSRI
FT                   QGYVGLSNFMGARFVATEPAMQAIIRDAAKRGLGYLDDGTAPRSVAGTLAKSLAIPFAR
FT                   ADLTIDQVPAGADIDKSLARLESIAKERGSAVGMASALPVTIERIVNWSKSLESRGILL
FT                   APLTTAMLKSKSS"
FT   gene            180944..181450
FT                   /locus_tag="Rpal_0166"
FT   CDS_pept        180944..181450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0166"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: bja:blr0436
FT                   dinucleoside polyphosphate hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98728"
FT                   /db_xref="GOA:B3Q740"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR022927"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q740"
FT                   /protein_id="ACE98728.1"
FT                   /translation="MARYEDLPYRTCVGVMLINREGLVFIGRRAGGIEHVDDTHVWQMP
FT                   QGGVDPGEDTWEAAKRELYEETSVNSVEKLAEVPDWLIYDIPRTVAGRAWKGRYRGQRQ
FT                   KWFAARFTGADSEINVVHPGGGHKAEFTSWRWEPMHNLPELIVPFKRPVYERVVKEFSQ
FT                   LAAAV"
FT   gene            complement(181632..182702)
FT                   /locus_tag="Rpal_0167"
FT   CDS_pept        complement(181632..182702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0167"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mex:Mext_4348 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98729"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q741"
FT                   /protein_id="ACE98729.1"
FT                   /translation="MTTPVDTSKLRILEIGGGYFKLQYPERTTCLWTWTKLTDDFGKLD
FT                   GFSTPDRVLRELRAAGRGEYDVVVVNSLRYSPWHPRYWARGIFYTPTNPWAALTRQFGP
FT                   SVFRWVKSPVPVVAVEMDDHFAISKSSVFLLDKAEAYFKRELPCDKWQALAGTVHPHLP
FT                   TLRYRRSEKWQRRIDKLQPISLPQFRFDARWRDAPFPEKTHDIFFIGSVNGNSTVRRDG
FT                   LPELERLRAAGVRIDQPTERLPYDAFMERMSHSWLAWSPEGMGWDCYRHYEAPIVQSVP
FT                   LMNNPTILRYAPLLSGQHGVYYDVEPGGLERAVTSALADKDNLRRMALAARDHVFAHHT
FT                   VKAHCDHILQAAMAAR"
FT   gene            182970..183917
FT                   /locus_tag="Rpal_0168"
FT   CDS_pept        182970..183917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0168"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; Male sterility
FT                   domain; KEGG: mca:MCA1165 NAD-dependent
FT                   epimerase/dehydratase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98730"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q742"
FT                   /protein_id="ACE98730.1"
FT                   /translation="MRLSRRILVSGGAGFIGSHLCDKLLAEGHEILCVDNYFTGWRRNI
FT                   EHLVGTPRFEVMRHDVTFPLYVEVDDIYNLACPASPVHYQHDPVQTLKTSVHGAINMLG
FT                   LAKRTRAKIFQASTSEVYGDPNVHPQPESYWGHVNPLGIRACYDEGKRAAETLFFDYHR
FT                   QHKVKIKVGRIFNTYGPRMHPNDGRVVSNFIVQALSGNDITIYGDGSQTRSFCYVTDLL
FT                   DGFARLMATGDEFIGPVNLGNPVEFTIRQLAEMVIEMTDSRSKLVMMPLPSDDPRQRQP
FT                   DISLARRELGWEPKVPLADGLKETIGYFRTLMAS"
FT   gene            183914..184435
FT                   /locus_tag="Rpal_0169"
FT   CDS_pept        183914..184435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0169"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: bja:blr0437
FT                   dinucleoside polyphosphate hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98731"
FT                   /db_xref="GOA:B3Q743"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="InterPro:IPR022927"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q743"
FT                   /protein_id="ACE98731.1"
FT                   /translation="MTSRPPIESLPYRRNVGIALFGADGRVLIGRRFRDDGPEIILPGL
FT                   EWQMPQGGIDEGEEPRIAVMRELWEETGVTNAEILGETDWASYDFPPYDGPPHRLAVFR
FT                   GQRQKWFALRFTGSETEIDPLAVRNDMPPEFDAWRWEQLDRVADLVVPFRREVYREVAR
FT                   SFARFTAAQA"
FT   gene            complement(184618..185025)
FT                   /locus_tag="Rpal_0170"
FT   CDS_pept        complement(184618..185025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0170"
FT                   /product="ATP synthase F1, epsilon subunit"
FT                   /note="TIGRFAM: ATP synthase F1, epsilon subunit; PFAM:
FT                   H+transporting two-sector ATPase delta/epsilon subunit;
FT                   KEGG: nwi:Nwi_0434 H+-transporting two-sector ATPase,
FT                   delta/epsilon subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98732"
FT                   /db_xref="GOA:B3Q744"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3Q744"
FT                   /protein_id="ACE98732.1"
FT                   /translation="MSTFHFDLVSPEMVAFSGDVDQVDIPGAEGDFGVLAGHAPVVAVI
FT                   RPGILTVTAGANKQKIVVLGGIAEVSDKGLTVLADVATPAPDVDLQDFAATIQTMEQQI
FT                   PGKVGDELDRAIERLDHFKSIQHELNTTAMH"
FT   gene            complement(185139..186569)
FT                   /locus_tag="Rpal_0171"
FT   CDS_pept        complement(185139..186569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0171"
FT                   /product="ATP synthase F1, beta subunit"
FT                   /note="KEGG: nha:Nham_0529 F0F1 ATP synthase subunit beta;
FT                   TIGRFAM: ATP synthase F1, beta subunit; PFAM:
FT                   H+transporting two-sector ATPase alpha/beta subunit central
FT                   region; H+transporting two-sector ATPase alpha/beta subunit
FT                   domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98733"
FT                   /db_xref="GOA:B3Q745"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q745"
FT                   /protein_id="ACE98733.1"
FT                   /translation="MATPANQTGRITQVIGAVVDVQFEGHLPAILNAIETKNGDNRLVL
FT                   EVAQHLGESTVRTIAMDTTEGLVRGQEVTDTGAPISVPVGAGTLGRIMNVIGEPVDEQG
FT                   PIKSEGLRAIHQEAPAYTDQSTEAEILVTGIKVVDLLAPYAKGGKIGLFGGAGVGKTVL
FT                   IQELINNVARAHGGYSVFAGVGERTREGNDLYHEFIESGVNKKGGGEGSKCALVYGQMN
FT                   EPPGARARVGLTGLTVAEHFRDQGQDVLFFVDNIFRFTQAGSEVSALLGRIPSAVGYQP
FT                   TLATDMGALQERITTTTKGSITSVQAIYVPADDLTDPAPATSFAHLDATTVLNRAISEK
FT                   GIYPAVDPLDSTSRMLSASIVGEEHYNTARMVQQILQKYKSLQDIIAILGMDELSEEDK
FT                   LTVARARKIERFLSQPFFVAEVFTGSPGKFVDLADTIKGFRAICEGKYDHLPEAAFYMV
FT                   GTIEEAVEKGKKLAAEAA"
FT   gene            complement(186641..187516)
FT                   /locus_tag="Rpal_0172"
FT   CDS_pept        complement(186641..187516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0172"
FT                   /product="ATP synthase F1, gamma subunit"
FT                   /EC_number="7.1.2.2"
FT                   /note="KEGG: nha:Nham_0531 F0F1 ATP synthase subunit gamma;
FT                   TIGRFAM: ATP synthase F1, gamma subunit; PFAM:
FT                   H+transporting two-sector ATPase gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98734"
FT                   /db_xref="GOA:B3Q746"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR023632"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3Q746"
FT                   /protein_id="ACE98734.1"
FT                   /translation="MASLKDMRVRIASTKATQKITKAMQMVAASKLRRAQMAAEAARPY
FT                   AEKMEAVISNIAGAAAGSPGAPVLLAGNGKDQVHLLLVCTGERGLSGAFNSSIVRLARE
FT                   RAYELMSQGKTVKFFCVGRKGYEQLRRNFEKQIIDNVELRSVRQIGFVNAEDIAKKVIA
FT                   RFNAGEFDVCTLFYSRFKSVISQIPTAQQLIPLEVTAPAAGTVATSYEYEPEEDEILSG
FT                   LLPRNLAVQIFRALLENNASFYGAQMSAMDNATRNAGEMIRKQTLVYNRTRQAMITKEL
FT                   IEIISGAEAI"
FT   gene            complement(187660..189192)
FT                   /locus_tag="Rpal_0173"
FT   CDS_pept        complement(187660..189192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0173"
FT                   /product="ATP synthase F1, alpha subunit"
FT                   /EC_number="3.4.21.68"
FT                   /note="KEGG: nha:Nham_0532 F0F1 ATP synthase subunit alpha;
FT                   TIGRFAM: ATP synthase F1, alpha subunit; PFAM:
FT                   H+transporting two-sector ATPase alpha/beta subunit central
FT                   region; H+transporting two-sector ATPase alpha/beta subunit
FT                   domain protein; ATP synthase F1 alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98735"
FT                   /db_xref="GOA:B3Q747"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033732"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q747"
FT                   /protein_id="ACE98735.1"
FT                   /translation="MDIRAAEISAILKDQIKNFGQEAEVSEVGQVLSVGDGIARVYGLD
FT                   NVLAGEMVEFENGTRGMALNLETDNVGVVIFGADREIKEGQTVKRTRSIVDAPVGKGLL
FT                   GRVVDALGNPIDGKGPIQAVERKRVDVKAPGIIPRKSVHEPMATGLKSIDALIPIGRGQ
FT                   RELIIGDRQTGKTAIALDTILNQKPLNVEGAPESQKLYCVYVAVGQKRSTVAQFVKVLE
FT                   EQGALEYSVVVAATASDPAPMQYIAPFTGCTIGEYFRDNGMHAVIIYDDLSKQAVAYRQ
FT                   MSLLLRRPPGREAYPGDVFYLHSRLLERAAKLNDEQGNGSLTALPVIETQANDVSAYIP
FT                   TNVISITDGQIFLETDLFFQGIRPAVNVGLSVSRVGSSAQTKAMKKVAGKIKGELAQYR
FT                   EMAAFAQFGSDLDAATQRLLNRGSRLTELLKQPQFSPLKMEEQVCVIWAGTNGYLDALP
FT                   LNKVRAFEDGLLALLRGKESGILEAIRTSRDLSDDTAAKLKAVVESYAKTFA"
FT   gene            complement(189192..189752)
FT                   /locus_tag="Rpal_0174"
FT   CDS_pept        complement(189192..189752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0174"
FT                   /product="ATP synthase F1, delta subunit"
FT                   /EC_number="7.1.2.2"
FT                   /note="KEGG: nwi:Nwi_0429 F0F1 ATP synthase subunit delta;
FT                   TIGRFAM: ATP synthase F1, delta subunit; PFAM:
FT                   H+transporting two-sector ATPase delta (OSCP) subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98736"
FT                   /db_xref="GOA:B3Q748"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="InterPro:IPR020781"
FT                   /db_xref="InterPro:IPR026015"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3Q748"
FT                   /protein_id="ACE98736.1"
FT                   /translation="MASEDPSVSGVSGRYATALFELARDEKSIDAVTADLDKFSAMLAG
FT                   SPDLVRLVRSPVFASEVQGKALAAVLDKAGITGISANFLKVLAANRRLFVVADVIRAYR
FT                   ALVAKFKGEATADVTVAEKLSDKNLEALKAALKSVTGKDVALNINVDPAIIGGLVVKLG
FT                   SRMVDSSLRTKLNSIKHAMKEAG"
FT   gene            190456..190926
FT                   /locus_tag="Rpal_0175"
FT   CDS_pept        190456..190926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0175"
FT                   /product="rare lipoprotein A"
FT                   /note="TIGRFAM: rare lipoprotein A; PFAM: Rare lipoprotein
FT                   A; KEGG: bja:blr044 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98737"
FT                   /db_xref="GOA:B3Q749"
FT                   /db_xref="InterPro:IPR009009"
FT                   /db_xref="InterPro:IPR012997"
FT                   /db_xref="InterPro:IPR034718"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q749"
FT                   /protein_id="ACE98737.1"
FT                   /translation="MVRKKTPALLTTGPAAAAAMIVASVFLGGSVGEASAKSRHHRHHH
FT                   HSHHSDWRSANASVESSGGRSFSGMASYYGNESGSRTASGQRMNANAMTAAHRTLPFGT
FT                   KLRVTHGGRSVVVTINDRGPFIRGRVLDLSTGAARAIGLTSRGVGRVVAEVM"
FT   sig_peptide     190456..190566
FT                   /locus_tag="Rpal_0175"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.215 at
FT                   residue 37"
FT   gene            complement(191082..193292)
FT                   /locus_tag="Rpal_0176"
FT   CDS_pept        complement(191082..193292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0176"
FT                   /product="primosomal protein N'"
FT                   /note="KEGG: bja:bll0445 primosome assembly protein PriA;
FT                   TIGRFAM: primosomal protein N'; PFAM: helicase domain
FT                   protein; type III restriction protein res subunit;
FT                   DEAD/DEAH box helicase domain protein; SMART: DEAD-like
FT                   helicases"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98738"
FT                   /db_xref="GOA:B3Q750"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005259"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037274"
FT                   /db_xref="InterPro:IPR040498"
FT                   /db_xref="InterPro:IPR041222"
FT                   /db_xref="InterPro:IPR041236"
FT                   /db_xref="InterPro:IPR042115"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q750"
FT                   /protein_id="ACE98738.1"
FT                   /translation="MDDLPTSSPASHAPASVVDVLVPVAIDQAYSYRVPRGLSLKPGDV
FT                   VAVPLGAREVLGVVWAENPNPDPRLHNRLKDVAEKLDVPPLRDELRRMVDWVSTYTLSA
FT                   RGMVLRMCLRMGEHLGPERQRMGVRLVGSPPQRMTPARRRLLQILSDGLLHGKSDVAKE
FT                   AGVSPGVIDGLVDEGTLQVEQMPRENPAPEPDPDFAPADFSPEQARAAETMRGLVTAGG
FT                   FQAALIDGVTGSGKTEVYFEAVAEVIRQGRQSLILMPEIALTGQFLDRFAQRFGVRPLE
FT                   WHSELTPRTRARNWASIAAGEARVVVGARSALFLPYADLGLIIVDEEHDQAYKQEDGAH
FT                   YHARDMAVVRASIAKIPIVLASATPSVETEVNARKGRYTRIPLPSRFGGQHMPQIEAID
FT                   LRREPPMRGRFISPRLAEQIGFAIERREQALLFLNRRGYAPLTLCRACGHRFACTICDA
FT                   WLVDHRFRQRLVCHHCGFSMPRPPACPHCGAEGSLVAVGPGVERLQEEAANLFPNARTM
FT                   VLSSDLITSIETMRAELNEIAEGRVDIIIGTQLVAKGHNFPRLNLVGVVDADLGLSNGD
FT                   PRAAERTFQLLNQVIGRAGRDQGRGVGFLQTHQPEHPVMKALVACDREAFYASEIDIRE
FT                   RTLYPPFGRLASLIISAGDRPTAEGFGRQLASAAPFDERVQVLGPAEAPLAVIKGRYRF
FT                   RLLVKSVRGFDLSNYLRSWLAKGPKTKGNLKLEVDVDPQSFL"
FT   gene            193494..194465
FT                   /locus_tag="Rpal_0177"
FT   CDS_pept        193494..194465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0177"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; integrase domain
FT                   protein SAM domain protein; KEGG: bja:blr0446 site-specific
FT                   tyrosine recombinase XerC"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98739"
FT                   /db_xref="GOA:B3Q751"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q751"
FT                   /protein_id="ACE98739.1"
FT                   /translation="MAPSKSAPPPLELSCAAADLTAEMTKWLSHLRAERRLSGKTLEAY
FT                   ARDVRQFLQFLAEHWGGEVTLGRFARLEATDVRAFMAARRADEIAGRSLMRALAGMRSF
FT                   GRFLEREGKGRVGALASVRAPKIKKSLPKPLPIAAAKRLADADERAGEERETWVLIRDA
FT                   AVMALLYGSGLRISEALGLKRRDVPAAGKGDTLIVHGKGNKTRMVPVLQNVLAQIAEYA
FT                   AACPYNLPPDGPMFVGARGGPLSPRIIQLAMERLRGGLGLPDSATPHALRHSFATHLLS
FT                   RGGDLRAIQELLGHASLSTTQVYTGIDTERLLEVYNSAHPRA"
FT   gene            194606..195196
FT                   /locus_tag="Rpal_0178"
FT   CDS_pept        194606..195196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0178"
FT                   /product="putative membrane protein of unknown function"
FT                   /note="KEGG: bbt:BBta_0400 putative membrane protein of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98740"
FT                   /db_xref="GOA:B3Q752"
FT                   /db_xref="InterPro:IPR025570"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q752"
FT                   /protein_id="ACE98740.1"
FT                   /translation="MGAHESMEHAEHAEHASGSNKGIALLISVIALFLAFSETLGKGAQ
FT                   TEALAKNVEASNLWAFFQAKSIRRTTVQAVSEHARLSLGTVPDEATKAALQKQIDDWQK
FT                   TAARYRSEPETGEGSEQLAERAKHAEHERDLAMARYHHYEVASAAFQIGIVLASATIIT
FT                   GMMVLAWLSGLLAVGGLGFMAIGLFAPHAVHLM"
FT   gene            complement(195260..195802)
FT                   /locus_tag="Rpal_0179"
FT   CDS_pept        complement(195260..195802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0179"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bja:bll0448 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98741"
FT                   /db_xref="GOA:B3Q753"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q753"
FT                   /protein_id="ACE98741.1"
FT                   /translation="MKGRLWQPLWVLLAVLFLIEAWFWDHVEPLIARIVALIPLRELKE
FT                   RLARWVDHLSPAMTLPVFLVPVAPLYPLKLFALALIAQGHWIAGLGIFAAAQVFGLGVA
FT                   AFIFDVTKPKLLQLRWFAATYRWVIELRAKAHAIVAPIMAQIRAKLAELLKGDGDGWGS
FT                   KVLRRIGALRRRIRTAR"
FT   gene            complement(195842..197245)
FT                   /locus_tag="Rpal_0180"
FT   CDS_pept        complement(195842..197245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0180"
FT                   /product="dihydrolipoamide dehydrogenase"
FT                   /note="TIGRFAM: dihydrolipoamide dehydrogenase; PFAM:
FT                   FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein; pyridine nucleotide-disulphide
FT                   oxidoreductase dimerisation region; HI0933 family protein;
FT                   FAD dependent oxidoreductase; KEGG: bja:bll0449
FT                   dihydrolipoamide dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98742"
FT                   /db_xref="GOA:B3Q754"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q754"
FT                   /protein_id="ACE98742.1"
FT                   /translation="MATYDLVVIGTGPGGYVCAIRAAQLGLKVAVVEKNATLGGTCLNV
FT                   GCMPSKALLHASELFEEAGHSFAKMGIGVPAPKLDLPAMMNFKQQGIDGNVKGVEYLMK
FT                   KNKIDVLVGKGKILGTGKVEVTGADGKASSVDTKSIVIASGSAVAQLKGIEIDEKRVVS
FT                   STGALSLDKVPGKLIVVGAGVIGLELGSVWRRLGAEVTVVEFLDRILPGMDGEVVKQFQ
FT                   RILEKQGFAFKLGAKVTGVDTSGAKLAVKVEAAAGGNPETLEADVVLVAIGRVPYTEGL
FT                   GLKEAGVALDERGRVVIDDHFATSLKGVYAIGDVVRGPMLAHKAEDEGVAVAELIAGKA
FT                   GHVNYDVIPGVVYTTPEVSSVGKTEEDLKQAGVAYTVGKFPFTANGRSKVNQTTDGFVK
FT                   ILADAKTDRVLGVHIIGREAGEMIHEAAVLMEFGGSAEDLARTCHAHPTRSEAIKEAAL
FT                   TVGKRAIHM"
FT   gene            complement(197277..198023)
FT                   /locus_tag="Rpal_0181"
FT   CDS_pept        complement(197277..198023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0181"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: bbt:BBta_0397 putative oxidoreductase
FT                   (YgfF), NAD(P)-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98743"
FT                   /db_xref="GOA:B3Q755"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q755"
FT                   /protein_id="ACE98743.1"
FT                   /translation="MNDRVVIITGGSRGIGRATALGCAKRGFKVVVGYASNAAAADEVV
FT                   AEIAASNGKAIAVKCDVGSEADILALFAAADAFGPLGALVNNAGIVGPTARVDEMSAER
FT                   IQRMMAVNVTGSILCAREAVKRMSTRHGGKGGVIVNLSSVAAKLGSPNTYVDYAASKGA
FT                   VDSFTVGLGHEVAGEGIRVAAIRPGLIDTEIHASGGDPERAHRLSVNVPMKRVGRAEEI
FT                   ANAVVWLLSDEASYVTSAIIDVSGGR"
FT   gene            complement(198031..198432)
FT                   /locus_tag="Rpal_0182"
FT   CDS_pept        complement(198031..198432)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0182"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcs:BCAN_A1965 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98744"
FT                   /db_xref="GOA:B3Q756"
FT                   /db_xref="InterPro:IPR001129"
FT                   /db_xref="InterPro:IPR023352"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q756"
FT                   /protein_id="ACE98744.1"
FT                   /translation="MPPMPTEITVLGWSVVLLIVQMFLASIPTTMELGGDYQAGPRDEP
FT                   RTPTGRFAGRANRAFRNLLETYPAFVGLALALAITGKAGGYAATASVVWLIARALYAPL
FT                   YIIEIPFARSIVWFVSLLALIAMLVRLLS"
FT   gene            complement(198491..199744)
FT                   /locus_tag="Rpal_0183"
FT   CDS_pept        complement(198491..199744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0183"
FT                   /product="2-oxoglutarate dehydrogenase, E2 subunit,
FT                   dihydrolipoamide succinyltransferase"
FT                   /note="TIGRFAM: 2-oxoglutarate dehydrogenase, E2 subunit,
FT                   dihydrolipoamide succinyltransferase; PFAM: biotin/lipoyl
FT                   attachment domain-containing protein; catalytic domain of
FT                   components of various dehydrogenase complexes; E3 binding
FT                   domain protein; KEGG: bbt:BBta_0396 dihydrolipoamide
FT                   acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98745"
FT                   /db_xref="GOA:B3Q757"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR006255"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q757"
FT                   /protein_id="ACE98745.1"
FT                   /translation="MTEIRVPTLGESVTEATIGRWFKKPGEAVAVDEPLVELETDKVTI
FT                   EVPAPSAGTLGEIVAKDGETVAVGALLGQITDGAAPAKPAAAAPAKAAAPAAAPAPAAP
FT                   APAAAPAAKAPPSDAPLAPSVRRLSTESGVDASTVPGSGKDGRVTKGDMLAAIEKAASA
FT                   PTPVNQPAAAVQVRGPSPADDAAREERVKMTRLRQTIARRLKEVQNTAAMLTTFNEVDM
FT                   TNVMALRAQYKDVFEKKHGAKLGFMGFFTKACVQALKDIPAVNAEMDGTDLIYKNYYHI
FT                   GVAVGTDKGLVVPVVRDCDEKSIADIEKSIVDYGKRARDGQLKIEEMQGGTFTITNGGI
FT                   YGSLMSTPILNAPQSGILGMHKIQERPVVIGGKIEVRPMMYLALSYDHRVIDGKEAVTF
FT                   LVRVKESLEDPARLVLDL"
FT   gene            complement(199849..202806)
FT                   /locus_tag="Rpal_0184"
FT   CDS_pept        complement(199849..202806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0184"
FT                   /product="2-oxoglutarate dehydrogenase, E1 subunit"
FT                   /note="TIGRFAM: 2-oxoglutarate dehydrogenase, E1 subunit;
FT                   PFAM: dehydrogenase E1 component; Transketolase central
FT                   region; KEGG: bbt:BBta_0395 alpha-ketoglutarate
FT                   decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98746"
FT                   /db_xref="GOA:B3Q758"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR011603"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR031717"
FT                   /db_xref="InterPro:IPR032106"
FT                   /db_xref="InterPro:IPR042179"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q758"
FT                   /protein_id="ACE98746.1"
FT                   /translation="MSRQDANAAFALSSFLQGANATYIDDLYSRYESDPSSVDADWQAF
FT                   FRSLKDAPGDIQKNAEGPSWEQANWPLTPRDELTSALDGNWNQVEKAVGQKIQAKAQSR
FT                   GVELSSADVLQATRDSVRALMLIRAYRMRGHFHAKLDPLGLSPAKDHEELDIRSYGFTE
FT                   ADLDRKIFLDHVLGLEYGSLREIVAICERTYCQTMGIEFLHISNGAQKAWIQERIEGPD
FT                   KEISFTREGRRAILMKLIESEGFEKFCDLKFTGTKRFGLDGGEALIPALEQIIKRGGNL
FT                   GVREIVLGMPHRGRLNVLTQVMAKAHRALFHEFKGGSANPDEVEGSGDVKYHLGASSDR
FT                   EFDHNKVHLSLTANPSHLEIVDPVVLGKVRAKQDQHGDLPEERISVLPLLMHGDAAFAG
FT                   QGVVAECFALSDLKGYRTGGSIHFIVNNQIGFTTYPRYSRSSPYPSDVAKMIDAPIFHV
FT                   NGDDPEAVVFAAKIAVEYRQKFHKPVVIDMFCYRRHGHNEGDEPSFTQPLMYRKIAGHP
FT                   TTLEIYSKRLIADGVITEGEVEKARADWRARLDAEFEAASSYRPNKADWLDGKWAGFKS
FT                   ADQEEEPRRGITGVDLPTLKEIGRRITKVPEGFRLHRTVQRFLENRARAIDSGNGLDWA
FT                   TGEALAFCTMLLEGHRIRLSGQDSERGTFSQRHSVLIDQEDETRYTPFNHLSPDQGHYE
FT                   VINSLLSEEAVLGFEYGYSLAEPNALTLWEAQFGDFANGAQVLFDQFISSGERKWLRMS
FT                   GLVCLLPHGYEGQGPEHSSARLERYLQMCAEDNMQVVYPTTPANYFHALRRQLKREIRK
FT                   PLILMTPKSLLRHKRAISRLEELGPDTSFHRVLLDDAQTLPDDKTKLVADAKIRRVVVC
FT                   SGKVYYDLYDEREKRGIDDVYLLRVEQLYPVPVKTLVHELSRFKDAELVWCQEEPRNMG
FT                   GWHFIEPYLEWVQNQIEAKHRRPRYVGRAASAATATGLMSKHLAQLKAFLDEALR"
FT   gene            complement(202934..203818)
FT                   /locus_tag="Rpal_0185"
FT   CDS_pept        complement(202934..203818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0185"
FT                   /product="succinyl-CoA synthetase, alpha subunit"
FT                   /note="TIGRFAM: succinyl-CoA synthetase, alpha subunit;
FT                   PFAM: CoA-binding domain protein; ATP-citrate
FT                   lyase/succinyl-CoA ligase; KEGG: bbt:BBta_0394 succinyl-CoA
FT                   synthetase, alpha subunit, NAD(P)-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98747"
FT                   /db_xref="GOA:B3Q759"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR005810"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017440"
FT                   /db_xref="InterPro:IPR033847"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q759"
FT                   /protein_id="ACE98747.1"
FT                   /translation="MSILIDSNTRVICQGFTGKNGTFHSEAAIAYGTKMVGGTSPGKGG
FT                   STHLGLPVFDTVREARDKTGADASVIYVPPPGAADAICEAIDAEIPLIVCITEGIPVLD
FT                   MVRVKRSLNGSKSRLIGPNCPGVMTAGECKIGIMPANIFKPGSVGIVSRSGTLTYEAVF
FT                   QTSAEGLGQTTAVGIGGDPVKGTEFIDVLEMFLADDKTESIIMIGEIGGSAEEDAAQFL
FT                   IDEAKRGRKKPMVGFIAGVTAPPGRRMGHAGAIISGGKGDAASKTAAMEAAGITVSPSP
FT                   ARLGKTLAEKLKS"
FT   gene            complement(203883..205079)
FT                   /locus_tag="Rpal_0186"
FT   CDS_pept        complement(203883..205079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0186"
FT                   /product="succinyl-CoA synthetase, beta subunit"
FT                   /EC_number="6.2.1.5"
FT                   /note="KEGG: bra:BRADO0404 succinyl-CoA synthetase subunit
FT                   beta; TIGRFAM: succinyl-CoA synthetase, beta subunit; PFAM:
FT                   ATP-citrate lyase/succinyl-CoA ligase; ATP-grasp domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98748"
FT                   /db_xref="GOA:B3Q760"
FT                   /db_xref="InterPro:IPR005809"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013650"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3Q760"
FT                   /protein_id="ACE98748.1"
FT                   /translation="MNIHEYQAKAVLREFGVPVGHGFPIFKASEAEAAAKQLGGPVWVV
FT                   KSQIHAGGRGKGKFKEASAGDKGGVRLAKSIDEVKEFAKQMLGATLVTVQTGADGKQVN
FT                   RLYIEEGSDIDKEFYLSLLVDRATSRISFVVSTEGGMSIEDVAHETPEKIVSFTVDPAT
FT                   GIMGHHGRTVAKALNLKGEQAKQAEAMVAKLYTAFVAKDMDMLEINPLVLTKQGDLKCL
FT                   DAKISFDGNALYRHTDIQALRDETEEDAKEIEASKYDLNYVTLDGTIGCMVNGAGLAMA
FT                   TMDIIKLYGMSPANFLDVGGGASKEKVTAAFKIITADPNVKGILINIFGGIMKCDVIAE
FT                   GVVAAVKEVGLDVPLVVRLEGTNVEAGKKIIKHSGLNVLPADNLDDAAQKIVAAVKGA"
FT   gene            complement(205175..206143)
FT                   /locus_tag="Rpal_0187"
FT   CDS_pept        complement(205175..206143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0187"
FT                   /product="malate dehydrogenase, NAD-dependent"
FT                   /note="TIGRFAM: malate dehydrogenase, NAD-dependent; PFAM:
FT                   Lactate/malate dehydrogenase; KEGG: bbt:BBta_0392 malate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98749"
FT                   /db_xref="GOA:B3Q761"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR011275"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3Q761"
FT                   /protein_id="ACE98749.1"
FT                   /translation="MARDKIALIGSGQIGGTLAHLVGLKELGDVVLFDIAEGVPQGKAL
FT                   DIAESSPVDGFDSKLTGANSYEAIEGARVVIVTAGVPRKPGMSRDDLLSINLKVMEQVG
FT                   AGIKKYAPDAFVICITNPLDAMVWALQKASGLPAKKVVGMAGVLDSARFRYFLADEFNV
FT                   SVEDVTAFVLGGHGDTMVPLVKYSTVAGIPLPDLVKMGWTSQARLDEIVDRTRNGGAEI
FT                   VNLLKTGSAFYAPASSAIAMAESYLKDKKRVVPVAAHLNGEYGVKDMYVGVPVVIGDKG
FT                   VERIVEIELAGKDKEAFDKSVAAVQGLVEACKKIAPDLLGR"
FT   gene            complement(206289..207473)
FT                   /locus_tag="Rpal_0188"
FT   CDS_pept        complement(206289..207473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0188"
FT                   /product="AFG1-family ATPase"
FT                   /note="PFAM: AFG1-family ATPase; KEGG: bra:BRADO0402
FT                   putative ATPase (YhcM) AFG1 family"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98750"
FT                   /db_xref="GOA:B3Q762"
FT                   /db_xref="InterPro:IPR005654"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q762"
FT                   /protein_id="ACE98750.1"
FT                   /translation="MSSPHSLRQQYQSLIASGSIEADPAQARAVQAFTLLNETLDGYKP
FT                   PKKQGFFGRLFGGGDAGQAPPQGLYIHGEVGRGKTMLMDLFFDASPIALKRRSHFHEFM
FT                   AETHDRINGFRQAIKRGDIPDADVMELTAASILDEAWLLCFDEFHVTDIADAMILGRLF
FT                   TKLFELGTVVVATSNVAPDDLYKGGLNRSLFMPFIGQVKRHMRVIRLDARTDYRLEKFA
FT                   GMKVWLAPDDAEATATIDRAWHRITGTTKGEPRDISIKGRILHVPQADHHVARFSFADL
FT                   CQKPLGASDYLRLAHEYHTLMIDHVPVMDYADRNAAKRFIALIDTLYDNSVKLMASAAA
FT                   EPARLYRATEGFEALEFNRTVSRLTEMGSESYLALPHGRRDSTATGETTGLVET"
FT   gene            complement(207556..208095)
FT                   /locus_tag="Rpal_0189"
FT   CDS_pept        complement(207556..208095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0189"
FT                   /product="2'-5' RNA ligase"
FT                   /note="TIGRFAM: 2'-5' RNA ligase; PFAM: Phosphoesterase
FT                   HXTX; KEGG: bra:BRADO0401 putative 2'-5' RNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98751"
FT                   /db_xref="GOA:B3Q763"
FT                   /db_xref="InterPro:IPR004175"
FT                   /db_xref="InterPro:IPR009097"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q763"
FT                   /protein_id="ACE98751.1"
FT                   /translation="MPRLFTGLEIPAEISQTLSSLRGGLPGARWVDPDDYHLTLRFIGD
FT                   IDGVTANEIASTLFRVNRKPFEVTLQGLSSFGGKKPRAVVASVVPSKPLIELQAELERL
FT                   MQRVGLDPEGRKFTPHVTLARLRGDVSSRDVADYLSIRGYFPSKVFKAERFVLYSARAS
FT                   TGGGPYIVEAPYELTA"
FT   gene            complement(208301..208915)
FT                   /locus_tag="Rpal_0190"
FT   CDS_pept        complement(208301..208915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0190"
FT                   /product="lipolytic protein G-D-S-L family"
FT                   /note="PFAM: lipolytic protein G-D-S-L family; KEGG:
FT                   bja:bll0459 esterase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98752"
FT                   /db_xref="GOA:B3Q764"
FT                   /db_xref="InterPro:IPR008265"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q764"
FT                   /protein_id="ACE98752.1"
FT                   /translation="MAALPGQTARAETAAKPLKLVVLGDSLTAGYGLPAADAFPAKLQK
FT                   ALKAKGIDTEMVNAGVSGDTASGGLQRLDWSVPPDADAVIVELGANDALRGTDPKVPRK
FT                   ALDEILKRLKARNLPVLLAGMLAPPNYGKDYAAQFDAIYPDLAKQYDVPLYPFFLDGVA
FT                   AVSNLNQADGIHPTAAGVDIIVERILPKVEALLRPLLVQSR"
FT   gene            208995..209738
FT                   /locus_tag="Rpal_0191"
FT   CDS_pept        208995..209738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0191"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bja:blr0460 probable ABC transporter ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98753"
FT                   /db_xref="GOA:B3Q765"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q765"
FT                   /protein_id="ACE98753.1"
FT                   /translation="MDSLIEPSSLAGGAPDSIAISNVNLSLGSGAARVHILKDISLRVG
FT                   AGETIGLIGPSGSGKSTLLMVMAGLERPDSGQVVVDGTSFNGLDEDALARFRGRQIGIV
FT                   FQSFHLIPTMTALENVAVPLELAGQAGAADRAARELTSVGLGERLHHYPSQLSGGEQQR
FT                   VALARALAPDPAILVADEPTGNLDETTGKQIVDLLFAKHAERGMTLVLVTHDSALAQRC
FT                   DRVVRLRSGRIDTTQPGSAARARSA"
FT   gene            209742..212312
FT                   /locus_tag="Rpal_0192"
FT   CDS_pept        209742..212312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0192"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   nha:Nham_0550 protein of unknown function DUF214"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98754"
FT                   /db_xref="GOA:B3Q766"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR038766"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q766"
FT                   /protein_id="ACE98754.1"
FT                   /translation="MTVLTETPPRIPSWSLPLRYALREMRGGLNGFYVFIACIALGVMA
FT                   IAGVGSVAASLGDGLAREGRTLLGGDAAFSLIQREAMPNEVAFLRSRGDVSVAATMRGM
FT                   ARTDDGRSALVELKAVDGAYPLLGDLKLEPPMPVADLLARRDDAFGAAADPALLARLDL
FT                   KIGDKVTIGSATFQIRSAVAAEPDKLSGNIGFGPRFLISDDGLRATQLLQPGSLVRWTY
FT                   RVRLPDNGTDDRAAQRLVDDTRAALPQAGWEIRTRGNASPQLERTITRFTQFLTLVGLA
FT                   ALVVGGVGVANAVKSHIDRRRDVIATLKAVGATGRDVFAIYLTQVIVLALIGAVIGLAL
FT                   GAAMPFALVGLFGQLLPLPVVAALHPGELALSLVYGLLTALAFGLWPLAQVRDVPVATL
FT                   FREAATADSHRPRLRHVALIAAVVAVLLAVVVGLAYDKRVALAVIGATLAIFVLLRGVA
FT                   AGLMAIARRLPRSRITMLRLAIANIHRPGALTPSVVLSLGLGLAVLVTVAQIDGNLRRQ
FT                   FSAALPEKAPTFFFIDIPSSKTDQFGTFLRQIAPNATLEDVPMLRGRIVAARGVRVEDL
FT                   KPAPDAEWVLQSDRGLTYAADIPAGSKVVEGRWWPKDYSGPPLVSFDKKLAQGLGLSIG
FT                   DKVTVNVLGREITATISNLRSIDWQSLGINFVLVFSPDTFRGAPHTHIATLTESGSTPQ
FT                   SDAAVIKQVADRFPMVTSVRVREALETVGGVVSNLVLAVRGASAVTLISAILVLGGALA
FT                   AGHRHRVYDAVILKTLGATRGRLIGAFALEYALIGLATAAFAVLAGSAAAWLIVTRLMT
FT                   LSFAWQAGSAASVVVAALVVTVGLGLIGTWLALNQKPASVLRNL"
FT   gene            212653..215704
FT                   /pseudo
FT                   /locus_tag="Rpal_0193"
FT   gene            214110..214436
FT                   /pseudo
FT                   /locus_tag="Rpal_0194"
FT   gene            214465..215259
FT                   /locus_tag="Rpal_0195"
FT   CDS_pept        214465..215259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0195"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /note="PFAM: aminoglycoside phosphotransferase; KEGG:
FT                   pap:PSPA7_3721 aminoglycoside 3'-phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98755"
FT                   /db_xref="GOA:B3Q767"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR024165"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q767"
FT                   /protein_id="ACE98755.1"
FT                   /translation="MIEQDGLHAGSPAAWVERLFGYDWAQQTIGRSDAAVFRLSAQGRP
FT                   VLFVKTDLSGALNELQDEAARLSWLATTGVPCAAVLDVVTEAGRDWLLLGEVPGQDLLS
FT                   SHLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERARTRMEAGLVDQDDLDEEHQ
FT                   GLAPAELFARLKARMPDGEDLVVTHGDACLPNIMVENGRFSGFIDCGRLGVADRYQDIA
FT                   LATRDIAEELGGEWADRFLVLYGIAAPDSQRIAFYRLLDEFF"
FT   gene            215859..216389
FT                   /locus_tag="Rpal_0196"
FT   CDS_pept        215859..216389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0196"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   nha:Nham_0238 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98756"
FT                   /db_xref="GOA:B3Q768"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q768"
FT                   /protein_id="ACE98756.1"
FT                   /translation="MSNALIRPATSADLPAITAIYEQAVRFGTATFELTPPDLAEMTQR
FT                   FATLTEAGFPYLAAEADGAIAGYAYAGPYRPRPAYRFTVENSIYLDPAAHRRGIGSALL
FT                   RDLIAGCTERGFRQMIAVIGDSANAASIALHRKAGFAPIGTHADVGFKFGRWLDSVLMQ
FT                   RTLGDGGRTVPET"
FT   gene            complement(216449..216817)
FT                   /locus_tag="Rpal_0197"
FT   CDS_pept        complement(216449..216817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0197"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nha:Nham_0406 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98757"
FT                   /db_xref="InterPro:IPR021252"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q769"
FT                   /protein_id="ACE98757.1"
FT                   /translation="MDLISGEADPSESRAAERPGTAPLQGLVTFNRLELNRILNLYGRM
FT                   VAAGEWRDYAIDFLKDTAVFSIFRRASEVPIYRIVKDPRLARKQGAYSVIGASGQILRR
FT                   GHELERVLLVIDRKLALV"
FT   gene            complement(217221..217976)
FT                   /locus_tag="Rpal_0198"
FT   CDS_pept        complement(217221..217976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0198"
FT                   /product="protein of unknown function DUF1223"
FT                   /note="PFAM: protein of unknown function DUF1223; KEGG:
FT                   nha:Nham_0407 protein of unknown function DUF1223"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98758"
FT                   /db_xref="InterPro:IPR010634"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q770"
FT                   /protein_id="ACE98758.1"
FT                   /translation="MNGVGGFSRWSGALGLCVTIATADLAAAEPRAVVELFTSQGCSSC
FT                   PPADRIIGELARDPSVIALSLPIDYWDYLGWKDTLADSRFTARQKAYSQVRGDRDVFTP
FT                   QVVVNGSAHLVGSNRAGIDSAIKTTDKTGGVMTVPVSVAVEGKEIKVSVAAAPQGETAK
FT                   SGEVWICAVSKAIPIEIGRGENRGRHVTYHNVVRNLLKVGDWTGAAEHWTVPLENVVGD
FT                   GVDAAAVYVQNGSREKPGAMLGAAFTSLN"
FT   sig_peptide     complement(217896..217976)
FT                   /locus_tag="Rpal_0198"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.859) with cleavage site probability 0.645 at
FT                   residue 27"
FT   gene            complement(218143..220860)
FT                   /locus_tag="Rpal_0199"
FT   CDS_pept        complement(218143..220860)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0199"
FT                   /product="aconitate hydratase 1"
FT                   /note="TIGRFAM: aconitate hydratase 1; PFAM: aconitate
FT                   hydratase domain protein; KEGG: bbt:BBta_0382 aconitate
FT                   hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98759"
FT                   /db_xref="GOA:B3Q771"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR006249"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q771"
FT                   /protein_id="ACE98759.1"
FT                   /translation="MTSLDSFKCRKILKVGSKSYVYYSLPTAEKNGLKGISRLPYSMKV
FT                   LLENLLRNEDDRTVKKADIMAVAKWMRKKALEHEIAFRPARVLMQDFTGVPAVVDLAAM
FT                   RNAMQKLGGDAEKINPLVPVDLVIDHSVIVNFFGNNQAFKKNVAEEYKQNQERYEFLKW
FT                   GQKAFSNFAVVPPGTGICHQVNLEYLAQTVWTKKEKMTIVRKTGTFEVAYPDTLVGTDS
FT                   HTTMVNGLAVLGWGVGGIEAEAAMLGQPLSMLLPEVVGFKLKGALKEGVTATDLVLTVT
FT                   QMLRKQGVVGKFVEFFGPGLDNLSVADKATIANMAPEYGATCGFFPVDGETIDYLKTSG
FT                   RASARVALVEKYAKAQGLFRTAKSPDPVFTVTLTLDLADVVPSLAGPKRPEGRVALPAV
FT                   AEGFTTAMDAEYKKALDGARYKVEGRNFDIGHGDVVIAAITSCTNTSNPSVLIGAGLLA
FT                   RNAAAKGLKAAPWVKTSLAPGSQVVAEYLANSGLQKDLDKVGFNLVGFGCTTCIGNSGP
FT                   LPEEISKSINDNGIVAAAVLSGNRNFEGRVSPDVQANYLASPPLVVAYALAGSVTKNLA
FT                   VDPIGTGKDGKPVYLKDIWPSTKEINAFVKKYVTSKIFKARYADVFKGDTNWRKIKTVE
FT                   SETYKWNMSSTYVQNPPYFEGMTKQPEPITDVVDARVLALFGDKITTDHISPAGSIKLT
FT                   SPAGKYLTERQVRPADFNQYGTRRGNHEVMMRGTFANIRIKNHMLKGADGNIPEGGLTK
FT                   HWPDGEQMSIYDAAMKYQEEKVPLVVFAGAEYGNGSSRDWAAKGTRLLGVRAVICQSFE
FT                   RIHRSNLVGMGVLPLTFEEGTSWASLGLKGDEKVTIRGLEGDLKPRQMLEAEITSAAGK
FT                   RKRVPLLCRIDTLDELDYYRNGGILHYVLRKLAA"
FT   gene            221076..221678
FT                   /locus_tag="Rpal_0200"
FT   CDS_pept        221076..221678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0200"
FT                   /product="heme exporter protein CcmA"
FT                   /note="KEGG: bja:blr0467 heme exporter protein A; TIGRFAM:
FT                   heme exporter protein CcmA; PFAM: ABC transporter related;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98760"
FT                   /db_xref="GOA:B3Q772"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005895"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q772"
FT                   /protein_id="ACE98760.1"
FT                   /translation="MRLSGRDLRCVRGGREVFAGLAFEASGGEALALVGHNGAGKTSLL
FT                   RLIAGLLTPEAGTITLDGGEPDTPVAEQAHYLGHRDALKPSLSVGENLGFWRDFLGGER
FT                   TDLSAGIKAVGLGHAAELPAAYLSAGQRRRLSIARLLVVRRPIWLLDEPTSALDVKGQE
FT                   LFVGLMQDHLTRGGIIVAATHTPLGIPVREQRIGAAT"
FT   gene            221675..222343
FT                   /locus_tag="Rpal_0201"
FT   CDS_pept        221675..222343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0201"
FT                   /product="heme exporter protein CcmB"
FT                   /note="TIGRFAM: heme exporter protein CcmB; PFAM:
FT                   cytochrome c-type biogenesis protein CcmB; KEGG:
FT                   bja:blr0468 heme exporter protein B"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98761"
FT                   /db_xref="GOA:B3Q773"
FT                   /db_xref="InterPro:IPR003544"
FT                   /db_xref="InterPro:IPR026031"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q773"
FT                   /protein_id="ACE98761.1"
FT                   /translation="MTALGAIIRRDIRIALRVGGGALIGVLFFLTVVVLMPFAVGPDLA
FT                   LLKRLGPAILWLGALLASLLTLDRLFTADAEDGSLDLIVMSRTPLELTCAAKALAHWLA
FT                   AGLPLIVATPVLGLLLNLDGSASLAVMATLLAGTPALTFTGMIGAALAVALRRGGLLLA
FT                   VLVLPLSIPVLIFGVSASQAAIVGPVSFGTPFSILCAISLLSLVIGPFAAAASLRQGLD
FT                   "
FT   gene            222436..223170
FT                   /locus_tag="Rpal_0202"
FT   CDS_pept        222436..223170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0202"
FT                   /product="heme exporter protein CcmC"
FT                   /note="TIGRFAM: heme exporter protein CcmC; PFAM:
FT                   cytochrome c assembly protein; KEGG: nwi:Nwi_0320
FT                   cytochrome c-type biogenesis protein CcmC"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98762"
FT                   /db_xref="GOA:B3Q774"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="InterPro:IPR003557"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q774"
FT                   /protein_id="ACE98762.1"
FT                   /translation="MKLTELANPTRFLTLAGRLLPWLAAATALALAAGLTQGMLAPDDY
FT                   QQGATVKIMFVHVPNAWLAMFVWGVMSVASLGTLVWRHPLADVAAKTAAPIGAAFTFLA
FT                   LVTGSLWGRPMWGTYWEWDARLTSMLVLFLMYLGLIALWRAVEDPSRAARAAAVLTLVG
FT                   AVNLPIIKFSVDWWNTLHQPASVVRMGGSTLDKAFLIPLLVTAIGFSLLFLTLHLAAMR
FT                   NEILRRRVRSLQMMQASRAEAA"
FT   sig_peptide     222436..222534
FT                   /locus_tag="Rpal_0202"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.895 at
FT                   residue 33"
FT   gene            223170..223343
FT                   /locus_tag="Rpal_0203"
FT   CDS_pept        223170..223343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0203"
FT                   /product="heme exporter protein CcmD"
FT                   /note="TIGRFAM: heme exporter protein CcmD; PFAM: Heme
FT                   exporter protein D (CcmD); KEGG: nha:Nham_0412 heme
FT                   exporter protein D (CcmD)"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98763"
FT                   /db_xref="GOA:B3Q775"
FT                   /db_xref="InterPro:IPR007078"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q775"
FT                   /protein_id="ACE98763.1"
FT                   /translation="MFGKYADFIVSSYAATAIVVLLLIGWVVLDYRKQKARLRDLEARG
FT                   AVRRSGRSAIDH"
FT   gene            223360..223956
FT                   /locus_tag="Rpal_0204"
FT   CDS_pept        223360..223956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0204"
FT                   /product="periplasmic protein thiol/disulphide
FT                   oxidoreductase DsbE"
FT                   /note="TIGRFAM: periplasmic protein thiol/disulphide
FT                   oxidoreductase DsbE; PFAM: alkyl hydroperoxide reductase/
FT                   Thiol specific antioxidant/ Mal allergen; Redoxin domain
FT                   protein; Thioredoxin domain; KEGG: bja:blr0471
FT                   thiol:disulfide interchange protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98764"
FT                   /db_xref="GOA:B3Q776"
FT                   /db_xref="InterPro:IPR004799"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q776"
FT                   /protein_id="ACE98764.1"
FT                   /translation="MSDTFDPASPKRRSWLVVLPALLFAGLAVLFWFRLGDSDVSRIPS
FT                   ALIGRPAPQTPLPPLDGLSRDGSQVAGLDPAMFKGKVSVVNVWASWCVPCHDEAPLLMT
FT                   LAQDTRIQLVGIDYKDKPDNARRFLGRYGNPFAAVGVDASGRAAIEWGVYGVPETFVIG
FT                   RDGKIAYKLVGPITPDNIEKVLKPEISKALAAPQS"
FT   gene            224096..224479
FT                   /locus_tag="Rpal_0205"
FT   CDS_pept        224096..224479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0205"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mex:Mext_2496 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98765"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q777"
FT                   /protein_id="ACE98765.1"
FT                   /translation="MGTSTFRRLTLAPLAAAVALGLLASAPAMAQAPQPATPPTAKSDK
FT                   MAPPPKAETKAAAPAKSEKVELLDINSATAEQLDALPGVGKAYSAAIIKGRPYKGKDEL
FT                   VQKKIVPQKTYDGIKDKIIAKQK"
FT   sig_peptide     224096..224188
FT                   /locus_tag="Rpal_0205"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 31"
FT   gene            complement(224619..225236)
FT                   /locus_tag="Rpal_0206"
FT   CDS_pept        complement(224619..225236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0206"
FT                   /product="intracellular septation protein A"
FT                   /note="TIGRFAM: intracellular septation protein A; PFAM:
FT                   Intracellular septation protein A; KEGG: nha:Nham_0403
FT                   intracellular septation protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98766"
FT                   /db_xref="GOA:B3Q778"
FT                   /db_xref="InterPro:IPR006008"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q778"
FT                   /protein_id="ACE98766.1"
FT                   /translation="MTDDLLKPNRPHPLFKLATELGPLLVFFIVNAKFHLFAATGAFMV
FT                   AVVAAVIASYVVTRHVPVMALVTAVVVLVFGTLTLVLHDETFIKMKPTIVYSLFGAVLG
FT                   GGLLFGRSFIAIMFDQVFNLTAAGWRKLTLRWALFFFAMALLNEAVWRTQSTDFWVNFK
FT                   VFGVVPLTMLFALLQMPLTKRYAAEPATLEQSAADEGDVSGR"
FT   gene            complement(225233..226180)
FT                   /locus_tag="Rpal_0207"
FT   CDS_pept        complement(225233..226180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0207"
FT                   /product="signal recognition particle-docking protein FtsY"
FT                   /note="KEGG: bja:bll0473 probable cell division protein;
FT                   TIGRFAM: signal recognition particle-docking protein FtsY;
FT                   PFAM: GTP-binding signal recognition particle SRP54 G-
FT                   domain; GTP-binding signal recognition particle SRP54
FT                   helical bundle; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98767"
FT                   /db_xref="GOA:B3Q779"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q779"
FT                   /protein_id="ACE98767.1"
FT                   /translation="MSDTPENSKQSWWRRLSSGLKRTSSSIGTALSEFVSKRKLDRAML
FT                   EEIEDVLLRADLGTEVAARIAKAVGEGRYDKMISASDVKEIVAAEVEKVLAPVAQPLEV
FT                   DAGNKPFVILMVGVNGSGKTTTIGKLSARFASEGHKVMLAAGDTFRAAAIDQLKVWGDR
FT                   TGTPVVAGAQGSDAAGLAFNALTAAKEQGRDVLLIDTAGRLQNRTELMSELEKVVRVIK
FT                   KVDATAPHAVLLVLDATVGQNALSQVEAFTKTAGVTGLVMTKLDGTARGGILVAIAEKH
FT                   KLPVHFIGVGEGVEDLAPFTARDFAKAIAGTEAA"
FT   gene            226209..227177
FT                   /locus_tag="Rpal_0208"
FT   CDS_pept        226209..227177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0208"
FT                   /product="pseudouridine synthase"
FT                   /note="PFAM: pseudouridine synthase; KEGG: bra:BRADO0385
FT                   putative RNA pseudouridine synthase (uracil hydrolyase)"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98768"
FT                   /db_xref="GOA:B3Q780"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q780"
FT                   /protein_id="ACE98768.1"
FT                   /translation="MNESHPDQFEPPELTPDEIQARVLYRDGLMLVIDKPPGLPVHRGP
FT                   KGGPNLEASFDALRYGLPRPPVLAHRLDRDTSGCLVLGRHRKATATLGLLFKHSRISKT
FT                   YWAIVEGGPTEDQGSIDLPIAKLNAERGWWQKVDPEGLPSLTKWRVMGRSGVLPAAATT
FT                   TSATSAPIRDATTSGSPPPCGEGSGVGVHSGSLTSGRPHPNPLPRAGEGVRPARGEADN
FT                   LSRKPGAILGAPPPTQLTWLALEPITGRTHQLRVHCAAMGWPILGDNIYGNGPRFGEPR
FT                   LHLHAREIVIPLSRNKPPVVVTAPPPTHMHPRLSACGWTAD"
FT   gene            227541..229493
FT                   /locus_tag="Rpal_0209"
FT   CDS_pept        227541..229493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0209"
FT                   /product="acetate/CoA ligase"
FT                   /note="TIGRFAM: acetate/CoA ligase; PFAM: AMP-dependent
FT                   synthetase and ligase; KEGG: bja:blr0573 acetyl-CoA
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98769"
FT                   /db_xref="GOA:B3Q781"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011904"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q781"
FT                   /protein_id="ACE98769.1"
FT                   /translation="MSEKIYDVPAEWASRAFVDDAKYRQMYERSVTDPTGFWAEHAKRV
FT                   DWIKAPTKIDNWSFAPGNVSIKWFEDGVLNAAYNCIDRHLDKRGDQVAIIWEGDDPSQS
FT                   RSITYRELHDEVCKFANILRNRNVGKGDRVTIYLPMIPEAAFAMLACARIGAIHSVVFA
FT                   GFSPDSLAGRINDCNSKIVITADEGLRGGRKVPLKANVDAALKKCDGVDWVMVVKRTGA
FT                   AVEMDDVRDFWYHEAAEVVTTECPVEHMHAEDPLFILYTSGSTGQPKGVLHTTGGYLVF
FT                   ASMTHQYVFDYHDGDIYWCTADVGWVTGHSYILYGPLANGATTLMFEGVPNYPTNSRFW
FT                   EVIDKHKVNIFYTAPTAIRALMQAGDEPVKKTSRKSLRLLGSVGEPINPEAWEWYHRVV
FT                   GEDRCPIVDTWWQTETGGILITPLPGATKLKPGSATRPFFGVVPEILDPEGNVLEGECT
FT                   GNLCLARSWPGQMRTVYGDHARFEQTYFSAYKGKYFTGDGCRRDADGFYWITGRVDDVI
FT                   NVSGHRMGTAEVESSLVAHPKVSEAAVVGYPHDIKGQGIYAYVTLMAGEEPTEDLRKEL
FT                   VAWVRKDIGPIASPDLIQFAPGLPKTRSGKIMRRILRKIAEDEPSSLGDTSTLADPAVV
FT                   DDLVEHRQNKHHKAS"
FT   gene            229876..230403
FT                   /locus_tag="Rpal_0210"
FT   CDS_pept        229876..230403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0210"
FT                   /product="ErfK/YbiS/YcfS/YnhG family protein"
FT                   /note="PFAM: ErfK/YbiS/YcfS/YnhG family protein; KEGG:
FT                   bja:blr0574 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98770"
FT                   /db_xref="GOA:B3Q782"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q782"
FT                   /protein_id="ACE98770.1"
FT                   /translation="MSFGFRSAKLAMVAVVLAGASVLTAPRAEARPDLVVFRGDYSPGT
FT                   IVVRTGERRLYLVVEPGHAVRYPVGVGKAGKQWAGVTKIDGKFRNPAWAPPAEVKRDVP
FT                   TIPDVIPGGSPANPMGVAAMTLAGGEYAIHGTNRPQSIGGFVSYGCIRMLNDDITDLYE
FT                   RVPVGTQVVVMR"
FT   sig_peptide     229876..229968
FT                   /locus_tag="Rpal_0210"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.575 at
FT                   residue 31"
FT   gene            complement(230478..231398)
FT                   /locus_tag="Rpal_0211"
FT   CDS_pept        complement(230478..231398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0211"
FT                   /product="OmpA/MotB domain protein"
FT                   /note="PFAM: OmpA/MotB domain protein; KEGG: bra:BRADO0242
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98771"
FT                   /db_xref="GOA:B3Q783"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q783"
FT                   /protein_id="ACE98771.1"
FT                   /translation="MSDFRGQRREVNENGRIVITEPGRIIVRDPSGQEFIRHNEVDRFR
FT                   YGARDIRTEQIRGGGTRTIVVRPDGTEIINITGDDGQLMRRIRRDRDGREIIIIDNSYG
FT                   PRDRANFYVDLPPPVIRIPRDRYIVDYEDASPELIYETLEAPPVERIERRYTMDEIRYS
FT                   PAVRQRMPSIDLNTINFDLGSWDIPPDQAAKLQAIADGLNRAIQRNPREVFLIEGHTDA
FT                   VGNDTDNLSLSDRRAEAAAALLTQQFGVPAENLTSQGYGEQYLKIQTQAPERQNRRVTI
FT                   RRITPLLNGGQAALPPPPPGVAPPR"
FT   gene            231500..232618
FT                   /locus_tag="Rpal_0212"
FT   CDS_pept        231500..232618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0212"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ani:AN5649.2 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98772"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q784"
FT                   /protein_id="ACE98772.1"
FT                   /translation="MPAERQRDLPAADRAAAEPAAVGRAAGQRRDRRRERPDRLADAAG
FT                   DRRRGRRVADRVRRTVGRRARRRGPTDSPAKSGRPAARPRGPVSVPQQAADWRPQAGAA
FT                   DRDAALRPAAGSCPAQSHSAECPALLEADRGARPGAAWRHPAWQHPARPHWAEQHRAAG
FT                   HDAAVLRLRAARADGRERRRAAAQPDAQQAQRSAEPRASEPAEVAEPHAEEAAERCGSA
FT                   AEAEEAQRAWARAPERLPAAEEAAVQPAEEQAAGAAARHGAELRPAGAAERSGRPWAVQ
FT                   AQGADRAAALPWPFPRTGPALGRPAPPARAASARTRSRPPRDDRSAIPASAPWSRAVQH
FT                   LTSSSNRPSMEQADCARRSRTVSRRVPINDKA"
FT   gene            complement(232778..233035)
FT                   /locus_tag="Rpal_0213"
FT   CDS_pept        complement(232778..233035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0213"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bja:bsr0520 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98773"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q785"
FT                   /protein_id="ACE98773.1"
FT                   /translation="MAPGDPQEVPNDPGPVTPPPEVPPSTPGTPTEPPLEQPPGNPNPD
FT                   IPPPIEEPGAPPQPNELPGYMPAEVPMQSPGRGVPNPGVA"
FT   gene            complement(233035..233523)
FT                   /locus_tag="Rpal_0214"
FT   CDS_pept        complement(233035..233523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0214"
FT                   /product="pyridoxamine 5'-phosphate oxidase-related
FT                   FMN-binding"
FT                   /note="PFAM: pyridoxamine 5'-phosphate oxidase-related
FT                   FMN-binding; KEGG: bbt:BBta_0235 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98774"
FT                   /db_xref="GOA:B3Q786"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR038725"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q786"
FT                   /protein_id="ACE98774.1"
FT                   /translation="MAATMNEGNAQHAWDLMKKITFAMLATRDGEKIRSRPMAAYVRPE
FT                   EGAIYFLTDVRRHKDEEIAQDHHVNLGFANASAQKYVSVTGYAAISDDRAKIKELFGTE
FT                   AKAWWDSPDDPNIRVLKVTPEEAEYWDSPGSLISYAKMMVAAATGSRPDLGENAKVAI"
FT   gene            complement(233760..234542)
FT                   /locus_tag="Rpal_0215"
FT   CDS_pept        complement(233760..234542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0215"
FT                   /product="succinate dehydrogenase and fumarate reductase
FT                   iron-sulfur protein"
FT                   /EC_number="1.3.5.1"
FT                   /note="TIGRFAM: succinate dehydrogenase and fumarate
FT                   reductase iron-sulfur protein; KEGG: bja:blr0515 succinate
FT                   dehydrogenase iron-sulfur subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98775"
FT                   /db_xref="GOA:B3Q787"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q787"
FT                   /protein_id="ACE98775.1"
FT                   /translation="MVEFALPKNSKIVGGKTWPKPEGATEVREFRVYRWNPDDGKNPSV
FT                   DTYYVDKHDCGPMVLDGLIWIKNNIDPTLTFRRSCREGVCGSCAMNIDGENTLACTKAM
FT                   DDVRDDAVKINPLPHQPVVKDLVPDLTNFYAQYASIQPWLQTVTPTPQKEWRQSHSDRE
FT                   KLDGLYECILCACCSTSCPSYWWNSDRFLGPAALLQATRWVEDSRDEATGERLDNLEDP
FT                   FRIYRCHTIMNCAKACPKGLNPSEAIANLKLKLVERQI"
FT   gene            complement(234650..236473)
FT                   /locus_tag="Rpal_0216"
FT   CDS_pept        complement(234650..236473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0216"
FT                   /product="succinate dehydrogenase, flavoprotein subunit"
FT                   /EC_number="1.3.5.1"
FT                   /note="KEGG: bbt:BBta_0230 succinate dehydrogenase
FT                   flavoprotein subunit; TIGRFAM: succinate dehydrogenase,
FT                   flavoprotein subunit; succinate dehydrogenase or fumarate
FT                   reductase, flavoprotein subunit; PFAM: fumarate
FT                   reductase/succinate dehydrogenase flavoprotein domain
FT                   protein; FAD dependent oxidoreductase; FAD-dependent
FT                   pyridine nucleotide-disulphide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98776"
FT                   /db_xref="GOA:B3Q788"
FT                   /db_xref="InterPro:IPR003952"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR011281"
FT                   /db_xref="InterPro:IPR014006"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q788"
FT                   /protein_id="ACE98776.1"
FT                   /translation="MAANVNGAPAAGGYAYPIEDHTYDVVVVGAGGAGLRAVVGCSEAG
FT                   LRTACITKVFPTRSHTVAAQGGISASLGNMHKDDWRWHMYDTVKGSDWLGDQDSIEYMV
FT                   RNAPEAVYELEHWGVPFSRTEDGKIYQRPFGGMTMDFGKGQAQRTCAAADRTGHAMLHT
FT                   MYGQALRHSAEFYIEFFAIDLIMDDQGCCRGVVALKLDDGTIHRFKAQTTILATGGYGR
FT                   AYASCTSAHTCTGDGGAMALRAGLPLQDMEFVQFHPTGIYGSGCLVTEGARGEGGYLVN
FT                   SEGERFMERYAPSAKDLASRDVVSRAMTIEMREGRGVGKKKDHIFLHLDHLAPEVLHER
FT                   LPGISESARIFAGVDVTREPIPILPTVHYNMGGIPTNFHGEVVTKKDGDDNAVVPGLMA
FT                   IGEAACVSVHGANRLGSNSLIDLVVFGRAAALRCAEKLVPNGKQPELPASSADMSLSRL
FT                   DKYRYAKGGTPTAKLRERMQHVMQNNCAVFRTGEVLAEGKELIANVHGSVGDVGVSDRT
FT                   LVWNSDLVETLEFDNLIVQAVVTMNSAANRTESRGAHAREDFPDRDDANWMKHTLAWIG
FT                   DKGDVTIDYRPVHDYTMTNDVQYIPPKPRVY"
FT   gene            complement(236477..236890)
FT                   /locus_tag="Rpal_0217"
FT   CDS_pept        complement(236477..236890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0217"
FT                   /product="succinate dehydrogenase, hydrophobic membrane
FT                   anchor protein"
FT                   /note="TIGRFAM: succinate dehydrogenase, hydrophobic
FT                   membrane anchor protein; PFAM: succinate dehydrogenase
FT                   cytochrome b subunit; KEGG: nha:Nham_3617 succinate
FT                   dehydrogenase, cytochrome b subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98777"
FT                   /db_xref="GOA:B3Q789"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR014312"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q789"
FT                   /protein_id="ACE98777.1"
FT                   /translation="MSSDAHGKRTPTSMRTPIGKVRKFGPAGSGTSDFWQQRITGVAMA
FT                   LLILPTIVVIMMLLGRNQAAAAQILGSPLISLIMILFIIASAIHMKIGMQVVIEDYVQN
FT                   EKLKLVTIMANNFFSIAVALAAIFAIFKMASGV"
FT   gene            complement(236887..237285)
FT                   /locus_tag="Rpal_0218"
FT   CDS_pept        complement(236887..237285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0218"
FT                   /product="succinate dehydrogenase, cytochrome b556 subunit"
FT                   /note="TIGRFAM: succinate dehydrogenase, cytochrome b556
FT                   subunit; PFAM: succinate dehydrogenase cytochrome b
FT                   subunit; KEGG: bja:blr0512 succinate dehydrogenase
FT                   cytochrome b-556 subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98778"
FT                   /db_xref="GOA:B3Q790"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR014314"
FT                   /db_xref="InterPro:IPR018495"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q790"
FT                   /protein_id="ACE98778.1"
FT                   /translation="MTARIERPLSPHMQAYRWSLTMTMSIVHRATGIALYSGTLLLAWW
FT                   LIACAAGPTAYANVQAFTGSWIGRLIVFGYTWSLMHHMLSGVRHFVWDLGYGFKTADRE
FT                   WLTWAALIGGIVLTVLLWVIAYSMGVAR"
FT   sig_peptide     complement(237112..237285)
FT                   /locus_tag="Rpal_0218"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.630) with cleavage site probability 0.412 at
FT                   residue 58"
FT   gene            237664..238608
FT                   /locus_tag="Rpal_0219"
FT   CDS_pept        237664..238608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0219"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /note="TIGRFAM: cation diffusion facilitator family
FT                   transporter; PFAM: cation efflux protein; KEGG:
FT                   nha:Nham_3422 cation diffusion facilitator family
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98779"
FT                   /db_xref="GOA:B3Q830"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q830"
FT                   /protein_id="ACE98779.1"
FT                   /translation="MSHDHHHHHGPGAAHGAGGHSHAPQDFGRAFAIGIALNMVFVVAE
FT                   AAFGYFSNSMALIADAGHNLSDVAGLVVAWIAAGLSKRPPSARYTYGLRGSSILAALFN
FT                   AVFLLLAVGAIGWEAVVRLFAPEPVAGITVMVVAGIGIVINAVTAWLFASGRHSDLNIR
FT                   GAYLHMAADAAVSAAVVVAGVIILLTGWYWIDPAVSLIVAVVIVWGTWGLLRDSTALSL
FT                   AAVPRDIDPTAVRAFLSKLPGVTQVHDLHIWGMSTTEVALTCHLVMPSGSPGDPFLVDL
FT                   AHELQHDFGIAHTTVQIETDPNTVCALAPEHVV"
FT   gene            complement(238841..240352)
FT                   /locus_tag="Rpal_0220"
FT   CDS_pept        complement(238841..240352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0220"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   bbt:BBta_0226 malonyl-CoA synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98780"
FT                   /db_xref="GOA:B3Q831"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q831"
FT                   /protein_id="ACE98780.1"
FT                   /translation="MNANLFARLFDKLDDPHKLAIETAAGDKISYAELVARAGRVANVL
FT                   VARGLQVGDRVAAQTEKSVEALVLYLATVRGGGVYLPLNTAYTLHELDYFITDAEPKIV
FT                   VCDPSKRDGIAAIAAKVGATVETLGPDGRGSLTDAAAQADEAFATVERGADDLAAILYT
FT                   SGTTGRSKGAMLSHDNLASNSLTLVEFWRFTPDDVLIHALPIYHTHGLFVASNVTLFAR
FT                   GSMIFLPKFDPDKILDLMARATVLMGVPTFYTRLLQSPRLTKEATGHMRLFISGSAPLL
FT                   ADTHREWSAKTGHAVLERYGMTETNMNTSNPYDGDRVPGAVGPALPGVSARVTDPETGK
FT                   ELPRGDIGMIEVKGPNVFKGYWRMPEKTKSEFRDDGFFITGDLGKIDERGYVHILGRGK
FT                   DLVITGGFNVYPKEIESEIDAMPGVVESAVIGVPHADFGEGVTAVVVRDKGAAIDEAQV
FT                   LHGLDGQLAKFKMPKKVIFVDDLPRNTMGKVQKNVLRETYKDIYK"
FT   gene            240629..241204
FT                   /locus_tag="Rpal_0221"
FT   CDS_pept        240629..241204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0221"
FT                   /product="beta-Ig-H3/fasciclin"
FT                   /note="PFAM: beta-Ig-H3/fasciclin; KEGG: bbt:BBta_0336
FT                   putative exported protein of unknown function with Fas1
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98781"
FT                   /db_xref="InterPro:IPR000782"
FT                   /db_xref="InterPro:IPR036378"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q832"
FT                   /protein_id="ACE98781.1"
FT                   /translation="MTKRIALLTAAAFSALALAATVSVPASAESGKMMKSSGDTVMVGG
FT                   APMYPSKTIVENAAKSKDHTTLVAAVKAAGLVKTLDGKGPFTVFAPTNMAFDKLPAGTV
FT                   DTLIKPENKAQLTKILTYHVVPGKLEAADLTDGKKLKTVEGETLTVKRMGDQVTLIDAK
FT                   GGSSTVTIPNVNQSNGVIHVIDTVLMPS"
FT   sig_peptide     240629..240715
FT                   /locus_tag="Rpal_0221"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.745 at
FT                   residue 29"
FT   gene            241426..242064
FT                   /locus_tag="Rpal_0222"
FT   CDS_pept        241426..242064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0222"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bja:bll0506 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98782"
FT                   /db_xref="GOA:B3Q833"
FT                   /db_xref="InterPro:IPR000516"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q833"
FT                   /protein_id="ACE98782.1"
FT                   /translation="MSTTTLTDPAPTTVPAESGAVLQPLWVRVMHWINAAAMLAMILSG
FT                   WQIYNAAPLFDFQFSRALTLGGWLGGGLLWHFAAMWVLVINGLLYVILGFATGRFRNKL
FT                   WPITLSGVASDLSQAIRLRLSHDDLSRYNAVQKVLYVGVLLVGLVSVASGLAIWKPVQF
FT                   HSLTALLGGYDTARYVHFFAMSAIVGFSAIHIVLAALVPKALRAMIIGR"
FT   gene            242180..242959
FT                   /locus_tag="Rpal_0223"
FT   CDS_pept        242180..242959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0223"
FT                   /product="oxidoreductase molybdopterin binding"
FT                   /note="PFAM: oxidoreductase molybdopterin binding; KEGG:
FT                   nha:Nham_3598 oxidoreductase, molybdopterin binding"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98783"
FT                   /db_xref="GOA:B3Q834"
FT                   /db_xref="InterPro:IPR000572"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR036374"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q834"
FT                   /protein_id="ACE98783.1"
FT                   /translation="MLRINRLLIPGVDKKLLVRDAAKLMPDVSRRRFLAGGASLGALTL
FT                   LTGCDVVDGASAETLLAKVSKFNDAVQAAIFNPNTLAPTFSEKDITRPFPFNAYYSLDE
FT                   APTIDGGDWKLEVSGLVQNKKSWTLQELTQLPEVSQITRHVCVEGWSAIGHWSGVRLRD
FT                   FLDLIGADTKANYVWFRCADDYTSPIDMPTALHPQTQMTFKFGGDVLPRAYGYPMKIRI
FT                   PTKLGFKNPKYVVSMEVTNDYKGGYWEDQGYNSFSGL"
FT   gene            243232..243750
FT                   /locus_tag="Rpal_0224"
FT   CDS_pept        243232..243750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0224"
FT                   /product="superoxide dismutase copper/zinc binding"
FT                   /note="PFAM: superoxide dismutase copper/zinc binding;
FT                   KEGG: nha:Nham_3597 superoxide dismutase, copper/zinc
FT                   binding"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98784"
FT                   /db_xref="GOA:B3Q835"
FT                   /db_xref="InterPro:IPR001424"
FT                   /db_xref="InterPro:IPR018152"
FT                   /db_xref="InterPro:IPR024134"
FT                   /db_xref="InterPro:IPR036423"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q835"
FT                   /protein_id="ACE98784.1"
FT                   /translation="MILRALLCTGALLGVTTAAMAADSAKATLKNAEGTEIGTATLTEG
FT                   SKGVTIKLALKGLPPGEHAFHIHAVGKCEPPFTSAGGHFNPENKKHGKMAEGGAHAGDM
FT                   PNLDVPASGALSIDVVNDAVTLAKGKPNSVFKDGGTALVIHAKADDYKSDPAGNAGDRI
FT                   ACGVIEEAK"
FT   sig_peptide     243232..243297
FT                   /locus_tag="Rpal_0224"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 22"
FT   gene            complement(243816..245003)
FT                   /locus_tag="Rpal_0225"
FT   CDS_pept        complement(243816..245003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0225"
FT                   /product="protein of unknown function DUF1228"
FT                   /note="PFAM: protein of unknown function DUF1228; major
FT                   facilitator superfamily MFS_1; KEGG: bja:blr0503
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98785"
FT                   /db_xref="GOA:B3Q836"
FT                   /db_xref="InterPro:IPR010645"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q836"
FT                   /protein_id="ACE98785.1"
FT                   /translation="MTLLDRTEAAPAHPARLILILSLAPTVGLGIGRFAYSLLLPDMRD
FT                   SLGWSYSAAGFMNTINAAGYLVGALVTSRLVARFGMAAIVRVGTLACVASLALCALSGN
FT                   FAVLSAARLIAGIGAALAFVAGGALATTIAQAQPARSAFLLSLFYAGPGIGILSSGLIA
FT                   PFLLQAAGPGSWWLGWLVLAALSAAMTLPVLLAPIGVDGGLGGGRAAPFRIAPVLVYLA
FT                   GYFMFGAGYIAYMTFMIAYVRDAGGGAAAQSAFWCLIGISAFVTPWVWRRVMALHRGGL
FT                   STTIILAVNAVGAVLPLFSLSPVMLATSALVFGVSFFAVVASTTAFVRFNYPQAGWPGA
FT                   IAAMTIAFGIGQTLGPLVVGAITDAIGSLSSALAVSAATLALGAALSAFQRPLPK"
FT   gene            245224..246336
FT                   /locus_tag="Rpal_0226"
FT   CDS_pept        245224..246336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0226"
FT                   /product="3-isopropylmalate dehydrogenase"
FT                   /note="TIGRFAM: 3-isopropylmalate dehydrogenase; PFAM:
FT                   isocitrate/isopropylmalate dehydrogenase; KEGG:
FT                   nha:Nham_3595 3-isopropylmalate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98786"
FT                   /db_xref="GOA:B3Q837"
FT                   /db_xref="InterPro:IPR004429"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q837"
FT                   /protein_id="ACE98786.1"
FT                   /translation="MATHKLLLLPGDGIGTEVMAEVSRLIDWLNKAGIASFETEHGLVG
FT                   GAAYDADKVAITDATMALAQASDAVIFGAVGGPKWDGVPYDARPEAGLLRLRKDLGLFA
FT                   NLRPAVCYPALADSSSLKRDVVEGLDIMIVRELTGGVYFGEPKTITDLGNGQKRAVDTQ
FT                   VYDTYEIERIGRVAFDLARKRRNKVTSMEKRNVMKTGVLWNEVITAVHDREYKDVQLDH
FT                   QLADSGGMNLVKWPKQFDVIVTDNLFGDMLSDIAAMLTGSLGMLPSASLGEVDAKTGKR
FT                   KSMYEPVHGSAPDIAGKGMANPVAMLASFGMALRYSLDMGALADKLDEAIAAVLAKGLR
FT                   TADIKSEGTTVISTSQMGEAIVTELQALHA"
FT   gene            complement(246494..246895)
FT                   /locus_tag="Rpal_0227"
FT   CDS_pept        complement(246494..246895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0227"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nha:Nham_3594 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98787"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q838"
FT                   /protein_id="ACE98787.1"
FT                   /translation="MRLPMGTPMFVKSTAARLLPVLLAAAAVAVIGVSNADAAPKKKRV
FT                   YGTSDQIRYGSRGPNVVYQAGPRTRVYVTKRSWLDAGTEVQPGERHFSDYAFPPGYSFA
FT                   RENGQRPLDRWPLNPASDLGGSPTGFPLY"
FT   sig_peptide     complement(246785..246895)
FT                   /locus_tag="Rpal_0227"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.610 at
FT                   residue 37"
FT   gene            complement(247039..247848)
FT                   /locus_tag="Rpal_0228"
FT   CDS_pept        complement(247039..247848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0228"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bbt:BBta_0343 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98788"
FT                   /db_xref="GOA:B3Q839"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q839"
FT                   /protein_id="ACE98788.1"
FT                   /translation="MRSSPALRAAASRHRIYPALQSFAEECRDTLLRTMAYVGALALIG
FT                   LIVFYTANPLTDAAITAATTAEAGPGWSVATRSQPAYALNQLDWPGKTETTEILRHPDG
FT                   GRKDILRLAAPGEPVAAEIEIYRIGRETSRVAAEAALAARMDPAGTATIETAGVIDTKF
FT                   GPVPLFSLTGSDRPAGSCLGFVKAIDAASLRISGFSCRGDSGPQRRTAVACLLDRLVLL
FT                   SGDAATAAAFAQAELRRGSCAPNQSAASAASADWITGLQDPLLRGRL"
FT   gene            247963..248997
FT                   /locus_tag="Rpal_0229"
FT   CDS_pept        247963..248997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0229"
FT                   /product="aspartate-semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.11"
FT                   /note="KEGG: bja:bll0501 aspartate-semialdehyde
FT                   dehydrogenase; TIGRFAM: aspartate-semialdehyde
FT                   dehydrogenase; PFAM: Semialdehyde dehydrogenase NAD -
FT                   binding; Semialdehyde dehydrogenase dimerisation region"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98789"
FT                   /db_xref="GOA:B3Q840"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR005986"
FT                   /db_xref="InterPro:IPR012080"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q840"
FT                   /protein_id="ACE98789.1"
FT                   /translation="MGYKVAVVGATGNVGREMLAILDERKFPADEVVALASRRSVGVEV
FT                   SYGDKTLKCKALEHYDFSDVDICLMSAGGEVSKEWSPKIGAQGAVVIDNSSAWRMDPDV
FT                   PLIVPEVNAAAAAGFTKKNIIANPNCSTAQLVVALKPLHDHAKIKRVVVSTYQSVSGAG
FT                   KDAMDELFSQTKAVYTNSELVNKKFPKRIAFNLIPQIDVFMEDGFTKEEWKMVVETKKI
FT                   LDPKIKLTATCVRVPVFVSHSESVNIEFENPISADEAREILRKAPGCLVIDKHEPGGYV
FT                   TPYEAAGEDATYISRIRTDPTVDNGLVLWCVSDNLRKGAALNAIQIAEVLINRKLITAK
FT                   KQAA"
FT   gene            249133..249687
FT                   /locus_tag="Rpal_0230"
FT   CDS_pept        249133..249687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0230"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   bra:BRADO0359 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98790"
FT                   /db_xref="GOA:B3Q841"
FT                   /db_xref="InterPro:IPR005134"
FT                   /db_xref="InterPro:IPR020761"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q841"
FT                   /protein_id="ACE98790.1"
FT                   /translation="MTDQPDPTPSPSSAKHVERGFETLLFNSRWLMAPFYFGLVISLVV
FT                   LLYKFVMLLYEFIVHATLAKESDIILGVLSLIDVSLTGNLVLIVVFSGYENFVSRIDPG
FT                   NHPDWPEWMTKVDFAGLKQKLLASIVAISAIQVLKAFMNIDSYDQTKLAWLVGIHLVFV
FT                   VSTLIMALSDRWGHSDDKGGH"
FT   gene            complement(249839..250483)
FT                   /locus_tag="Rpal_0231"
FT   CDS_pept        complement(249839..250483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0231"
FT                   /product="Carbonate dehydratase"
FT                   /EC_number="4.2.1.1"
FT                   /note="PFAM: carbonic anhydrase; KEGG: bbt:BBta_0346
FT                   putative carbonic anhydrase 2"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98791"
FT                   /db_xref="GOA:B3Q842"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR015892"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q842"
FT                   /protein_id="ACE98791.1"
FT                   /translation="MTSFPKSLIDGYEAFRTQRLPTEQSRFRELSERGQSPEVMVIGCC
FT                   DSRVSPEVIFDAGPGEMFVVRNVANLVPVYEPDGGAHGVSAALEFAVQVLRVKHIVVLG
FT                   HALCGGIKAFTDKTPPLTESDFIGRWMQMFTKPGEVVEKRDHETVQDFRTRIEKAAVFR
FT                   SIENLMTFPCVKILVERGKLQLHGAYFGVADGDLFVLDQENKQFVPAAKVV"
FT   gene            250664..251542
FT                   /locus_tag="Rpal_0232"
FT   CDS_pept        250664..251542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0232"
FT                   /product="Citryl-CoA lyase"
FT                   /EC_number="4.1.3.34"
FT                   /note="PFAM: HpcH/HpaI aldolase; KEGG: bbt:BBta_0347
FT                   putative citrate lyase beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98792"
FT                   /db_xref="GOA:B3Q843"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR011206"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q843"
FT                   /protein_id="ACE98792.1"
FT                   /translation="MIRPRRSLLFMPGSNARALEKARLLPVDGLILDLEDAVAPDAKDT
FT                   ARDQIAAAVAAKGYGKREVLVRINALDTAWWQDDIAMAAKAGPDGILVPKVSSIEDIAT
FT                   VGNKLAELGADPSIRVWIMIETARGVLHAEELAAQKHEAKSRLEGFVFGPNDISRETGI
FT                   RMLPGRSTMLSMITHCVLAARVHGLIALDGPYSDIGNVDGLSEECAQARDLGFDGKTLI
FT                   HPGQIDACNAAFTPPPEDVAQARKILAAFERPENQGRGAIQLDGRMVERLHAEIAKKTI
FT                   AIADAIETAGH"
FT   sig_peptide     250664..250720
FT                   /locus_tag="Rpal_0232"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.658) with cleavage site probability 0.649 at
FT                   residue 19"
FT   gene            complement(251718..253409)
FT                   /locus_tag="Rpal_0233"
FT   CDS_pept        complement(251718..253409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0233"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: histidine kinase HAMP region domain protein;
FT                   chemotaxis sensory transducer; KEGG: mag:amb3991
FT                   methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98793"
FT                   /db_xref="GOA:B3Q844"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q844"
FT                   /protein_id="ACE98793.1"
FT                   /translation="MKIRLSITSMIVAFAVVVLVSLTAMLTTNIMALNQLRVGGPLYSQ
FT                   IKLGNDLVADILPPPAYVIEAYLEATLALRRPTEWRAHAAKLEQLHRDYLDRQKYWSGS
FT                   ELDPVLKTRLTVDSDAAVQKFWRAAEQELIPALSAGDEAAAEAAYTKLDASYAAHRAII
FT                   DDIVKRANAENAELETEAARQVGSYSTIVWILSGFAALLIALGVAGLAVGMVRPLVRLT
FT                   AAMQAMAAGMLDVVIPGAGRSDEIGGMAKAITAIKTNAEHKANQEAAEKSRQEHLAAEQ
FT                   RKADMARLADGFEDAVGEIIKTVSSAANELEAAAHSLSSTAARSLELAVGVASSSQEAS
FT                   AGVQSVASASEELTASVHEIGRQVQTSANVANEAADQARQTNERVSELSAAAARIGDVV
FT                   ELISNIAGQTNLLALNATIEAARAGEAGRGFAVVASEVKALAEQTGKATGEIGQQITGI
FT                   QAATGESVAAIKEICSIIGQMSEISSSIASAVEEQGMATKDIAVNIQHAAHGTSQVDED
FT                   IARVQAGARETGAASVQVLSAAKSLSSESSRLRAEVGNFLASVRAA"
FT   sig_peptide     complement(253311..253409)
FT                   /locus_tag="Rpal_0233"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.480 at
FT                   residue 33"
FT   gene            complement(254159..254764)
FT                   /locus_tag="Rpal_0234"
FT   CDS_pept        complement(254159..254764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0234"
FT                   /product="3-isopropylmalate dehydratase, small subunit"
FT                   /EC_number="4.2.1.33"
FT                   /note="KEGG: bra:BRADO0365 isopropylmalate isomerase small
FT                   subunit; TIGRFAM: 3-isopropylmalate dehydratase, small
FT                   subunit; PFAM: aconitate hydratase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98794"
FT                   /db_xref="GOA:B3Q845"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR004431"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3Q845"
FT                   /protein_id="ACE98794.1"
FT                   /translation="MDKFTTLEGVAAPLKIINVDTDMIIPKQYLKTIKRTGLGKGLFSE
FT                   QRYKDDGSENPDFILNKPAYRGAKILVAGDNFGCGSSREHAPWALLDFGIRCVISTSFG
FT                   DIFYNNCFKNGVLPIRVSQADLDKLFDDAERGSNATMTIDLQAQEIRGPDGGAIKFEID
FT                   PFRKHCLINGLDDIGLTLEKKPSIDAYETKLKTERAWA"
FT   gene            complement(254850..255263)
FT                   /locus_tag="Rpal_0235"
FT   CDS_pept        complement(254850..255263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0235"
FT                   /product="protein of unknown function DUF1025"
FT                   /note="PFAM: protein of unknown function DUF1025; KEGG:
FT                   bja:blr0494 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98795"
FT                   /db_xref="InterPro:IPR010428"
FT                   /db_xref="InterPro:IPR038555"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q846"
FT                   /protein_id="ACE98795.1"
FT                   /translation="MWINAKAPSLADLEQMAHEMFARLPGEFRSLCEDVIIRVDDFATE
FT                   EVLDELGAETEFDVLGLFQGIGLPQRSSQDVAPMPNMIWLYRRPILDYWAEHDDSLGEI
FT                   VRHVLVHEIGHHFGLSDDDMEAIEAKADELAED"
FT   gene            255369..255716
FT                   /locus_tag="Rpal_0236"
FT   CDS_pept        255369..255716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0236"
FT                   /product="putative exported protein of unknown function"
FT                   /note="KEGG: bbt:BBta_0353 putative exported protein of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98796"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q847"
FT                   /protein_id="ACE98796.1"
FT                   /translation="MDQLGKGRITITAAALGLGLAFGLPATTSAQAQQTAAANADRAAA
FT                   DRLTDVSSQDRVRRAPRRVPVYPRDEGDDVIPRYNPGPNAVRDCTASYVQEYRPSGTVI
FT                   VPRMNCFWRRG"
FT   sig_peptide     255369..255467
FT                   /locus_tag="Rpal_0236"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.944 at
FT                   residue 33"
FT   gene            255948..256229
FT                   /locus_tag="Rpal_0237"
FT   CDS_pept        255948..256229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0237"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nwi:Nwi_2788 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98797"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q848"
FT                   /protein_id="ACE98797.1"
FT                   /translation="MKILKLSGLAAIAGLLLIAAPGERAQAAPLSTPGIAASVQRDAIP
FT                   QTTEVQYRHHRHMHRHHHRSHRHHHVRRHYGHRHHHHHYRHHHHRHWR"
FT   sig_peptide     255948..256031
FT                   /locus_tag="Rpal_0237"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.833 at
FT                   residue 28"
FT   gene            256340..256651
FT                   /locus_tag="Rpal_0238"
FT   CDS_pept        256340..256651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0238"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nha:Nham_3587 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98798"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q849"
FT                   /protein_id="ACE98798.1"
FT                   /translation="MRTWIGAAILATALGAAGPAGATPATAAKATGVSGAQATDISARQ
FT                   RKPHAKHRHVRRHSAPHRTYVYGPRGSYDYNARPHWYRPDPVSPFFPFSYGWGLGPSW"
FT   sig_peptide     256340..256423
FT                   /locus_tag="Rpal_0238"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.557 at
FT                   residue 28"
FT   gene            256772..257443
FT                   /locus_tag="Rpal_0239"
FT   CDS_pept        256772..257443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0239"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bra:BRADO0372 conserved hypothetical protein
FT                   (partial)"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98799"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q850"
FT                   /protein_id="ACE98799.1"
FT                   /translation="MADLRVIRMPAAQSSRPSPGPLRLVRRIGVALMAATALTISAITP
FT                   RPALALSPVTPATKSISSAAATQPIQVQHHFGHGGGPRVGGFHGGGFRGGPAFHGGFRG
FT                   GPAVGPRFYGGGRHFYAGPRVYGAPRFYGRPRYFGARHYGFHRRYYRPRVYGYYGPAYY
FT                   GSAYYYPAYYGYYRPRVCRVVWTYYGPRRVCHVRHWRHHWHRHWRHHHRHHHHHRHWRV
FT                   Y"
FT   sig_peptide     256772..256924
FT                   /locus_tag="Rpal_0239"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.801) with cleavage site probability 0.798 at
FT                   residue 51"
FT   gene            complement(257510..258919)
FT                   /locus_tag="Rpal_0240"
FT   CDS_pept        complement(257510..258919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0240"
FT                   /product="3-isopropylmalate dehydratase, large subunit"
FT                   /EC_number="4.2.1.33"
FT                   /note="KEGG: nha:Nham_3584 isopropylmalate isomerase large
FT                   subunit; TIGRFAM: 3-isopropylmalate dehydratase, large
FT                   subunit; PFAM: aconitate hydratase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98800"
FT                   /db_xref="GOA:B3Q851"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004430"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3Q851"
FT                   /protein_id="ACE98800.1"
FT                   /translation="MSAKPTTLYDKIWNDHLVHEAEDGTCLLYIDRHLVHEVTSPQAFE
FT                   GLRTAGRKVHAPEKTLAVVDHNVPTTDRSKPNPDPESAEQIAALAENARDFGITYYNEF
FT                   DKRQGVVHVIGPEQGFTLPGTTIVCGDSHTSTHGAFGALAHGIGTSEVEHVLATQTLIQ
FT                   KKAKNMRVTVDGQLPDGVTAKDVILAIIGEIGTAGGTGYVLEYAGDAIRSLSMEGRMTV
FT                   CNMSIEGGARAGLIAPDAKAYEFLKGRPLAPKGEAWDAALRYWETLRSDDGAHFDHELK
FT                   LDAAALPPIVTWGTSPEDVISVTGRVPNPADIADEAKRLSKERALAYMGLTPGTKITDI
FT                   KIDRMFIGSCTNGRIEDLRAAAKVAEGKTVNANVNAIIVPGSGLVKEQAEAEGLDKIFI
FT                   KAGFEWREPGCSMCLAMNPDKLAPEERCASTSNRNFEGRQGFKGRTHLVSPAMAAAAAI
FT                   AGHFVDIRDWH"
FT   gene            complement(258996..259109)
FT                   /locus_tag="Rpal_0241"
FT   CDS_pept        complement(258996..259109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0241"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nha:Nham_3583 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98801"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q852"
FT                   /protein_id="ACE98801.1"
FT                   /translation="MDGMFPNRRRASKIVLDDRSRLPWRFFGRLTTAALIS"
FT   gene            complement(259229..259618)
FT                   /locus_tag="Rpal_0242"
FT   CDS_pept        complement(259229..259618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0242"
FT                   /product="ribosomal protein L19"
FT                   /note="PFAM: ribosomal protein L19; KEGG: nha:Nham_3582 50S
FT                   ribosomal protein L19"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98802"
FT                   /db_xref="GOA:B3Q853"
FT                   /db_xref="InterPro:IPR001857"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR018257"
FT                   /db_xref="InterPro:IPR038657"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3Q853"
FT                   /protein_id="ACE98802.1"
FT                   /translation="MNLIQTLEKEQFDKLSAGKTIPEFGPGDTVIVNVKVVEGERSRVQ
FT                   AYEGVCIGRSGGGINESFTVRKISYGEGVERVFPLLSPMIDSIKVVRRGKVRRAKLYYL
FT                   RNLRGKSARIVEKKQDRTAAVAAAE"
FT   gene            complement(259732..260478)
FT                   /locus_tag="Rpal_0243"
FT   CDS_pept        complement(259732..260478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0243"
FT                   /product="tRNA (guanine-N1)-methyltransferase"
FT                   /note="KEGG: bja:blr0486 tRNA
FT                   (guanine-N1)-methyltransferase; TIGRFAM: tRNA
FT                   (guanine-N1)-methyltransferase; PFAM: tRNA
FT                   (guanine-N1-)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98803"
FT                   /db_xref="GOA:B3Q854"
FT                   /db_xref="InterPro:IPR002649"
FT                   /db_xref="InterPro:IPR016009"
FT                   /db_xref="InterPro:IPR023148"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3Q854"
FT                   /protein_id="ACE98803.1"
FT                   /translation="MTWRATVLTLFPEMFPGPLGVSLAGRALASGLWGLEARDIRDSAT
FT                   DRHRSVDDTPAGGGPGMVLRADVLAAAIDAVDAAADRPRLVMSPRGRPLTQARVAELAA
FT                   GPGPLIVCGRFEGIDQRVIDARGLEEVSIGDYVLSGGEIAAMALIDACVRLLPGVMGKL
FT                   ESSTDESFSAGLLEYPQYTRPQTFEGRAIPEVLLSGDHGKVAAWRLGEAEALTKARRPD
FT                   LWAARPAQTIRAKGESQKTPKNKTDG"
FT   gene            complement(260621..261151)
FT                   /locus_tag="Rpal_0244"
FT   CDS_pept        complement(260621..261151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0244"
FT                   /product="16S rRNA processing protein RimM"
FT                   /note="TIGRFAM: 16S rRNA processing protein RimM; PFAM:
FT                   RimM protein; PRC-barrel domain protein; KEGG: bja:blr0483
FT                   16S rRNA processing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98804"
FT                   /db_xref="GOA:B3Q855"
FT                   /db_xref="InterPro:IPR002676"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR011961"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="InterPro:IPR036976"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3Q855"
FT                   /protein_id="ACE98804.1"
FT                   /translation="MPSGLICVARIGAPHGVRGAVRLWSFTADPFAVSDYGPLVTKDGA
FT                   RQFEIASAREAKSHLVVTLKGVATRDEAERLNGVELYVARDKLPPTEADEYYHADLIGL
FT                   AAVTTAGDALGKVVAIHNFGAGDIIEIAPPSGPTLLLPFTNAVVPTVDLAAGQVVIELP
FT                   NEIEGDTPNHPEA"
FT   gene            complement(261164..261484)
FT                   /locus_tag="Rpal_0245"
FT   CDS_pept        complement(261164..261484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0245"
FT                   /product="ribosomal protein S16"
FT                   /note="PFAM: ribosomal protein S16; KEGG: bra:BRADO0378 30S
FT                   ribosomal protein S16"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98805"
FT                   /db_xref="GOA:B3Q856"
FT                   /db_xref="InterPro:IPR000307"
FT                   /db_xref="InterPro:IPR023803"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3Q856"
FT                   /protein_id="ACE98805.1"
FT                   /translation="MSVVIRLARAGTKKRPFYHVVVADSRFPRDGRFIERLGYFNPLMA
FT                   KDNEARLKLDLDKVKDWLAKGAQPSDRVARFLDTAGVRKREARNNPEKAVPRKERKAAD
FT                   GK"
FT   gene            complement(261654..263204)
FT                   /locus_tag="Rpal_0246"
FT   CDS_pept        complement(261654..263204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0246"
FT                   /product="signal recognition particle protein"
FT                   /note="KEGG: bbt:BBta_0368 signal recognition particle with
FT                   4.5 RNA, ffh family; TIGRFAM: signal recognition particle
FT                   protein; PFAM: GTP-binding signal recognition particle
FT                   SRP54 G- domain; Signal peptide binding (SRP54) M- domain
FT                   protein; GTP-binding signal recognition particle SRP54
FT                   helical bundle; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98806"
FT                   /db_xref="GOA:B3Q857"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004125"
FT                   /db_xref="InterPro:IPR004780"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR022941"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036891"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q857"
FT                   /protein_id="ACE98806.1"
FT                   /translation="MFDNLSDKLGGILDRLTGRGALSEADVDAAMREIRRALLEADVAL
FT                   EVVRSFTERVREQAVGATVVKSVKPGQMVVKIVNDELIATLGSEVQSIDLNAVPPVPIM
FT                   MVGLQGSGKTTTTAKLARRMTERDKRKVLMASLDVYRPAAMEQLAVLGRDLQIDTLPIV
FT                   AGQQPPDIARRAMEAGKLGGYDVVLLDTAGRTTLDEDMMAEAAEIKAAANPHEVLLVAD
FT                   SLTGQDAVNLARAFDQRVGLTGIVLTRIDGDGRGGAALSMRAVTGKPIKLMGTGEKTDA
FT                   LEDFHPSRIASRILGMGDIVSLVEKAAATLDAEKAAAVAEKMRKGKFDLTDLRDQLLQM
FT                   TKMGGIGGLMGLMPGISKMKNQIAASGIDDKVLKRQVAIIDSMTREERKNPDILKASRK
FT                   KRIAAGAGIKVEDVNKLLKMHRNMADMMKAVGRGKGGPMAGFAKAMGFGGGLPSPDEIK
FT                   AMQEKMKSGDMPEGLPELPKDLPASLRGGMPNLPGLTGLAGKPTLPGLGGFPGFGKKK"
FT   gene            263657..263926
FT                   /locus_tag="Rpal_0247"
FT   CDS_pept        263657..263926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0247"
FT                   /product="prevent-host-death family protein"
FT                   /note="KEGG: sus:Acid_1771 prevent-host-death family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98807"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q858"
FT                   /protein_id="ACE98807.1"
FT                   /translation="MKFVKLADARAAIEQLLDEVERGETIIITRGVLPRRKAGAPQEQW
FT                   RTAMQDLRDLKKGAGLASIEDLLQWREEQRKAARGQRTAPARWI"
FT   gene            264152..265213
FT                   /locus_tag="Rpal_0248"
FT   CDS_pept        264152..265213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0248"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   bra:BRADO0380 putative metallo-hydrolase/oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98808"
FT                   /db_xref="GOA:B3Q859"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR024884"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q859"
FT                   /protein_id="ACE98808.1"
FT                   /translation="MSLITRRRLLATAAGLAATAGLSSLWISRMSYYQGPVTDHFDGTR
FT                   FFDPDGAPPKSFWEVMRWRFSHKPAQWPEWAPSPFADTPPPRVDGAGIRLVYVGHASWL
FT                   IQTAGLNVLIDPVWSKRVSPVSFAGPKRHNDPGVAFDRLPKIDVVLVSHGHYDHLDLAT
FT                   LSRLAATHRPRVITPLGNDLTMTAHDDSIRAEAYDWSDRVELNDRVAVTLVPTRHWTAR
FT                   GLFDRNRALWASFVLETPAGRIYVVCDSGYGDGRHFRRVRDAHAPLKLAILPIGAYEPR
FT                   WFMQDQHMNPADAVKALADCGAERALANHHGTFQLTDEAIDAPEQALYAALDADGVPRE
FT                   RFPVLKPGQVFEL"
FT   sig_peptide     264152..264229
FT                   /locus_tag="Rpal_0248"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.226 at
FT                   residue 26"
FT   gene            complement(265223..265921)
FT                   /locus_tag="Rpal_0249"
FT   CDS_pept        complement(265223..265921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0249"
FT                   /product="protein of unknown function DUF541"
FT                   /note="PFAM: protein of unknown function DUF541; KEGG:
FT                   nha:Nham_3577 protein of unknown function DUF541"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98809"
FT                   /db_xref="InterPro:IPR007497"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q860"
FT                   /protein_id="ACE98809.1"
FT                   /translation="MNMLRSLSIAAAACCLFVALPARAQDVPPPGIVVRGEAQKSVAPD
FT                   TAVIEAGVSNFAKSARGAAEATNLAIGKVLLELKNAGIDGKDIQTSQLSLQPQYADRPG
FT                   PSEVTGYVAKNIVSVRVRDIAAVAGILDRLMVAGANEVRGISFTVSNASKLLDEARTEA
FT                   VADARRKAEIYARAAGLTLAAPVSIAEDSGPGVMPMRKMAADLSAGAQVAPGEQSLNVS
FT                   VTVNWGVKAQ"
FT   sig_peptide     complement(265847..265921)
FT                   /locus_tag="Rpal_0249"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 25"
FT   gene            complement(265918..266700)
FT                   /locus_tag="Rpal_0250"
FT   CDS_pept        complement(265918..266700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0250"
FT                   /product="transcription activator effector binding"
FT                   /note="PFAM: transcription activator effector binding;
FT                   KEGG: bja:blr0478 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98810"
FT                   /db_xref="InterPro:IPR010499"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="InterPro:IPR029442"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q861"
FT                   /protein_id="ACE98810.1"
FT                   /translation="MERPCLFGLMRVGLMPALVLTLGIVGASAQTAPYASKDAKDKPPA
FT                   AAPEQAQTPAAPATSATPAAPAPATPPAASEAPAATPVPTTPSAPSATQTPAAPSAPAP
FT                   VQTADPFGEESTLEPKTVVILKGKANWDNAFDSLMDAFKSLTALLDKQGIAPNGNPMIV
FT                   YTSTDDAGFTFQAQIPVPQEPKNLGKSMSIGKSPDGKALKFVHRGSYDNMDNTYEAITN
FT                   FLDDKKLEAKDTFIEEYMTDPLKTAEDKLVINVYVPMK"
FT   sig_peptide     complement(266611..266700)
FT                   /locus_tag="Rpal_0250"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.988) with cleavage site probability 0.903 at
FT                   residue 30"
FT   gene            266937..267818
FT                   /locus_tag="Rpal_0251"
FT   CDS_pept        266937..267818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0251"
FT                   /product="Diaminopimelate epimerase"
FT                   /EC_number="5.1.1.7"
FT                   /note="PFAM: diaminopimelate epimerase; KEGG: nwi:Nwi_2776
FT                   diaminopimelate epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98811"
FT                   /db_xref="GOA:B3Q862"
FT                   /db_xref="InterPro:IPR001653"
FT                   /db_xref="InterPro:IPR018510"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3Q862"
FT                   /protein_id="ACE98811.1"
FT                   /translation="MSALDNRLFAKMNGIGNEIVVVDLRDQPAPVTPADARAVAAHVPY
FT                   DQLMLLQPARLPGTEAFVRIYNNDGSESGACGNGMRCVARQMFAGSDKNGLTFETRAGL
FT                   LNCWRGPADGLYTVDMGEPKFGWQDIPLAEEFRDTRMIELQIGPIDAPVLHTPSVVSMG
FT                   NPHAIFWVDDVNAYDLGRFGPLLENHPIFPERANITLAHIVDRQHITMRTWERGAGLTK
FT                   ACGSAACATAVAAARLKRTDRTVEMTLPGGQLTIEWRDNDNHVLMTGGAEFEFEGRFDP
FT                   ALFAGALDPTGA"
FT   gene            267818..269089
FT                   /locus_tag="Rpal_0252"
FT   CDS_pept        267818..269089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0252"
FT                   /product="MiaB-like tRNA modifying enzyme"
FT                   /note="KEGG: bra:BRADO0384 putative MiaB-like tRNA
FT                   modifying enzyme; TIGRFAM: RNA modification enzyme, MiaB
FT                   family; MiaB-like tRNA modifying enzyme; PFAM: Radical SAM
FT                   domain protein; Protein of unknown function UPF0004; SMART:
FT                   Elongator protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98812"
FT                   /db_xref="GOA:B3Q863"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006467"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q863"
FT                   /protein_id="ACE98812.1"
FT                   /translation="MAVEVVTFGCRLNAFESELIRREAESAGLADAIVVNSCAVTNEAV
FT                   AQARQQIRKLKRARPEARIIVTGCAAQTEPATFAAMAEVDRVIGNDDKTRSDAWHAAKG
FT                   ALEAGASFGLDTEQKIAVADIMAVREMAPHLLDGYQSGLPRVFVQVQNGCDHRCTFCII
FT                   PYGRGNSRSVPVGAVVEQVRLLAERGHAEIVLTGVDLTSYGADLPGAPKLGTLVKKVLR
FT                   HVPELQRLRISSIDQVEADRDLIDALATEPRLMPHLHLSLQAGDDLILKRMKRRHARAD
FT                   AIAFCAEVRRRRPDIALGADLIAGFPTETEEMFQRSLDLVEECGLTFLHVFPYSPRPGT
FT                   PAARMPQLDGRVIRDRAARLRAAGEAALQRRLDAEIGATRAVLIESPTQGRTEHFLPVA
FT                   ISGATPGDVQTLRIIRHDGARLTV"
FT   gene            complement(269099..269761)
FT                   /locus_tag="Rpal_0253"
FT   CDS_pept        complement(269099..269761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0253"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xau:Xaut_1107 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98813"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q864"
FT                   /protein_id="ACE98813.1"
FT                   /translation="MSTSTITDPIAFIHANTRLREVPLVPEVMLHVADEALPLWSKTEE
FT                   ELGEAGLPPPFWAFAWAGGQALARYVLDHPQDVAGKEVIDLASGSGLVAIAAMKAGARS
FT                   VTAFDIDGFAREAILVNAAANGVAIDVCGDDLLAGPHPLPAQAVLAGDIFYQQDIAGLA
FT                   FAFLQNRVAQGARVLIGDPGRYYLPKDQLVQLASYGVPVTRELEDSEIKHTGVWMLK"
FT   gene            complement(269947..270360)
FT                   /locus_tag="Rpal_0254"
FT   CDS_pept        complement(269947..270360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0254"
FT                   /product="protein of unknown function DUF55"
FT                   /note="PFAM: protein of unknown function DUF55; KEGG:
FT                   bja:blr0569 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98814"
FT                   /db_xref="InterPro:IPR002740"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q865"
FT                   /protein_id="ACE98814.1"
FT                   /translation="MAYWLVKSEPSVWSWDQQVAKGAAGEAWTGVRNHSAKLHMVAMRR
FT                   GDRAFFYHSNEGKEIVGIAEIIREAYPDPTDASGKFVCVDIKADKPLKSPVTLAAVKAE
FT                   PRLAEMALMKYSRLSVQPVTAEEWKLVCKMGGL"
FT   gene            complement(270363..271352)
FT                   /locus_tag="Rpal_0255"
FT   CDS_pept        complement(270363..271352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0255"
FT                   /product="Glycerol-3-phosphate dehydrogenase (NAD(P)(+))"
FT                   /EC_number="1.1.1.94"
FT                   /note="PFAM: NADP oxidoreductase coenzyme F420-dependent;
FT                   NAD-dependent glycerol-3-phosphate dehydrogenase domain
FT                   protein; 3-hydroxyacyl-CoA dehydrogenase NAD-binding;
FT                   Ketopantoate reductase ApbA/PanE domain protein; KEGG:
FT                   bbt:BBta_0290 NAD(P)H-dependent glycerol-3-phosphate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98815"
FT                   /db_xref="GOA:B3Q866"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3Q866"
FT                   /protein_id="ACE98815.1"
FT                   /translation="MGSLNSIAVLGGGAWGTALAQTAARAGRKVTLWEHDAGNAEHLIA
FT                   ARESRFLPGVRLEPSIQVTRDLAEAARADALLLVVPAQVLRQVVTSLQPLIAPRTPLVA
FT                   CAKGIEHGTHRFMTEIIAEAAPAAIPAILSGPSFAADVARGLPTAVTIAATDAACAQAL
FT                   AQAMNSGSFRPYHSTDVRGVELGGATKNVLAIAAGIVEGRQLGASALAAMTTRGFVELV
FT                   RFGKAYGARIETMHGLSGLGDLTMCCSTPQSRNFSFGMALGRGEGIESAAHGKLAEGYY
FT                   TAPVLLEMAQAKGIDMPISTAVAAVLGGKLSVDAAIEGLLTRPLKAEE"
FT   sig_peptide     complement(271290..271352)
FT                   /locus_tag="Rpal_0255"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.988) with cleavage site probability 0.949 at
FT                   residue 21"
FT   gene            complement(271388..272479)
FT                   /locus_tag="Rpal_0256"
FT   CDS_pept        complement(271388..272479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0256"
FT                   /product="metalloendopeptidase, glycoprotease family"
FT                   /EC_number="3.4.24.57"
FT                   /note="KEGG: nha:Nham_0561 O-sialoglycoprotein
FT                   endopeptidase; TIGRFAM: metalloendopeptidase, glycoprotease
FT                   family; PFAM: peptidase M22 glycoprotease"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98816"
FT                   /db_xref="GOA:B3Q867"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017860"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3Q867"
FT                   /protein_id="ACE98816.1"
FT                   /translation="MTSEQALLVLGIETTCDETAAAVVERRADGSGRLLSNIVRSQTDE
FT                   HAPFGGVVPEIAARAHVDVLDGIIAAAMNEAGVAFASLSGVAAAAGPGLIGGVIVGLTT
FT                   AKAIALVHGTPLIAVNHLEAHALTPRLTDAVEFPYCLFLASGGHTQIVAVLGVGNYVRL
FT                   GTTVDDAIGEAFDKIAKMLGLPYPGGPQVERAAEAGDPNRFAFPRPMLGRQDANFSLSG
FT                   LKTAVRNEAGKLTPLDPQDINDLCAGFQAAVLESVADRLGAGLRLFKERFGPPKALVAA
FT                   GGAAANQAIRRMLREVAAKVQTTLIVPPPSLCTDNGAMIAWAGAERLALGLTDTMDTAP
FT                   RARWLLDANATAPAKFANTRAGF"
FT   gene            272704..273450
FT                   /locus_tag="Rpal_0257"
FT   CDS_pept        272704..273450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0257"
FT                   /product="Uroporphyrinogen III synthase HEM4"
FT                   /note="PFAM: Uroporphyrinogen III synthase HEM4; KEGG:
FT                   bja:bll0566 uroporphyrinogen III synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98817"
FT                   /db_xref="GOA:B3Q868"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="InterPro:IPR039793"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q868"
FT                   /protein_id="ACE98817.1"
FT                   /translation="MALLVTRPQPDGDATAKALRAKGYDVLLAPMLRFEPVPFPDDPDA
FT                   HYTGVIVTSANALRALDDQPVLARLLKLPLFAVGKHTARKAQDAGFSDVIVADGDAAKL
FT                   RIKIGDSLRGTDKRAGALLYLAGADLSRDLAGELREDGFDVVMQTAYRMVPLPSLPEDV
FT                   CDAFAANRIEAVLHYSRRSARAFIDATRTSGIEISALAIPQCCLSEAVSEVVREAGANQ
FT                   VMVARKPDEKALLEALDRALGPAKVN"
FT   gene            273502..274911
FT                   /locus_tag="Rpal_0258"
FT   CDS_pept        273502..274911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0258"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nha:Nham_0564 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98818"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q869"
FT                   /protein_id="ACE98818.1"
FT                   /translation="MVENRPEHEQAAEPAEHHQPTGEETSTAAPGAEAEAAAEIAPEAE
FT                   PAQGPEQAFDIAADQREQAEQAAGLPEPEFATTTAAADASATAQSSAAPRNSIASLVLP
FT                   PVLTIAIATGLVVGAAKMGLLPQFLSSTSVTAPQADPAAFDALNARIAKLEAAPTAGGA
FT                   TAVPSDSAALEALAIRITNLEARPKAASEGAAAADPAATGRIDALEKSAASLRDDLTAL
FT                   RSQTDQLAATVKDLKAAPGASADEAKPSAEAAGADRAAALEQTTAAMAAIDRRLGVLEA
FT                   ATKAEAEKPAPKTAPAEDGALRRAVAATLLDLAVTQGQPFQALLKAAAPLAPDAGSLKP
FT                   LDRFAATGVPSARALGQELIDQLPNLLPDKTHSNANFIDRFQANAERLVKIQRSDAVEG
FT                   IDRTAIVGRLTAAAKQGDIAAALKELKALAPGDRAPVQSWIDKAEARDQALAASHQFAT
FT                   AALGALQKPSP"
FT   gene            274920..276617
FT                   /locus_tag="Rpal_0259"
FT   CDS_pept        274920..276617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0259"
FT                   /product="HemY domain protein"
FT                   /note="PFAM: HemY domain protein; KEGG: bja:bll0564
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98819"
FT                   /db_xref="GOA:B3Q870"
FT                   /db_xref="InterPro:IPR010817"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016982"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q870"
FT                   /protein_id="ACE98819.1"
FT                   /translation="MLRIVLFLVIIALAAAGAAWVADQPGEVVLSWNDWKASMTLPVFA
FT                   LVIGAGVVAVMLAWAIILGVVRAPSWMKRGRSSRRSARARNAITQGLLAVGHGDSGTAR
FT                   LHANAARRHAPHDPLALLLQAQSAQLEGDREGARRAFLAMAARKDTKSLGMRGLYIEAQ
FT                   RADDPYAALAIAEEALRVQPNCAWASQAVLGFRCARSDWTGALEILERNLSAGLIDKKA
FT                   FRRQRAVLLTARAIDLEESDESLARDSALEANKLAPTLVPAAVLAAKYLAEAHQVRRAM
FT                   KVIEAAWQAQPHPDLASTYANLKPGDTATARLGRVENLVGKGPQQLESALAIARAAIDA
FT                   GSFSRARTVLQPYLDMPTQRVAMLMAEIEHGDRGDTAKARAWTLRAVRALHDPVWTADG
FT                   YVSDHWRPVSPVTGRLDAFQWQVPVSALPSSKAVVVDDKFHDALIASSAGETLPASTTS
FT                   EAVTVTVEAAPEAPIVAPKEPTAVVEEPAKADKPAKTTEAPAEAVAPPAASSSPLFHRR
FT                   KEAAPVIPIVRAPDDPGVDEDAAPEEFPERAPTPAGQSSGWRGYRPPR"
FT   sig_peptide     274920..274985
FT                   /locus_tag="Rpal_0259"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.995 at
FT                   residue 22"
FT   gene            276776..276851
FT                   /locus_tag="Rpal_R0004"
FT                   /note="tRNA-Thr1"
FT   tRNA            276776..276851
FT                   /locus_tag="Rpal_R0004"
FT                   /product="tRNA-Thr"
FT   gene            complement(277309..278091)
FT                   /locus_tag="Rpal_0260"
FT   CDS_pept        complement(277309..278091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0260"
FT                   /product="putative methyl-accepting chemotaxis sensory
FT                   transducer"
FT                   /note="PFAM: histidine kinase HAMP region domain protein;
FT                   KEGG: atc:AGR_C_4040 putative methyl-accepting chemotaxis
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98820"
FT                   /db_xref="GOA:B3Q871"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q871"
FT                   /protein_id="ACE98820.1"
FT                   /translation="MQFDLSNRNLAQKISILVLGITLFASVAIGGVGEMVLHKVTDSHA
FT                   KQAASVASLDRLVGQGGATLSPVRAADGSIVGMLVMQQDAGPVVMPASYEGQGLVVQAS
FT                   ETVVTSTPDYGVGAARTMLLLAGVVVFAVVGLVGTRISRGLLAPLGELEKDVERLASGD
FT                   TSVRIHALSRSDEIGRIARSIAKIQQSLIELAKLKSHRVLDGTNGILSNLKEMWMDLKG
FT                   AVSNAREMLFTDGRTVSETLSRSWSSWLHNGLGVPKRA"
FT   sig_peptide     complement(277999..278091)
FT                   /locus_tag="Rpal_0260"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.887) with cleavage site probability 0.839 at
FT                   residue 31"
FT   gene            278933..279724
FT                   /locus_tag="Rpal_0261"
FT   CDS_pept        278933..279724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0261"
FT                   /product="cobalamin B12-binding"
FT                   /note="KEGG: mex:Mext_4818 cobalamin B12-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98821"
FT                   /db_xref="InterPro:IPR036594"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q872"
FT                   /protein_id="ACE98821.1"
FT                   /translation="MRAVHTESIVSTVIPHLVVKHTSAKTRVAQDPAEARAAELARLLI
FT                   APNLADAFDLIDKSLARASSPTALFTGLFEPTARSLGNLWAEDACSEFEVTIGLCHLQT
FT                   AMRRISFDLLSAPLARSQPRSVLLVSQPGEPHSFCAALHAELLRQAGWNTVSEFPDTDR
FT                   ALSELVANGWFDAVNISLSPALRREHWLPRMAETIRKLRAASRNPALAVVASGRVFAER
FT                   SDAVALVGADAATISSVQIERCLMRSLLNRTARPAANFAWI"
FT   gene            279898..280983
FT                   /locus_tag="Rpal_0262"
FT   CDS_pept        279898..280983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0262"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nwi:Nwi_2399 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98822"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q873"
FT                   /protein_id="ACE98822.1"
FT                   /translation="MQSETKSYPFDHLPMIDYDAHPAYGRVMSMPMLGARLKAITIFGY
FT                   GFCLTTAQRMIDVEHLPRPVDAGNRFVTTLRSLPTYLRLIMLQRLGRFSAGSAYAPKTE
FT                   RGTAVFTPLARDGFAAVQLSPDKIVELRNQLDAAFKTLEHRVAIPGDPDSTRVVIDPTA
FT                   APDLYKWFNQVAADAGLTEAASGYLKRPVGIGRIAADVSEAPNGALSSPFADVSVDASP
FT                   CDGFKVDDSYNVLKMVVYLGETGAANGPLTYVAGSNRAGRRFWDAMIRRANDLCGLSST
FT                   LPAARETFYALPAGLQRKATFGADLVADSNFTTAIAENQVVVTSSQGNAVVYDPAGIHR
FT                   DGVPSQGRRSAVIVTFTELPR"
FT   gene            complement(281011..282309)
FT                   /locus_tag="Rpal_0263"
FT   CDS_pept        complement(281011..282309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0263"
FT                   /product="RiBisCO-like protein"
FT                   /EC_number="4.1.1.39"
FT                   /note="PFAM: ribulose bisphosphate carboxylase large chain;
FT                   KEGG: plt:Plut_0412 ribulose-bisphosphate carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98823"
FT                   /db_xref="GOA:B3Q874"
FT                   /db_xref="InterPro:IPR000685"
FT                   /db_xref="InterPro:IPR017443"
FT                   /db_xref="InterPro:IPR033966"
FT                   /db_xref="InterPro:IPR036376"
FT                   /db_xref="InterPro:IPR036422"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q874"
FT                   /protein_id="ACE98823.1"
FT                   /translation="MTPDDIAGFYAKRADLDLDNYIELDFDFECAGDPREAAAHLCSEQ
FT                   STAQWRRVGFDEDFRPRFAAKVLELSAEPRPSGFSVPVECAARGEVHACRVTIAHPHGN
FT                   FGAKIPNLLSAVCGEGVFFSPGIPLIRLQDIRFPEPYLAAFDGPRFGIAGVRERLQAFD
FT                   RPIFFGVIKPNIGLPPQPFAELGYQSWTGGLDIAKDDEMLADVDWCPLAERAALLGDAC
FT                   RRASAETGVPKIYLANITDEVDRLTELHDVAVVNGAGALLINAMPVGLSAVRMLRKHAT
FT                   VPLIAHFPFIAAFSRLANYGIHSRVMTRLQRLAGFDVVIMPGFGPRMMTPEHEVLDCIR
FT                   ACLEPMGSIKPCLPVPGGSDSAATLENVYRKVGSADFGFVPGRGVFGHPMGPAAGATSI
FT                   RQAWDAIAAGIPVADHAASHPELAAALKAFGGR"
FT   gene            complement(282424..282846)
FT                   /locus_tag="Rpal_0264"
FT   CDS_pept        complement(282424..282846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0264"
FT                   /product="protein of unknown function UPF0047"
FT                   /note="PFAM: protein of unknown function UPF0047; KEGG:
FT                   cph:Cpha266_0672 protein of unknown function UPF0047"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98824"
FT                   /db_xref="InterPro:IPR001602"
FT                   /db_xref="InterPro:IPR035917"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q875"
FT                   /protein_id="ACE98824.1"
FT                   /translation="MQIQRHRIELATTAPIQLIDITDQVRRFVTSSGIKDGLVTVSCLH
FT                   TTARINVNEREEKLERDMLTFLKRFVPRDGDYLHNLDPVDGRDNAHSHLIGLFMNSSET
FT                   IPVAKGTMVLGEWQSVFFIELDGPRERRGVELQIIG"
FT   gene            283072..285009
FT                   /locus_tag="Rpal_0265"
FT   CDS_pept        283072..285009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0265"
FT                   /product="acyltransferase 3"
FT                   /note="PFAM: acyltransferase 3; KEGG: bte:BTH_I1858
FT                   acyltransferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98825"
FT                   /db_xref="GOA:B3Q876"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q876"
FT                   /protein_id="ACE98825.1"
FT                   /translation="MRPAYRSDIDGLRAIAVLLVVGFHAFPAEVRGGFIGVDVFFVISG
FT                   FLITSIICQALDRGDFSFATFYARRINRIFPALLLVLAACAIGGWFLQFPVDYRDAGKA
FT                   IGFGAAFLANIALLHDSGYFDTSSELNPLLHLWSLGVEEQFYLLWPPVIILAWRWKNGA
FT                   VAAAVAILLASFVTNLLLTPTHQSAAFYLPVTRFWELMTGCLLAIATATRAAPLAQHAA
FT                   RLRNIGAVAGLALIATGATLIDRSRAFPGWWAVLPVLGAALLIGTGPGTWVGRRLLGNR
FT                   AMVYVGLISYPLYLWHWPVLAAIRIVRLGEEPPPLMKLIAVLVAFGLADFTYRFVEPKI
FT                   RYRPTRAKTAAAFAGVALVGLVGAGIYVAGGVPSRFSAGVQIVARDHQAEAMPAYRLKS
FT                   CFLSSGSTFARECDDAALPGVPRIALWGDSHAAHLYPGLRAVQKSEGGFTLSQYTTAGC
FT                   PPIFGYVSVQTPGCTAANANARERLKAIKPDTVILVARQWHDYDGADRDPAAIDAMIKA
FT                   TLAELRSIGIRRIVVVGKFPSWRTPPKRILAQAYRSEAAGLTTASEIPTRDGPPRLDRS
FT                   EAEANERLRAFFTAQGVEFISPTLVYCNDQGCLLAVPGSGTPVTFDGSHLTIASSQFFV
FT                   RQIAKELIGR"
FT   gene            complement(285062..286228)
FT                   /locus_tag="Rpal_0266"
FT   CDS_pept        complement(285062..286228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0266"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fps:FP1412 probable sugar O-acetyltransferase
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98826"
FT                   /db_xref="InterPro:IPR031811"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q877"
FT                   /protein_id="ACE98826.1"
FT                   /translation="MAAITTSPRRWLRRLAAAAFVAMPAWTLWNLAVPSHAVRIGPALV
FT                   GVTQQVPFDLSLHGFIDGALQKAAVLRIADAMPLRRTLIRLNNQIAYSLFGEITAPGIL
FT                   IGRDGELVQRGYLEEYCSRTIGQADTMADAAIPLLRDIQAYYRDRGKLFLYIVTPSKVA
FT                   DMPDKFTHLIVCPSSPQARAELVPAYVARLRAAGIDVLDLVTSTHAMRSDDTPPFPRGG
FT                   IHWNELAMARGSQQIVDAINTRAGHELLTPFSFTVTVSSPAEGRDRDLAELANLLVAPI
FT                   DYPTPKLTYSHPSCDGREATRIDAALVGTSFIDPVSEVLTEQACLTRLGQYFYLKLGRS
FT                   RGGVRQDNLSEAELREVRDVDVMLLEENESLIGRQQYLSLLHQIVTTP"
FT   sig_peptide     complement(286115..286228)
FT                   /locus_tag="Rpal_0266"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.963) with cleavage site probability 0.536 at
FT                   residue 38"
FT   gene            complement(286231..287643)
FT                   /locus_tag="Rpal_0267"
FT   CDS_pept        complement(286231..287643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0267"
FT                   /product="membrane bound O-acyl transferase MBOAT family
FT                   protein"
FT                   /note="PFAM: membrane bound O-acyl transferase MBOAT family
FT                   protein; KEGG: mag:amb1065 predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98827"
FT                   /db_xref="GOA:B3Q878"
FT                   /db_xref="InterPro:IPR004299"
FT                   /db_xref="InterPro:IPR024194"
FT                   /db_xref="InterPro:IPR028362"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q878"
FT                   /protein_id="ACE98827.1"
FT                   /translation="MLFYDPLFLTCFPFLYVLYFAAREARTKRWILLIGSGLFYLWGEP
FT                   LFVPVVVASALIDHLLARRITGSSSVPTKRALLALGVVQNLAILIIYKYTSFALESLNV
FT                   LLAAGKFSALPVWHIALPIGVSFVTFEKITYLVDSYRGVSQPARRFSDYCLFVFFFPKL
FT                   LAGPILKYHEIDRQIAVPRGFEWSDCGAGLARFAQGAFKKLLIADPLGHSADQVFGADP
FT                   ATLSMGGAWLGTVCFTLQIYFDFSGYSDMAIGIARMLGFSLRENFNMPYISRSITEFWR
FT                   RWHISLTTWIRDYLYIPLGGNRGNALVTYRNLWICFLLSGLWHGASWNFVLWGAYNGLF
FT                   LTLDRVFLERWLQRGGAVIATMATLLIVMLGWVIFRSPDTAHLGGFFAALAGFGHATAW
FT                   LPPPVSVLWTAALGAALSLIPALPAFGSLGAAWRSSGVLRLAGYVGLAALGTIAIARAV
FT                   AIPFQPFIYFRF"
FT   gene            complement(287848..287922)
FT                   /locus_tag="Rpal_R0005"
FT                   /note="tRNA-Gly3"
FT   tRNA            complement(287848..287922)
FT                   /locus_tag="Rpal_R0005"
FT                   /product="tRNA-Gly"
FT   gene            288238..289158
FT                   /locus_tag="Rpal_0268"
FT   CDS_pept        288238..289158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0268"
FT                   /product="thioredoxin"
FT                   /note="TIGRFAM: thioredoxin; PFAM: Thioredoxin domain;
FT                   KEGG: bra:BRADO0321 putative thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98828"
FT                   /db_xref="GOA:B3Q879"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q879"
FT                   /protein_id="ACE98828.1"
FT                   /translation="MTILEQGSGAAPQAAADLIKDTTTQSFVRDVIEESKRQPVLIDFW
FT                   AQWCGPCKQLTPILEKAVRAANGKVKLVKMNIDEHPSIPGQMGIQSIPAVIAFVDGRPA
FT                   DGFMGAVPESQVNAFIEKLTAGMPGGAPTAAELLQEAEAVLAEGDVQTAASIYAEVLRA
FT                   DGTNVAAIAGLARCYMQTGATEQAKKTLGLVPEAKREDAAVKAVQAMIDLAEQAQSLGP
FT                   IAELEQKVAADPLDHQARFDLAIALNAADRREDATTHLLDIVKRDRKWNDDGARKQLVQ
FT                   FFEAWGPTDDATVEGRKRLSTILFS"
FT   gene            289185..289862
FT                   /locus_tag="Rpal_0269"
FT   CDS_pept        289185..289862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0269"
FT                   /product="peptidase S16 lon domain protein"
FT                   /note="PFAM: peptidase S16 lon domain protein; KEGG:
FT                   bja:blr0595 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98829"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q880"
FT                   /protein_id="ACE98829.1"
FT                   /translation="MPINAAYRGPADLPEVIPVFPLAGALLLPRGQMPLNIFEPRYLAM
FT                   IDDALRDGHRLIGMIQPDAAHSSETAEKPSLFNVGCVGRITQLAESGDGRYILELTGVS
FT                   RFKVVDELQVLTPYRQCKVDYFPFVDDFTARKGEDEVDRETLLSVLTDFLKANNLKVDW
FT                   DGVESAPNEALVNALAMMSPYGAPEKQALLEAPDLKTRAEILIAVTEMDLAKKRTSGDP
FT                   PLQ"
FT   gene            289952..290149
FT                   /locus_tag="Rpal_0270"
FT   CDS_pept        289952..290149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0270"
FT                   /product="protein of unknown function DUF343"
FT                   /note="PFAM: protein of unknown function DUF343; KEGG:
FT                   nha:Nham_0083 protein of unknown function DUF343"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98830"
FT                   /db_xref="InterPro:IPR005651"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3Q881"
FT                   /protein_id="ACE98830.1"
FT                   /translation="MSLSPSERPDTVDRKLLDILVCPVTKGPLEFDPARQELISRGAKL
FT                   AYPIRDGIPIMLPEEARKLG"
FT   gene            complement(290285..291505)
FT                   /locus_tag="Rpal_0271"
FT   CDS_pept        complement(290285..291505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0271"
FT                   /product="Ubiquinone biosynthesis hydroxylase,
FT                   UbiH/UbiF/VisC/COQ6 family"
FT                   /note="TIGRFAM: Ubiquinone biosynthesis hydroxylase,
FT                   UbiH/UbiF/VisC/COQ6 family; PFAM: monooxygenase
FT                   FAD-binding; KEGG: nwi:Nwi_0079
FT                   2-octaprenyl-6-methoxyphenyl hydroxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98831"
FT                   /db_xref="GOA:B3Q882"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR010971"
FT                   /db_xref="InterPro:IPR018168"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q882"
FT                   /protein_id="ACE98831.1"
FT                   /translation="MTAPRSIVIGGGAFAGLALALALRQGLGPEVPVIVADPALALRPS
FT                   RDPRATAIVAACRRLFEALGVWDEVAPTAQPIIDMIVTDSHLEDATRPVFLTFAGEVQP
FT                   GEPFAHMVENRYLVEALAKRAEAEGVELRATPVTSYDARTEAIGVTLGDGSVIDASLLV
FT                   AADGAKSKLRQRAGIATYGWDYDQSGIVVTVEHERDHNGCAEEHFLPAGPFAILPLTGR
FT                   RSSLVWSESRRDAERIVALPEKEFQRELEKRFGLRLGDVKPLDKPKSFPLGYFVAQSFI
FT                   APRLALIGDAAHVIHPIAGQGLNMGLRDVAALAEVVVDAARLGIDPGQVDVLEGYQRWR
FT                   RFDTMAMGVATNGLNFLFSNNSPLLRGIRDIGLGLVDRLPPLKGAFIRQAAGLTGETPR
FT                   LLKGEAL"
FT   sig_peptide     complement(291443..291505)
FT                   /locus_tag="Rpal_0271"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.923) with cleavage site probability 0.773 at
FT                   residue 21"
FT   gene            291745..292620
FT                   /locus_tag="Rpal_0272"
FT   CDS_pept        291745..292620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0272"
FT                   /product="acyl-CoA thioesterase II"
FT                   /EC_number="3.1.2.2"
FT                   /note="KEGG: bja:blr0604 acyl-CoA thioesterase II; TIGRFAM:
FT                   acyl-CoA thioesterase II; PFAM: acyl-CoA thioesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98832"
FT                   /db_xref="GOA:B3Q883"
FT                   /db_xref="InterPro:IPR003703"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR042171"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q883"
FT                   /protein_id="ACE98832.1"
FT                   /translation="MSKSLIDLISILDLEPLEVNLFRGTSPKTSWQRVFGGQVIGQAMV
FT                   AGCRTVENRLPHSLHCYFILPGDPQVPIIYQVERLRDGRSYTTRRVTAIQHGNAIFSLM
FT                   MSFHDDEPTNFDHQDKMPDVPPPEALSAEEIVKQPLFKDMPDFIKRYYESDRPIELRPV
FT                   ELKRYFGQKIDDGRIHVWIKTAAKLPDDPALHMCALAYASDFSLLDAVMARYGRTLFDK
FT                   RMMPASLDHAMWFHRPFRADEWLLYAQDSPSAQGGRGLTRGQIFKTDGTLVASVAQEGS
FT                   VRERRDTSKP"
FT   gene            complement(292654..293487)
FT                   /locus_tag="Rpal_0273"
FT   CDS_pept        complement(292654..293487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0273"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: scl:sce3213 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98833"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q884"
FT                   /protein_id="ACE98833.1"
FT                   /translation="MLQRLVKATNQWMPTAMAFHCCRILASRPPRAEVSAAEQAALAQA
FT                   SRLFELDWSNDAAWSWGSGPTVVLIHGWGGRAAQMAPLAVELARSGLRAVAFDVAGHGE
FT                   SAEPSAGWEYSIRDIAKVSRQLGSVAGYVGHSAGGLSLMAARRIHGLSPAKYVCVCAPS
FT                   HPYPPVRGLAQRLDPRPSVLQRYRTYLGAQFQTDWRSLEAGAAYLGAGDDLLLCYDRKD
FT                   RFVDPDDGNRIHALCPGSRLLTSDAYGHTRILRATEVMREIAKFLNDEASRIAAA"
FT   gene            293576..294157
FT                   /locus_tag="Rpal_0274"
FT   CDS_pept        293576..294157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0274"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: sal:Sala_0735
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98834"
FT                   /db_xref="GOA:B3Q885"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q885"
FT                   /protein_id="ACE98834.1"
FT                   /translation="MPRKPKHKEAIVDAAVRLFRRGGYAATGLNDIVEASGAPKGSLYY
FT                   YFPHGKPSIAEAAVIEAGRRVAATLQELATTATSTADLLQAHARQLAGWMSKSGYRDGC
FT                   PITTVLLELAPEDRAVTKAGRDAYAERIAIFRQRLLDDGIVPARAAALAAMCTSTLQGA
FT                   LIQARVERSGRPLIDAALELGELLPRPDVA"
FT   gene            294303..294641
FT                   /locus_tag="Rpal_0275"
FT   CDS_pept        294303..294641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0275"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /note="PFAM: nitrogen regulatory protein P-II; KEGG:
FT                   bbt:BBta_0295 regulatory protein for nitrogen assimilation,
FT                   regulates GlnL, GlnE, and AmtB"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98835"
FT                   /db_xref="GOA:B3Q886"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR002332"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q886"
FT                   /protein_id="ACE98835.1"
FT                   /translation="MKLVVAIIKPFKLDEVRQALTEIGVHGMTVTEVKGYGRQRGHTEI
FT                   YRGAEYIVNFLPKLRIEIAVDSALADKAVEVITRGARTGQIGDGKIFVTPIDRALRIRT
FT                   GETDVDAL"
FT   gene            294716..296047
FT                   /locus_tag="Rpal_0276"
FT   CDS_pept        294716..296047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0276"
FT                   /product="ammonium transporter"
FT                   /note="TIGRFAM: ammonium transporter; PFAM: Rh family
FT                   protein/ammonium transporter; KEGG: bbt:BBta_0294 ammonium
FT                   transport protein (Amt family)"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98836"
FT                   /db_xref="GOA:B3Q887"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR002229"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q887"
FT                   /protein_id="ACE98836.1"
FT                   /translation="MTLLLRRAASAATGYILATFGLAAVGVTPALAQGMATAAPGISPA
FT                   DTAWMTVATAFVLMMTIPGLALFYSGMVRKKNVLATMAQSLAAVALISILWVAFGYSLA
FT                   FTGSGSLIGSFDRIFLAGMTMDSVNPAAKTIPEALFMLYQMTFAVITVALVAGSVADRM
FT                   RFSAYLLFSIGWFICVYVPLAHWIWGGGFLGAMGVLDFAGGLVVHLSAGTGGLVAAIVI
FT                   GRRHGYGMENLSPFDLSLAVIGTGLLWVGWFGFNGGSALAADSRAVFAITATHLAACSG
FT                   ALTWGAIEWMARRKPSVLGMISGAVAGLGTITPASGYVEPWHGVVIGIVAGLICYWACT
FT                   WLKHRLRYDDSLDVFGVHGIGGLTGTFLAGIFATASIGGVSGALEGSWMQPLTQLAGIL
FT                   VTFVWSAGATYVLLKAVSLFVALRVSREHEIEGLDISQHGEALQ"
FT   sig_peptide     294716..294814
FT                   /locus_tag="Rpal_0276"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.843 at
FT                   residue 33"
FT   gene            296357..296695
FT                   /locus_tag="Rpal_0277"
FT   CDS_pept        296357..296695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0277"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /note="PFAM: nitrogen regulatory protein P-II; KEGG:
FT                   bja:blr0612 nitrogen regulatory protein PII"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98837"
FT                   /db_xref="GOA:B3Q888"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR002332"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q888"
FT                   /protein_id="ACE98837.1"
FT                   /translation="MKIVMAIIKPFKLEEVRDALTAIGVHGLTVTEVKGYGRQKGHTEI
FT                   YRGAEYAVSFLPKIKIEVAIANEQVEKTIEAITSAAKTGQIGDGKIFVIGLDHAVRIRT
FT                   GEADAAAL"
FT   gene            296733..298175
FT                   /locus_tag="Rpal_0278"
FT   CDS_pept        296733..298175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0278"
FT                   /product="ammonium transporter"
FT                   /note="TIGRFAM: ammonium transporter; PFAM: Rh family
FT                   protein/ammonium transporter; KEGG: bja:blr0613 ammonium
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98838"
FT                   /db_xref="GOA:B3Q889"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q889"
FT                   /protein_id="ACE98838.1"
FT                   /translation="MTFKRPYGAGLAVLAAGMFAATAAYAEPTVNKGDNAWMLTSTVLV
FT                   LLMTIPGLALFYGGLVRSKNMLSVLAQVFYTVCIACIIWALYGYSLAFTGGSDFIGGFS
FT                   KAFLAGVTTDSKAATFSVDANISELVYVCFQMTFCAITPALIVGAFAERTRFAAVALFI
FT                   PLWITLIYLPMAHMVWYWAGPDAINDAAKALAAAADEAAKTAAQAKLDEVNADSGFLFK
FT                   KGAIDFAGGTVVHINAGIAGLVGALLVGRRTGYGKELMAPHSLTMTMIGASLLWVGWFG
FT                   FNAGSNLEASGGAALAMTNSFVATAAAALSWMFAEWIFKGHPSVLGALSGAVAGLVAVT
FT                   PAAGFSGPMGAIVLGLVVGVVCLFFCTVVKNALKYDDSLDVFGVHAVGGIVGAIGTGIL
FT                   VNPALGGTGVYDYVAGKVGDYDMTTQLISQCWGVGTTVLLSGIGSAILYKVVDVIVGLR
FT                   APVEVEREGLDLVEHTERAYNM"
FT   sig_peptide     296733..296813
FT                   /locus_tag="Rpal_0278"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.979 at
FT                   residue 27"
FT   gene            298294..298641
FT                   /locus_tag="Rpal_0279"
FT   CDS_pept        298294..298641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0279"
FT                   /product="DNA polymerase beta domain protein region"
FT                   /note="PFAM: DNA polymerase beta domain protein region;
FT                   KEGG: cak:Caul_1178 DNA polymerase beta domain protein
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98839"
FT                   /db_xref="GOA:B3Q890"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q890"
FT                   /protein_id="ACE98839.1"
FT                   /translation="MARGSQGFAPETCYTASMDRRTALEILKNSEAPLRARGVRRAALF
FT                   GSVTRGTNLPDSDIDVLIEIDPTARITVFDYVELKDYIAGLFDHPVDVVNRDQLKPSVA
FT                   PSAAQDAIYAF"
FT   gene            298743..298988
FT                   /locus_tag="Rpal_0280"
FT   CDS_pept        298743..298988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0280"
FT                   /product="protein of unknown function DUF86"
FT                   /note="PFAM: protein of unknown function DUF86; KEGG:
FT                   mrd:Mrad2831_3537 protein of unknown function DUF86"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98840"
FT                   /db_xref="InterPro:IPR008201"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q891"
FT                   /protein_id="ACE98840.1"
FT                   /translation="MYAVTRCLEIISEASRRVSEDIKNRHSSIPWKQIAGSGNVYRHDY
FT                   EDVAAQMIWETVQRALPALKAMVAEALARCDEQRPQ"
FT   gene            299111..300337
FT                   /locus_tag="Rpal_0281"
FT   CDS_pept        299111..300337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0281"
FT                   /product="aminotransferase class I and II"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   nha:Nham_0089 aminotransferase, class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98841"
FT                   /db_xref="GOA:B3Q892"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q892"
FT                   /protein_id="ACE98841.1"
FT                   /translation="MALSASTSPARAAGSVDAAGQSERSPFARLTELLAPYQPGQSLIN
FT                   LSVGEPQHPVPDFVGGVLARYTAEFGRYPLAKGIEPFRKAASAWLTKRFALDLAPDPET
FT                   EVLVLNGSREGLFLAAIAAARYVPKRDGTPAILMPNPFYPAYAAGARAAGCEAVFLPTT
FT                   LANGFLPDLDQLDEATLKRTVAIYLASPANPQGSVASRDYFVRLKQLADRYGFMILSDE
FT                   CYSEIYTQVAPGSAMQVAGPNFRNVVVFQSLSKRSNLAGMRVGFVAGDKDFLKAYHELR
FT                   NVAAPQVPIPLQHVAVAAYSDEAHVEENRRLYRLKFDLADQILGSRYGYQRPAGGFCLW
FT                   LDVSAHGGDEAATVMLFKDGGVRVVPGSYLARPQADGSNPGAGYIRVAMVQDSETTAEA
FT                   LHRLVRILG"
FT   gene            300351..302819
FT                   /locus_tag="Rpal_0282"
FT   CDS_pept        300351..302819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0282"
FT                   /product="cell divisionFtsK/SpoIIIE"
FT                   /note="PFAM: cell divisionFtsK/SpoIIIE; SMART: AAA ATPase;
FT                   KEGG: bja:blr0616 cell division protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98842"
FT                   /db_xref="GOA:B3Q893"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR018541"
FT                   /db_xref="InterPro:IPR025199"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041027"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q893"
FT                   /protein_id="ACE98842.1"
FT                   /translation="MSMPAIERAFPLVGHLPPSVREVLARRLRELAGFGLIALAAVAAA
FT                   ALATWSVQDPSLSHATSRRIHNLLGYPGAIGADLAMQILGLGAIGLLMPVAVWGWRMLN
FT                   HRPFDRTALRMGAWFLCTIFAAGFASSFPHDTAWPLPTGLGGVVGDALVRAPSLVFGPG
FT                   LIFRVILSFILGAAVLATFLIAGGFGSREREPDEATSDEDLPLEDEEESDRGSVSLGWL
FT                   VHALLSAKARLWRLAKLSYQGLVSSAPATGKQGFERQEPRLGGRTAPPIAPEADHHDDY
FT                   EPEPVEEIEDEDDEEEAPPVSRAPRKKAAPKPVAKKARFDLPSVNVLSAPKASDRQPLS
FT                   KSELEANSRALEGVLQDFGVRGEIIKASPGPVVTLYELEPAPGIKSSRVIGLSDDIARS
FT                   MSALSARVAVVPGRNAIGIELPNAHREKVYLRELLSVKDTNETVHKLPLCLGKNIGGES
FT                   IIVDLARMPHLLIAGTTGSGKSVAINTMILSLVYRLRPDQCRLIMVDPKMLELSVYDGI
FT                   PHLLTPVVTDPKKAVVALKWAVREMEERYKRMAKLGVRNIDGYNTRLGEAKAKGEELTR
FT                   TVHTGFDKETGKAIYEEEKLDLEPLPYIVIIVDEMADLMMVAGKDIEGAVQRLAQMARA
FT                   AGLHVILATQRPSVDVITGTIKANFPTRISFQVTSKIDSRTILGEMGAEQLLGQGDMLY
FT                   MAGGGRISRVHGPFVSDEEVEKVVKHLKAQGAPEYLEAVTAEEPSEEDGAVFDATGMGG
FT                   DGGGDLFQQAVAIVKRDRKASTSYIQRRLQIGYNRAASLMERMELEGIVGQANHAGKRE
FT                   ILVAEEDSNF"
FT   gene            302837..303778
FT                   /locus_tag="Rpal_0283"
FT   CDS_pept        302837..303778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0283"
FT                   /product="outer membrane lipoprotein carrier protein LolA"
FT                   /note="PFAM: outer membrane lipoprotein carrier protein
FT                   LolA; KEGG: bbt:BBta_0134 putative exported protein of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98843"
FT                   /db_xref="GOA:B3Q894"
FT                   /db_xref="InterPro:IPR004564"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q894"
FT                   /protein_id="ACE98843.1"
FT                   /translation="MQGTDTGSRNRHSAPVAADQHRGDAVTAVQDMSLIKQFNDLMPNW
FT                   TTGTGLRQLCAAAAAAAIIGAAIQPAAAEPVPAPKPSPRATQLSAAEPKQRTPQSPAQP
FT                   VTKLTTPPEPVIPDPRRNVPASIFNTFDAAQKAEAAKASTYLSSLQTLVGQFVQVGPDG
FT                   SKLTGDFYIMKPGRVRFEYDDPSPISMIADGQSVVVRDRKLATQDVYPLSQTPLRYLLS
FT                   DRLDLLRDTNVVSITSDDLYSNIIIEEKNAVIGTSRLLLMFGTKDGQLKQWTVTDPQGY
FT                   DTTVAVYNLDTTRRPDPSMFKIDYTNYGTPPG"
FT   gene            304067..304879
FT                   /locus_tag="Rpal_0284"
FT   CDS_pept        304067..304879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0284"
FT                   /product="exodeoxyribonuclease III Xth"
FT                   /note="TIGRFAM: exodeoxyribonuclease III Xth; PFAM:
FT                   Endonuclease/exonuclease/phosphatase; KEGG: bja:blr0618
FT                   exodeoxyribonuclease III"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98844"
FT                   /db_xref="GOA:B3Q895"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR020847"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="InterPro:IPR037493"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q895"
FT                   /protein_id="ACE98844.1"
FT                   /translation="MRLTLTTWNINSVRLRIDLVAKFLKAQRPDILCLQETKCPDDAFP
FT                   LKRFKRLGYEHVALNGQKGYHGVAVISKLPFVTTDIRTFCDIIDSRHISVSVKTDENAP
FT                   PLVLHNFYVPAGGDIPDPAVNPKFKHKLSFLDEMKACEPLHPSGDQRHILVGDLNVAPH
FT                   EHDVWSHKQLLKVVSHTPVECEKLLAVLRAGNWVDVARERIPLDQKVYTWWSYRAADWT
FT                   VGDRGRRLDHIWVSEALKDRVVDFKVLRDARSWERPSDHVPVTMTMEL"
FT   gene            complement(304931..305380)
FT                   /locus_tag="Rpal_0285"
FT   CDS_pept        complement(304931..305380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0285"
FT                   /product="cyclic nucleotide-binding protein"
FT                   /note="PFAM: cyclic nucleotide-binding; KEGG: bja:bll0619
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98845"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q896"
FT                   /protein_id="ACE98845.1"
FT                   /translation="MSIEDDVALLARVSTLRLLGEQALRMLAIGSEQRDFARGDVMFNV
FT                   GEPADAGYVVQRGAFQITMENGGVHETVARPGDLIGELALVMPMRRQTTAVALEYSTAI
FT                   RIARSLFQRVLESDPGAALRLRDEFAARANQVASDIVMVGSKLTS"
FT   gene            complement(305420..306106)
FT                   /locus_tag="Rpal_0286"
FT   CDS_pept        complement(305420..306106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0286"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: bja:bll0620 two-component
FT                   response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98846"
FT                   /db_xref="GOA:B3Q897"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q897"
FT                   /protein_id="ACE98846.1"
FT                   /translation="MPNARKILIVDDDNDLRDALVEQLSLHEEFEASAVDTGAKGVQTA
FT                   KALSPDLVLMDVGLPDTDGREVVRSLRKGGFKAPIIMLTGHDTDSDTILGLESGANDYV
FT                   AKPFRFAVLLARIRAQLRQHEASEDAVFTVGPYSFRPGSKMLTGANAKKVRLTEKETAI
FT                   LRFLYRAGQAPVSRETLLQEVWGYNSGVTTHTLETHIYRLRQKIERDAANPEILVTEAG
FT                   GYKLVP"
FT   gene            306271..306834
FT                   /locus_tag="Rpal_0287"
FT   CDS_pept        306271..306834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0287"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nha:Nham_0095 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98847"
FT                   /db_xref="GOA:B3Q898"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q898"
FT                   /protein_id="ACE98847.1"
FT                   /translation="MKKITKSAPSEKSPRPLARVQVGAAAGQRSRGWLIAGGLTIPVAL
FT                   GRGGILANKREGDGGTPRGTFHPLRLWWRPDRGPRPRTHLPIRIIGPDDAWCEDPQSRH
FT                   YNQPIHRSSAGEGDRLMRDDRLYDLIVEIDHNTRPRIAGRGSAVFLHLARDNFGPTAGC
FT                   VAMTRGNLQRLLARIGPRTKIVIG"
FT   gene            complement(306916..307575)
FT                   /locus_tag="Rpal_0288"
FT   CDS_pept        complement(306916..307575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0288"
FT                   /product="alanine racemase domain protein"
FT                   /note="PFAM: alanine racemase domain protein; KEGG:
FT                   bbt:BBta_0174 putative exported protein of unknown
FT                   function"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98848"
FT                   /db_xref="GOA:B3Q899"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR011078"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q899"
FT                   /protein_id="ACE98848.1"
FT                   /translation="MSAAANLAAVEAEIACACKDARRERSEVTLIAVSKTFEAEAIRPV
FT                   LSAGQRVFGENRVQEAKGKWPALVDEYPGTELHLIGPLQSNKAKDAVGLFGAIHSVDRD
FT                   SLCEALSKVLPQAGRKVELFVQINTGEEPQKAGIAPQDADAFLVACRERWGLTISGLMC
FT                   IPPVDEAPAPHFALCAKIAKRNGLAKLSMGMSADFATAIQFGATHVRVGSAIFGHR"
FT   gene            307746..309419
FT                   /locus_tag="Rpal_0289"
FT   CDS_pept        307746..309419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0289"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; histidine kinase HAMP region domain
FT                   protein; KEGG: bja:blr0624 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98849"
FT                   /db_xref="GOA:B3Q8A0"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q8A0"
FT                   /protein_id="ACE98849.1"
FT                   /translation="MSRIAIVRKKAKLRALLGIRARLVVLALILVCPLMLDRVRLLEAT
FT                   RTAQLAAMANELSTLAQRTADAEREVISSVEAVLKSAAYVHAAAAQAGRSCSILRASLR
FT                   VDLPSIRMLMVAGPDGVVHCSTSSMFVGSNISDRPYFRKALETHDFVVSDFLVGRQTQK
FT                   GTILAAYPVSAIDTGEEAVIVAGMNLDWLSDMMSSLAGRAGVNAALIDGEGTVLAAPPD
FT                   ERSLIGKKLDRLALLPAMAETPQGRSSITMRDDAGRLMTVSRIPGTSARLVVTVDENKV
FT                   SAGINHDIRTAYLQLALVCLFVLLGALIAAERLIVQPISVLTGVAKKFAEGNWSARVAR
FT                   KRLPSEFVPLARAFNAMAAQLGQRERELVASNSRLTVMASMDLLSGLANRRGLQSRLDF
FT                   EWMKGQQTGHRLALMMIDVDHFKLFNDSYGHPEGDACLSRIGETLAAVADQTGGFAARY
FT                   GGEEFCLLLPETGIGRALQVGELVRTTVEQLALPHKTSAFEHVTVSIGVACTLPSEHAS
FT                   PAELIEAADAALYAAKHRGRNNVVEHGFIRASDGPVAMAS"
FT   gene            309625..312255
FT                   /locus_tag="Rpal_0290"
FT   CDS_pept        309625..312255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0290"
FT                   /product="leucyl-tRNA synthetase"
FT                   /note="TIGRFAM: leucyl-tRNA synthetase; KEGG: bbt:BBta_0171
FT                   leucyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98850"
FT                   /db_xref="GOA:B3Q8A1"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002302"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR025709"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3Q8A1"
FT                   /protein_id="ACE98850.1"
FT                   /translation="MSNERYNARESEPKWQAKWDEAKIFATRNDDLRKKYYVLEMFPYP
FT                   SGRIHMGHVRNYTMGDVVARTMRARGYNVLHPMGWDAFGLPAENAAIERKIAPKAWTYD
FT                   NIAAMKKQLQTMGLSLDWAREFATCDPSYYKHQQKMFLDFLKVGLVEREKRKLNWDPVD
FT                   MTVLANEQVIDGRGWRSGAVVELREMNQWVFKITKYAQELLDALDTLDRWPDKVRLMQR
FT                   NWIGRSEGLMVRFALDSATTPAGETELKIFTTRPDTLFGAKFMAIAADHPLAQAAAAKD
FT                   PKVAAFIDDCKKRGTAQAEIDTAEKQGIDTGIRAMHPFDPSWKLPVYVANFVLMEYGTG
FT                   AIFGCPAHDQRDLDFVNKYQLGNTPVVCPEGQDPASFVITDTAYDGDGRMINSRFLDGM
FT                   TIVEAKEEVAKRLETAQLGGAPVGERKVNFRLRDWGISRQRYWGCPIPIIHCPTCDVVP
FT                   VPDADLPVVLPEDVSFDKPGNALDHHPTWKHVTCPKCGGKAVRETDTMDTFVDSSWYFA
FT                   RFTDPWNTEAPTTPDVVNRMMPVDQYIGGVEHAILHLLYSRFFTRAMKAAGHIDIQHDE
FT                   PFAGLFTQGMVVHETYRKADGHFASPAEISITVEGDTRRATLLDGGSPVEIGPIEKMSK
FT                   SKRNTVDPDDIIGTYGADTARWFMLSDSPPDRDVIWSEEGVKGASRFVQRLWRMVNDAA
FT                   PIAASAPAERPASFGADALTLRKAAHGALDKVLSGIERLAFNVSLAHIREFSNTLGDAL
FT                   ARSQTPSPDLAWAIRESTVILVQLFHPMMPHLAEECWTVLGQTGLVSEALWPQIEPDLL
FT                   VEDSITLPVQVNGKKRGEVTVPRDAPTSEIEAAVLALDAVKQALGDKPVRKVIVVPQRI
FT                   VNVVG"
FT   gene            312242..312805
FT                   /locus_tag="Rpal_0291"
FT   CDS_pept        312242..312805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0291"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nha:Nham_0099 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98851"
FT                   /db_xref="GOA:B3Q8A2"
FT                   /db_xref="InterPro:IPR007485"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q8A2"
FT                   /protein_id="ACE98851.1"
FT                   /translation="MSSAKPAELKKFVVRLALAVALAAPVAGCFQPMYADRGDGSPTLR
FT                   DKLNAIEVPPLDIPNGSRNSRLGVELRNKLMFKLYGSATGAPPLYTLKISISTSRSSLI
FT                   VDPSTQLPTIENYAIDASYQLKDIATGKTVVSGNTFSRVEYDVPGQSQRFARTRAGRDA
FT                   EDRAVQEIAENINTRLASFFYAGM"
FT   sig_peptide     312242..312328
FT                   /locus_tag="Rpal_0291"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.691) with cleavage site probability 0.515 at
FT                   residue 29"
FT   gene            312862..313893
FT                   /locus_tag="Rpal_0292"
FT   CDS_pept        312862..313893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0292"
FT                   /product="DNA polymerase III, delta subunit"
FT                   /note="TIGRFAM: DNA polymerase III, delta subunit; PFAM:
FT                   DNA polymerase III delta; KEGG: bja:blr0629 DNA polymerase
FT                   III subunit delta"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98852"
FT                   /db_xref="GOA:B3Q8A3"
FT                   /db_xref="InterPro:IPR005790"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR010372"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q8A3"
FT                   /protein_id="ACE98852.1"
FT                   /translation="MVALRGKDATSFLARPDPGRPIVLLYGPDAGLVRERADALIAASL
FT                   DDPKDPFALVRLDGDELAAEPSRLVDEALAIPMFGGRRAIRVRAGSRSFVAGVEALITS
FT                   PPRECRIVIEAGDIKPDNALRKACEKAATGAVAIGCYPDAEADIARLIDDELRGSNLQI
FT                   AKDARAVLTTLLGGDRQASRNELRKLALYAHGKGEVTLDDVITCVSDASDLKLDAIVDA
FT                   AFSGKPVVVETEFAKAMVAGTYPGQIILAAQRHAAFLHKTSLVVEGGTPAAVVLDSGFP
FT                   RLHFSRKAAAETALRNLSTTRLAQIIEQLASAALETRRQATLGAAIAQRTLLSIAVSAR
FT                   RRS"
FT   gene            complement(314155..315045)
FT                   /locus_tag="Rpal_0293"
FT   CDS_pept        complement(314155..315045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0293"
FT                   /product="parB-like partition protein"
FT                   /note="TIGRFAM: parB-like partition protein; PFAM: ParB
FT                   domain protein nuclease; KEGG: nwi:Nwi_0094 ParB-like
FT                   partition protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98853"
FT                   /db_xref="GOA:B3Q8A4"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="InterPro:IPR041468"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q8A4"
FT                   /protein_id="ACE98853.1"
FT                   /translation="MADEHRSRLGRGLASLIGDVGGEATQVERPRAQRKVPIEFIKANP
FT                   RNPRRTFTDAELGELSDSIKQHGVIQPIVVRPVKGSADRYEIIAGERRWRAAQRAGLHE
FT                   VPIVPVDVSDALALEIAIVENVQREDLNPLEEALGYQALAAEFNRSQEEIAKIVGKSRS
FT                   HVANMMRLIKLPDDVKSLIASGELTAGHARALIGLPDPSTIAKRIVAEGLNVRQTEALA
FT                   HEEGVPERKPQKPRATASAKSVKDADTLALEKRLSDALGMKVTIDDHEGTGAVQIRYAD
FT                   LDQLDDIIRRLEVGG"
FT   gene            complement(315218..316072)
FT                   /locus_tag="Rpal_0294"
FT   CDS_pept        complement(315218..316072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0294"
FT                   /product="Cobyrinic acid ac-diamide synthase"
FT                   /note="PFAM: Cobyrinic acid ac-diamide synthase; KEGG:
FT                   nha:Nham_0103 cobyrinic acid a,c-diamide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98854"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q8A5"
FT                   /protein_id="ACE98854.1"
FT                   /translation="MTVIDEIYQGDRANSEPGRPRIIALANQKGGVGKTTTAINLGTAL
FT                   AAIGERVLIVDLDPQGNASTGLGIDRRDRNTSTYDVLAGEAPLRDAVVATAVPRLHIAA
FT                   STMDLSGLELELGHRGDRAFRLRDAIGVLNKDIDPPLDYTYVLIDCPPSLNLLTVNAMA
FT                   AADAILVPLQCEFFALEGLSQLLQTVEQVRANLNPSLTIHGIVLTMFDSRNNLSSQVVA
FT                   DVRQFMGKKVYDTMIPRNVRISEAPSYGKPVLVYDLKCVGSEAYLKLATEVIQRERELR
FT                   TTH"
FT   gene            complement(316100..316771)
FT                   /locus_tag="Rpal_0295"
FT   CDS_pept        complement(316100..316771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0295"
FT                   /product="methyltransferase GidB"
FT                   /note="TIGRFAM: methyltransferase GidB; PFAM: glucose
FT                   inhibited division protein; KEGG: bra:BRADO0194 glucose
FT                   inhibited division protein B; methyltransferase GidB"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98855"
FT                   /db_xref="GOA:B3Q8A6"
FT                   /db_xref="InterPro:IPR003682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3Q8A6"
FT                   /protein_id="ACE98855.1"
FT                   /translation="MQRAARPLVSVSDLDADKAAALKLIPIPSALEARLDAYVALLQQW
FT                   QAKTNLVAPSTLPQLWTRHVADSLQLVSLMPHARRWLDFGSGGGFPGVVLACAMADVGG
FT                   HVTLVERIAKKAAFLREALRVAGAPGTVVLADIGDNVDRFPQALDCITARAVAPLHQLI
FT                   GFAEPLMTPGITKALFLKGQDVDAELTESTKYWKFQPKLHASLTGGQGWIVEIDHIERR
FT                   T"
FT   gene            complement(316944..318812)
FT                   /locus_tag="Rpal_0296"
FT   CDS_pept        complement(316944..318812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0296"
FT                   /product="glucose inhibited division protein A"
FT                   /note="TIGRFAM: glucose inhibited division protein A; PFAM:
FT                   glucose-inhibited division protein A; FAD dependent
FT                   oxidoreductase; KEGG: nha:Nham_0105 tRNA uridine
FT                   5-carboxymethylaminomethyl modification enzyme GidA"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98856"
FT                   /db_xref="GOA:B3Q8A7"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="InterPro:IPR026904"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3Q8A7"
FT                   /protein_id="ACE98856.1"
FT                   /translation="MRTSFDVIVIGGGHAGCEAAAAAARIGAATALVTHRFATVGAMSC
FT                   NPAIGGLGKGHLVREVDALDGLMGRVADAGGIQFRMLNRRKGPAVRGPRAQADRKLYAA
FT                   AMQIAIQGFPNLSVIEGEADALLWQDGRVSGIRLGDGREFAAAAVVITTGTFLRGLIHL
FT                   GERSWPAGRIDEAPAMGLSSSFEALGFKLGRLKTGTPPRLDGRTIDWSAVEMQPGDDPA
FT                   EPFSVLTPAITTPQIECGITRTTPATHEVIRANVHRSPMYSGQIQSTGPRYCPSIEDKI
FT                   VKFGDRDGHQIFLEPEGLDDPTVYPNGISTSLPEEVQRAILKTIPGLERTEMLRPGYAI
FT                   EYDHVDPRELEPTLQTKRLRGLFLAGQINGTTGYEEAAAQGLVAGLNAALSAGGGDRAV
FT                   FDRADGYLGVMIDDLVTRGITEPYRMFTSRAEYRLTLRADNADQRLTDKGLALGCVGVE
FT                   RSAFHHDKMAALSDAKALAQSLSITPNEAAKHGLALNRDGQRRSAFDLLSYPEIEWAQV
FT                   RAIWPELGKVDPAIAVHVEIDAKYHVYLERQTADVEAFRRDESLGLTDVDYAAVPGLSN
FT                   EARTRLERHRPHTVGQAGRLDGITPAALGILAAYLRREQRKRKSTG"
FT   gene            complement(318978..320303)
FT                   /locus_tag="Rpal_0297"
FT   CDS_pept        complement(318978..320303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0297"
FT                   /product="tRNA modification GTPase TrmE"
FT                   /note="KEGG: bbt:BBta_0164 tRNA modification GTPase TrmE;
FT                   TIGRFAM: tRNA modification GTPase TrmE; small GTP-binding
FT                   protein; PFAM: GTP-binding protein HSR1-related; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98857"
FT                   /db_xref="GOA:B3Q8A8"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004520"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR018948"
FT                   /db_xref="InterPro:IPR025867"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR027368"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031168"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3Q8A8"
FT                   /protein_id="ACE98857.1"
FT                   /translation="MHPSDQTIFALATGPLPSAIAILRVSGSRAGDVLRALTGSLPPPR
FT                   RAVRCDLRSRDGDLIDDGVALWFPTPASATGEDVAELHIHGSRAVAAALIKTLSAFEGV
FT                   RPAEPGEFTRRGFENGKLDLTEAEGLDDLIHADTDAQRRQALRQLGGVLGDRARQWRDQ
FT                   IIEALALVEAGIDFSDEGDVADELMGPARAKIAELSAEIAEVLAEQGRGEKLRDGMVVA
FT                   IAGPPNVGKSTLINRLARREVAIVSPHAGTTRDVIEIQLDLDGYPVTVIDTAGLRDSDD
FT                   PVEQEGVRRARLRAAAADLVLWLSTATDASDPDVKGPEVWRVRNKIDLANGEVAESGPS
FT                   QPVFRISAATGEGFADLLRELTRFAAQYFGSAEAGLITRDRHRRLLADAAASLTRSLVP
FT                   GLAEEIVAEELRASAHSLGRLLGRVDVEDVLGEIFGRFCIGK"
FT   gene            complement(320391..321656)
FT                   /locus_tag="Rpal_0298"
FT   CDS_pept        complement(320391..321656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0298"
FT                   /product="transcription termination factor Rho"
FT                   /note="KEGG: nwi:Nwi_0100 transcription termination factor
FT                   Rho; TIGRFAM: transcription termination factor Rho; PFAM:
FT                   H+transporting two-sector ATPase alpha/beta subunit central
FT                   region; Rho termination factor domain protein; Rho
FT                   termination factor RNA-binding; Ribonuclease B OB region
FT                   domain; SMART: AAA ATPase; Cold shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98858"
FT                   /db_xref="GOA:B3Q8A9"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004665"
FT                   /db_xref="InterPro:IPR011112"
FT                   /db_xref="InterPro:IPR011113"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036269"
FT                   /db_xref="InterPro:IPR041703"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q8A9"
FT                   /protein_id="ACE98858.1"
FT                   /translation="MREIKLQDLKAKTPAELVSFSEELGVENASTMRKQELMFACLKQL
FT                   SAKETDIIGEGVVEVLSDGFGFLRSPDANYLPGPDDIYVSPSQIRRFGLRTGDTIEGHI
FT                   RSPKEGERYFALLKVNSLNFEDPEKSKHKVNFDNLTPLFPDERFRLEIDDPTRKDLSAR
FT                   VIDIVAPIGKGQRALIVAPPRTGKTVLMQNIAHSITANHPECYLIVLLIDERPEEVTDM
FT                   QRSVKGEVISSTFDEPAVRHVQVAEMVIEKAKRLVEHGRDVVILLDSITRLGRAYNTVV
FT                   PSSGKVLTGGVDANALQRPKRFFGAARNIEEGGSLTIIATALVDTGSRMDEVIFEEFKG
FT                   TGNSELILDRKVADKRTFPAIDISRSGTRKEELITDPQLLKKMYVLRRILNPMGTMDAI
FT                   EFLLDKLRNTKNNSEFFDSMNT"
FT   gene            complement(321916..322356)
FT                   /locus_tag="Rpal_0299"
FT   CDS_pept        complement(321916..322356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0299"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   bra:BRADO0198 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98859"
FT                   /db_xref="GOA:B3Q8B0"
FT                   /db_xref="InterPro:IPR005265"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q8B0"
FT                   /protein_id="ACE98859.1"
FT                   /translation="MIDWVDVYPWVKTLHVVAVISWMAGMLYMPRLFVYHCTAEVGSTQ
FT                   SETFKIMERRLYRAIMNPAMMVAWVAGLAIAWEQSYFTSGWFHAKLAAVVLMTVIHLLL
FT                   GRYVRDFAADRNTRSHKFYRIINEIPTLLMIAAVLFVIVKPF"
FT   gene            322811..323650
FT                   /locus_tag="Rpal_0300"
FT   CDS_pept        322811..323650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0300"
FT                   /product="protein of unknown function DUF299"
FT                   /note="PFAM: protein of unknown function DUF299; KEGG:
FT                   bbt:BBta_0161 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98860"
FT                   /db_xref="GOA:B3Q8B1"
FT                   /db_xref="InterPro:IPR005177"
FT                   /db_xref="InterPro:IPR026565"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3Q8B1"
FT                   /protein_id="ACE98860.1"
FT                   /translation="MLTDGSYFHLHLVSDSTGETLITVSRAVTAQYANVTPVEHVYPLV
FT                   RSQKQLDRVLQEIEEAPGIVLFTLLETELVNRLEAKCQEINSPSLSIIGPVMQLFEAYL
FT                   GASTMGRVGAQHTLNAEYFQRIDALNYSMMHDDGQHVEGLEEADVVLVGVSRTSKTPTS
FT                   IYLANRGIRTANVPLVAGIPIPHQLETLKKPLVVSLHASPERLIQVRQNRLLSLGAGSG
FT                   NDSYIDRQAVTDEVLLARKLSAKYGWSLLDVTRRSIEETAAAIMKLLADRQRQRVPE"
FT   gene            323647..324255
FT                   /locus_tag="Rpal_0301"
FT   CDS_pept        323647..324255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0301"
FT                   /product="Maf family protein"
FT                   /note="PFAM: Maf family protein; KEGG: bja:blr0638 Maf-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98861"
FT                   /db_xref="GOA:B3Q8B2"
FT                   /db_xref="InterPro:IPR003697"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q8B2"
FT                   /protein_id="ACE98861.1"
FT                   /translation="MTLWLGPQPLVLASQSRARQTVLANAGIPFDAIPADIDERGIAEA
FT                   SGLSAPGDIAALLAQQKAAFVSNYHPGRLVLGADQTLALGARGFNKPADRAAAAKQLRE
FT                   LAGRRHELHSAVAVVRNGITLFADVAIARMTMRPLTEAEIEAYLDVVGDKATTSVGAYQ
FT                   IEGLGVHLFDGIHGDHFTILGLPLLPLLGFLRSQNLLAV"
FT   gene            324352..324951
FT                   /locus_tag="Rpal_0302"
FT   CDS_pept        324352..324951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0302"
FT                   /product="dephospho-CoA kinase"
FT                   /EC_number="2.7.1.24"
FT                   /note="KEGG: nha:Nham_0114 dephospho-CoA kinase; TIGRFAM:
FT                   dephospho-CoA kinase; PFAM: Dephospho-CoA kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98862"
FT                   /db_xref="GOA:B3Q8B3"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q8B3"
FT                   /protein_id="ACE98862.1"
FT                   /translation="MLVLGLTGSIGMGKSTTAKLFAEAGVPVYDADATVHKIYENEAVP
FT                   AIEAAFPGTTVGGKVDRALLSAKVVHDPAAMKRLEGIVHPMLRAHHQQFLDDAESSGAP
FT                   VAVVDVPLLFETGGEKRVDAVVVVTTSPEVQRERILARDNMTPEKLDAILARQMPDAEK
FT                   RKRADFVVDTSNGLDPVRLQIREILEAAAKMPRRRD"
FT   gene            324987..325685
FT                   /locus_tag="Rpal_0303"
FT   CDS_pept        324987..325685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0303"
FT                   /product="DNA polymerase III, epsilon subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: bja:blr0640 DNA polymerase III epsilon chain;
FT                   TIGRFAM: DNA polymerase III, epsilon subunit; PFAM:
FT                   Exonuclease RNase T and DNA polymerase III; SMART:
FT                   Exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98863"
FT                   /db_xref="GOA:B3Q8B4"
FT                   /db_xref="InterPro:IPR006054"
FT                   /db_xref="InterPro:IPR006309"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q8B4"
FT                   /protein_id="ACE98863.1"
FT                   /translation="MREIVLDTETTGLDPLRGDRLVEIGCVEIFNRMPTGRTYHQYLNP
FT                   ERDMPAEAFAVHGLSSEFLADKPLFAHVADEFLEFIGDAPLVIHNASFDIGFINAELSR
FT                   LSRAPVPRDRLVDTLLLARRKHPGVSNRLDDLCSRYAIDNSRRTKHGALLDAELLAEVY
FT                   IDLIGARQSQLILADVPAEVVGAASENRRRQRPAPLPNRLTEADLEAHRAFIATMGEKA
FT                   IWPDYLPAGA"
FT   gene            complement(325765..326238)
FT                   /locus_tag="Rpal_0304"
FT   CDS_pept        complement(325765..326238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0304"
FT                   /product="protein-export protein SecB"
FT                   /note="TIGRFAM: protein-export protein SecB; PFAM: protein
FT                   export chaperone SecB; KEGG: nwi:Nwi_0106 preprotein
FT                   translocase subunit SecB"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98864"
FT                   /db_xref="GOA:B3Q8B5"
FT                   /db_xref="InterPro:IPR003708"
FT                   /db_xref="InterPro:IPR035958"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3Q8B5"
FT                   /protein_id="ACE98864.1"
FT                   /translation="MTNGNGTPPEGAPPQLNVLAQYTKDLSFENPNAPASLAPQQQQPA
FT                   INIQINVGANNVGENEYEVTLSIEGKAESGSSVLFSFELAYAGVFRVLNVPQENLHPLI
FT                   MIECPRLLFPFAREIIASAVRDGGFPPLMLDPVDFIGLYRQNLERAQQQGQPS"
FT   gene            326702..327409
FT                   /locus_tag="Rpal_0305"
FT   CDS_pept        326702..327409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0305"
FT                   /product="import inner membrane translocase subunit Tim44"
FT                   /note="PFAM: import inner membrane translocase subunit
FT                   Tim44; KEGG: bja:blr0642 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98865"
FT                   /db_xref="InterPro:IPR007379"
FT                   /db_xref="InterPro:IPR016985"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR039544"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q8B6"
FT                   /protein_id="ACE98865.1"
FT                   /translation="MDIYTIIFLALAVFIFLRLRNVLGQRTGSERPPFDRAAARDMIPG
FT                   KQDNNVVSMPGTVIDQAPMAPNADVVPPSDRWKGIAEPDSELEHGLNAIAQNDSSFDAQ
FT                   HFITGAKSAYEMIVMAFANGDRRSLRDLLSSEVYESFDAAIKDREKNDLKVETRFVSIE
FT                   KAELISAELRDRTAMLTLKFVSQMISATRDKTGAVVDGSPDKVVDITDVWTFARDTSSR
FT                   DPNWKLVGTGSGT"
FT   gene            327387..328880
FT                   /locus_tag="Rpal_0306"
FT   CDS_pept        327387..328880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0306"
FT                   /product="MltA domain protein"
FT                   /note="PFAM: MltA domain protein; 3D domain protein; KEGG:
FT                   bbt:BBta_0155 putative membrane-bound lytic murein
FT                   transglycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98866"
FT                   /db_xref="GOA:B3Q8B7"
FT                   /db_xref="InterPro:IPR005300"
FT                   /db_xref="InterPro:IPR010611"
FT                   /db_xref="InterPro:IPR026044"
FT                   /db_xref="InterPro:IPR034654"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q8B7"
FT                   /protein_id="ACE98866.1"
FT                   /translation="MGPAAAPDVRGARRAALAGCVLAAALLSVLGEADARSRHHHSGAR
FT                   SVSKFAEHHAKYLHPLWPLEIPGGQYLPVAWSEIPGWDSDDQLAALKTFRVSCRPILAA
FT                   GRAPSTDKPLGGSLWEPCHAARSAHLTTAAEARAFFEQHFVPLQISRLSEPLGFVTGYY
FT                   EPVIEGSPVKTDDYVVPVYRRPSNLFVRGYKQEAALPNGGPVFRKIGRRKLVPYYDRGE
FT                   IEDGAIDGRGLEICWLKSQTDLLFAQIQGSARIKLPDGRVIRINYDAHNGFPYTPVGRI
FT                   LIERGIIPREEMSMQRIRDWMDANPDGAKELRRANRSYVFFRKVELKDDDEAIGAQGVP
FT                   LTPGRSIAVDKGLHVYGTPFFITGELPIESPTAKTAFRRLMIGQDTGSAIVGPARADLY
FT                   FGAGAEAGAVAGRIRHPIAFAMLVPKGLDPVARARSLPVPEPRPPAKTNKPAATPSKSG
FT                   GRDGATTVPTPDSRPATAPSRPTGHRHRSYHSRHHRHLR"
FT   gene            328886..329470
FT                   /locus_tag="Rpal_0307"
FT   CDS_pept        328886..329470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0307"
FT                   /product="Smr protein/MutS2"
FT                   /note="PFAM: Smr protein/MutS2; KEGG: bja:blr0644
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98867"
FT                   /db_xref="InterPro:IPR002625"
FT                   /db_xref="InterPro:IPR036063"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q8B8"
FT                   /protein_id="ACE98867.1"
FT                   /translation="MKRIIPPLDPPMSRRKRSLTEDERALWDGVARQIKPLRGRPRLIK
FT                   VEIADPQALVPAIKPAPVAPPQPLKRTAKPSLPTAPPPLTPLGRRERAHLSRGRKDIDA
FT                   RIDLHGMTQARAHHALLYFLQRASHDGLGFVLVITGKGKSGDTERGVLRRQVPQWLALP
FT                   EFRAYVVGFDEAHIGHGGEGALYVRVRRARG"
FT   gene            complement(329807..331108)
FT                   /locus_tag="Rpal_0308"
FT   CDS_pept        complement(329807..331108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0308"
FT                   /product="heat shock protein HslVU, ATPase subunit HslU"
FT                   /note="KEGG: nwi:Nwi_0129 ATP-dependent protease
FT                   ATP-binding subunit; TIGRFAM: heat shock protein HslVU,
FT                   ATPase subunit HslU; PFAM: ATPase AAA-2 domain protein;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98868"
FT                   /db_xref="GOA:B3Q8B9"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004491"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3Q8B9"
FT                   /protein_id="ACE98868.1"
FT                   /translation="MTDFSPREIVSELDRFIVGQADAKRAVAIALRNRWRRLQLEGSLR
FT                   EEVLPKNILMIGPTGVGKTEIARRLAKLAGAPFLKVEATKFTEVGYVGRDVEQIIRDLV
FT                   EVAIAQVREKKRKDVQARAQVAAEERVLDALVGPGSGPATRDSFRKKLRAGELNDKEIE
FT                   IETQAGSGSPMFEIPGMPGAQIGAVSLGDIFGKMGGRTKKRRLTVADSHEILVNEEADK
FT                   LLDTDQLVQEAIAAVENNGIVFLDEIDKICVRDGRSGGEVSREGVQRDLLPLIEGTTVS
FT                   TKHGAVKTEHILFIASGAFHIAKPSDLLPELQGRLPIRVELNALSRDDMRRILTEPEAS
FT                   LIKQYVALMKTEGVTLDFSDDAIDALADVAVAVNSTVENIGARRLQTVMERVLDEISFV
FT                   APDRHGETFQVDADYVKTNVGDLAKNTDLSRFIL"
FT   gene            complement(331150..331761)
FT                   /locus_tag="Rpal_0309"
FT   CDS_pept        complement(331150..331761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0309"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bbt:BBta_0150 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98869"
FT                   /db_xref="GOA:B3Q8C0"
FT                   /db_xref="InterPro:IPR019691"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3Q8C0"
FT                   /protein_id="ACE98869.1"
FT                   /translation="MSMAGAERPVSSAAGLPVRWALAVVLALLAIQATALFAMGRVPIC
FT                   TCGTVKLWHGVVQSSENSQHLTDWYTFSHIIHGFLFYAGTWLLLRRWSWTARLIVATLI
FT                   EGGWELTENSSFIIERYRAGTISLDYYGDSIVNSVADTLAMISGFLLARWLPIAATVAI
FT                   AVLFEVLVGLHIRDNLTLNVIMLIHPFDAIRQWQAGPPII"
FT   gene            complement(331758..332327)
FT                   /locus_tag="Rpal_0310"
FT   CDS_pept        complement(331758..332327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0310"
FT                   /product="20S proteasome A and B subunits"
FT                   /note="PFAM: 20S proteasome A and B subunits; KEGG:
FT                   nha:Nham_0121 ATP-dependent protease peptidase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98870"
FT                   /db_xref="GOA:B3Q8C1"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR022281"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q8C1"
FT                   /protein_id="ACE98870.1"
FT                   /translation="MALYSSSADAGPPVWHGTTILTVRKGGKVVIGGDGQVSIGQTVIK
FT                   ANAKKVRKLGKGDVIGGFAGATADAFTLFERLEAKLEQYPGQLTRAAVELAKDWRTDRY
FT                   LRRLEAMMIVADKDVSLVLTGTGDVLEPEAGVMAIGSGGNYALAAARALADTDQDAETI
FT                   VRKALGIAAEICVYTNGNLTLETLTA"
FT   gene            332515..333108
FT                   /locus_tag="Rpal_0311"
FT   CDS_pept        332515..333108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0311"
FT                   /product="Imidazoleglycerol-phosphate dehydratase"
FT                   /EC_number="4.2.1.19"
FT                   /note="PFAM: imidazoleglycerol-phosphate dehydratase; KEGG:
FT                   bja:blr0650 imidazoleglycerol-phosphate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98871"
FT                   /db_xref="GOA:B3Q8C2"
FT                   /db_xref="InterPro:IPR000807"
FT                   /db_xref="InterPro:IPR020565"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR038494"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3Q8C2"
FT                   /protein_id="ACE98871.1"
FT                   /translation="MRTATIKRKTKETDIEVTVDLDGTGVANAATGIGFFDHMLDLLAK
FT                   HSRIDLTVKAVGDLHVDFHHTTEDVGIALGQAVKQALGNMAGITRYATVLMPMDETLTR
FT                   VVIDVSGRPFLVFKADFPRDKIGEFDTELVREWFQAFAMNAGVTLHVETLYGENSHHIA
FT                   ESCFKGLARALRAAVAIDPKTAGEVPSTKGQLGG"
FT   gene            333136..333657
FT                   /locus_tag="Rpal_0312"
FT   CDS_pept        333136..333657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0312"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nha:Nham_0123 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98872"
FT                   /db_xref="GOA:B3Q8C3"
FT                   /db_xref="InterPro:IPR024399"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q8C3"
FT                   /protein_id="ACE98872.1"
FT                   /translation="MPVFTVHAPRADDDEPQRAAPEQFRFVRDGFYFWAFVFGPFWLLY
FT                   RRLWLATLGYLVVIAASAVALTALHAGSGTRFVVALLLASLLGLEAGSVWRWTLARRGW
FT                   QSVGVAVGEDREIAERRFFDRWVAGQPQPISFTLPVDRGAPPPARTIPLPASSIHGDIF
FT                   GSFPNPGGSR"
FT   gene            333654..334304
FT                   /locus_tag="Rpal_0313"
FT   CDS_pept        333654..334304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0313"
FT                   /product="imidazole glycerol phosphate synthase, glutamine
FT                   amidotransferase subunit"
FT                   /note="TIGRFAM: imidazole glycerol phosphate synthase,
FT                   glutamine amidotransferase subunit; PFAM: glutamine
FT                   amidotransferase class-I; KEGG: bbt:BBta_0146 imidazole
FT                   glycerol phosphate synthase subunit HisH"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98873"
FT                   /db_xref="GOA:B3Q8C4"
FT                   /db_xref="InterPro:IPR010139"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q8C4"
FT                   /protein_id="ACE98873.1"
FT                   /translation="MSVAIIDYGSGNLHSAAKAFERAARSMENPEPILVTRDPDQVFRA
FT                   DRVVLPGVGAFADCRKGLDLIDGMVQALNETVRDKARPFFGICVGMQLMATRGKEHVTT
FT                   DGLNWIAGDVVKIAPNREDLKIPHMGWNTLDQIREHPVLDRLPLGSKGLHAYFVHSFHL
FT                   AAEHEGDVLARADYGGPVTAVVGKDTAIGTQFHPEKSQRFGLALISNFLKWKP"
FT   gene            334301..335038
FT                   /locus_tag="Rpal_0314"
FT   CDS_pept        334301..335038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0314"
FT                   /product="phosphoribosylformimino-5-aminoimidazole
FT                   carboxamide ribotide isomerase"
FT                   /note="TIGRFAM: phosphoribosylformimino-5-aminoimidazole
FT                   carboxamide ribotide isomerase; PFAM: histidine
FT                   biosynthesis protein; KEGG: bbt:BBta_0145
FT                   1-(5-phosphoribosyl)-5-[(5-
FT                   phosphoribosylamino)methylideneamino]
FT                   imidazole-4-carboxamide isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98874"
FT                   /db_xref="GOA:B3Q950"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR006063"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023016"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3Q950"
FT                   /protein_id="ACE98874.1"
FT                   /translation="MILFPAIDLKNGQCVRLEQGDMARATVFNLDPAAQAQSFAAQGFQ
FT                   YLHVVDLDGAFAGKPMNAQAVEAMLKVVSMPVQLGGGIRDLKTIEAWLSKGIARVIIGT
FT                   AAVRDPALVKEAAKAFPGRVAVGLDARDGNVAVEGWAESSQVTALDIAQRFEDAGVAAI
FT                   IFTDIARDGLLKGINWDATIALAEAISIPVIASGGLASIEDVRTLLSPRAKKLEGAIAG
FT                   RALYDGRLDPTEALALIGAAKAA"
FT   gene            335049..335816
FT                   /locus_tag="Rpal_0315"
FT   CDS_pept        335049..335816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0315"
FT                   /product="imidazoleglycerol phosphate synthase, cyclase
FT                   subunit"
FT                   /note="TIGRFAM: imidazoleglycerol phosphate synthase,
FT                   cyclase subunit; PFAM: histidine biosynthesis protein;
FT                   KEGG: nha:Nham_0126 imidazole glycerol phosphate synthase
FT                   subunit HisF"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98875"
FT                   /db_xref="GOA:B3Q951"
FT                   /db_xref="InterPro:IPR004651"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3Q951"
FT                   /protein_id="ACE98875.1"
FT                   /translation="MFKVRVIPCLDVKDGRVVKGVNFVDLRDAGDPVEAAIAYDAAGAD
FT                   ELCFLDITATHENRGIMLDVVRRTAEACFMPVTVGGGVRTVDDIKTLLRSGADKVSINS
FT                   AAVARREFVKEAAEKFGDQCIVVAIDAKRVPGRDRWEIFTHGGRKGTGIDAIEFAQEVV
FT                   SLGAGEILLTSMDRDGTKSGFDIPLTRAIADSVGVPVIASGGVGNLDHLVDGIREGHAT
FT                   AVLAASIFHFGEYTIRQAKDHMVQAGLPMRLDP"
FT   gene            335870..336193
FT                   /locus_tag="Rpal_0316"
FT   CDS_pept        335870..336193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0316"
FT                   /product="phosphoribosyl-ATP diphosphatase"
FT                   /note="TIGRFAM: phosphoribosyl-ATP diphosphatase; PFAM:
FT                   phosphoribosyl-ATP pyrophosphohydrolase; KEGG: bja:blr0655
FT                   phosphoribosyl-ATP pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98876"
FT                   /db_xref="GOA:B3Q952"
FT                   /db_xref="InterPro:IPR008179"
FT                   /db_xref="InterPro:IPR021130"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q952"
FT                   /protein_id="ACE98876.1"
FT                   /translation="MARFTLHDLAATVDARAASGGESSYTKKLLDKGPEHCAKKFGEEA
FT                   VEMVIAAVENDRGHLISETADVLFHMLVLLKSRGVKLEEVEAALAQRTSMSGLEEKASR
FT                   KRD"
FT   gene            336268..337224
FT                   /locus_tag="Rpal_0317"
FT   CDS_pept        336268..337224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0317"
FT                   /product="pantothenate kinase"
FT                   /EC_number="2.7.1.33"
FT                   /note="KEGG: nha:Nham_0128 pantothenate kinase; TIGRFAM:
FT                   pantothenate kinase; PFAM: phosphoribulokinase/uridine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98877"
FT                   /db_xref="GOA:B3Q953"
FT                   /db_xref="InterPro:IPR004566"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3Q953"
FT                   /protein_id="ACE98877.1"
FT                   /translation="MDARSDLHHYNPYRVFSRAEWASMREDTPMTLDAAEVAALRSMHD
FT                   RLDLSEVEEIYLPMSRLLSIHVAAMQQLYYAQRRFLGVVERKMPFIIGVAGSVAVGKST
FT                   TARVLQALLARWSPRPTVDLVTTDGFLHPNAVLERAGLMQKKGFPESYDLPALLGFLSD
FT                   IKSGRRKVKAPIYSHLTYDIVPNKFTVIDRPDILIVEGVNVLQTGRLPRDGKAVPVVSD
FT                   FFDFSVYLDADEPVLRDWYVRRFLALRDTAFHDPRSYFHRYAVLSDEEATATAIAIWER
FT                   TNLANLEDNILPTRPRATLILKKGADHVVDSVALRRL"
FT   gene            complement(337371..338321)
FT                   /locus_tag="Rpal_0318"
FT   CDS_pept        complement(337371..338321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0318"
FT                   /product="putative hemolysin"
FT                   /note="KEGG: azc:AZC_0076 putative hemolysin"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98878"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q954"
FT                   /protein_id="ACE98878.1"
FT                   /translation="MHTDHLARSKKFIKLLRPETAGAAAQTAITWFKPALKLAETGKPI
FT                   GPSPATLGRLGPLEVRLAQTKQDVKRAQKLRYRVFYKDGTAIADAPTMLARRDKDAFDP
FT                   ICDHLLVVDHAAKPSLSGKQPVVGTYRLLRQDVANRNGGFYTESEFDIGGLITRHPELR
FT                   FLELGRSCVLPPYRNKRTVELLWHGIWTYVRQHGVDVMLGCASFDGTDPDRLALPLSFL
FT                   HHYAPAPEAWRARAHPSRYVEMNRLPKEAIDQKAALRELPPLIKGYLRLGATIGEGAVI
FT                   DYQFGTTDVLIILPVSAISARYIEHFGADASRHAA"
FT   gene            complement(338482..340392)
FT                   /locus_tag="Rpal_0319"
FT   CDS_pept        complement(338482..340392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0319"
FT                   /product="integral membrane sensor hybrid histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="PFAM: response regulator receiver; ATP-binding
FT                   region ATPase domain protein; histidine kinase A domain
FT                   protein; KEGG: bja:bll0659 two-component hybrid sensor and
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98879"
FT                   /db_xref="GOA:B3Q955"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q955"
FT                   /protein_id="ACE98879.1"
FT                   /translation="MAGKLRIRSRLRLLARRHPRITMAGRAVMAFSAGFGGAYGLLLGS
FT                   NPETSGYDPHAFAVGASFLFALACLALAVQTMRLRRMRGRLRLLTASQEPPPDLQPNQS
FT                   KTRALIAARESADAANHAKSRLLAMASHEIRTPLNGIIGMSRLLLDTPLSAEQATYAKA
FT                   VKTSGEALLALTDELLDYARIEAGKIELDCRPFVLSSLIEDIIELLAPRAQARGLEIAA
FT                   DIDERLPVSLIGDAARLRQVLLNLCGNAIKFTETGGVALIVERGDQSDGLRIIVRDTGI
FT                   GIAPDAQARIFHEFEQADAGIARNFGGTGLGLSISDRIVSVMGGRIALESKPGEGSTFT
FT                   ITLPLSAADHDRATAAFAPPDLHGSSVMIVSPHGVEASLAARRLERWGAETCLCDDLAA
FT                   AIARLPERSWHAVLIDHAFGTDTIETLARKALPRATHRLVMLTPAARHELLPDLPAAFT
FT                   GYLVKPLRAASLAARLGTAVEVAAPSIADGDPPPVQDASSAITHEAFAILVAEDNDINA
FT                   LLIRALLHRLGHHAEIVGDGRRAVEAWGAADNTGTPFDLVLMDVQMPILDGLAAARQIR
FT                   TLEAERARSRVPILALTANTLAEDREACLESGMDGFLVKPIDPDRLAAILAGVAAVHQT
FT                   A"
FT   sig_peptide     complement(340276..340392)
FT                   /locus_tag="Rpal_0319"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.897) with cleavage site probability 0.369 at
FT                   residue 39"
FT   gene            complement(340519..342057)
FT                   /locus_tag="Rpal_0320"
FT   CDS_pept        complement(340519..342057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0320"
FT                   /product="Mg chelatase, subunit ChlI"
FT                   /note="KEGG: bja:bll0661 hypothetical protein; TIGRFAM: Mg
FT                   chelatase, subunit ChlI; PFAM: magnesium chelatase ChlI
FT                   subunit; ATPase associated with various cellular activities
FT                   AAA_5; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98880"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q956"
FT                   /protein_id="ACE98880.1"
FT                   /translation="MVQHVSTVAFEGIEARSVDVQVQVSPGLPAFAMVGLADKAVSEAR
FT                   ERVRSALIASGLALPARRITVNLAPADLPKEGSHYDLPIALGLMAAIGAIPADALEGFT
FT                   VLGELGLDGSIAPVAGVLPAAIAANAREHGLICPAACGSEAAWASPDIQIIAASSLIQI
FT                   ANHFKGSQLLGRPQPRVREAEASMLDLRDIKGQESAKRALEIAAAGGHHLLMIGAPGAG
FT                   KSMLAARLPSILPPLSPAELLEVSMIASVAGEIRDGALTARRPFRAPHHSASMAALTGG
FT                   GIKARPGEISLAHQGVLFLDELPEFDPRVLDSLRAPLETGEVAVSRANHRVTYPARVML
FT                   VAAMNPCRCGHAFEPGFACKRGRVDRCTSDYQSRISGPLMDRIDLRIEVPAVSAADLIL
FT                   PPPAEGSAEVAARVAAARDVQRTRYASIGLPQIRTNAEAPAAVLETTAQPDSAGLKLLH
FT                   DAAETMRLSARGYHRVLRVARTLADLDGCDRIGRVHLAEALSYRALADDQRRAA"
FT   gene            complement(342157..342381)
FT                   /locus_tag="Rpal_0321"
FT   CDS_pept        complement(342157..342381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0321"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98881"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q957"
FT                   /protein_id="ACE98881.1"
FT                   /translation="MNASSKPRGARPITLNPPLKQHAVCIDALASTINRAIEQAEELGI
FT                   SSAVQLLMMARLEVDLTEIALESRTKNSA"
FT   gene            complement(342378..343034)
FT                   /locus_tag="Rpal_0322"
FT   CDS_pept        complement(342378..343034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0322"
FT                   /product="putative autoinducer (acylhomoserine lactone)
FT                   synthase"
FT                   /note="KEGG: bra:BRADO0941 putative autoinducer
FT                   (acylhomoserine lactone) synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98882"
FT                   /db_xref="GOA:B3Q958"
FT                   /db_xref="InterPro:IPR001690"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q958"
FT                   /protein_id="ACE98882.1"
FT                   /translation="MQVHVIRRENRALYAGLLEKYFRIRHQIYVVERGWKELDRPDGRE
FT                   IDQFDTEDAVYLLGVDNDDIVAGMRMVPTTSPTLLSDVFPQLALAGPVRRPDAYELSRI
FT                   FVVPRKRGEHGGPRAEAVIQAAAMEYGLSIGLSAFTIVLETWWLPRLVDQGWKAKPLGL
FT                   PQDINGFSTTAVIVDVDDDAWVGICNRRSVPGPTLEWRGLEAIRRHSLPEFQVIS"
FT   gene            complement(343120..343851)
FT                   /locus_tag="Rpal_0323"
FT   CDS_pept        complement(343120..343851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0323"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="PFAM: regulatory protein LuxR; Autoinducer-binding
FT                   domain protein; KEGG: bbt:BBta_7112 putative N-acyl
FT                   homoserine lactone transcriptional regulator, LuxR-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98883"
FT                   /db_xref="GOA:B3Q959"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR005143"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036693"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q959"
FT                   /protein_id="ACE98883.1"
FT                   /translation="MIVGEDQLWGRRALEFVDSVERLEAPALISRFESLIASCGFTAYI
FT                   MAGLPSRNAGLPELTLANGWPRDWFDLYVSENFSAVDPVPRHGATTVYPFVWSDAPYDR
FT                   DRDPAAHRVMTRAAEFGLVEGYCIPLHYDDGSAAISMAGKDPDLSPAARGAMQLVSIYA
FT                   HSRLRALSRPKPIRRNRLTPRECEILQWAAQGKTAWEISVILCITERTVKFHLIEAARK
FT                   LDAANRTAAVAKALTLGLIRL"
FT   gene            complement(344088..345029)
FT                   /locus_tag="Rpal_0324"
FT   CDS_pept        complement(344088..345029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0324"
FT                   /product="glutathione synthetase"
FT                   /EC_number="6.3.2.3"
FT                   /note="KEGG: nha:Nham_0145 glutathione synthetase; TIGRFAM:
FT                   glutathione synthetase; PFAM: glutathione synthetase domain
FT                   protein; glutathione synthetase ATP-binding; RimK domain
FT                   protein ATP-grasp"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98884"
FT                   /db_xref="GOA:B3Q960"
FT                   /db_xref="InterPro:IPR004215"
FT                   /db_xref="InterPro:IPR004218"
FT                   /db_xref="InterPro:IPR006284"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q960"
FT                   /protein_id="ACE98884.1"
FT                   /translation="MTLKVAVQMDPIARINIRGDSTFALLLEAQARGHAISYFTPDKLS
FT                   LRGNDVVASVQSLKVRDQEGDHFTLGEPARVDMRSYDVVLLRQDPPFDLAYITSTHLLE
FT                   RIHPATLVVNNPASVRNAPEKLFVMDFAELMPPTLISRDKDEINAFRAEHGAVVMKPLH
FT                   GHGGAAVFRVLPQDINFGSLYDMFAVTFREPWVIQRFLPEVKHGDKRIILVDGEFAGAV
FT                   NRVPAEDDLRSNMVRGGAAAATELSPREREICATLGPKLRERGLLFVGIDVIDGYLTEI
FT                   NVTSPTGIRAVARLGGPDIAAKIWDVIEAKRA"
FT   gene            complement(345102..345494)
FT                   /locus_tag="Rpal_0325"
FT   CDS_pept        complement(345102..345494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0325"
FT                   /product="protein of unknown function UPF0102"
FT                   /note="PFAM: protein of unknown function UPF0102; KEGG:
FT                   bra:BRADO0179 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98885"
FT                   /db_xref="GOA:B3Q961"
FT                   /db_xref="InterPro:IPR003509"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q961"
FT                   /protein_id="ACE98885.1"
FT                   /translation="MAKTDRSHPSVLARIAAFRTGLSAEASAADYLERQGYRILARRFK
FT                   TRCGEIDLVAQRDALVVFVEVKARGNVDDAAYAVTPRQQGRIVAAAEAWLSRHPEHAMS
FT                   ELRFDAILIAPNTAPRHLPGAFDATP"
FT   sig_peptide     complement(345408..345494)
FT                   /locus_tag="Rpal_0325"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.622) with cleavage site probability 0.474 at
FT                   residue 29"
FT   gene            complement(345481..346437)
FT                   /locus_tag="Rpal_0326"
FT   CDS_pept        complement(345481..346437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0326"
FT                   /product="Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase"
FT                   /note="PFAM: Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase; KEGG: nha:Nham_0147
FT                   protein of unknown function UPF0011"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98886"
FT                   /db_xref="GOA:B3Q962"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q962"
FT                   /protein_id="ACE98886.1"
FT                   /translation="MRVKPEISAPPPAAAEPNARTFLVAGQRLVAPRIAPGLHLVATPI
FT                   GHLGDITLRALETLAGADLIACEDTRITHRLLERYGISARLKPYHEHNAAQARPKLLEM
FT                   LAQGQSVALVSDAGTPLISDPGYKLVREVYAAGHQVIGLPGASAVLVALSLAGLPTDRF
FT                   FFDGFLPSKQGARRTRLGELAAIDATLVLFEAGSRIQNSVHDLADLLGAPREAAICREL
FT                   TKLHQEVRRATLGELAAQAETMETRGEFVVVIAPPDPASRVMSDDDLDHWLSEALTRLS
FT                   VKDAVAQAVELSGRHKREIYARALELSRQREADDGED"
FT   gene            346656..347855
FT                   /locus_tag="Rpal_0327"
FT   CDS_pept        346656..347855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0327"
FT                   /product="extracellular ligand-binding receptor"
FT                   /note="KEGG: nha:Nham_0148 extracellular ligand-binding
FT                   receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98887"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q963"
FT                   /protein_id="ACE98887.1"
FT                   /translation="MASLHDPHTKPLRTTRRTALGLLLGAPLLSACSGVQQSLSDQFGQ
FT                   QQPAAGPAQQPAAVGNGRVKVGLVLPLSAPGNAGLAAQSMKNAAEMALAEFRNPDVQLL
FT                   IKDDAGNPTGAQTATQQALDEGAEIILGPLFAQSVPAAAQAARARGVSVIAFSTDSSVA
FT                   GRGVFLLSFLPESDVNRIIGYAGSIGKRSYAALLPENAYGAVVEAAFKQITSQKGGRIV
FT                   AFEKYGADRAGPARTIAASLASADALLLADDGDALAAVADALGAAGADLKRVQLLGTGL
FT                   WDNPRVFATQALQGGLFAAPDPSGFRAFSGRYRARYGQDPVRTATLAYDGVALVAALAR
FT                   TQGPQRFSAETLTNPSGFAGIDGLFRFRADGTNERGLAVMKVASGGAQAVAGPPKSFGA
FT                   "
FT   sig_peptide     346656..346778
FT                   /locus_tag="Rpal_0327"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.989) with cleavage site probability 0.370 at
FT                   residue 41"
FT   gene            complement(347873..348235)
FT                   /locus_tag="Rpal_0328"
FT   CDS_pept        complement(347873..348235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0328"
FT                   /product="transcriptional regulator, HxlR family"
FT                   /note="PFAM: helix-turn-helix HxlR type; KEGG:
FT                   pla:Plav_3490 transcriptional regulator, HxlR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98888"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q964"
FT                   /protein_id="ACE98888.1"
FT                   /translation="MTRTHQKVGDLPRSNPAHTPLTAAQGIAAGFRLLEGRWKILILFH
FT                   LFGGRVLRFSELERSIPDVSQKMLAQQLRQLEADGIVARTVHPEVPPRVEYHLTDWGQS
FT                   LCPALDALLGWVEQKP"
FT   gene            348306..348635
FT                   /locus_tag="Rpal_0329"
FT   CDS_pept        348306..348635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0329"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pde:Pden_4576 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98889"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q965"
FT                   /protein_id="ACE98889.1"
FT                   /translation="MTVSLPAPIEAYFVASNARAVQDVAAAFAADAEVRDEGKIHRGRE
FT                   AIAAWKRAALGKYQMQMEPLTIERAAQTAIVTARVAGDFPGSPVRLTYRFGLGEDGITS
FT                   LEIGA"
FT   gene            complement(348640..349797)
FT                   /locus_tag="Rpal_0330"
FT   CDS_pept        complement(348640..349797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0330"
FT                   /product="oxygen-independent coproporphyrinogen III
FT                   oxidase"
FT                   /EC_number="1.3.98.3"
FT                   /note="KEGG: bra:BRADO0175 coproporphyrinogen III oxidase;
FT                   TIGRFAM: oxygen-independent coproporphyrinogen III oxidase;
FT                   PFAM: Radical SAM domain protein; HemN domain protein;
FT                   SMART: Elongator protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98890"
FT                   /db_xref="GOA:B3Q966"
FT                   /db_xref="InterPro:IPR004559"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010723"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q966"
FT                   /protein_id="ACE98890.1"
FT                   /translation="MQASSDPAFGVYVHWPFCLSKCPYCDFNSHVRHAAIDEERFARAF
FT                   AREIATTAERIGPRQVSSIFLGGGTPSLMQPSTVAAILDAIARHWHVEPGAEVTLEANP
FT                   TSVEATRFRGYRAAGVNRVSLGVQALDDASLKALGRMHSAEEALNAVAIAKSAFDRYSF
FT                   DLIYARPGQTAAMWEAELRYAIGEAAEHLSLYQLTIEPDTPFYSLHKAGKLPTPDEAEA
FT                   RALYDVTQSVCAELGLPAYEISNHARPGAECRHNLIYWRGHEYAGIGPGAHGRLDIGNA
FT                   RYATATEKRPESWLMRVEATGHGLIADEHLTSEERADEFLLMGLRLAEGIDPQRYQLLS
FT                   GRPLDPSRIALLREEGAIAVDADGRLRVTQEGFPVLDAVVADLAA"
FT   gene            complement(349787..350419)
FT                   /locus_tag="Rpal_0331"
FT   CDS_pept        complement(349787..350419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0331"
FT                   /product="non-canonical purine NTP pyrophosphatase,
FT                   rdgB/HAM1 family"
FT                   /note="TIGRFAM: non-canonical purine NTP pyrophosphatase,
FT                   rdgB/HAM1 family; PFAM: Ham1 family protein; KEGG:
FT                   bbt:BBta_0185 putative deoxyribonucleotide triphosphate
FT                   pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98891"
FT                   /db_xref="GOA:B3Q967"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q967"
FT                   /protein_id="ACE98891.1"
FT                   /translation="MHRRITGKLVIATHNPGKLAEMRELLAPYGIEAISAGELGLAEPD
FT                   ETGGSFQANARIKAEAAAKAAQLPAFADDSGLTVDALDGAPGIYSARWAGDAKDFAGAM
FT                   ARIERLLQERGATAPERRTAHFVSALCVAWPDGHIEEVEARADGTLVWPPRGTAGFGYD
FT                   PVFLPEGHSRTFGEMTSVEKHGLPPLGLGLSHRAKAFVKLAEICLAG"
FT   gene            complement(350471..351184)
FT                   /locus_tag="Rpal_0332"
FT   CDS_pept        complement(350471..351184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0332"
FT                   /product="ribonuclease PH"
FT                   /EC_number="2.7.7.56"
FT                   /note="KEGG: nha:Nham_0151 ribonuclease PH; TIGRFAM:
FT                   ribonuclease PH; PFAM: 3' exoribonuclease; Exoribonuclease,
FT                   phosphorolytic domain 2"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98892"
FT                   /db_xref="GOA:B3Q968"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR002381"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR018336"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3Q968"
FT                   /protein_id="ACE98892.1"
FT                   /translation="MRPSRRAPDELRAVSLERGVVKYAEGSCLVKFGDTHVLVTATLEE
FT                   RLPPWLKGQGRGWVTAEYGMLPRATLERTRREASAGKQNGRTVEIQRLIGRSLRTIVDL
FT                   EALGERQITVDCDVLQADGGTRTASITGAWVALADCLNWMKARNMIKGQVLRDNVAAIS
FT                   CGIYNGTPVLDLDYAEDSEAETDANFVMTGDGRLVEVQGTAERTPFSQDEFLQLMALAQ
FT                   KGVARLVDLQKMAVG"
FT   gene            351340..352428
FT                   /locus_tag="Rpal_0333"
FT   CDS_pept        351340..352428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0333"
FT                   /product="heat-inducible transcription repressor HrcA"
FT                   /note="TIGRFAM: heat-inducible transcription repressor
FT                   HrcA; PFAM: Negative regulator of class I heat shock
FT                   protein; KEGG: nwi:Nwi_0194 heat-inducible transcription
FT                   repressor"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98893"
FT                   /db_xref="GOA:B3Q969"
FT                   /db_xref="InterPro:IPR002571"
FT                   /db_xref="InterPro:IPR021153"
FT                   /db_xref="InterPro:IPR023120"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3Q969"
FT                   /protein_id="ACE98893.1"
FT                   /translation="MAQHDPIGLIAPNAGLAQLNERSREIFRQIVESYLATGEPVGSRN
FT                   ISRLISVPLSPASVRNVMADLEQLGLIYAPHTSAGRLPTELGLRFFVDALMQIGDLTEP
FT                   ERQSIQAQLSSVGRAHTVEAALGEALTRLSGLTRAAAVVLTAKANVRLKHIEFVRLEPE
FT                   RALVILVAEDGQVENRVLTLPPGVPSSALIEAANYLNARIRGRTLAEARLELESLMVQN
FT                   KAELDQLTQKVIAAGIASWSGGDGEDRQLIVRGHANLLEDLHALDDLERVRLLFDDLET
FT                   KRGVIDLLGRAESADGVRIFIGSENKLFSLSGSSTIIAPYSDGAGHIVGVLGVIGPTRL
FT                   NYARVIPMVDYTARIVSRMLGG"
FT   gene            352519..353142
FT                   /locus_tag="Rpal_0334"
FT   CDS_pept        352519..353142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0334"
FT                   /product="Ribulose-phosphate 3-epimerase"
FT                   /EC_number="5.1.3.1"
FT                   /note="PFAM: GrpE protein; KEGG: bbt:BBta_0188 protein GrpE
FT                   (HSP-70 cofactor)"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98894"
FT                   /db_xref="GOA:B3Q970"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3Q970"
FT                   /protein_id="ACE98894.1"
FT                   /translation="MTETDGQKDNNQDTAQAAADPVVSKPYIMPDDPEEGSNEALVREA
FT                   ADARDKMLRTLAEMENLRKRTQKEVADARTYGVTSFARDVLDIADNLQRALDAVPAEAR
FT                   ANAEPGLKALIEGVELTERSLLNALEKNGVKKFDPKGQKFDPNFQQAMYEVPDPSVPAG
FT                   TVVQVVQAGFTIGDRVLRPALVGVAKGGAKAAPSDGGSETGNLN"
FT   gene            complement(353249..354190)
FT                   /locus_tag="Rpal_0335"
FT   CDS_pept        complement(353249..354190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0335"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bja:bll0679 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98895"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q971"
FT                   /protein_id="ACE98895.1"
FT                   /translation="MRQIARLFAIALLSAAATNAVAADAVYPRGIRVGIVPMPGLNQST
FT                   AFLGFESGDQGVKVLVSELPGPAFDQIDAAFKAAPEGSLGNVKPEKIETAAGNGYFTAE
FT                   DAVVGPDKVRRYSLIVPGSKLFSGYVAVQVPATEAKTYSDEAIKKMLSSVSVRQQVPVD
FT                   EQVAQMPFKIRELGDFKTVRTLAPGAALLLTDGNEEAVETGPFMVLGLIGSVPEKTDDR
FT                   ARFAQQAAEAIPGVRESKITMSEPMRIDGAPGFETRVTGVSGKNNTPVTVVQWLRFGSA
FT                   NVAMRVIGSSPKDQWETAFPRFRKVRDGLQPR"
FT   sig_peptide     complement(354122..354190)
FT                   /locus_tag="Rpal_0335"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.991 at
FT                   residue 23"
FT   gene            354525..356420
FT                   /locus_tag="Rpal_0336"
FT   CDS_pept        354525..356420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0336"
FT                   /product="chaperone protein DnaK"
FT                   /EC_number="1.3.1.74"
FT                   /note="KEGG: bbt:BBta_0191 chaperone protein DnaK; TIGRFAM:
FT                   chaperone protein DnaK; PFAM: Heat shock protein 70"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98896"
FT                   /db_xref="GOA:B3Q972"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3Q972"
FT                   /protein_id="ACE98896.1"
FT                   /translation="MGKVIGIDLGTTNSCVAVMDGKSAKVIENAEGMRTTPSIVAITDD
FT                   GERLVGQPAKRQAVTNPERTFFAVKRLIGRRYDDPMVEKDKGLVPYKIVKASNGDAWVE
FT                   ADGKTYSPSQVSAFILQKMKETAEAHLGQKVDQAVITVPAYFNDAQRQATKDAGKIAGL
FT                   EVLRIINEPTAAALAYGLDKAKTGTIAVYDLGGGTFDVSILEIGDGVFEVKSTNGDTFL
FT                   GGEDFDMRLVNYLADEFQKEQGIDLRKDKLALQRLKEAAEKAKIELSSTTQTEINLPFI
FT                   TADQSGPKHLTMKLTRAKFEALVDDLVQKTIEPCRKALKDAGLTAGEISEVVLVGGMTR
FT                   MPKVQEVVKQLFGKEPHKGVNPDEVVAIGAAIQAGVLQGDVKDVLLLDVTPLSLGIETL
FT                   GGVFTRIIDRNTTIPTKKSQVFSTAEDNQNAVTIRVFQGEREMAADNKMLGQFDLMGIP
FT                   PAPRGMPQIEVTFDIDANGIVNVSAKDKATGKEQQIRIQASGGLSDSEIDKMVKDAEAN
FT                   AAEDKKRREAVDAKNHADALVHSTEKALAEHGSKVDESERRSIEDALSDLREALKGDDA
FT                   EAIKAKSNTLAQASMKLGEAMYKQAEAAGGAQQAGKDDVVDAEFTEVDDDKKKSA"
FT   gene            356635..357774
FT                   /locus_tag="Rpal_0337"
FT   CDS_pept        356635..357774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0337"
FT                   /product="chaperone protein DnaJ"
FT                   /note="TIGRFAM: chaperone protein DnaJ; PFAM: DnaJ central
FT                   domain protein; heat shock protein DnaJ domain protein;
FT                   chaperone DnaJ domain protein; KEGG: nha:Nham_0156
FT                   chaperone DnaJ"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98897"
FT                   /db_xref="GOA:B3Q973"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3Q973"
FT                   /protein_id="ACE98897.1"
FT                   /translation="MSTTKRCYYETLEVERNADDSTLKSAFRKLAMKWHPDRNPGDPQC
FT                   EIKFKEINEAYEVLKDGDKRAAYDRYGHAAFEQGGFGGGAGFGAGFASSFSDIFEDLFG
FT                   MAAQRGRGTGRERGADLRYNMEITLEDAFKGKTAQIEIPVSVTCEACSGTGAKAGTKPK
FT                   TCSTCGGAGRVRQAQGFFTLERTCPSCQGRGQTIEDPCPSCTGSGRVTKERTLSVNIPQ
FT                   GVEDGTRIRLAGEGEAGLRGGPPGDLYIFLSLANHAIFQRDGADLHCRVPISMVTAALG
FT                   GEFEVPTIDRGKTKVKVPSGTQTGRRFRIAGKGMPVLRSRQVGDMYVQVVVETPQNLTK
FT                   KQQELLAEFEKLSSGETQPEAVGFFSKVKEFFGSRASAP"
FT   gene            357868..358473
FT                   /locus_tag="Rpal_0338"
FT   CDS_pept        357868..358473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0338"
FT                   /product="ribosomal RNA adenine methylase transferase"
FT                   /note="SMART: ribosomal RNA adenine methylase transferase;
FT                   KEGG: bja:blr0681 phospholipid N-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98898"
FT                   /db_xref="GOA:B3Q974"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q974"
FT                   /protein_id="ACE98898.1"
FT                   /translation="MALQSSVRAFKKPPRPLVDEVRFLRSWIEKPLHMGAVMPSGKLLA
FT                   RTMARYVDIQSDGPVIELGPGTGAITNALVEHGVDQKRLVLLEFDPGFCALLRERFPLA
FT                   KVVQGDAYRLRDSLWDALEIPATAVVSGLPLVTKPMLTRMKLIRDAFTLLEPGAPFVQF
FT                   TYSVAPPIPKSLPGVSTEGSERIWMNVPPARVWVYRKR"
FT   gene            358575..359156
FT                   /locus_tag="Rpal_0339"
FT   CDS_pept        358575..359156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0339"
FT                   /product="NADPH-dependent FMN reductase"
FT                   /note="PFAM: NADPH-dependent FMN reductase; KEGG:
FT                   bja:blr0682 putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98899"
FT                   /db_xref="GOA:B3Q975"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q975"
FT                   /protein_id="ACE98899.1"
FT                   /translation="MSAVKILIIPGSLRTGSHNVRLAATAAHEFARADIDTTWLSLADY
FT                   ALPIYDADFEAKSGVPKNAVGLKRMIGAHHGVLIVSPEYNSAPPPLLKNAIDWVSRVED
FT                   PHETQGQVFRDRVFALAAASEGKLGGARCLAALRLILSGCRAPVIPNQLALSFAHEAYD
FT                   DNDRLKHPADATALQAMVRQLIDFAQQMMR"
FT   gene            359164..359877
FT                   /locus_tag="Rpal_0340"
FT   CDS_pept        359164..359877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0340"
FT                   /product="orotidine 5'-phosphate decarboxylase"
FT                   /EC_number="4.1.1.23"
FT                   /note="KEGG: bja:blr0683 orotidine 5'-phosphate
FT                   decarboxylase; TIGRFAM: orotidine 5'-phosphate
FT                   decarboxylase; PFAM: Orotidine 5'-phosphate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98900"
FT                   /db_xref="GOA:B3Q976"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR014732"
FT                   /db_xref="InterPro:IPR018089"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3Q976"
FT                   /protein_id="ACE98900.1"
FT                   /translation="MAPVDIPDRDRLIVALDLPDLRVAEAMVDRLGDSVGFYKIGYQLA
FT                   YAGGLPLARALVGAGKKVFVDLKLHDIGNTVARGVESLSHLGASFLTVHAYPQTMKAAV
FT                   EARGSSKVKILAVTVLTSYDDRDLADAGYRFGVRDLVEARARQAQAIGVDGLVCSPEEA
FT                   AHLRGIVGPEMDLVTPGIRPAGAAAGDQKRIMTPAKAIAAGASYLVVGRPVLDAPDPKA
FT                   AADAIVAEIAAARGS"
FT   gene            359903..360211
FT                   /locus_tag="Rpal_0341"
FT   CDS_pept        359903..360211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0341"
FT                   /product="protein of unknown function DUF1330"
FT                   /note="PFAM: protein of unknown function DUF1330; KEGG:
FT                   bra:BRADO0159 conserved hypothetical protein; putative
FT                   dimeric alpha-beta barrel domain"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98901"
FT                   /db_xref="InterPro:IPR010753"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q977"
FT                   /protein_id="ACE98901.1"
FT                   /translation="MPKGYWVGRIDVHDLDGYKRDYVAHNGAVFAKYGAKFLTRGGTYE
FT                   AKEGQARSRNVVIEFKDYETALACYHSPEYQALIKARAPFSEGEMVVVEGYDGPQPS"
FT   gene            360308..361123
FT                   /locus_tag="Rpal_0342"
FT   CDS_pept        360308..361123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0342"
FT                   /product="Dihydrodipicolinate reductase"
FT                   /EC_number="1.17.1.8"
FT                   /note="PFAM: dihydrodipicolinate reductase; KEGG:
FT                   nha:Nham_0158 dihydrodipicolinate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98902"
FT                   /db_xref="GOA:B3Q978"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR022663"
FT                   /db_xref="InterPro:IPR022664"
FT                   /db_xref="InterPro:IPR023940"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3Q978"
FT                   /protein_id="ACE98902.1"
FT                   /translation="MSEMRLIVAGAGGRMGRALTRAISETEGVVLTGALESPNSELLGK
FT                   DAGTLAGLPANGVLLSADLWSLSANADGIVDFTVPQATIANVAIAAQRGIAHIIGTTGL
FT                   STSDNAVIQSVTDRAVVVKSGNMSLGVNLLAAIAKRVAQSLDDSFDIEIVEMHHRAKVD
FT                   APSGTALLLGEAVAAGRKIDLATHSARGRDGFTGARKPGDIGFASLRGGTVTGDHTVIF
FT                   AGASERIELTHKAEDRMIFAHGALTAARWAKGKKPGLYSMADVLGLGDI"
FT   gene            complement(361203..362717)
FT                   /locus_tag="Rpal_0343"
FT   CDS_pept        complement(361203..362717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0343"
FT                   /product="phosphoglycerate mutase,
FT                   2,3-bisphosphoglycerate-independent"
FT                   /note="KEGG: gbe:GbCGDNIH1_1712 phosphoglycerate mutase;
FT                   TIGRFAM: phosphoglycerate mutase,
FT                   2,3-bisphosphoglycerate-independent; PFAM: metalloenzyme
FT                   domain protein; BPG-independent PGAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98903"
FT                   /db_xref="GOA:B3Q979"
FT                   /db_xref="InterPro:IPR005995"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR011258"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR036646"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q979"
FT                   /protein_id="ACE98903.1"
FT                   /translation="MQSRRPVMLVILDGWGWREDPADNAVLQAKTPTFDALWTNGPHAF
FT                   LRTSGKSVGLPNGQMGNSEVGHLNIGAGRVVMQDLPRISDAIANGEIERAPGLVAFIEK
FT                   LKASGGTCHLMGLVSPGGVHSLQDHACALAKILTKAGVKTVLHAFTDGRDTPPKSAVDD
FT                   IVRLRAELPPNVPIATVSGRYYAMDRDNRWERVSKAYGVIADADGPRFANADAVIADGY
FT                   AAGVNDEFIVPAVVGDYQGMRDGDGVLCFNFRADRVREILAALLDPAFAGFPRKQVKQI
FT                   AAAAGMTQYSTALDALMGTIFPPQSLVNGLGQVVADAGLHQLRMAETEKYPHVTYFLNG
FT                   GEEVPYPGEDRIMVPSPKVATYDLQPEMSAPELGDKAVAAIESGKYDLIVLNFANPDMV
FT                   GHTGSLPAAIKAVETVDTQLGHIVAAIRKAGGALLVTADHGNCEMMRDPETGGPHTAHT
FT                   TNPVPVLLVGDNGPLADGQLSDLAPTLLKLMELPQPAEMTGKSLIG"
FT   gene            complement(362809..363741)
FT                   /locus_tag="Rpal_0344"
FT   CDS_pept        complement(362809..363741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0344"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="TIGRFAM: methylated-DNA/protein-cysteine
FT                   methyltransferase; PFAM: helix-turn-helix- domain
FT                   containing protein AraC type;
FT                   Methylated-DNA-[protein]-cysteine S-methyltransferase DNA
FT                   binding; KEGG: bja:bll0687 transcriptional regulatory
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98904"
FT                   /db_xref="GOA:B3Q980"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q980"
FT                   /protein_id="ACE98904.1"
FT                   /translation="MAARAAADNISGMMNLAIADHQLIKPGARDSALADYDCVRRAIAF
FT                   ISQKWKAQPTIEAIADAAGLTPDELHHLFRRWAGLTPKAFMQALTLDHAKSLLRDSASV
FT                   LDAALASGLSGPGRLHDLFVTHEAMSPGEWKSGGAGLSLRYGFHPSPFGTAVIIASDRG
FT                   LAGLAFADPDEEQAALVDLQQRWPRAVCTQDQDATAPLARRIFDPAQWRAEQPLRVVLI
FT                   GTDFEVRVWETLLKIPLGKAVCYSDIAAKISLPKASRAVGAAVGKNPISFVVPCHRALG
FT                   KGGALTGYHWGLTRKQAMIGWEAGQLRAE"
FT   gene            complement(363756..364271)
FT                   /locus_tag="Rpal_0345"
FT   CDS_pept        complement(363756..364271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0345"
FT                   /product="putative membrane protein of unknown function"
FT                   /note="KEGG: bbt:BBta_0200 putative membrane protein of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98905"
FT                   /db_xref="GOA:B3Q981"
FT                   /db_xref="InterPro:IPR016990"
FT                   /db_xref="InterPro:IPR019253"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q981"
FT                   /protein_id="ACE98905.1"
FT                   /translation="MAIEPDLGLDSREPKLFSARLKPHRALSHNGFLILIGLVGTASFA
FT                   AGLAFWMMGAWPVFGFFGLDVLALAFAFKVSFARARASEEISMTCSELRVRRTSARGEV
FT                   AEWVLNPLWVRLEKIVHHDAGIERLYLVSSGRRLAIASFLGAEEKANFAKALMAALDAA
FT                   RRGPLYPA"
FT   gene            364294..365079
FT                   /locus_tag="Rpal_0346"
FT   CDS_pept        364294..365079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0346"
FT                   /product="endonuclease III"
FT                   /EC_number="4.2.99.18"
FT                   /note="KEGG: bra:BRADO0152 endonuclease III DNA-(apurinic
FT                   or apyrimidinic site) lyase; TIGRFAM: endonuclease III;
FT                   PFAM: helix-hairpin-helix motif; HhH-GPD family protein;
FT                   SMART: iron-sulfur cluster loop"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98906"
FT                   /db_xref="GOA:B3Q982"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR004035"
FT                   /db_xref="InterPro:IPR005759"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q982"
FT                   /protein_id="ACE98906.1"
FT                   /translation="MPKTTRRPARPAAKTPAASPAKPAKRTAGAKPKSVSAKSAPSRRG
FT                   KSPRRWSAAEVQEAFSRFAKANPEPKGELEHLNPFTLLVAVVLSAQATDAGVNKATRPL
FT                   FAVADTPQKMLALGEDRVREYIKTIGLFRTKAKNVIALSQKLITDFGGEVPNTREALET
FT                   LPGAGRKTANVVLNMAFGQPTMAVDTHVFRVGNRTGLAPGDTPLAVELELERVIPAEFM
FT                   QHAHHWLILHGRYTCLARKPRCEVCLINDLCRWPEKTVS"
FT   gene            complement(365195..366760)
FT                   /locus_tag="Rpal_0347"
FT   CDS_pept        complement(365195..366760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0347"
FT                   /product="peptidase S10 serine carboxypeptidase"
FT                   /note="PFAM: peptidase S10 serine carboxypeptidase; KEGG:
FT                   bja:bll5514 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98907"
FT                   /db_xref="GOA:B3Q983"
FT                   /db_xref="InterPro:IPR001563"
FT                   /db_xref="InterPro:IPR018202"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q983"
FT                   /protein_id="ACE98907.1"
FT                   /translation="MPLSPRSAVTASMLIAALALPQFGSSAVAQEARPAAPHAERAKPN
FT                   AEQADAVASKAEASPARAELNSLPPDVTTKHSLALPGRTLAFTATAGSIRLFNGKGEPQ
FT                   ADVAITTYKLDGADARTRPVTFLFNGGPGASSAWLQLGAAGPWRLPIGNSVVASSPPVL
FT                   QANAETWLDFTDLVFIDPVGTGYSRFVASGDEVRKHFYAVEGDISAMAVVIRRWLEKND
FT                   RLVSPKYLAGESYGGIRGPKVVDNLQTKQGVGVNGLILVSPVLDFRDLSGSSLLQYAAR
FT                   LPSMTAVARQQKGKVNRADLADVESYARSEFLTDLVKGEADKEATTRLADRVSALTGID
FT                   KTVSRRLAGRFDTREFQREFDRDRGRVTGRFDGAKLGLDPFPDSSAAHFGDPSADSLIA
FT                   PLTSAAVQLTRSTLNWKPDGSYELLNSSVAEQWDFGRGRQPLESTTQLREILSVDPSLQ
FT                   VLVTGGLFDLAAPYFGTQMVLDQLPPTLAEKRVKFVVYPGGHMFYAEDAARQSLHDEVK
FT                   AMMK"
FT   sig_peptide     complement(366671..366760)
FT                   /locus_tag="Rpal_0347"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.961 at
FT                   residue 30"
FT   gene            complement(366889..367857)
FT                   /locus_tag="Rpal_0348"
FT   CDS_pept        complement(366889..367857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0348"
FT                   /product="magnesium chelatase accessory protein"
FT                   /note="TIGRFAM: magnesium chelatase accessory protein;
FT                   PFAM: alpha/beta hydrolase fold; KEGG: bbt:BBta_6446
FT                   putative alpha/beta hydrolase, putative protoporphyrin IX
FT                   magnesium chelatase BchO-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98908"
FT                   /db_xref="GOA:B3Q984"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR017497"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q984"
FT                   /protein_id="ACE98908.1"
FT                   /translation="MVNPARDPLHTSSSRTAATRPHCPKPEWERDSHDWPHRDTSRFVE
FT                   AGGLRWHVQLMGRGPALLLLHGTGAATHSWRQLAPLLAEHFTVIAPDLPGHGFTETPAR
FT                   KRMSLEGMAADIAALLRTLGHRPMLVAGHSAGVAVLARMCLDGAIAPAGLVSLNGALLP
FT                   IGGRAGRWMLPLARLLAVSTMVPRLVARFAHRQGLVERMIADTGSSLDPHGIELYRRLV
FT                   CSPGHVAAALTMMASWRLEQLTAELPHLAPHLLLIAGSNDKTIASADAGRVQAIVPGAR
FT                   AIVMPGLGHLAHEERPQDVAGLIVEFAREHGALPPALAAAE"
FT   gene            complement(368431..369174)
FT                   /locus_tag="Rpal_0349"
FT   CDS_pept        complement(368431..369174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0349"
FT                   /product="protein of unknown function DUF540"
FT                   /note="PFAM: protein of unknown function DUF540; KEGG:
FT                   nwi:Nwi_0060 CysZ-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98909"
FT                   /db_xref="GOA:B3Q985"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q985"
FT                   /protein_id="ACE98909.1"
FT                   /translation="MLDAAIKALTQILSPPMRSILWRSVGFALALIAVAAIGLQRLLSW
FT                   AATSSELWAEAALGGFQTPLYILSWVLSIAAGLGIVVGAVFLMPAVTSLVAGIFVDEAA
FT                   EHVERESYPHEAPGVALPIGLATWETVKTALLTILVYLVALPFLFVAGAGAIVFFVATA
FT                   WLLGREYFELAAMRFRTAPEAKAMRRDNATTVFIGGLIIAAFVSIPIVNLATPLFGMAF
FT                   MVHLHKRLSGSRPEVLAPDQRSMRR"
FT   sig_peptide     complement(369034..369174)
FT                   /locus_tag="Rpal_0349"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.890) with cleavage site probability 0.850 at
FT                   residue 47"
FT   gene            complement(369262..371094)
FT                   /locus_tag="Rpal_0350"
FT   CDS_pept        complement(369262..371094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0350"
FT                   /product="(Isocitrate dehydrogenase (NADP(+))) kinase"
FT                   /EC_number="2.7.11.5"
FT                   /note="PFAM: Isocitrate dehydrogenase kinasephosphatase;
FT                   KEGG: bpt:Bpet0058 isocitrate dehydrogenase
FT                   kinase/phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98910"
FT                   /db_xref="GOA:B3Q986"
FT                   /db_xref="InterPro:IPR010452"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3Q986"
FT                   /protein_id="ACE98910.1"
FT                   /translation="MTATASHTRARPLGASEIEHATRIAEPDFDLLDALYRTDDPDDQA
FT                   RLLARVVLSAFDNYYAVSRRIPALAQAAFEARDWPVTVRLSKIRIGLYTACIDQLVPLL
FT                   KAGLPELTTDEQLWPTAEAELLAAIEGRYEADFAFAFWQSLRRKLVSDEWRPVSYDAGS
FT                   TARRTTSPAAVLKTTTTTLPITAEVIAGILGDAGFRVPWRDRDGDAALAAQAIETALEP
FT                   LSPRPGEPVKIEIADAGFFRNRGACLVGRIQLRDRGDMPMRNLPLLIALLNEKDGLVVD
FT                   AVLTDSDELQYAFSSTLANYHATNPRYHELARLLYELMPKRPLGTQYSCIGFHHLGKVA
FT                   VMSEILAEHRKTKERLATAPGFKGTVAIAFTMPSSAYVLKIIRDHPTDDYKFDYFDGLD
FT                   EVLRKYNLVHEIDRAGSMLDNIIYSNVKLDRAMFAPELLDELLEAGIGTVTLDRGALVF
FT                   RHLIVQIKLTPLPLYLANASAAESRAAVINLGDCIKNNAAADIFNKDLDGRNYGVSRIR
FT                   KVYLFDYDAVEPLTSVTVSRDGAAPGEFDNGMVFRPQEMLEGLRIDDPGLRRAFRDAHP
FT                   ELMQADYWEGMQRALRDGKVPKVMNYPASRRLQR"
FT   gene            complement(371430..372281)
FT                   /locus_tag="Rpal_0351"
FT   CDS_pept        complement(371430..372281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0351"
FT                   /product="alpha/beta hydrolase fold"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: mbn:Mboo_0148
FT                   alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98911"
FT                   /db_xref="GOA:B3Q987"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR013595"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q987"
FT                   /protein_id="ACE98911.1"
FT                   /translation="MAKLTQFLISGACALLITATSAIADPIAPAGKPIGQDAGGRTIYQ
FT                   VDANGISIGYKLIGQGAPMVMIMGLGGTAENWPPQVVEALSKNHQLILMDNRGMGHTTA
FT                   NDNPFSYPLFAADVIGLLDALGVKRSDVLGYSMGSTITQQLLLQYPDRFNKALIHATST
FT                   DGSNVAKALHGRVPADPIVARQVEATTHWKTPLDKLPSIDNQVMLVVGTADNVVGTESS
FT                   KTIASAIPGAWLVQFKGATHHLMYETPEGFSAAALTFFETNETVTPKIEPNASVAPPPT
FT                   QP"
FT   sig_peptide     complement(372207..372281)
FT                   /locus_tag="Rpal_0351"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 25"
FT   gene            372492..373664
FT                   /locus_tag="Rpal_0352"
FT   CDS_pept        372492..373664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0352"
FT                   /product="DNA-cytosine methyltransferase"
FT                   /note="TIGRFAM: DNA-cytosine methyltransferase; PFAM: C-5
FT                   cytosine-specific DNA methylase; KEGG: ade:Adeh_3442
FT                   DNA-cytosine methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98912"
FT                   /db_xref="GOA:B3Q988"
FT                   /db_xref="InterPro:IPR001525"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q988"
FT                   /protein_id="ACE98912.1"
FT                   /translation="MKVAGLFAGVGGLELGLHRAGHDTLVFSEIWDPAGAVLERRFGGV
FT                   PNVGDVASLKSLPADVDLMTAGFPCQDLSQAGKTAGIRGRKSGLVSHVFRLIDRSRPKW
FT                   VLLENVSFMLRLDAGSAMTRLVSEFEQRGYRWAYRVVNSLSFLPHRRARVFFLASLEGD
FT                   PADVLLVDDAEPAEPQTNLRSHAHGFYWTEGTRGLGWGPDCIPTLKNGSTIGIPSPPAI
FT                   LLTNGEIVTPDIRDAERLQGLPADWTKPAAQVTRASFRWSLVGNAVSTPVAAWIGKRLV
FT                   KPGQFDPARDGAAVVKGNWPKAARSDGEVRREVMISEFPKWAKRESLQDFLRHQPNLLS
FT                   VRATAGFLSRIEKSSLRFVPGFKDKVRAHLEHVRAIDSFVEPSRLLVAAE"
FT   gene            373661..374077
FT                   /locus_tag="Rpal_0353"
FT   CDS_pept        373661..374077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0353"
FT                   /product="DNA mismatch endonuclease Vsr"
FT                   /note="TIGRFAM: DNA mismatch endonuclease Vsr; PFAM: DNA
FT                   mismatch endonuclease vsr; KEGG: ppw:PputW619_0683 DNA
FT                   mismatch endonuclease Vsr"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98913"
FT                   /db_xref="GOA:B3Q989"
FT                   /db_xref="InterPro:IPR004603"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q989"
FT                   /protein_id="ACE98913.1"
FT                   /translation="MTSPGFEKPTDPARSALMRRVRQTGTKAEDEVAAILRQSGLRFRR
FT                   NVKSLPGSPDFANKTNQWAIFVHGCFWHRHEGCPRTTTPTRNRDFWLAKFAANVNRDTI
FT                   KARLLRAMGFKVLTIWECETRNPSNVRRRLQRLR"
FT   gene            374082..374903
FT                   /locus_tag="Rpal_0354"
FT   CDS_pept        374082..374903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0354"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_3444 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98914"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q990"
FT                   /protein_id="ACE98914.1"
FT                   /translation="MAKNKKIARKFATDQANLLENSIRRELDWAGDRSVVEKGSATDKK
FT                   NYAEGLSRALSQRFADALRKSFDGILPDVDGFGQESKARTGKGLKKLDVNYSTVELGLG
FT                   LGVSIKTINFRDAKTKRYTKNYTRVDNELRAEAADYHERQPYAVLCAVVFIPLDACDDG
FT                   GSAPSSFGQAVQIFRYRAGRERPVDDATLFERILVGLYDAGSPCFGTTGFFDVMDAPPR
FT                   TGRPSALMTFEQAIDKIVEAYDARNKSAFKWAEGETEILAAPEAEDDEDET"
FT   gene            complement(374910..376721)
FT                   /locus_tag="Rpal_0355"
FT   CDS_pept        complement(374910..376721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0355"
FT                   /product="GTP-binding protein LepA"
FT                   /note="TIGRFAM: small GTP-binding protein; GTP-binding
FT                   protein LepA; PFAM: elongation factor G domain protein;
FT                   protein synthesis factor GTP-binding; elongation factor Tu
FT                   domain 2 protein; GTP-binding protein LepA domain protein;
FT                   KEGG: bja:blr8150 GTP-binding protein LepA"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98915"
FT                   /db_xref="GOA:B3Q991"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006297"
FT                   /db_xref="InterPro:IPR013842"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035654"
FT                   /db_xref="InterPro:IPR038363"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3Q991"
FT                   /protein_id="ACE98915.1"
FT                   /translation="MTTAPIDNIRNFSIVAHIDHGKSTLADRLIQITGGMSDREMAGKE
FT                   QVLDSMDIERERGITIKAQTVRLKYRAHDGKDYIFNLMDTPGHVDFAYEVSRSLAACEG
FT                   SLLVVDASQGVEAQTLANVYHALDAGHEIVPVLNKVDLPAAEPEKIKQQIEDVIGLDAS
FT                   DAVMISAKTGLGVPDVLEAIVTRLPPPKGDRDATLKALLVDSWYDVYLGVVVLVRVVDG
FT                   VLKKGQRIRMMGTGAAYDVERVGYFTPKMVNVEELGPGEVGFITAAIKEVADTRVGDTI
FT                   TDDKKPVTDMLPGFKPAIPVVFCGLFPVDADDFETLRAAMGKLRLNDASFSFEMETSAA
FT                   LGFGFRCGFLGLLHLEIIQERLSREFDLDLIATAPSVIYKMKLTDGTEMEIHNPVDMPD
FT                   VVKIAEIEEPWIEATILTPDEYLGSVLKLCQDRRGNQKELTYVGARAMVKYDLPLNEVV
FT                   FDFYDRLKSVSKGYASFDYHLTDYKPADLVKMQILVNAEPVDALSMLVHRTRAEGRGRA
FT                   MVEKMKELIPPHMFQIPIQAAIGGKVIARETVRALRKDVTAKCYGGDITRKRKLLEKQK
FT                   EGKKKMRQFGKVDIPQEAFIAALKVDS"
FT   gene            376866..378404
FT                   /locus_tag="Rpal_0356"
FT   CDS_pept        376866..378404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0356"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bra:BRADO0839 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98916"
FT                   /db_xref="GOA:B3Q992"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q992"
FT                   /protein_id="ACE98916.1"
FT                   /translation="MSPRSTPRRPFAPLTRWLDALLDPKRQELTVIWTLLAYMAVWTAY
FT                   RIIATWPRDLHADETELYGWSRHLALGTDKHPPFSAWVARAWFTLVPPSDLSVHLLATA
FT                   NIALTLYIAWRTMRRYMDAEKSLFGLALLTLIPFFNFIALKYNANAVLLPLWALTIHCF
FT                   LRALESRAVLWGALAGVFAGASMLGKYWSIVLVVALGLAALIDPRRGRFFASPAPWLMI
FT                   LCGGLVLGPHVWWLADHGFPTLAYAAAHESADLADNLRDTLTYLPGAVAYAAVALITAA
FT                   VVLRPSRAALADIAWPAGSERRTILLIQLLLIVAPMPVALATGIRIVPLWAMPAYTLLP
FT                   IVLLASPLIAVGRDAVRRCLIVASAVSLGSLALSPVVALVIHLSDPPGPFEYASLLADH
FT                   VDREWRRNIDEPVPLVAGETVLAENTAFYLRTDTLGFETADLAALKQRAAARGAILVCP
FT                   ADDKGCIATAEQIIAGQPQILRGKVWLSRPLFGQPGGRVSDVFFLVLPTERSAK"
FT   gene            complement(378456..378788)
FT                   /locus_tag="Rpal_0357"
FT   CDS_pept        complement(378456..378788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0357"
FT                   /product="Phosphotransferase system, phosphocarrier protein
FT                   HPr"
FT                   /note="TIGRFAM: phosphocarrier, HPr family; PFAM:
FT                   phosphocarrier HPr protein; KEGG: nha:Nham_0439 HPrNtr"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98917"
FT                   /db_xref="GOA:B3Q993"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q993"
FT                   /protein_id="ACE98917.1"
FT                   /translation="MTIDAPQPGSGPDQASGASGDKISREIPVINKRGLHARASAKFVQ
FT                   MAERFNAEVWVTRNGETVGGTSIMGLMMLAAGIGTTVTVSASGPEARQALDAITELMGS
FT                   KFGEEE"
FT   gene            complement(378785..379186)
FT                   /locus_tag="Rpal_0358"
FT   CDS_pept        complement(378785..379186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0358"
FT                   /product="PTS system fructose subfamily IIA component"
FT                   /note="PFAM: PTS system fructose subfamily IIA component;
FT                   KEGG: nha:Nham_0440 PTS system fructose subfamily IIA
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98918"
FT                   /db_xref="GOA:B3Q994"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR033887"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q994"
FT                   /protein_id="ACE98918.1"
FT                   /translation="MIGLVLVTHGRLADEFKAALEHVMGPQQQIEAVTIGAEDDADLCR
FT                   SDIIEAVNRVDSGEGVAILTDMFGGTPSNLAISCMSRPKVEVLAGINLPMLVKLAKVRE
FT                   ERSLPEAIALAQEAGRKYVTIASRVLAGK"
FT   gene            complement(379374..379841)
FT                   /locus_tag="Rpal_0359"
FT   CDS_pept        complement(379374..379841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0359"
FT                   /product="HPr kinase"
FT                   /note="KEGG: nha:Nham_0441 HPr kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98919"
FT                   /db_xref="GOA:B3Q995"
FT                   /db_xref="InterPro:IPR011104"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q995"
FT                   /protein_id="ACE98919.1"
FT                   /translation="MTEAMPRTVHASAVKVGDLAVVIRGPSGSGKSRLAWALILAGRAG
FT                   QIPRAELIGDDRVFMEPEQGRLTVRQVPELAGLIEIRGLGVRQTASVAAATVGLVVDLG
FT                   AADASRMPETAALRTEIGGVQLPRVPVAAGYDPLPLVAAALTTTGMAEEEA"
FT   gene            complement(379838..381583)
FT                   /locus_tag="Rpal_0360"
FT   CDS_pept        complement(379838..381583)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0360"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; KEGG: nha:Nham_0442 periplasmic
FT                   sensor signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98920"
FT                   /db_xref="GOA:B3Q996"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR025908"
FT                   /db_xref="InterPro:IPR025919"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q996"
FT                   /protein_id="ACE98920.1"
FT                   /translation="MRDETPVHGRRWPRPLDWVRRTGQFFFTLSFSSLTRRILSLNLAG
FT                   LMALSASILYLSQFRAGLIDARAQSLLVQAEIIAGAIAASATVETNTITIDPDRLLDLK
FT                   PGESYGPPDEYAVLDFPINPERVAPVLRRLISPTKTRARIYDRDGVLILDSRSLYGRGD
FT                   VMRFELPPPTAEKPGIVERAMIAIRTWFNRGDLPLYRELGPENGNGYQEVAQSLKGQKS
FT                   SMVRINDRGEVIVSVSVPVQRFRAIYGSLMLSTQGDDIDQMVTAERLAILKVFGVAAVV
FT                   MFVLSVLLASTIAGPVRRLADAAERVRRRIRARVEIPDFTRRRDEIGHLSGALRDMTDS
FT                   LYNRIEAIERFAADVSHELKNPLTSLRSAVETLPLAKTDNSRARLLSVIEHDVKRLDRL
FT                   ISDISDASRLDAELQRQDAAQVDLRRLLTTLTLVANETRLGHNALVEVKFDGPAADQFP
FT                   VPGHDSRLGQVISNLLSNAQSFSREGGKVRILCRRRKAEIEIIVEDEGPGIRDDALEKI
FT                   FERFYTDRPHQGFGQNSGLGLSISKQIVEAHGGKIWAENRVGPRGEDGEPTIAGARFIV
FT                   RLPAT"
FT   gene            complement(381746..382447)
FT                   /locus_tag="Rpal_0361"
FT   CDS_pept        complement(381746..382447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0361"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: bja:blr8144 two-component
FT                   response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98921"
FT                   /db_xref="GOA:B3Q997"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q997"
FT                   /protein_id="ACE98921.1"
FT                   /translation="MPTIALVDDDRNILTSVSIALEAEGYRIMTYTDGASALDGFRTTP
FT                   PDLAILDIKMPRMDGMETLRRLRQKSDLPVIFLTSKDEEIDELFGLKMGADDFIRKPFS
FT                   QRLLVERVKAVLRRSAPKDPAAAPKENDAKALDRGPLRMDPERHTCTWKNEPVTLTVTE
FT                   FLILQALATRPGVVKSRNALMDAAYDDQVYVDDRTIDSHIKRLRKKFKAVDDEFEMIET
FT                   LYGVGYRFKEI"
FT   gene            382681..383415
FT                   /locus_tag="Rpal_0362"
FT   CDS_pept        382681..383415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0362"
FT                   /product="pyridoxamine 5'-phosphate oxidase-related
FT                   FMN-binding"
FT                   /note="PFAM: pyridoxamine 5'-phosphate oxidase-related
FT                   FMN-binding; KEGG: bja:bll8143 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98922"
FT                   /db_xref="GOA:B3Q998"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR019595"
FT                   /db_xref="InterPro:IPR037119"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q998"
FT                   /protein_id="ACE98922.1"
FT                   /translation="MQPTPDFSAPKLAKTLLRRRREGALATLMENGGAPYCSLVNLASH
FT                   PDGSPLLLISRLAIHTRNVLADPRVSLMLDERSAGDPLEGARIMLAGRAVLARPDELPL
FT                   WRRRYLAAHPAAEGYIDFADFSLFKIESSGLHLVAGFGRILDLSPDRYLTDLTGAEALL
FT                   EVEASAVEHINADHPDTMKLYATQLLGSGEADWRCTGIDPEGLDLQCERATLRLDFPSR
FT                   VENSAALRDMLKRMADIARKTE"
FT   gene            383604..385217
FT                   /locus_tag="Rpal_0363"
FT   CDS_pept        383604..385217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0363"
FT                   /product="Phosphoenolpyruvate carboxykinase (ATP)"
FT                   /EC_number="4.1.1.49"
FT                   /note="PFAM: phosphoenolpyruvate carboxykinase (ATP); KEGG:
FT                   bbt:BBta_7365 phosphoenolpyruvate carboxykinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98923"
FT                   /db_xref="GOA:B3Q999"
FT                   /db_xref="InterPro:IPR001272"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="InterPro:IPR015994"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3Q999"
FT                   /protein_id="ACE98923.1"
FT                   /translation="MQETGVHNGAYGTDKFGLKNLKGVYWNFGAPQLYEHALKNGEAVL
FT                   SSDGALVADTGVFTGRSPKDKFTVRDATTENTMWWGGNQSITAEQFETLYQDFLKHAEG
FT                   MTLFAQDLYGGADPTFRIKTRVYTELAWHSLFIRTLLRRPERAELENFVPELTLIDLPS
FT                   FRADPKRHGCRSENVVAIDFARKIVLIGGTQYAGEMKKSVFTTLNYYLPEKGVLPMHCS
FT                   ANVGPNGDTAIFFGLSGTGKTTLSADPNRTLIGDDEHGWGKDGVFNFEGGCYAKCIKLS
FT                   AENEPEIYAASTRFGAVLENVVLGEIDRKPDFDDGSKTENTRSAYPLESIPNASLTGRA
FT                   GQPKNVVMLAADAFGVMPPIAKLTPAQAMYHFLSGYTAKVAGTERGVTEPTPEFSTCFG
FT                   SPFLPRDPSVYGNMLRELIAKHNVDCWLVNTGWTGGIYGTGHRMPIKVTRALLTAALDG
FT                   SLRNVEFRTDPYFGFAVPTALPGVPSEILDPVKTWADKAAFDTTARKLVGMFQKNFAKF
FT                   EAQVDAEVRAAAPDVKMAAE"
FT   gene            385465..388350
FT                   /locus_tag="Rpal_0364"
FT   CDS_pept        385465..388350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0364"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sbn:Sbal195_0330 RNA binding S1 domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98924"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q9A0"
FT                   /protein_id="ACE98924.1"
FT                   /translation="MLVSLEVFFRKLLIERAEIDLVSIENLSDTLIQQSSITSLLQIKR
FT                   TLNATTLADAIREAYEIAILADQCLDERIRFQIACELKETELSIYQLDASRIFRKGESF
FT                   DVKQLSRTRALFDPNAPIVVIADPVLALYRTFWLAGVPDPASLATRCLGTLFKAFDGHH
FT                   RENVEHALYDLIEVVKGATRNHHHNAGLGRILTATNFQIAQQPSLAREPLIGRRPRVAD
FT                   FVADRFKNRSGLLAGVERAANDWLSSLPIAPDDDDGILHIFWIEGRAGDGKSVLLLQLV
FT                   SRLLSGKLSFITELANRKEIESWLRDVPVWDDVAKARGAFPSVAFIDDLHEKIEKDELE
FT                   SLVSEVFYRGTRTAAILTCGPSLDLSSFSESISRFRIKSFKVPSLSLSDREEFTAWYES
FT                   RTGQLAKPVGESRSWLLVEWLLQISRGNLEHEFADNFRRSLERQGLLEIATTVAAVNTL
FT                   SVGAPETLLTTVNERIGFDAVSSQGAQHFELRKDEDEVGLFLTHPALTWPLFRAWTKKD
FT                   GVGLAAVWGARIGVALSHFLNADQPGAARFVLGQLLDAGTFRARFQCKTFSEQIRLART
FT                   TLESAYETLEQRHALAAQAPVMALWLAAQKLQRLKAHSAVGLRALAATLLRSERHETRF
FT                   RSEIAVALLSLNIVEDDAEKQAQTWLIENSECSQHVIGSLESLARKDEARLKFHFFMGW
FT                   LRTRTTDARAFRVFVAAIERYPQTEAHAISLEFVRNNSGAEAGCVLLALARSGMDRQAL
FT                   GPAATLWINTTSDKRIVPKLLCLLLRQGVARLYRRSALRWLAANPGVPWVEEVIKLLLA
FT                   HDPQEKLLVDAVELWLSLHKETMQAAQILRVLVKNRACRSRWLAAAKDHVLATQGPIRI
FT                   PVLASLLSSIPSTEDVLLALDLIEADPTSSESRFLFSQLAIGVKKLSNEKIQRLRRQCR
FT                   PECDQRLRRAIEWSPKGGASKRRSRQASPRN"
FT   gene            complement(388605..389480)
FT                   /locus_tag="Rpal_0365"
FT   CDS_pept        complement(388605..389480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0365"
FT                   /product="conserved hypothetical secreted protein"
FT                   /note="KEGG: azo:azo3831 conserved hypothetical secreted
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98925"
FT                   /db_xref="InterPro:IPR009097"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q9A1"
FT                   /protein_id="ACE98925.1"
FT                   /translation="MRNTLLTSITSVLLAVAVSAGVAAAADGTIDNSALSKSEFRDHAR
FT                   TFGLVYTLPKNVNDVLDSTIRGPLKEKLLNAKLDTEAQMFNIPHVTVVHVHSADPATPE
FT                   KMLAAMPKLPPVLTVKLKTFYTTEAAKGAGRPWWFDLGLVKEGKSFDDMMAFNTTATAA
FT                   LTPLRDGPLPRCTGPVYAAMGDAAKDLVRTVGVSGVNVVKDGKELRSHNPHTTLVYSMA
FT                   KFTPELQAQMNQAAKEFNQILPDGVDATFKTVSIVELGFAGNVLREVYRISLDDGSVTT
FT                   IATGKTASLK"
FT   sig_peptide     complement(389403..389480)
FT                   /locus_tag="Rpal_0365"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.965 at
FT                   residue 26"
FT   gene            389770..390645
FT                   /locus_tag="Rpal_0366"
FT   CDS_pept        389770..390645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0366"
FT                   /product="Beta-lactamase"
FT                   /EC_number="3.5.2.6"
FT                   /note="PFAM: beta-lactamase; KEGG: nha:Nham_0446
FT                   beta-lactamase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98926"
FT                   /db_xref="GOA:B3Q9A2"
FT                   /db_xref="InterPro:IPR000871"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023650"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q9A2"
FT                   /protein_id="ACE98926.1"
FT                   /translation="MIDRRELMKAATGLAGLGLFGSSAALAADALADMCARLEAGSGGR
FT                   LGVGVLDTASGRMIGHRLDERFPMCSTFKVLAAGLVLARVDRKQEKLDRRVSYAKSNLV
FT                   TYSPATEKHVEDGMTIAELCEAAITLSDNTAANLLLASFGGPAGLTAFARSLGDETTRL
FT                   DRIETELNEALPGDPRDTTSPRAMAQDLRALTLGDALSPASRAQLITWLKANTTGGTRL
FT                   RAGVPPGWTVGDKTGTGSRGTANDIAVLWPPQRAPLIVTVYLTGATVVRDQQNKIIADV
FT                   GAAVADAMRG"
FT   sig_peptide     389770..389853
FT                   /locus_tag="Rpal_0366"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 28"
FT   gene            complement(390670..391788)
FT                   /locus_tag="Rpal_0367"
FT   CDS_pept        complement(390670..391788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0367"
FT                   /product="Endonuclease/exonuclease/phosphatase"
FT                   /note="PFAM: Endonuclease/exonuclease/phosphatase; KEGG:
FT                   mmr:Mmar10_0829 endonuclease/exonuclease/phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98927"
FT                   /db_xref="GOA:B3Q9A3"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q9A3"
FT                   /protein_id="ACE98927.1"
FT                   /translation="MDYTGLRRMSDADRGRLISTLTGLRTGLRRLPAKDPGNFLLATWN
FT                   IREFGGTKYRGRIPDALYCIAECISRFDLVAVQEVRQDLVALKQVVRILGRDWDYIYND
FT                   VSLADGGNGERLAFLFNRSRVRFTGLAGELVLPSKSASKLVAQIARTPFICGFQSGWAK
FT                   FNLCTVHIYYGEGKKDDPKRIEEIEKTAKLLADKAKSYINLDDPVDYSPENLVLLGDFN
FT                   IFGREDATFQALTKNRFVIPEPLLRQKGSNVSEDKFYDQIAFFKETRGIECSNAGVFNF
FT                   YQYAFNDPKLYKGVMPASAAFNTWRTFQMSDHLIMWTEFNVDKTDAYLKTLMREQASAP
FT                   KGGTKKAATKKTAKTAVKKTTAKTKAAKKKAA"
FT   gene            complement(391867..392670)
FT                   /locus_tag="Rpal_0368"
FT   CDS_pept        complement(391867..392670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0368"
FT                   /product="protein of unknown function DUF81"
FT                   /note="PFAM: protein of unknown function DUF81; KEGG:
FT                   xau:Xaut_2893 protein of unknown function DUF81"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98928"
FT                   /db_xref="GOA:B3Q9A4"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q9A4"
FT                   /protein_id="ACE98928.1"
FT                   /translation="MLPNIPFTDLATVASGALVGFILALIGGGGSVLAVPLLVYVVGVR
FT                   SPHMAIGTSSIAVAISALANMLSHWAAGNVRWACAIVFSAAGIGGAFAGATIAKQIDGQ
FT                   KLLILFGLLMIVIGALMSRKNRGGGDPAVRLTRDTARAMLPRLIGTGFGVGLLAGFFGI
FT                   GGGFLIVPGLILATGMPLTSAIGTSLVAVVAFGASTATSYALSGLIDWRLAGNFIGGGL
FT                   IGGLIGIGTGKLIGGHDKVLRSVFSVVVIAVGLYVCYRGAMYFLT"
FT   sig_peptide     complement(392566..392670)
FT                   /locus_tag="Rpal_0368"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.988) with cleavage site probability 0.984 at
FT                   residue 35"
FT   gene            392764..393660
FT                   /locus_tag="Rpal_0369"
FT   CDS_pept        392764..393660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0369"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   pla:Plav_1618 beta-lactamase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98929"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q9A5"
FT                   /protein_id="ACE98929.1"
FT                   /translation="MTSPSSPAIRAFFDEPTNTVSYLVSDPASGRAAVIDPVLDYDHGD
FT                   GSVDVRSVETILEAARADGLTIDWVLETHAHADHLSGAPYIKAKASARVGIGEHIKDVQ
FT                   KIFRPLFNADDLRTDGSDFDHLFKDGERFMIGGLTVEVMHTPGHTPADIAYRIADAVFV
FT                   GDTLFMPDYGTARADFPGGDAHQLYRSIQKLLALPPQTRLFMCHDYKAPGRDVYAWETT
FT                   VQAERDGNVHLRGGVSEEDFVAMRTKRDATLKAPTLLLPSIQVNIRAGRFPKAQHNGVR
FT                   YLLLPVRPRPGAEAGIS"
FT   gene            393759..394121
FT                   /locus_tag="Rpal_0370"
FT   CDS_pept        393759..394121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0370"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bbt:BBta_5525 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98930"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q9A6"
FT                   /protein_id="ACE98930.1"
FT                   /translation="MADIMSVLASGYSSAALQTPSKTKYVNVDPALYSGTWTGTYSNTK
FT                   KFSITVSDVQGFRAQVKYQSEGTVKYQSVLIKDGAFRIGDTKFALGKNDTASIRNVVTD
FT                   AATGQTQLVTGTAKRS"
FT   gene            complement(394333..395232)
FT                   /locus_tag="Rpal_0371"
FT   CDS_pept        complement(394333..395232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0371"
FT                   /product="RNA polymerase, sigma 32 subunit, RpoH"
FT                   /note="TIGRFAM: RNA polymerase sigma factor RpoH; RNA
FT                   polymerase sigma factor, sigma-70 family; PFAM: sigma-70
FT                   region 2 domain protein; sigma-70 region 4 domain protein;
FT                   KEGG: bja:blr7337 RNA polymerase factor sigma-32"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98931"
FT                   /db_xref="GOA:B3Q9A7"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR012759"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q9A7"
FT                   /protein_id="ACE98931.1"
FT                   /translation="MARAATLPILNGESGLARYLAEIRKFPMLEPQQEYMLAKRWREHG
FT                   DRDAAHQLVTSHLRLVAKIAMGYRGYGLPISEVVSEGNVGLMQAVKRFEPEKGFRLATY
FT                   AMWWIKASIQEYILRSWSLVKMGTTANQKKLFFNLRKAKSKISALDEGDLHPDQVKLIA
FT                   TRLGVTEQDVVDMNRRLGGDASLNAPIRDDGEPGEWQDWLVDQSPSQEAVMAEHEELDQ
FT                   RRAALNGAIQVLNPRERRIFEARRLADEPMTLEDLASEFGVSRERVRQIEVRAFEKVQS
FT                   AVKGTIARQEQAALEAAH"
FT   gene            complement(395454..396458)
FT                   /locus_tag="Rpal_0372"
FT   CDS_pept        complement(395454..396458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0372"
FT                   /product="pseudouridine synthase, RluA family"
FT                   /EC_number="3.2.1.17"
FT                   /note="KEGG: bja:blr7336 pseudouridine synthase homolog;
FT                   TIGRFAM: pseudouridine synthase, RluA family; PFAM:
FT                   RNA-binding S4 domain protein; pseudouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98932"
FT                   /db_xref="GOA:B3Q9A8"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q9A8"
FT                   /protein_id="ACE98932.1"
FT                   /translation="MGETPENPVNVVVAGDEGSQRLDRVLAARCPELSRSRLKALILDG
FT                   RVAIAGTPVRDPAYHASPGETITIDVPPPVPAEPAGEAIALDIVYEDADIIVLNKPRGL
FT                   VVHPAAGHETGTLVNALIAHCGASLSGIGGVRRPGIVHRLDKDTTGLMVAAKNDKAHQS
FT                   LSAQFADHGRTGELRRGYLAFVWGVPGRKYGTIDAPIDRHPHAREKMAVRQGGREAITH
FT                   WEVLENFAGKDGKPVAALIACQLETGRTHQIRVHLAHLGHPLLGDDVYGPHFKTKANQL
FT                   APAGRAALAGLGRQALHAYLLTLEHPSTGEVLTWESPLPADLAHLQAALTATE"
FT   gene            396501..396836
FT                   /locus_tag="Rpal_0373"
FT   CDS_pept        396501..396836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0373"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bja:bll7335 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98933"
FT                   /db_xref="GOA:B3Q9A9"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q9A9"
FT                   /protein_id="ACE98933.1"
FT                   /translation="MTDTATPDPTPEQAALFARVRRMMLIAGLTTTLAVAAVLIAIGYK
FT                   LFRAEGSAPAATEHTLRLPKGARVVSTASAGDYVVVTLDIGGATELRTFEAKTLKPTGR
FT                   LTFATEP"
FT   gene            397100..397174
FT                   /locus_tag="Rpal_R0006"
FT                   /note="tRNA-Glu1"
FT   tRNA            397100..397174
FT                   /locus_tag="Rpal_R0006"
FT                   /product="tRNA-Glu"
FT   gene            complement(397224..399746)
FT                   /locus_tag="Rpal_0374"
FT   CDS_pept        complement(397224..399746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0374"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC sensor(s)"
FT                   /note="KEGG: pin:Ping_3328 response regulator receiver
FT                   modulated diguanylate cyclase/phosphodiesterase; TIGRFAM:
FT                   PAS sensor protein; diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; EAL domain protein; PAS fold-3 domain
FT                   protein; SMART: PAC repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98934"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q9B0"
FT                   /protein_id="ACE98934.1"
FT                   /translation="MAVRGVSLRQPYPREPRGWHQEWSLRRAMRMARAAYWESYSAAAT
FT                   DFWMSAEFTSLYDAETPDDSVPLAPARDHDLTESHAILQDHYAACWTEGRPFAVETKLI
FT                   KPDGRLLDCVVHGEPEFDANGQVQRVFGIVRDATPETSALRQLAVSEQRLADFVSTASD
FT                   WCWESGPDHRLLPYPKSLDGNAALQTVASGGKARWELAYAPDEEGSMALHRDDMEAHRP
FT                   FRDFIYTSIGNDGSRIIISTSGKPIFADDGTFLGYRGTASDITQLAAARTLLDQRTGAL
FT                   EEAHRLGRIGTWTHRLDTGRTVWSPELYQLLGLEPDAFEPTYEGTEPYFLDDDAVRLLK
FT                   IQKRVLRTSTTEATDIRILHTDGAPRDLAIICKAEISNGRVIGLIGTAQDVTDRKEAER
FT                   RLEQLAYTDPLTGLANRALYKRKLADLFENPMAEHGQNALYLIDLDRFKEVNDSLGHST
FT                   GDSLLIHVAGVLRQELGPQAFIARIGGDEFAVLTNSPNTSVEATTALADRLIAKLSVPV
FT                   ELAEGEACIGATIGIAILPEHGATAEKASRNADLALYMAKEAGRGRAQLFEPMYAEAVD
FT                   QKLDLGRRLRHAVDSGGLNTHYQPQIDLKTGRVIGFEALLRWSHPERGPISPAEFIPIA
FT                   ETTGLIVDLGHWVLRDACKQMRGWLDAGLPARTISVNVSPAQIWNGDFEKVVATVLADT
FT                   GLPPELLCLELTENLFVDHTKQKVSTTLAALSKLGIQLALDDFGSGYSSLGYLTRLPFN
FT                   RLKIDRTFVEGIATVPEKCKLLGGIIALAHGLGMSVVAEGAELAAEVDLLTAFDCDFVQ
FT                   GYVFSRPVAADQAPVVAAEIERGAGSNN"
FT   gene            complement(399947..401131)
FT                   /locus_tag="Rpal_0375"
FT   CDS_pept        complement(399947..401131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0375"
FT                   /product="methionine gamma-lyase"
FT                   /EC_number="4.4.1.11"
FT                   /note="KEGG: mgm:Mmc1_0771 methionine gamma-lyase; TIGRFAM:
FT                   methionine gamma-lyase; PFAM: Cys/Met metabolism
FT                   pyridoxal-phosphate-dependent protein; aromatic amino acid
FT                   beta-eliminating lyase/threonine aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98935"
FT                   /db_xref="GOA:B3Q9B1"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006237"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q9B1"
FT                   /protein_id="ACE98935.1"
FT                   /translation="MTESSHSPGFATTAIHHGYDPLAHHGALNPPLFLTSTYAFASAAE
FT                   GAARFAGEAEGFVYSRVGNPTVAVLESRLAALEGGEAALATASGVGALTALIWTLLKTG
FT                   DGIIADQMLYGCTFGLFEHHLPRFGIEVVFADLTDPANLQAALRPNTRLVFTETPTNPN
FT                   MRLVDIAACAEICRRADVRLVVDNTYCTPYLQRPLDLGADLVTHSATKYLGGHGDLLAG
FT                   AVVGPKEIIDQLRFVGVKELNGACISAFDAFLILRGLKTLNLRMDRHSATAVKLAHDLE
FT                   AHPAVAAVYYPGLDSHKQRNLAQRQMRQPGGMIALELRGGLAAGRSFMDKVKLATRAVS
FT                   LGDAETLIQHPASMTHATYDPAERARHGFTDGLIRISVGLEDYEDLKHDLLGAL"
FT   gene            401242..401727
FT                   /locus_tag="Rpal_0376"
FT   CDS_pept        401242..401727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0376"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="PFAM: regulatory protein AsnC/Lrp family; KEGG:
FT                   oan:Oant_0505 putative transcriptional regulator, AsnC
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98936"
FT                   /db_xref="GOA:B3Q9B2"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q9B2"
FT                   /protein_id="ACE98936.1"
FT                   /translation="MVNPAKITLDAIDLKILAELQADARIPNIVLAQKVGLSPSPCSRR
FT                   VKLLEQAGVLASYRALVDRAAVGLAVTAFAFIRVERHSRDNAESFIEAVQTMPEVIACH
FT                   LVSGDSDFLLEVVVPDIASYETTVLRGLLALPTVRDIRTSFAMRSYKLSGPLPLPAA"
FT   gene            complement(401728..402165)
FT                   /locus_tag="Rpal_0377"
FT   CDS_pept        complement(401728..402165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0377"
FT                   /product="thioredoxin"
FT                   /note="TIGRFAM: thioredoxin; PFAM: Redoxin domain protein;
FT                   Thioredoxin domain; KEGG: mlo:mll6589 thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98937"
FT                   /db_xref="GOA:B3Q9B3"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q9B3"
FT                   /protein_id="ACE98937.1"
FT                   /translation="MSDHLVVCTHCGGVNRLPEQRPALDGKCGKCGHRLFEGHPADVSG
FT                   DQFDKQVSRSSVPVLVDVWAPWCGPCRAMAPAYEQAARELEPNVRLIKLNSDNEQQVAG
FT                   RLGIQGIPTMILFDNGRERARTSGAMPAGEIVRWVRQHLPA"
FT   gene            complement(402305..403288)
FT                   /locus_tag="Rpal_0378"
FT   CDS_pept        complement(402305..403288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0378"
FT                   /product="zinc-binding alcohol dehydrogenase family
FT                   protein"
FT                   /note="TIGRFAM: zinc-binding alcohol dehydrogenase family
FT                   protein; PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   bja:blr6070 putative alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98938"
FT                   /db_xref="GOA:B3Q9B4"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014187"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q9B4"
FT                   /protein_id="ACE98938.1"
FT                   /translation="MDAMVLTAPGTSLQWQSRDTPQPGDGEVLVTVSACGVCRTDLHVV
FT                   DGELPNIRYPIIPGHEIVGRVAAVGAGVTTHQIGDRVGIPWLGHTCGLCRYCRSGMENL
FT                   CDAPLFTGYTRDGGFASHAIADARYAFPLGEAGDDVAIAPLLCAGLIGWRSLAIAGDAE
FT                   RLGIYGFGAAGHIVAQVARWQGRQVYAFTRGGDVAAQDFARSLGAMWAGASEELPPEPL
FT                   DAAIIYAPVGSLVPAALKAVRKGGRVVCAGIHMSDIPSFPYDLLWEERQLVSVANLTRQ
FT                   DGVDFLEVAQQAGIRTETHAFPLREANTVLNKLRAGELLGAAVLVP"
FT   gene            complement(403362..403583)
FT                   /locus_tag="Rpal_0379"
FT   CDS_pept        complement(403362..403583)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0379"
FT                   /product="ChaB family protein"
FT                   /note="PFAM: ChaB family protein; KEGG: tcx:Tcr_2071 ChaB"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98939"
FT                   /db_xref="InterPro:IPR009317"
FT                   /db_xref="InterPro:IPR037205"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q9B5"
FT                   /protein_id="ACE98939.1"
FT                   /translation="MPYASTDDLAPGLQVRLPLHAQEIYIAAFNNAFAEYQDRGPEEQE
FT                   ATAHRVAWAAVKKLYRKQGENWVARERS"
FT   gene            403814..404536
FT                   /locus_tag="Rpal_0380"
FT   CDS_pept        403814..404536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0380"
FT                   /product="protein-L-isoaspartate O-methyltransferase"
FT                   /EC_number="2.1.1.77"
FT                   /note="KEGG: nha:Nham_1929 protein-L-isoaspartate
FT                   O-methyltransferase; TIGRFAM: protein-L-isoaspartate
FT                   O-methyltransferase; PFAM:
FT                   protein-L-isoaspartate(D-aspartate) O-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98940"
FT                   /db_xref="GOA:B3Q9B6"
FT                   /db_xref="InterPro:IPR000682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q9B6"
FT                   /protein_id="ACE98940.1"
FT                   /translation="MTSPASDLPPLSGRSFAVLRELMVERQIAARGLHDPRVLAAMRKV
FT                   PREAFLPEPMRDLAYEDAPVPIAAEQTMSQPYIVALMVEALLLQGSDNVLEIGAGSGYA
FT                   AAVLGEIAGHVTTVERIATLADAAAAKLAELGYGHVDVHRSDGTRGWAAAAPYDAIVVA
FT                   AGGPQVPESLKAQLKIGGRLVMPVGANQQAQELVRLTRLGEADFKREHLGDVRFVPLLG
FT                   SEGWQQPEPAGRTAREKG"
FT   gene            404689..405513
FT                   /locus_tag="Rpal_0381"
FT   CDS_pept        404689..405513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0381"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein; KEGG: nha:Nham_1926 UspA"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98941"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q9B7"
FT                   /protein_id="ACE98941.1"
FT                   /translation="MIKDLIVNLERSKDRQQITDIALGVAELFGAHVAGCCFAYDSLPS
FT                   FTMPDFPSDLLSKMLAASEEAARAAVAQFETACKREGVSAEHHLLETAYGTSGRFPKMA
FT                   RRFDLSVIMQSDAENGDNDILIEQVLFDSGRPLLIVPYIQKTPVKLDRVICCWDGSRAA
FT                   TRAINDAKPFLRRAGQVELVIVRDHKVRDPNELRGIEMANHLARYDVKVDIKTITAPDI
FT                   GVSGTILSHVADTSADLLVMGGYGHSRLREFVLGGVTREMLTSMTVPVLMSH"
FT   gene            complement(405710..406990)
FT                   /locus_tag="Rpal_0382"
FT   CDS_pept        complement(405710..406990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0382"
FT                   /product="glycoside hydrolase family 4"
FT                   /note="PFAM: glycoside hydrolase family 4; KEGG:
FT                   bra:BRADO2867 putative alpha-galactosidase (melibiase)"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98942"
FT                   /db_xref="GOA:B3Q9B8"
FT                   /db_xref="InterPro:IPR001088"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR022616"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q9B8"
FT                   /protein_id="ACE98942.1"
FT                   /translation="MTNTTKIVFLGASSASFGLSMFRDLFASPVLAGSTLTLVGRNAET
FT                   LGRMTELAKLMNARSGAGLIIEQTTDRHAALDGAGFVINATAIDRNRLWKQDFEVPKKH
FT                   GIRHTLGENGGPGGLFFTLRTLPLVFDFIRDIEELCPNALFLNYSNPESRIILALGRYT
FT                   KVRHIGLCHGIFMGRDAVAYIMQMPREEIEVWGAGLNHFQCLTEIRHRDTGEDLYPRFR
FT                   AAEQSFDPDAWRFTRRLYRAFGYWLTCSDDHLGEYLPYGWEAGEKGYDFDQDERWRGEF
FT                   LTQLNGVLGGTMPIPRWWTEPSGERGAAVIAAMLHNQKRFIESGIVLNRGVIPNLPAEL
FT                   AVEVPVTVDAAGVHPVSLGPLPDPIAKLMLMQASVQQLAVEAAVHASKELALQALLIDP
FT                   VVNSAVAAEKILDELWEINRPYIRKCV"
FT   sig_peptide     complement(406892..406990)
FT                   /locus_tag="Rpal_0382"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.712 at
FT                   residue 33"
FT   gene            407214..408152
FT                   /locus_tag="Rpal_0383"
FT   CDS_pept        407214..408152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0383"
FT                   /product="1-phosphofructokinase"
FT                   /EC_number="2.7.1.56"
FT                   /note="KEGG: bbt:BBta_6479 putative carbohydrate kinase
FT                   PfkB family; TIGRFAM: 1-phosphofructokinase; PFAM: PfkB
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98943"
FT                   /db_xref="GOA:B3Q9B9"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR017583"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q9B9"
FT                   /protein_id="ACE98943.1"
FT                   /translation="MVDIVTLTPNPAIDLSTSVERLVPSRKLRCAAQKRDPGGGGINVA
FT                   RVVQRLGGNVEAIFPAGGFTGKLLKLLLDEENVPNRIVEAVAETREDFSVSENATGEQF
FT                   RFVLPGLPLAEHEWRGILETLAATSPAPKIVIGSGSLPPGVPVDFYAQAAAVAKQIGAK
FT                   FFLDTSGKPLTAALAQGVTLIKPNLREMQELAGRPLGCEKEWVDAARAHITAGQVEIVA
FT                   LSLGHLGALLVTKDQALRSPALPVTPVSTVGAGDSFLAAIAHRLAQGGSVADAFRLGLA
FT                   AGSATLTVHGTQLCGPAEVERLYGQVIIEPI"
FT   gene            408267..410579
FT                   /locus_tag="Rpal_0384"
FT   CDS_pept        408267..410579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0384"
FT                   /product="oxidoreductase alpha (molybdopterin) subunit"
FT                   /note="TIGRFAM: oxidoreductase alpha (molybdopterin)
FT                   subunit; PFAM: molybdopterin oxidoreductase; molydopterin
FT                   dinucleotide-binding region; KEGG: bbt:BBta_3664 putative
FT                   oxidoreductase alpha (molybdopterin) subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98944"
FT                   /db_xref="GOA:B3Q9C0"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR010046"
FT                   /db_xref="InterPro:IPR037951"
FT                   /db_xref="InterPro:IPR041953"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q9C0"
FT                   /protein_id="ACE98944.1"
FT                   /translation="MSQDEARLQDTDIPDTADGTVTYDGPAGGWGSLQGISQIFGREWS
FT                   TPAAIETLMRQNKPKGFMCVSCSWAKPADHHTFEFCENGAKATLWELTSARCTPEFFAE
FT                   HSVTELRGWADYDLEMQGRLTEPMRYDATTDHYVPCSWDEAFQAIGEHLRSLDPKSVIF
FT                   YASGRASLETSYLYALFARLYGNNNLPDSSNMCHETTSVALKKLLGVGVGTVVFDDLAK
FT                   CDAMFFFGQNTGSNSPRFLHPLQEAAKRGVEIITFNPVREKGLESFVNPQNPAEMLTGR
FT                   ETRISSQYHQVKAGGDVAVLIGLCKHVFARDDEARREGRRVLDVDFIEAHTHGLDEFEA
FT                   KVRAISWDEIEHESGLSREAIESAGDVYVKAERVIGVYGMGLTQHAHGFLNVAMFVNLL
FT                   LLRGNIGRDGTGISPVRGHSNVQGQRTVGISEKPELVPLDKMAEQFGFDPPRDKGMNTV
FT                   EACHGLLEGKVRAFISLGGNFVRAIPERDAMEGAWTRMQLTVQIATKLNRSHLINGKAA
FT                   YLLPCLGRTEQDIQATGPQAVTMEDTFSCIQGSIGLRKPASEQLKSELAIVAGIAKATL
FT                   PDNPKLKWDDWVGDYGLVRDLIAESYPEMFHDFNDRMFTPGGFYKGNAARERIWKTESG
FT                   KAEFTTPDRLNSIGFDDAPGRYRLMTLRSNDQFNTTIYGMSDRLRGIEGRRDVLLINPD
FT                   EMARAGLSEGQEVWLEGDAGDGVHREAGPLQVTPFRLPDGCLGAYYPEMNSLMPVWHHD
FT                   GPSKTPAAKSVPVRIRT"
FT   gene            410851..412113
FT                   /locus_tag="Rpal_0385"
FT   CDS_pept        410851..412113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0385"
FT                   /product="glucose-1-phosphate adenylyltransferase"
FT                   /note="TIGRFAM: glucose-1-phosphate adenylyltransferase;
FT                   PFAM: Nucleotidyl transferase; KEGG: bja:blr6458
FT                   glucose-1-phosphate adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98945"
FT                   /db_xref="GOA:B3Q9C1"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005836"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR011831"
FT                   /db_xref="InterPro:IPR023049"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3Q9C1"
FT                   /protein_id="ACE98945.1"
FT                   /translation="MSQGVTAPFARHAMAYVLAGGRGSRLMELTDWRAKPAVYFGGKSR
FT                   IIDFALSNALNSGIRRIAVATQYKAHSLIRHLQRGWNFFRPERNESFDILPASQRVSEE
FT                   MWYRGTADAVFQNIDIIESYDPKFIVLLAGDHVYKMDYEKMLQQHVEQGADVTVGCLEV
FT                   PRAEATAFGVMHTDTTDRIISFLEKPADPPAMPGKADKSLVSMGIYVFETKFLLDELRR
FT                   DAADPNSSHDFGKDIIPYIVKHGKAVAHHFDKSCRRSSSEAVSYWRDVGTVDAYWAANI
FT                   DLTDIVPELDLYDREWPIWTYGEITPPAKFVHDKEGRRGEAVSSLVSGGCIISGASLRH
FT                   SLLFTGVRVHSFSHVENTVVLPYADIGRSCRLKNVVIDAEVKLPAGLVVGEDPELDAKR
FT                   FRRTENGICLITRAMIEKLDA"
FT   gene            412110..413561
FT                   /locus_tag="Rpal_0386"
FT   CDS_pept        412110..413561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0386"
FT                   /product="glycogen/starch synthase, ADP-glucose type"
FT                   /note="TIGRFAM: glycogen/starch synthase, ADP-glucose type;
FT                   PFAM: glycosyl transferase group 1; Starch synthase
FT                   catalytic domain protein; KEGG: bja:blr6459 glycogen
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98946"
FT                   /db_xref="GOA:B3Q9C2"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR011835"
FT                   /db_xref="InterPro:IPR013534"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3Q9C2"
FT                   /protein_id="ACE98946.1"
FT                   /translation="MTTLAVLSVASELFPLIKTGGLADVAGALPAALRANDVAVTSLLP
FT                   GYPAVLGGIEDPQQVHSFNELFGGTARLLAARCGDLDLFVLDAPHLYVRPGNPYVGPDG
FT                   KDWPDNGLRFAALAQVGAALGQGLLPHYKPDVLHAHDWQTGLLPAYLKYSGRPGPKTVF
FT                   TIHNLAFQGRFPYELLGRLGLPERAFGLDGIEYYGGIGYLKAGLQLADRITTVSPSYAA
FT                   EIQGSEAGMGLDGLLQLRADRLSGILNGIDTDVWNPASDALISATYDVESIAARARNKK
FT                   VLQARFGLKPEPGALLYGVISRLSWQKGLDLLLQALPQLIGGGAQLALLGSGDAELEQG
FT                   YAAAARKYPGQVGAVIGYDEALAHQIQAGADALLVPSRFEPCGLTQLCALRYGAVPVVA
FT                   RVGGLADTVVDANEMATATGVATGVQFAPVTTDALIKAFGKTRALFADVVAWRNLQING
FT                   MTTDVSWKNPAQHYAKLYRDLVAER"
FT   gene            413707..414507
FT                   /locus_tag="Rpal_0387"
FT   CDS_pept        413707..414507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0387"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   pap:PSPA7_1700 probable enoyl CoA-hydratase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98947"
FT                   /db_xref="GOA:B3Q9C3"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q9C3"
FT                   /protein_id="ACE98947.1"
FT                   /translation="MPGQDTVLIERDGPVTIVTINRPERRNAVDGATAKKLYDAFLAFD
FT                   ADESASVAVFTGAGGTFCAGADLKAVAAGDAEKKREIAGHNTLAPMGPSRLRLSKPVIA
FT                   AVEGFAVAGGLELALWADMRVVAEDATFGVFCRRFGVPLIDLGTIRLPRLIGHSQAMDM
FT                   ILTGRPVTADEAHRIGLANRLVPRGEALPRAIELAKQISQFPQTCLRADRLSAFQQWDL
FT                   PEEDAIMNEMRGGLKVIQSGETLSGATRFAQGEGRHGAFGKPAP"
FT   gene            414504..415076
FT                   /locus_tag="Rpal_0388"
FT   CDS_pept        414504..415076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0388"
FT                   /product="protein of unknown function DUF1566"
FT                   /note="PFAM: protein of unknown function DUF1566; KEGG:
FT                   pat:Patl_3291 protein of unknown function DUF1566"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98948"
FT                   /db_xref="InterPro:IPR011460"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q9C4"
FT                   /protein_id="ACE98948.1"
FT                   /translation="MIRRGDQAGTGRSHRGAIAALLCIALSFAASPARADCYDRDRSGH
FT                   QTRFRLAAAEAIDQRTGLIWQRCSVGKSWSDNAGCKGEAGYLGLDQAIAAASAAGNGWR
FT                   VPSGTELESIIDTDCGSPVVDTTVFPDIVPTEEGLAKYWSVTPYGMLDLYWNFDFVDGH
FT                   PDSNSRGIRLAVRLVRAAKPEIKPNAN"
FT   sig_peptide     414504..414611
FT                   /locus_tag="Rpal_0388"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.926 at
FT                   residue 36"
FT   gene            complement(415092..415811)
FT                   /locus_tag="Rpal_0389"
FT   CDS_pept        complement(415092..415811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0389"
FT                   /product="DNA repair protein RadC"
FT                   /note="PFAM: DNA repair protein RadC; KEGG: nwi:Nwi_0335
FT                   DNA repair protein RadC"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98949"
FT                   /db_xref="GOA:B3Q9C5"
FT                   /db_xref="InterPro:IPR001405"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR020891"
FT                   /db_xref="InterPro:IPR025657"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q9C5"
FT                   /protein_id="ACE98949.1"
FT                   /translation="MPTDNAERLQQPGFAEAPHYHGHRERLRERFREAGSDALSDYELL
FT                   ELVLFRALPRRDVKPIAKELIARFGSFAEAVHAPAERLREVSGVGEAAIIEIGLIAAAA
FT                   ARVTKGQVKQRTVLSSWSAVIDYCRTTMAFADKEQFRILFLDKRNQLIADELQQVGTVD
FT                   HTPVYPREIVKRGLELSATAVIMVHNHPSGDPTPSQADIQMTKSIVAIAEPLGIAVHDH
FT                   IIVGKNGHASLKGLRLI"
FT   gene            complement(415906..416148)
FT                   /locus_tag="Rpal_0390"
FT   CDS_pept        complement(415906..416148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0390"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bbt:BBta_5458 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98950"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q9C6"
FT                   /protein_id="ACE98950.1"
FT                   /translation="MVDRPRDLPRDLATRMAQRSRPADGFLRETFVLPRPAARAKAKEF
FT                   LEAWPKAAYMSSVESWRELPGDTIEFTMRRLPSAD"
FT   gene            416255..417250
FT                   /locus_tag="Rpal_0391"
FT   CDS_pept        416255..417250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0391"
FT                   /product="Ku protein"
FT                   /note="TIGRFAM: Ku protein; PFAM: Ku domain protein; KEGG:
FT                   nha:Nham_0450 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98951"
FT                   /db_xref="GOA:B3Q9C7"
FT                   /db_xref="InterPro:IPR006164"
FT                   /db_xref="InterPro:IPR009187"
FT                   /db_xref="InterPro:IPR016194"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q9C7"
FT                   /protein_id="ACE98951.1"
FT                   /translation="MAPRANWKGFLRLSLVTCPVALYPATSDSDKISFNQINRATGHRI
FT                   KYLKVDAETGDEVPADEIMKGYKVDADSYIEITKDELDNLALESTRTIEIDQFVPRAEI
FT                   DDLYLVRPYYLVPDGKVGHDAYAVIRETIRSMDKVALARVVLTNREHVIALEARDNGLV
FT                   GMLLRYPYEVRDAADYFDDIQDVKITKDMLDLAKHIVEQKSGHFQPDLFEDHYETALTE
FT                   LINTKMAGQSLKPQARPRGDNVVDLMDALRRSLGDAKSAPAAKKSASSETAEKSAPAKP
FT                   ARAKKRKTAAGQKEMLLPIAGSGTGKAKEEPAKATKPARSAAGGKARKAG"
FT   gene            complement(417363..418187)
FT                   /locus_tag="Rpal_0392"
FT   CDS_pept        complement(417363..418187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0392"
FT                   /product="methionine aminopeptidase, type I"
FT                   /note="TIGRFAM: methionine aminopeptidase, type I; PFAM:
FT                   peptidase M24; KEGG: nha:Nham_0431 methionine
FT                   aminopeptidase, type I"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98952"
FT                   /db_xref="GOA:B3Q9C8"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q9C8"
FT                   /protein_id="ACE98952.1"
FT                   /translation="MSYVDATETAQRKTGQIKLHGPAGFAGMRKAGQVVARCLDELVDI
FT                   VKPGVPTSRIDDFVRDFAFSNGAYPATLMYRGYRYSTCTSLNHVVCHGMPGDRPLKEGD
FT                   IVNVDVTMIVDGWYGDSSRMYPVGPIARKAERLIDVTYESLLRGIAAVKPGATTGDIGH
FT                   AIQSFVEPQQMSVVRDFCGHGLGRLFHDEPNIIHVGSPGQGAVLKPGMFFTIEPMINLG
FT                   KPYVKILSDGWTAVTRDRSLSAQFEHSIGVTEDGCEIFTASPKGLDKPPFQS"
FT   gene            418383..420176
FT                   /locus_tag="Rpal_0393"
FT   CDS_pept        418383..420176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0393"
FT                   /product="sodium/hydrogen exchanger"
FT                   /note="PFAM: transporter-associated region; sodium/hydrogen
FT                   exchanger; KEGG: nwi:Nwi_0337 potassium/proton antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98953"
FT                   /db_xref="GOA:B3Q9C9"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR030151"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q9C9"
FT                   /protein_id="ACE98953.1"
FT                   /translation="MESLDSVSIAILLGSVLVMAGILSSLLALRFGAPLLLVFLVIGIL
FT                   AGESGPGGINFNDLGTTYLVGSVALALILFDGGLKTRFSSIKAVLAPSMGLATVGVLLT
FT                   ALVTAPVARYALDLSWVEALLAGAVVASTDAAAVFLLVHAQGLRLRPRVGATLEVESGT
FT                   NDPFAVFLTLMLVELITRGESSILHVLIEFVREAALGAVIGVVGGRVVVMALNRVALPQ
FT                   GLHAPFVTTAALVVFGAAQMSHASGFLAVYLAGMIIGNQPTRAHNSVVAFLDAATWLAQ
FT                   IVMFVLLGLLVSPQRLMGSIGPAVVIALALMLVARPLAVFICLAPFRFNWRERLFIAWV
FT                   GLRGAVAIFLASIPMLVGLSKAYLYFDVAFVVVLISLMLQGWTLAPAARKLLVALPRSD
FT                   RGPRRIELDLPGQLEQQLVGYAVRPKSLYLKRGLIPSWSKPTLVIRDQRILTPEEAEPV
FT                   APGDYVYLLAPPEKAAALDRFFVDMPPSTAPDPHLLGDFIVPGETSLGDLAAAYGISVP
FT                   PGQEALTLADYFDIYLDQAPMVGATLPLDSIVLVARSLGGGRVNVVGLRLPEEEDEAPP
FT                   PTRLAKVRTKLSEVWSLLAGV"
FT   sig_peptide     418383..418445
FT                   /locus_tag="Rpal_0393"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.888) with cleavage site probability 0.795 at
FT                   residue 21"
FT   gene            complement(420201..421163)
FT                   /locus_tag="Rpal_0394"
FT   CDS_pept        complement(420201..421163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0394"
FT                   /product="peptidase U6 penicillin-insensitive murein
FT                   endopeptidase"
FT                   /note="PFAM: peptidase U6 penicillin-insensitive murein
FT                   endopeptidase; KEGG: nwi:Nwi_0341 penicillin-insensitive
FT                   murein endopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98954"
FT                   /db_xref="GOA:B3Q9D0"
FT                   /db_xref="InterPro:IPR005073"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q9D0"
FT                   /protein_id="ACE98954.1"
FT                   /translation="MRRAILAAPVRLASLLAAMMSLVPAAVAQDKGTLDPKPLPPLAHP
FT                   DDPNLAARELFARKLRPTAQQPRPIGFYAKGCMAGGISLPINGPSWQVMRLSRNRAWAL
FT                   PATVRLIERVADKAREQAGWNGILVGDMSQPRGGPMLTGHASHQVGLDADIWLTPMPNR
FT                   QLSRNEREEMSAVMMVRSDRLDIEPSAWTPTHWKVIRAAALEPQVDRIFVNAAIKKALC
FT                   REAKGDRSWLHKVRPMYGHDYHFHIRLRCPAGIEGCEAQAEPPPGEGCDASDFAYWFSD
FT                   AVLHPKPPLKPPPPRHQLTLSELPAECRTVLNAPDKKPD"
FT   sig_peptide     complement(421077..421163)
FT                   /locus_tag="Rpal_0394"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.975 at
FT                   residue 29"
FT   gene            421544..423781
FT                   /locus_tag="Rpal_0395"
FT   CDS_pept        421544..423781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0395"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC sensor(s)"
FT                   /note="KEGG: bja:bll8156 hypothetical protein; TIGRFAM: PAS
FT                   sensor protein; diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; EAL domain protein; PAS fold domain
FT                   protein; SMART: PAS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98955"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q9D1"
FT                   /protein_id="ACE98955.1"
FT                   /translation="MPQVRLKKKKTARIRPPAGSAKPRRSALPAPKTLSKPRRTARPAD
FT                   VAEGERAVAAALEEARRSHARLREAIDILPQGIVFLDAEGRYILWNKRYAEIYKASADQ
FT                   FSPGARIQDTMRIGIARGDYPEAEGREEEWIAERLQRMFNPGSSHEQVLADGRCIQIEE
FT                   RTTSDGGIIGLRVDITELKQREASFRLMFESNPVPMIVCAVNDERILAVNDAAVEHYGY
FT                   SPSEFASLTIRRLQAFETELPWAGNHTHEERTARTWKHVKADGSLIDLAIYSRQLTYNG
FT                   EPAVLLALMDITERKRAEMRLAFMAHHDGLTGLPNRNSLRKRLDELLIQTRRTGEKIAV
FT                   LFVGIDNFKAVNDTLGHAVGDKLLRGVARRLRSTLREEDPLARLNSDEFAVIQTGIKRP
FT                   EDIVLLAKRLLHAIAEPYLLQGHSVVVGASIGIAVAPGDGDDSEKLLMNADMALSRAKK
FT                   DTRGTFSFFEVGMDARAQARRKIETDLRAALQHEVLRPYYQPLVRLADGRITGSEALVR
FT                   WPHPERGMISPAEFIPVAEDTGLINAIGAQILRSACMDAARWPDDVRVAVNLSPLQFRV
FT                   GNLLSVVMDALKQSGLPPRRLELEITETLLLEKSSQVLATLHALRALGVRISMDDFGTG
FT                   YSSLSYLRSFPFDKIKIDQSFVRGLCDNRESQAIVRSIISLGNGLGVTITAEGVESEAE
FT                   LSWLRAEGCQEAQGFLFSQARPNAEITGLLDLQQSGASAGAEFAMGSARVA"
FT   gene            complement(423796..425553)
FT                   /locus_tag="Rpal_0396"
FT   CDS_pept        complement(423796..425553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0396"
FT                   /product="Alkaline phosphatase"
FT                   /EC_number="3.1.3.1"
FT                   /note="PFAM: Alkaline phosphatase; KEGG: rru:Rru_A1289
FT                   alkaline phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98956"
FT                   /db_xref="GOA:B3Q9D2"
FT                   /db_xref="InterPro:IPR001952"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q9D2"
FT                   /protein_id="ACE98956.1"
FT                   /translation="MMTKHIVATAFASLMFVSAASAQTIYPIDRAEILAGTRFDLKVEF
FT                   AGEVTADKASLTINGADAASVFGKAPELIAQEAGQPRSALLLRDVTLNKPGRYTVEAGD
FT                   GAVRRSVSWTVYDTGPRRAKNVILFIGDGLSPAHRVAARLLSKGIQEGRAGGKLAIDDM
FT                   PQMALVSTAGSDSIITDSANAASAYATGHKAAVNAMGVYADRTPDPLDDPKVETLASVA
FT                   KRRLGLSIGIVTNTEVEDATPAAVIAHTRRRAAYDDIVAQFYAAQPDVLMGGGAAYFLP
FT                   KSANGKRKDDIDYLAKFRDAGYAVANNATDLDAASKTAPRKLLGLFAPGNMDGVLDRRF
FT                   LKGGGVTKNPDQPDLTQQVAVALDVLSKNDAGFFLMVESGLIDKYAHALDMERAVYDTI
FT                   MLDNAVRQTRDWAKARGDDTLILVVADHNHPNALVGTVRDDLAEGDDVPLRERIGVYER
FT                   AGFPNYPAPDADGYPDRVDVSRRIAIFSASLPDHYETLRPKLDGPNQPTEAGDKHGTFK
FT                   ANDKYKGVPGAVLRIGNLPAMMNASVHSGEDVILTATGPGSDRVRGSLENTDVFRVMAA
FT                   ALGLGAEAK"
FT   sig_peptide     complement(425485..425553)
FT                   /locus_tag="Rpal_0396"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.975 at
FT                   residue 23"
FT   gene            complement(425794..427131)
FT                   /locus_tag="Rpal_0397"
FT   CDS_pept        complement(425794..427131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0397"
FT                   /product="Argininosuccinate synthase"
FT                   /EC_number="6.3.4.5"
FT                   /note="PFAM: argininosuccinate synthase; KEGG: bja:bll0522
FT                   argininosuccinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98957"
FT                   /db_xref="GOA:B3Q9D3"
FT                   /db_xref="InterPro:IPR001518"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018223"
FT                   /db_xref="InterPro:IPR023434"
FT                   /db_xref="InterPro:IPR023437"
FT                   /db_xref="InterPro:IPR024073"
FT                   /db_xref="InterPro:IPR024074"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3Q9D3"
FT                   /protein_id="ACE98957.1"
FT                   /translation="MTTILKSLPKGENVGIAFSGGLDTSAALLWMKQKGAKVFAYTANL
FT                   GQPDEADYDAIPRKAMEFGAEKARLVDCRTQLVHEGIAAIQAGAFHVSTGGIAYFNTTP
FT                   LGRAVTGTMLVSAMKEDGVNIWGDGSTYKGNDIERFYRYGLLTNPALRIYKPWLDQQFI
FT                   DELGGRAEMSAFMTSHGFAYKMSAEKAYSTDSNLLGATHEAKDLEHLDSGIKIVNPIMG
FT                   VPFWRDDCAVKAEAVTVRFEEGQPVALNGQTFTDPVAMFYEANAIGGRHGLGMSDQIEN
FT                   RIIEAKSRGIYEAPGMALLHIAYERLVTGIHNEDTIEQYRINGMKLGRLLYQGRWFDSQ
FT                   ALMLRETAQRWVARAVTGEVTLELRRGNDYSILNTVSPNLTYAPERLSMEKVEDAPFTP
FT                   ADRIGQLTMRNLDITDTRAKLGLYAKTGLLSSGEGTPIPQLENDKG"
FT   gene            complement(427232..428011)
FT                   /locus_tag="Rpal_0398"
FT   CDS_pept        complement(427232..428011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0398"
FT                   /product="phosphoesterase PA-phosphatase related"
FT                   /note="PFAM: phosphoesterase PA-phosphatase related; KEGG:
FT                   nwi:Nwi_2804 phosphoesterase, PA-phosphatase related"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98958"
FT                   /db_xref="GOA:B3Q9D4"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q9D4"
FT                   /protein_id="ACE98958.1"
FT                   /translation="MNRNGLLIALALFAGIGLTFGLFPSLDLWLAGLFYDTAAKTFPMR
FT                   SMPDLEFARDFAMWVAWAIAAPSIFALVYKMIRPDRPLVMPGRTVAFLLISITLSAGVL
FT                   TNMTFKSHWGRPRPAAVTEFNGPWQFKAWWDNSGACPKNCSFFSGEGATAYWTFAPAAL
FT                   TPPAVRPYAYAAAFTFGTVTSGLRMAFGGHFFTDVAIAGLVTFLVVWLLYALIYRWAWS
FT                   RTSDEAVDAALTRAFWPLYRLRLKKWRGQDIGPAPAA"
FT   sig_peptide     complement(427946..428011)
FT                   /locus_tag="Rpal_0398"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.919) with cleavage site probability 0.457 at
FT                   residue 22"
FT   gene            complement(428008..428508)
FT                   /locus_tag="Rpal_0399"
FT   CDS_pept        complement(428008..428508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0399"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bra:BRADO0245 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98959"
FT                   /db_xref="GOA:B3Q9D5"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q9D5"
FT                   /protein_id="ACE98959.1"
FT                   /translation="MALLGRLFVIAIGFLLASIAAGLVVVGMLLFPELSQIADGPIDPD
FT                   ALNIMMGFGFIFVSGFALLPALVVVLITEAFSIRSALAYAIGGGLVGVACYLGLVPFDP
FT                   ATLHFDGIIRRHLEIMTGAGIVGGMVYWLVAGRNAGAWRDPPRRRAPLPPSQPEPPPVN
FT                   RAP"
FT   sig_peptide     complement(428446..428508)
FT                   /locus_tag="Rpal_0399"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.891) with cleavage site probability 0.323 at
FT                   residue 21"
FT   gene            complement(428508..429101)
FT                   /locus_tag="Rpal_0400"
FT   CDS_pept        complement(428508..429101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0400"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="PFAM: metal-dependent phosphohydrolase HD sub
FT                   domain; SMART: metal-dependent phosphohydrolase HD region;
FT                   KEGG: pfl:PFL_2689 metal-dependent phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98960"
FT                   /db_xref="GOA:B3Q9D6"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR039356"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q9D6"
FT                   /protein_id="ACE98960.1"
FT                   /translation="MLPANEIKGVLAFLREAERLKSVIRSGYTSTGRPESTAEHTWRLC
FT                   LMAMLLADGLGDIDVARLLKICIVHDLGEALHGDVPAVAQVEGDDRAARERADIETLTQ
FT                   SLDDKRRAELLGLWHDYETGASPEGRLAKGLDKLETILQHTQGLNPADFDYAFNLDYGA
FT                   RHTAVHPLVSAIRAELDNDTRARMAAQQASGAPH"
FT   gene            complement(429106..430305)
FT                   /locus_tag="Rpal_0401"
FT   CDS_pept        complement(429106..430305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0401"
FT                   /product="radical SAM enzyme, Cfr family"
FT                   /note="TIGRFAM: radical SAM enzyme, Cfr family; PFAM:
FT                   Radical SAM domain protein; KEGG: bbt:BBta_0241 putative
FT                   pyruvate formate lyase activating enzyme 2 (YfgB)"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98961"
FT                   /db_xref="GOA:B3Q9D7"
FT                   /db_xref="InterPro:IPR004383"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR027492"
FT                   /db_xref="InterPro:IPR040072"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3Q9D7"
FT                   /protein_id="ACE98961.1"
FT                   /translation="MTPSAASALVEKTPLETYVPPAKPSLIGLSRAQLCDRLGDVGVAP
FT                   PQRKMRAQQLWHWMYVRGARDFSEMTNVSKEMRATLAEHFTVDRPEVVAEQISADGTRK
FT                   WLLRLPSGGDGQKAHEVECVYIPETDRGTLCVSSQVGCTLNCAFCHTGTQRLVRNLTAG
FT                   EIVGQVMVARDRLGDWIDRETPNGNRLITNIVMMGMGEPLYNFDAVRDALLIVSDNEGI
FT                   GISRRRITLSTSGVVPNIKRTGDEIGVMLAISLHAVRDELRDELVPLNRKYPLKELLQA
FT                   CRDYPGASNARRITFEYVMLKGVNDSLDDARKLVQLLKGIPAKINLIPFNPWPGSNYEC
FT                   SDWDQIEKFSEYVFNAGYSSPVRTPRGRDILAACGQLKSETEKLSVRERNALRAMAMTD
FT                   "
FT   gene            complement(430492..431067)
FT                   /locus_tag="Rpal_0402"
FT   CDS_pept        complement(430492..431067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0402"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bja:bll0526 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98962"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q9D8"
FT                   /protein_id="ACE98962.1"
FT                   /translation="MIMRRMLIAALAGSLMVAAGNAAVAREAKGKPAATPAAASGGGEP
FT                   TLIGQFGSWGAYTASPGGKKVCFALAKPSSSKTTPPNRPRDPAYAFISTRPSEKVVNEV
FT                   SVMVGYPLKPGSESAIEVAGSSFAMYTQGDGIWIKNAAEEERLVEAMRRGAEITVKGVS
FT                   AKGTASTDVFSLKGLAQALDKVAQACGS"
FT   sig_peptide     complement(430990..431067)
FT                   /locus_tag="Rpal_0402"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.579 at
FT                   residue 26"
FT   gene            complement(431221..432057)
FT                   /locus_tag="Rpal_0403"
FT   CDS_pept        complement(431221..432057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0403"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: bja:bll0527 hypothetical
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98963"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q9D9"
FT                   /protein_id="ACE98963.1"
FT                   /translation="MFEAGLLANRRILITGGGSGLGAAMAARFAELGASLVLCGRRAEV
FT                   LQETAEQLRSHGSQVDTIVCDVRDPQAVEAMLDEIWRVAPLDVLVNNAAATFIAQTERL
FT                   SARAADAILAPTLHGAMYCTLGAGRRWIDGEHAGVVLSILSTSTITGRAFTVPSAMAKS
FT                   AVLAMTKSLAVEWGPKQIRLVAIAPGAFPTAGATAQLRPDGRSADPADRVPLGRVGRHA
FT                   ELANLASFLISDQAGYITGEMVVQDGGTHLRSSGAEDLLQWNDQQWSAHRAGRAKS"
FT   sig_peptide     complement(431965..432057)
FT                   /locus_tag="Rpal_0403"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.744) with cleavage site probability 0.418 at
FT                   residue 31"
FT   gene            432289..433263
FT                   /locus_tag="Rpal_0404"
FT   CDS_pept        432289..433263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0404"
FT                   /product="Alcohol dehydrogenase zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   bbt:BBta_0243 putative quinone oxidoreductase (NADPH) and
FT                   Zn-dependent alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98964"
FT                   /db_xref="GOA:B3Q9E0"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q9E0"
FT                   /protein_id="ACE98964.1"
FT                   /translation="MKAILCQQYCGPDDLVYADVPDPVAGPGEAVIAVKAAALNFFDIL
FT                   MIQGKYQIKPPFPFSPGAEVAGVIESVGEGVTDLKVGDRVVASCGHNGAREKIALPAQM
FT                   IVKIPDNLDFDRAAGIIIIYGTALHALEDRASPKPGETLAVLGAAGGTGLAACELGKLM
FT                   GLKVIACASSDEKLAFAKQHGAELTLNYATEDLKEGLKKLTGGKGVDIIFDPVGGTYAE
FT                   AALRSIAWEGRFLVIGFAAGDIPKMPLNLALLKGCDIRGVFWGAWTRLNPEKNRANLEK
FT                   LVKWAAEGKISSHVDRTFPLTQTADALKVLAGRQAMGKVILHP"
FT   gene            complement(433392..435527)
FT                   /locus_tag="Rpal_0405"
FT   CDS_pept        complement(433392..435527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0405"
FT                   /product="amine oxidase"
FT                   /note="PFAM: amine oxidase; FAD dependent oxidoreductase;
FT                   KEGG: bbt:BBta_7528 putative phytoene dehydrogenase and
FT                   related proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98965"
FT                   /db_xref="GOA:B3Q9E1"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q9E1"
FT                   /protein_id="ACE98965.1"
FT                   /translation="MKTFLTVKLVLVPFAVFWALLALHQPSWAIWLGLGLSLAGNAWRA
FT                   YRRELFVLEAGGLVLFAALAALSLIAPAVAASNALWLSFAGLAGISALSLAAKRPWTSD
FT                   YSRAAHPDNADTPQFFLVNAAITALWAVLFGAIAACRYIDAPGEVITAIVSVGALISIF
FT                   GPKAAIHLILNRMAASRESYRWPTPSFAPFEVQDCDVVIIGAGIGGLTAAALLADAGLR
FT                   VKVFEQHVVAGGYCHTYLRKAHHRGRPVLYRFDAGPHDFSGVQPGGPFATLLQRLGVGN
FT                   RITWERVTHSFHTQAGAIDVPPDWRDYVRLLGERFPASAAGIKELFDEIKAIFDDMFAT
FT                   AASRGGVPGMPSSIDELLAFPRNHPHAYRWMNRPFAELVAAHVQDPAAVAFINGLAGYI
FT                   GDGSEPSTCARMVPIFGYYFHGGYYPRGGSSVVSGALVAAIEARGGEVKLKTPVARILV
FT                   ENEAAAGVVLGNGATVRARAVISNADLKHTLLDLVPSEALPQDARRWITEAAPANSCFS
FT                   VHLGLDCVPDIRPSVHLHAPMRVGLAMMSKLDPTAAPAGHSILSLIHLVPHAEAKSWFP
FT                   PEPEHDWKSWRRSEAYLRRKQELGDRMIAAAETVIPNLSQHIVYRTDASPVTYARYDWA
FT                   SFGSIYGMSTAGQLKGSKSPLRNLVIAGGGNIGAGIEAVVISGAEAVEALMPGLLASAQ
FT                   PVASEPAAATRPELMPA"
FT   sig_peptide     complement(435438..435527)
FT                   /locus_tag="Rpal_0405"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.900) with cleavage site probability 0.793 at
FT                   residue 30"
FT   gene            435666..436286
FT                   /locus_tag="Rpal_0406"
FT   CDS_pept        435666..436286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0406"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: ade:Adeh_2875
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98966"
FT                   /db_xref="GOA:B3Q9E2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR039536"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q9E2"
FT                   /protein_id="ACE98966.1"
FT                   /translation="MEKQQEPADDARRAAILQAAFDVFVEKGFEAATTAEIVRRARTSK
FT                   RTLYEFFASKQEILTALIRYGAAKMQPSPELPEPQNRQQFLVVLEQFGRIFLSELLHPE
FT                   RTAMYRLAIAEAARGGGSVARELEASGRVPVTQAATRFFEQAAARGIIRREQVATLISV
FT                   FFSVLIGITPLQVLLGEPPIGADAIAQRAALATQVLARMIEPA"
FT   gene            complement(436304..436678)
FT                   /locus_tag="Rpal_0407"
FT   CDS_pept        complement(436304..436678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0407"
FT                   /product="protein of unknown function DUF1232"
FT                   /note="PFAM: protein of unknown function DUF1232; KEGG:
FT                   bja:bll0531 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98967"
FT                   /db_xref="InterPro:IPR010652"
FT                   /db_xref="InterPro:IPR016983"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q9E3"
FT                   /protein_id="ACE98967.1"
FT                   /translation="MTTDHSVGFEPADRLAQDPEQVRRRFWRKIKSVAVRLPFVEDILA
FT                   AYYCAFDRQTPRHVQIALLGAIAYFILPFDFLPDILPVLGFTDDAAILATALRMVASNI
FT                   TPEHREAARAAMQRGLEDEA"
FT   gene            complement(436761..437063)
FT                   /locus_tag="Rpal_0408"
FT   CDS_pept        complement(436761..437063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0408"
FT                   /product="transcriptional coactivator/pterin dehydratase"
FT                   /note="PFAM: transcriptional coactivator/pterin
FT                   dehydratase; KEGG: nwi:Nwi_2809
FT                   pterin-4-alpha-carbinolamine dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98968"
FT                   /db_xref="GOA:B3Q9E4"
FT                   /db_xref="InterPro:IPR001533"
FT                   /db_xref="InterPro:IPR036428"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3Q9E4"
FT                   /protein_id="ACE98968.1"
FT                   /translation="MNRLSASERQAALRELPGWLELEEREAIGRSYQFTDFSEAFGFMT
FT                   RVALAAEKADHHPEWRNVYRTVDVVLTTHDAGGVTERDVKLAKAMDAIAERCGAR"
FT   gene            437263..438651
FT                   /locus_tag="Rpal_0409"
FT   CDS_pept        437263..438651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0409"
FT                   /product="TRAP transporter solute receptor, TAXI family"
FT                   /note="TIGRFAM: TRAP transporter solute receptor, TAXI
FT                   family; KEGG: bja:blr0533 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98969"
FT                   /db_xref="GOA:B3Q9E5"
FT                   /db_xref="InterPro:IPR011852"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q9E5"
FT                   /protein_id="ACE98969.1"
FT                   /translation="MLQPSLRSPWRRMLLIVLAITLSLIGIASAGYYFAMRPVTLKIAV
FT                   GPQAGDDYKLIQALTQVFARERNTVRLRPVVTDGPAASALALKSGAVDLAVIRGDLPVP
FT                   KQAQSVAVLHKNVAVLWAPASQQPKGKRKGSKTAGIAGITDLTGKRVGVVGRTEANAGL
FT                   LTVILQQYGVDPSKVQTLSVPVAEVADAVRTGKVDALLAAGPLNSKIIGDAVAATAHTG
FT                   REPVFLSIESSEALAANHPSYEAASIPAGAFGGAPARPDNEVKTVSFSHYIVAREGASD
FT                   TTIATFTEQLFTARQIVIGEVPLAAKIETPDTDKDAVIPVQPGAAAYVDGEEKSFLDRY
FT                   SDLIWFSLMGLSLMGSAGAWFASFLRKDERTSTASQRERLLDMLATARRCSSAEELDTM
FT                   QTEADAILRDTLTAYENGAIDSAALTAFSIALEQFHNAVTDRKLLLADVSPLPPLRGVR
FT                   PQAV"
FT   sig_peptide     437263..437355
FT                   /locus_tag="Rpal_0409"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.496 at
FT                   residue 31"
FT   gene            complement(438655..440100)
FT                   /locus_tag="Rpal_0410"
FT   CDS_pept        complement(438655..440100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0410"
FT                   /product="PepSY-associated TM helix domain protein"
FT                   /note="PFAM: PepSY-associated TM helix domain protein;
FT                   KEGG: azc:AZC_2703 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98970"
FT                   /db_xref="GOA:B3QA84"
FT                   /db_xref="InterPro:IPR005625"
FT                   /db_xref="UniProtKB/TrEMBL:B3QA84"
FT                   /protein_id="ACE98970.1"
FT                   /translation="MSSVVRRAKRWLYLGHRWLGIAGCLLFAMWFISGVVMMYVAFPHY
FT                   DKEERWAALPDLAWQHVALSPDQAMQAAGVTHYPRDLRLVMLDTEPVYRLLDWRGQRAT
FT                   VSAIDGRKIEQVSADQALGIARHHPAAAAPQLLETVDRDQWSVTSRYDSFRPLYLIGLG
FT                   DTAGTELYVASRGGEIVLDTTRQERIWNWLGAIPHWIYFTVLRQDGPLWRQVVLWVSGI
FT                   LMMVAASGIWIGLLRAGLRRRYASGRITPYRGWMAWHHITGLIGGVVVLTWMFSGWLSM
FT                   NPGEAFARRGESREMLQRYAGHDAPTIAAKLPTTLLPGVVEARFAWIGGTPLILLGHSD
FT                   GRQTVADPDDGTAKRLPEETIIAAATRLLPDATMVLRQRLERYDAYWYQHHRQRVLPVL
FT                   RVGFDDPASTWFHLDPATGELLGRSDTSARSYRWLFNAPHSFDFPVLLAYRPAWDLVVI
FT                   VLSLAGLVISVSGVVIGWRRLVR"
FT   gene            complement(440105..442381)
FT                   /locus_tag="Rpal_0411"
FT   CDS_pept        complement(440105..442381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0411"
FT                   /product="TonB-dependent siderophore receptor"
FT                   /note="TIGRFAM: TonB-dependent siderophore receptor; PFAM:
FT                   TonB-dependent receptor; TonB-dependent receptor plug;
FT                   KEGG: azc:AZC_2702 TonB-dependent siderophore receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98971"
FT                   /db_xref="GOA:B3QA85"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:B3QA85"
FT                   /protein_id="ACE98971.1"
FT                   /translation="MTPAVLPLGRNRRLLSSVALVPLLWPVDGLAQTASANPRGLDPIV
FT                   VEGQTVRAAKPRATANAGSSRQRRAAARPVATPGPAPTQPTTTAATAPTFNLGTPSSTG
FT                   SRLGLTPLQTPASVEVIRAETIAERGQHNVIDAVTQNATGFTASPRPGNGGLAFTTRGF
FT                   TGNGTVMSLYDGTRLYVGSGTMTFPFDTWTAQSIEVLRGPASVMYGEGAIGGAINVISK
FT                   KPLDVARNEAEISLDTNMSRRLAVDSGGPINPNVSYRLAAIGNMSDGWVDRDKNSNVAV
FT                   SGSVRVQAADNLAFTLSEDYADRSPSRYFGTPLVNGRLDEALRFQNYNVGDASIRYRDN
FT                   WTQLKTEWDVAEGVSVKNVTYYLSTHRHWKDVESYTYNPLRGNIGRSSYIEIFHDQEQI
FT                   GNRFDTTFKGHVFGLANEFVAGFDVNRIAFTHTNNSPYAGTSSVPAYNFDPGYFLPVSP
FT                   TRPSFHTLTTQYGVFAENRLSLTDQLSLIGGIRSDNPTVQRTDFLSPSNSFEKTYSAPS
FT                   WRVGAVYNPIENLSIYGQYSTAVDPVTNLITMTGVNRDFSLSTGKQVEVGIKQQLAGGR
FT                   AEWTLAAYHIVKNNLLARDPQNPANTNPLQIGQQSSRGIEASAGLKVTETIRLDANVAW
FT                   LRAKYDDFTQVVGGRAVNYAGNVPNNVPQIVSNIWATWAFAPGWSANAGVQLVGDTWAD
FT                   DANTLVRPAYNVVNAGLMWKPDTRQTLALRVYNLFDTVYTTSGNTTMWQLGMPRTAELS
FT                   YNVKF"
FT   sig_peptide     complement(442286..442381)
FT                   /locus_tag="Rpal_0411"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.648) with cleavage site probability 0.575 at
FT                   residue 32"
FT   misc_binding    complement(442490..442686)
FT                   /bound_moiety="adenosylcobalamin"
FT                   /note="Cobalamin riboswitch as predicted by Rfam (RF00174),
FT                   score 117.71"
FT   gene            443110..444933
FT                   /locus_tag="Rpal_0412"
FT   CDS_pept        443110..444933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0412"
FT                   /product="GTP-binding protein TypA"
FT                   /note="TIGRFAM: small GTP-binding protein; GTP-binding
FT                   protein TypA; PFAM: elongation factor G domain protein;
FT                   protein synthesis factor GTP-binding; elongation factor Tu
FT                   domain 2 protein; KEGG: bra:BRADO0265 GTP-binding protein
FT                   TypA/BipA (tyrosine phosphorylated protein A)"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98972"
FT                   /db_xref="GOA:B3QA86"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006298"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035651"
FT                   /db_xref="InterPro:IPR042116"
FT                   /db_xref="UniProtKB/TrEMBL:B3QA86"
FT                   /protein_id="ACE98972.1"
FT                   /translation="MTLRNIAIIAHVDHGKTTLVDKLLQQSGTYRDNQRQVERAMDSND
FT                   LERERGITILAKCTSVVWGDTHINIVDTPGHADFGGEVERILSMVDGVIVLVDAAEGPM
FT                   PQTKFVVGKALKLGLKPIVAINKVDRSDARVTEVVNEVFDLFAALDATDEQLDFPILYG
FT                   SGKNGWMSDKPDGDPSEGMKPLFELVLKHVHPPVVEEGPFRLLGTILEANPYLGRIITG
FT                   RIASGSVKPNQAVKVLSRDGKLVEQGRISKILAFRGLERVPLDIAEAGDIVAIAGLTKG
FT                   TVADTFCDPAVDTPIQAQAIDPPTVSMSFIVNNSPLAGTEGDKVTSRLIRDRLLREAEG
FT                   NVALRVVESADKDAMEVSGRGELQLAILIENMRREGFELSVSRPRVVLTRDENGQLLEP
FT                   VEEVVIDVDEEFSGVVVQKMSERKAEMIEMRPSGGNRLRLVFYAPTRGLIGYQGELMTD
FT                   TKGTAIMNRLFHNYLPYRGEIQGRRNGVLISNDQGEAVAYAMFKLEDRGPMMIEPGWKV
FT                   YKGMIVGEHTRDNDLEINVLKGKQLTNIRTTSKDEAVRLTPPIRMTLEKALAYIEDDEL
FT                   VEITPKSIRLRKRLLDPNERKRAEKSKQAVA"
FT   gene            445043..446311
FT                   /locus_tag="Rpal_0413"
FT   CDS_pept        445043..446311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0413"
FT                   /product="amine oxidase"
FT                   /note="PFAM: amine oxidase; FAD dependent oxidoreductase;
FT                   KEGG: bja:blr0541 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98973"
FT                   /db_xref="GOA:B3QA87"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B3QA87"
FT                   /protein_id="ACE98973.1"
FT                   /translation="MPSSSFPSSVDIAIIGAGAAGLGAARTLEGTGLSVIVLEARNRIG
FT                   GRAWTRMVTPEIAFDVGCGWLHSADENSFVGIAKQLGIGIDKTHPPWGEASFGDVFPKR
FT                   DRAAFGKALDAFYERVWRAAKNKTDVAAATLLEPGNRWNPMIDAVSTYVNGAELDRISV
FT                   HDLESYRDTGINWRVREGYGTLIAAYGEPCPVALNCVVEQIDHSERRIKINTSLGTLSA
FT                   SQVIITVPTNLIADEAIRFVPALPGKVEAARHLPLGVDDKVMLKLSDSNGFPADGNLRA
FT                   ATMRSAMGTYHLRPFGHDCIEGFFGGRYARELEDAGEGAFAAQAIDEIADLLGNDIRRK
FT                   LSPLAESRWAHDPFARGAYSHALPGHAGARAVLAAPVDGRLFFAGEATSPQFFSTAHGA
FT                   RDSGERAARQAIDCRSGPGFAAN"
FT   gene            446487..446996
FT                   /locus_tag="Rpal_0414"
FT   CDS_pept        446487..446996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0414"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   bja:blr0547 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98974"
FT                   /db_xref="GOA:B3QA88"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B3QA88"
FT                   /protein_id="ACE98974.1"
FT                   /translation="MSTTLIEVRAARAADASAVAATHDEAWRSAYQGIIPGAELEKLIN
FT                   RRGPTWWDSAIRKGSRISVLCFGDKIAGYANYGRNRARSLQFEGEIYELYLRPEFQGLG
FT                   FGRRLFAAARRDLVQSGLKSMVIWALSDNEPATEFYRALGGRMVARSSERFGPKSLDKV
FT                   AFAWSN"
FT   gene            447073..447609
FT                   /locus_tag="Rpal_0415"
FT   CDS_pept        447073..447609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0415"
FT                   /product="Inorganic diphosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /note="PFAM: Inorganic pyrophosphatase; KEGG: bja:blr0548
FT                   inorganic pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98975"
FT                   /db_xref="GOA:B3QA89"
FT                   /db_xref="InterPro:IPR008162"
FT                   /db_xref="InterPro:IPR036649"
FT                   /db_xref="UniProtKB/TrEMBL:B3QA89"
FT                   /protein_id="ACE98975.1"
FT                   /translation="MRIDAIPVGVNPPYDVNVIIEVPVGGEPIKYEMDKAAGTLVVDRF
FT                   LYTAMHYPGNYGFIPHTLSDDGDPCDVLVANTRGIVPGAVMSVRPVGVLYMSDEAGHDE
FT                   KIIAVPSSKLTQRYDRIKTYSDLPEITLAQFQHFFEHYKDLEPGKWVKVVRWGGADEAH
FT                   KLILEGLDRAKKAKG"
FT   gene            447645..449126
FT                   /locus_tag="Rpal_0416"
FT   CDS_pept        447645..449126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0416"
FT                   /product="peptidase M20"
FT                   /note="PFAM: peptidase M20; peptidase dimerisation domain
FT                   protein; KEGG: bra:BRADO0276 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98976"
FT                   /db_xref="GOA:B3QA90"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:B3QA90"
FT                   /protein_id="ACE98976.1"
FT                   /translation="MRRLLRWIRNLVAIALLAVAVLAGVLAYNTFRHGSRQITVAAVPP
FT                   IAIDEQGAAERLSQSIRFQTISNFLNPEQDAEALRGLRAHIESSFPAFHAAAKREIVGG
FT                   HSLLYTWEGSDPQAKPIGLLAHQDVVPIAPKTEQDWQQPPFSGAIEGGYVWGRGSWDDK
FT                   GNLYAMLEAAELMAKQGFRPKRTIYFAFGHDEEVSGLRGAAKIAELLASRKVRLDFVLD
FT                   EGLLITDGVMKGLDKPAALIGVSEKGYATLVLTARGTPGHSSMPPRDTTIGMLAAALTH
FT                   LEDNRLPMRIRGSVAEMFDTLAPEMSGFSRVALSNLWLFRPLLLREFAKSGTTAAMVQT
FT                   TTALTVFNAGDKDNVLPGVAEASVNFRLLPGDTQTSVTDHVRSVVANDRIGIQGFDGNF
FT                   DPPPVTGTSSPSYQALNRTIREVFPDVVVAPGLMIAATDSRHYAQVADNIFRFSPVRAT
FT                   PEDLKRFHGTNERISIKNYADMIRFYVRLMQSTAG"
FT   sig_peptide     447645..447728
FT                   /locus_tag="Rpal_0416"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.789 at
FT                   residue 28"
FT   gene            complement(449315..450202)
FT                   /locus_tag="Rpal_0417"
FT   CDS_pept        complement(449315..450202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0417"
FT                   /product="Methenyltetrahydrofolate cyclohydrolase"
FT                   /EC_number="3.5.4.9"
FT                   /note="PFAM: tetrahydrofolate dehydrogenase/cyclohydrolase;
FT                   KEGG: nha:Nham_0609 methylenetetrahydrofolate dehydrogenase
FT                   (NADP+)"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98977"
FT                   /db_xref="GOA:B3QA91"
FT                   /db_xref="InterPro:IPR000672"
FT                   /db_xref="InterPro:IPR020630"
FT                   /db_xref="InterPro:IPR020631"
FT                   /db_xref="InterPro:IPR020867"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3QA91"
FT                   /protein_id="ACE98977.1"
FT                   /translation="MTARIIDGKTISAEVRARVAAEVTRLKTDHGITPGLAVVLVGNDP
FT                   ASEVYVRSKHKQTQEAGMASFEHRLPADVPQAELMALIAKLNADPAVHGILVQLPLPKG
FT                   LDSNAVIDAIDPAKDVDGLNPTNAGRLASGLFALTPCTPLGSIIMAKTVHASLEGMNAL
FT                   VIGRSNLVGKPLVQLLLNENATVTIAHSRTRDLPALCRQADLVFAAVGKAEMVKGDWIK
FT                   PGATVIDVGINRTPGKDGGKDKLLGDVAFAEAKEVAGAITPVPGGVGLMTVACLLVNTV
FT                   RAACAIHGLPKPAV"
FT   gene            complement(450309..450635)
FT                   /locus_tag="Rpal_0418"
FT   CDS_pept        complement(450309..450635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0418"
FT                   /product="protein of unknown function DUF167"
FT                   /note="PFAM: protein of unknown function DUF167; KEGG:
FT                   nwi:Nwi_0479 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98978"
FT                   /db_xref="InterPro:IPR003746"
FT                   /db_xref="InterPro:IPR036591"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3QA92"
FT                   /protein_id="ACE98978.1"
FT                   /translation="MAEAWRYSAQGVAVAVRVTPRGGRDDIDGLETLSDGRPVVKVRVR
FT                   AIADGGEANRAVTELLAKAVGVPKRNVRLLSGATSRQKQIAIDGDPKQLGEALRRLVAA
FT                   KPAE"
FT   gene            complement(450661..450951)
FT                   /locus_tag="Rpal_0419"
FT   CDS_pept        complement(450661..450951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0419"
FT                   /product="protein of unknown function YGGT"
FT                   /note="PFAM: protein of unknown function YGGT; KEGG:
FT                   nwi:Nwi_0478 protein of unknown function YGGT"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98979"
FT                   /db_xref="GOA:B3QA93"
FT                   /db_xref="InterPro:IPR003425"
FT                   /db_xref="UniProtKB/TrEMBL:B3QA93"
FT                   /protein_id="ACE98979.1"
FT                   /translation="MRAILDIVLIILDLYIWLLIASAILSWLIAFNVVNTRNQFVGAVS
FT                   EFLYRITEPLLAPIRNLLPSLGGLDISPIILILLIMFLQRVITYYIYPAVF"
FT   gene            451151..451226
FT                   /locus_tag="Rpal_R0007"
FT                   /note="tRNA-Ala1"
FT   tRNA            451151..451226
FT                   /locus_tag="Rpal_R0007"
FT                   /product="tRNA-Ala"
FT   gene            complement(451429..452241)
FT                   /locus_tag="Rpal_0420"
FT   CDS_pept        complement(451429..452241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0420"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   bja:bll0552 enoyl-CoA hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98980"
FT                   /db_xref="GOA:B3QA94"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:B3QA94"
FT                   /protein_id="ACE98980.1"
FT                   /translation="MSYQDILYEVADKIATITLNRPDRMNAWTPVMEREVRTAMQQAAA
FT                   DSEVRVIVLTGAGRGFCAGADMQVLQTIDPSDVRRATDLPPFDMNRRPDWQTRYAFYPS
FT                   IPKPIIGMLNGATAGIGLVHALYCDVRFAADSAVFTTAFARRGLIAEHGISWMLPRIVG
FT                   HANALDLLLSARRVSAEEALRMGLVNRLYPIDQLREQTYAYARDLADNVAPASMQVIKR
FT                   QLYEVPFQTLAEATIDANREMAISLASDDFKEGVASFVEKRPPRFSSV"
FT   gene            complement(452323..452823)
FT                   /locus_tag="Rpal_0421"
FT   CDS_pept        complement(452323..452823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0421"
FT                   /product="protein of unknown function DUF1486"
FT                   /note="KEGG: vei:Veis_3840 protein of unknown function
FT                   DUF1486"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98981"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:B3QA95"
FT                   /protein_id="ACE98981.1"
FT                   /translation="MTSEEFARLLESLTRAAESGDGARFAGHFTEDATYHDYIYGPHIG
FT                   RAEIATMMQDLFHRDAADYRWEMFDPVCNGDLGYAWSLSSFTSTVPEFKGQRVVIDGMS
FT                   RFILRGELIAEYRESVNGGVAMAQLGVAPERMAKVFRKWSGWLQHRPETQDYLARPKGT
FT                   RRT"
FT   gene            complement(452927..453724)
FT                   /locus_tag="Rpal_0422"
FT   CDS_pept        complement(452927..453724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0422"
FT                   /product="glutamine amidotransferase class-I"
FT                   /note="PFAM: glutamine amidotransferase class-I; KEGG:
FT                   bbt:BBta_0273 glutamine amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98982"
FT                   /db_xref="GOA:B3QA96"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B3QA96"
FT                   /protein_id="ACE98982.1"
FT                   /translation="MLVRLTDCGRVASPALQPAKTNDPRPVLIVLHQETSTPGRVGNAL
FT                   RTLGHPLDIRRPRFGDPLPHSLDDHAGAVIFGGPMSSNDPDDYIRREIDWIAVPLKERR
FT                   PFLGICLGAQMLAKQLGARVAPHPHGRAEVGYYDIRPTAAGRAMCAHWPRQVYHWHVEG
FT                   FELPAGADLLAEGGDFPVQAIRSDTAYGFQFHPDVTSAMMHRWTTKGHDRLSLPGARPR
FT                   REHFADRAVHDLAERIWLEHFLDHWLSRTPLGEPVAALREAAE"
FT   gene            complement(453845..454624)
FT                   /locus_tag="Rpal_0423"
FT   CDS_pept        complement(453845..454624)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0423"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: nha:Nham_0606 short-chain
FT                   dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98983"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B3QA97"
FT                   /protein_id="ACE98983.1"
FT                   /translation="MTERVTLITGASAGIGVELARIFADNAHRVALVARRGDRLESLAA
FT                   EIRAKGGPEPIVIACDLGKPDAAEQIIAALAAAGVEVEYLVNNAGYGLFGRAMELDRES
FT                   QLGIIDVNNRALTDLTLRFADSIARLRGGILNVASIAGFLPGPGMAVYYASKAYVLSFS
FT                   EAMHQELGPKGVRVTALCPGPVQTEFQNRAGFEPGFDSAVLNVTPAEVARQAYQGLMNN
FT                   KRIVLPGLGVKIVPFLLRFFPRGFIAAAVSGFQLRRR"
FT   gene            complement(454807..455334)
FT                   /locus_tag="Rpal_0424"
FT   CDS_pept        complement(454807..455334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0424"
FT                   /product="protein of unknown function DUF1332"
FT                   /note="PFAM: protein of unknown function DUF1332; KEGG:
FT                   bbt:BBta_0275 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98984"
FT                   /db_xref="InterPro:IPR007791"
FT                   /db_xref="InterPro:IPR029024"
FT                   /db_xref="UniProtKB/TrEMBL:B3QA98"
FT                   /protein_id="ACE98984.1"
FT                   /translation="MLDKLRQFITDVVAPSAPDELMLDDGGYRLAATALLIHVISIDGD
FT                   PSEVEKQKLHSLLEQRFGLDAATATRLIASATLVEGEAVDLYHFTSVIMRSVNEQGRLR
FT                   IVEMMWELVYADGTVTEFEENVVWRAADLLAISTRDRVTLRQKVAAAAPVAPGAAQGGT
FT                   AMGSVAEVDPAN"
FT   gene            complement(455471..456856)
FT                   /locus_tag="Rpal_0425"
FT   CDS_pept        complement(455471..456856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0425"
FT                   /product="cytochrome P450"
FT                   /note="PFAM: cytochrome P450; KEGG: bbt:BBta_0276 putative
FT                   cytochrome P450 hydroxylase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98985"
FT                   /db_xref="GOA:B3QA99"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:B3QA99"
FT                   /protein_id="ACE98985.1"
FT                   /translation="MSIAAIDDRPASRAPLIPPTPPRAPENLSALGRLAAIRQNAIASW
FT                   GDRAYQDDVVRGRFFAHSSYILNTPDAIRHVLVDNTDNYRRTATGIRVLRPMLGEGLLL
FT                   AEGRAWKHQRRTLAPAFTPRAVATLVPHMASATDEVVEGLRRKTGVPLDLRETMQHLAL
FT                   EIAGRTMFSFEMGTHGQALRGFVIDYGTRLASPRFLDLLLPLGWPTPQDVSRALFRRRW
FT                   TRFIGELIAARRAAGKAEGAPPRDLFELMLAARDPETGEAFSDAQLGDQVATMILAGHE
FT                   TTATALFWALYLLALDPDAQERLANEVRRVGPGGTEIERLPFTRAVLDETLRLYPPAFL
FT                   IVREAAGPDQVAGFAVRKHDVMLIAPWLLHRHDKLWSDPNAFVPERFLPGAPSPDRFAY
FT                   LPFGVGPRVCIGAHFALVEATLALAKIVGTFRIELIDSEPVIPIGVVTTQPDRSPPFRL
FT                   TPR"
FT   gene            complement(456977..457978)
FT                   /locus_tag="Rpal_0426"
FT   CDS_pept        complement(456977..457978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0426"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding"
FT                   /note="PFAM: D-isomer specific 2-hydroxyacid dehydrogenase
FT                   catalytic region; D-isomer specific 2-hydroxyacid
FT                   dehydrogenase NAD-binding; KEGG: bja:bll0766 2-hydroxyacid
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98986"
FT                   /db_xref="GOA:B3QAA0"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B3QAA0"
FT                   /protein_id="ACE98986.1"
FT                   /translation="MSVKKKPLVVVTRKLPDSIETRMRELFDARLNLDDVPMTAEQLAE
FT                   AARTADVLVPTVTDEITAAMVNQPDCKLRLIAHFGNGIDNLDVAAAHARGITVTNTPKV
FT                   LTEDTADMTMALILAVPRRMIEGAALLTDGGEWPGWSPTWMLGRRLGGKRLGIIGMGRI
FT                   GQAVARRARAFGLQIHYHNRKPVAPRIADELGATYWDSLDQMLARMDIISVNCPHTPAT
FT                   FHLLSARRLKLVRKDAFIVNTARGEVIDEETLTKLIEAGDIAGAGLDVYEHEPAVNPKL
FT                   VRLAKHGKVVLLPHMGSATIEGRVEMGEKVIINIRTFLDNHKPPDRVLPGML"
FT   gene            458213..458737
FT                   /locus_tag="Rpal_0427"
FT   CDS_pept        458213..458737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0427"
FT                   /product="protein of unknown function DUF1058"
FT                   /note="PFAM: protein of unknown function DUF1058; KEGG:
FT                   nha:Nham_0044 protein of unknown function DUF1058"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98987"
FT                   /db_xref="InterPro:IPR010466"
FT                   /db_xref="UniProtKB/TrEMBL:B3QAA1"
FT                   /protein_id="ACE98987.1"
FT                   /translation="MTMKYLMAVTAFAGAMICAATFAHAGKESPLSASGLPVPRYVSLK
FT                   SDHVNVRVGPTKDNDVAWVYTRAGLPVEVTAEFENWRRVRDSEGAEGWVYHSLLSGRRT
FT                   AVVTMKDKDGLAPLYESASSGSAVVARLQAGVVAQVKRCDMKWCRIVGSGFDGWIEKLQ
FT                   LWGVYADEQVN"
FT   sig_peptide     458213..458290
FT                   /locus_tag="Rpal_0427"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.800 at
FT                   residue 26"
FT   gene            complement(458845..459294)
FT                   /locus_tag="Rpal_0428"
FT   CDS_pept        complement(458845..459294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0428"
FT                   /product="ferric uptake regulator, Fur family"
FT                   /note="PFAM: ferric-uptake regulator; KEGG: nwi:Nwi_0035
FT                   ferric-uptake regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98988"
FT                   /db_xref="GOA:B3QAA2"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B3QAA2"
FT                   /protein_id="ACE98988.1"
FT                   /translation="MHEAHSHAEPRLNGCPWHDVNEMLQSVGLRPTRQRMALGWLLFGK
FT                   GDRHLTAEMLYEEASQAKVPVSLATVYNTLNQLTDVGLLRQVSVDGTKTYFDTNVSAHQ
FT                   HFYLENNHELIDIPNAELELKATPDVPEGYEIARVDVVVRLRKKG"
FT   gene            459595..460122
FT                   /locus_tag="Rpal_0429"
FT   CDS_pept        459595..460122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0429"
FT                   /product="beta-hydroxyacyl-(acyl-carrier-protein)
FT                   dehydratase FabA"
FT                   /EC_number="4.2.1.59"
FT                   /note="KEGG: nwi:Nwi_0034 3-hydroxydecanoyl-(acyl carrier
FT                   protein) dehydratase; TIGRFAM:
FT                   beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabA;
FT                   PFAM: Beta-hydroxyacyl-(acyl-carrier-protein) dehydratase
FT                   FabA/FabZ"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98989"
FT                   /db_xref="GOA:B3QAA3"
FT                   /db_xref="InterPro:IPR010083"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3QAA3"
FT                   /protein_id="ACE98989.1"
FT                   /translation="MRDRRSSYEYEDLLACGRGELFGAGNAQLPLPPMLMFDRITTITE
FT                   DGGEFGKGHVRAELDVNPDLWFFACHFKNDPVMPGCLGLDAMWQMVGFFLGWVGGEGPG
FT                   RALGLGELKFTGQVLPNISKVVYNVDIKRVMRSKLWLGIADGWLSADDEIIYRAKDLKV
FT                   GLFKQTAQPVAG"
FT   gene            460184..461410
FT                   /locus_tag="Rpal_0430"
FT   CDS_pept        460184..461410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0430"
FT                   /product="Beta-ketoacyl synthase"
FT                   /note="PFAM: Beta-ketoacyl synthase; KEGG: bja:blr0770
FT                   3-oxoacyl-(acyl carrier protein) synthase I"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98990"
FT                   /db_xref="GOA:B3QAA4"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:B3QAA4"
FT                   /protein_id="ACE98990.1"
FT                   /translation="MRRVVVTGMGIVSSIGNNTQEVLASLHDAKSGISRAEKHAELGFR
FT                   SQVQGAPTLNPADVVDRRAMRFLGEGAAWNHVAMEQAIADSGLEESEISNIRTGIVMGS
FT                   GGPSARTIVEAADITRTKGPKRVGPFAVPKAMSSTASATLATWFKIKGVNYSISSACAT
FT                   SNHCIGNAYELIQWGKQDVMFAGGCEELDWSLSVLFDAMGAMSSKYNDTPATASRPYDV
FT                   NRDGFVIAGGAGVLVLEELEHAKARGAKIYGEIIGYGATSDGYDMVAPSGEGAERCMKM
FT                   ALATTGGIKIDYINPHATSTPAGDPPEMNAIRAVFGIGDKCPPISATKALTGHSLGATG
FT                   VQEAIYSLLMMQNGFICESAHITELDPAFADMPIVRKRVDNAKLGAVLSNSFGFGGTNA
FT                   TLVFKRLEA"
FT   gene            461586..462395
FT                   /locus_tag="Rpal_0431"
FT   CDS_pept        461586..462395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0431"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   bja:blr0771 enoyl-(acyl carrier protein) reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98991"
FT                   /db_xref="GOA:B3QAA5"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR014358"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B3QAA5"
FT                   /protein_id="ACE98991.1"
FT                   /translation="MQGLMQGKRGLIMGVANDHSIAWGMAKTLAAHGAELAFTYQGEAL
FT                   ARRVKPLAQSLNSDLVLPCDVEDIASVDAVFDTLKDKWGKLDFVIHAIGFSDKNELRGQ
FT                   YIDTSRANFSRTMVISCFSFTEVAKRAAALMPDGGAMITLTFGASERAMPNYNVMGLAK
FT                   AALEASVRYLACDLGPKGIRVNAVSAGPVRTLAGAGIGDSRAMFGFMEKHSPLGRGVTL
FT                   EELGGSALYLLSDLSGGVTGETHYVDSGYNIVLMPKPDALKADADKA"
FT   gene            complement(462579..463097)
FT                   /locus_tag="Rpal_0432"
FT   CDS_pept        complement(462579..463097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0432"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: oan:Oant_3604 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98992"
FT                   /db_xref="InterPro:IPR021417"
FT                   /db_xref="UniProtKB/TrEMBL:B3QAA6"
FT                   /protein_id="ACE98992.1"
FT                   /translation="MLLRLPVITAAMLAVVGLAHADDDELAIQGIGISRDIDCQGKNVG
FT                   VYGAENEIALTGQCRTITVHGSKHKVSFEQGQTLSVSGSDNTVNGGRAKDVVVSVAKNT
FT                   VTTTLEAGDEPGTLKATGANNKITLVLSGPSRLDVGGVEQVVEWSKADGAPNPEVRSSG
FT                   ALNSIKRKK"
FT   sig_peptide     complement(463032..463097)
FT                   /locus_tag="Rpal_0432"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 22"
FT   gene            complement(463325..465535)
FT                   /locus_tag="Rpal_0433"
FT   CDS_pept        complement(463325..465535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0433"
FT                   /product="catalase/peroxidase HPI"
FT                   /note="TIGRFAM: catalase/peroxidase HPI; PFAM: Haem
FT                   peroxidase; KEGG: mes:Meso_0626 catalase/peroxidase HPI"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98993"
FT                   /db_xref="GOA:B3QAA7"
FT                   /db_xref="InterPro:IPR000763"
FT                   /db_xref="InterPro:IPR002016"
FT                   /db_xref="InterPro:IPR010255"
FT                   /db_xref="InterPro:IPR019793"
FT                   /db_xref="InterPro:IPR019794"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3QAA7"
FT                   /protein_id="ACE98993.1"
FT                   /translation="MDAKTDDKGAGKCPFSGGSHGHRNRDWWPDQLDISVLHNNSKKSD
FT                   PMGAAFNYAEEFKKLDLEAVKKDLHALMTDSQEWWPADFGHYGGLFVRMAWHSAGTYRI
FT                   TDGRGGAGAGQQRFAPLNSWPDNANLDKARRLLWPIKQKYGSKISWADLMVLTGNVALE
FT                   SMGFKTFGFAGGRADVWEPEELYWGPEGTWLGDERYSGERQLAEPLGAVQMGLIYVNPE
FT                   GPNGNPDPVAAAKDIRETFARMAMDDEETVALIAGGHTFGKTHGAGDPSLIGPAPEGGL
FT                   LEEQGLGWTSKYGSGFGADAITGGPEVIWTQTPTQWSNHFFENLFGFEWELDKSPAGAK
FT                   QWKAKGAEATVPDPFDPAKKRVPTMLTTDLSLRFDPIYEKISRRFLENPDQFADAFARA
FT                   WFKLTHRDMGPRERYLGPEVPKEELIWQDPIPAVNHELVGEADIEALKAKILASGLSVA
FT                   QLVSTAWASASTFRGSDKRGGANGARIRLAPQKDWEVNQPAELAQVLSKLEAIQGEFNG
FT                   AQKDGKKVSLADLIVLGGAAAIEKAAKDAGTAVKVPFTPGRMDASAEQTDVESFKVLEP
FT                   RADGFRNYINTKRHQFMHPEEALVDKAQLLTLTGPELTVLVGGLRVLGANYAHSTHGVL
FT                   TERPEKLTNDFFVNLLDMGTKWTKANGEVEIYEGRDRKNGELKWTGTRVDLVFGSHSQL
FT                   RAFAEVYACSDAQEKFVSDFVAAWSKVMNADRFDIVAKKQAA"
FT   gene            465805..466743
FT                   /locus_tag="Rpal_0434"
FT   CDS_pept        465805..466743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0434"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: nwi:Nwi_0029 regulatory protein,
FT                   LysR"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98994"
FT                   /db_xref="GOA:B3QAA8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B3QAA8"
FT                   /protein_id="ACE98994.1"
FT                   /translation="MISLRQLRYLSALARHGHFGRAADACSVTQPALSMQIAELERTLG
FT                   IKVVERRPGEVFLTDIGREIARRAEEVLAATRDLVDFARHRAKPLTGRLSLGVIPSLAP
FT                   YLLPKVLPLLQQHFPELRLELRESQTRPLVADVVSGVLDAALLALPVGHSDLDAIPLFD
FT                   DPFLLAVPADDPRAETTPIGVEEIDQSRLILLEDGHCLRDQALAFCATARNRGIQMGSA
FT                   GTASFGASSLTTVIQMVAGGYGITLIPQIAAEVERRDSRVKFLRLRRPQPGRSVGLVFR
FT                   KTSPRRGDFEAFGEVVKQGIGGAAPIESAVA"
FT   gene            complement(466755..468437)
FT                   /locus_tag="Rpal_0435"
FT   CDS_pept        complement(466755..468437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0435"
FT                   /product="methyl-accepting chemotaxis sensory transducer
FT                   with Pas/Pac sensor"
FT                   /note="KEGG: bbt:BBta_2308 putative methyl-accepting
FT                   chemotaxis receptor/sensory transducer with PAS domain;
FT                   TIGRFAM: PAS sensor protein; PFAM: chemotaxis sensory
FT                   transducer; PAS fold-3 domain protein; PAS fold-4 domain
FT                   protein; PAS fold domain protein; SMART: PAS domain
FT                   containing protein; PAC repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98995"
FT                   /db_xref="GOA:B3QAA9"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B3QAA9"
FT                   /protein_id="ACE98995.1"
FT                   /translation="MFSFTRSAGHDHAAAMLAALNRSQAVIEFDLDGNVIDANDNFLTA
FT                   LGYSLPEIKGKHHRMFVDPSEHDSTAYREFWTALRTGQYQAGEFHRIGKGGREVWIQAS
FT                   YNPILDKNGKPTGVVKFAADITAAKTQSLEDAGKLAAIGRAQAVIEFAMDGTVLTANDN
FT                   FLAAMEYSLGEIKGKHHSMFVEPSVRESSDYREFWARLNRGEYFPGEFKRIGKGGKEVW
FT                   ILASYNPILDARGKPFKVVKYATDVTAQKLKNADFSGQIDAIRKSQAVIEFSIDGTVLD
FT                   ANDNFLHALGYSLGEIKGRHHSIFIDPAERESAAYRAFWAALGRGDYQAGEYKRIGKGG
FT                   REVWIQASYNPILDLNGRPFKVVKYAADTTRQVLTRLGNERVRAMMESVAAGAEELNAS
FT                   VREISEAMTKSRQTAMNAVGEVDAADSQANQLNDAAQAMSGIVELINHITGQINLLALN
FT                   ATIESARAGEAGRGFAVVAAEVKNLANQAKQATDKIGTEISNLTSVSGDVVGALGKIKS
FT                   AIQNVSEYVSSTAAAVEEQSTVTSEMSSSMQRAAAEAAAIAAG"
FT   gene            complement(468727..470895)
FT                   /locus_tag="Rpal_0436"
FT   CDS_pept        complement(468727..470895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0436"
FT                   /product="Polyribonucleotide nucleotidyltransferase"
FT                   /EC_number="2.7.7.8"
FT                   /note="KEGG: nwi:Nwi_0028 polynucleotide
FT                   phosphorylase/polyadenylase; PFAM: 3' exoribonuclease; RNA
FT                   binding S1 domain protein; KH type 1 domain protein;
FT                   Exoribonuclease, phosphorolytic domain 2; Polynucleotide
FT                   phosphorylase, phosphorolytic RNA-binding,
FT                   bacterial/organelle-type; SMART: KH domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98996"
FT                   /db_xref="GOA:B3QAB0"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR012162"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR015848"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="InterPro:IPR036456"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3QAB0"
FT                   /protein_id="ACE98996.1"
FT                   /translation="MFNIHSVEIDWGGRPLKLETGKVARQADGAVVATYGETVVLATVV
FT                   AAKSPREGVDFLPLTVDYQEKAYAAGRIPGGYFKREGRPTEKETLVSRLIDRPIRPLFA
FT                   DGWRNETQVIVTVLSHDMENDPDVLAMVAASAALTLSGVPFKGPIGAARVGFINDEYVL
FT                   NPVLDEMAETQLELVVAGTADAVLMVESEAKELSEEIMLGAVMFGHRHFQPVIDAIIDL
FT                   AEKAAKEPRELTVVDDSEIEKEMLGLVEQELRAAYAIPVKQDRYAAVGKVKEKAIAHFF
FT                   PEGQEPKYDKLRIAGVFKELEAKIVRWNILDTGKRIDGRDSKTVRNILAQVGVLPRTHG
FT                   SALFTRGETQALVVTTLGTGEDEQYVDSLSGTYKETFLLHYNFPPYSVGETGRLGGTKR
FT                   REIGHGKLAWRAIHPVLPPHHEFPYTIRVVSEITESNGSSSMASVCGASLALMDAGVPL
FT                   KRPTAGIAMGLILEGERFAVLSDILGDEDHLGDMDFKVAGTEQGITSLQMDIKIAGITE
FT                   EIMKVALGQAKDGRIHILGEMSKALDRARAELGEHAPRIETFKIPTDKIREVIGTGGKV
FT                   IREIVEKTGAKVNIEDDGTVKVASSDGESIKAAIKWIKSIASDPEIGEIYEGTVVKVME
FT                   FGAFVNFFGAKDGLVHISQLAAGRVQKTSDVVKEGDKVKVKLLGFDDRGKTRLSMKVVD
FT                   QTTGEDLEAKQKAEAKAEGEAPAQAAGE"
FT   gene            complement(471234..471503)
FT                   /locus_tag="Rpal_0437"
FT   CDS_pept        complement(471234..471503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0437"
FT                   /product="ribosomal protein S15"
FT                   /note="PFAM: ribosomal protein S15; KEGG: bja:bsl0780 30S
FT                   ribosomal protein S15"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98997"
FT                   /db_xref="GOA:B3QAB1"
FT                   /db_xref="InterPro:IPR000589"
FT                   /db_xref="InterPro:IPR005290"
FT                   /db_xref="InterPro:IPR009068"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3QAB1"
FT                   /protein_id="ACE98997.1"
FT                   /translation="MSITAERKAEVIKTSATKAGDTGSPEVQVAILSERITNLTAHFKT
FT                   HTKDNHSRRGLLKLVSTRRSLLDYIKKKDEARYKALLEKHNIRR"
FT   gene            complement(471506..472606)
FT                   /locus_tag="Rpal_0438"
FT   CDS_pept        complement(471506..472606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0438"
FT                   /product="tRNA pseudouridine synthase B"
FT                   /note="TIGRFAM: tRNA pseudouridine synthase B; PFAM:
FT                   pseudouridylate synthase TruB domain protein; KEGG:
FT                   nwi:Nwi_0026 tRNA pseudouridine synthase B"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98998"
FT                   /db_xref="GOA:B3QAB2"
FT                   /db_xref="InterPro:IPR002501"
FT                   /db_xref="InterPro:IPR014780"
FT                   /db_xref="InterPro:IPR015240"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR032819"
FT                   /db_xref="UniProtKB/TrEMBL:B3QAB2"
FT                   /protein_id="ACE98998.1"
FT                   /translation="MTVTTPDALLAPHDVQHAGADESAAQIRKPRDNKDPRNANRGGGN
FT                   GKPRRDKRDVHGWVVLDKPIGMTSTQAVAVLKRLFSAKRAGHAGTLDPLASGGLPIAMG
FT                   EATKTVPFVMDGRKRYRFTVAWGEERDTDDTEGRAVATSPDRPTAEAIRALLPRFTGVI
FT                   EQVPPQYSAVKIQGERAYDLARDGEVVPLVPRPVEIHELTLVEHGDDGRSVFEAECGKG
FT                   TYVRALARDMGRLLGCYGHICALRRTVVGPFDESDMIPLEELQALCDRAASGEGSLADA
FT                   LLPVETALDDIPALAVTRADAARLHRGQAVLLRGRDAPHCSGTVYVTVAGRLLALAEVG
FT                   NGELIPKRVFNLTGLTASSAVRKESI"
FT   gene            complement(472606..473019)
FT                   /locus_tag="Rpal_0439"
FT   CDS_pept        complement(472606..473019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0439"
FT                   /product="ribosome-binding factor A"
FT                   /note="PFAM: ribosome-binding factor A; KEGG: nwi:Nwi_0025
FT                   ribosome-binding factor A"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98999"
FT                   /db_xref="GOA:B3QAB3"
FT                   /db_xref="InterPro:IPR000238"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR020053"
FT                   /db_xref="InterPro:IPR023799"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3QAB3"
FT                   /protein_id="ACE98999.1"
FT                   /translation="MSRQHQKSSPPGGSTRSLRVGELIRHAVAEILAQGGVHDPVLESH
FT                   LVTVPEVRMSPDLKLATIYVMPLGGRDEKLVIDALEHHKRFLRGEIAHRVNLKFAPELR
FT                   FRIDERFAEAERIDKLLRSPAVQKDLEPNSDQD"
FT   gene            complement(473193..475844)
FT                   /locus_tag="Rpal_0440"
FT   CDS_pept        complement(473193..475844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0440"
FT                   /product="translation initiation factor IF-2"
FT                   /note="TIGRFAM: translation initiation factor IF-2; small
FT                   GTP-binding protein; PFAM: protein synthesis factor
FT                   GTP-binding; GTP-binding protein HSR1-related; elongation
FT                   factor Tu domain 2 protein; translation initiation factor
FT                   IF-2 domain protein; Initiation factor 2 associated domain
FT                   protein; KEGG: bja:bll0783 translation initiation factor
FT                   IF-2"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99000"
FT                   /db_xref="GOA:B3QAB4"
FT                   /db_xref="InterPro:IPR000178"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006847"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR013575"
FT                   /db_xref="InterPro:IPR015760"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036925"
FT                   /db_xref="UniProtKB/TrEMBL:B3QAB4"
FT                   /protein_id="ACE99000.1"
FT                   /translation="MVDTKTPGDKTLTMPTKTLTLKPRVEQGVVRQSFSHGRSKQVVVE
FT                   KRGKRRLGGDEPAAPAAPEVAKKPAPAPAAPPRQQQSRPAPQQSRSGMVLRTLTEDERT
FT                   ARATALADARVREIEERKQAEIEAQRRAEQEKIEKAEREAAEARRKAEEERHRQEDEAK
FT                   RKAETEAKKRFGDAEPAKKPAETSTTTTTAAPARPATTTTRAPTPAGRPPAVAAEAGDD
FT                   DEAPRMIRRPGGPARPAPPPKQPAAKPGASKQRGRLTVVTALNADDVRERSIASFRRRT
FT                   QRLKGHASNEPKEKLVREVVIPEVIAIQELANRMSERAVDVIRLLMKQGAMHKITDVID
FT                   ADTAQLIAEELGHTVKRVAASDVEEGLFDVVDDSTDTEPRSPVVTVMGHVDHGKTSLLD
FT                   ALRHANVVSGEAGGITQHIGAYQVTSPESGKKITFIDTPGHAAFTAMRARGAKVTDIVV
FT                   LVVAADDGVMPQTIEAINHAKAAGVPIIVAINKIDKPDAKPDRVRTDLLQHNVQVESMG
FT                   GDVVDVEVSAKNKINLDKLLEMIALQAEILELKTNTQRPAEGTVIEAKLDRGRGPVATV
FT                   LVQRGTLRVGDIIVAGAEMGRVRALISDQGETVQEAGPSVPVEVLGFNGPPEAGDRLAV
FT                   VENEARARQITDYRAHQKREKSAASVSGMRGSLEQMMTQLKTSGRKEFPLIVKADVQGS
FT                   LEAILGSLEKLGTDEVAARILHAGVGGISESDVTLAEGFNAVILGFSVRANKEAAAAAK
FT                   RNGIEIRYYNIIYDLVDDIKKAMSGLLAPTLRETMLGNAQILEIFNISKVGKVAGCRVT
FT                   DGTVERGANVRLIRDNVVVHEGKLSTLKRFKDEVKEVVAGQECGMAFENYTDMRAGDII
FT                   ECYRVETIQRSL"
FT   gene            complement(475837..476616)
FT                   /locus_tag="Rpal_0441"
FT   CDS_pept        complement(475837..476616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0441"
FT                   /product="protein of unknown function DUF448"
FT                   /note="PFAM: protein of unknown function DUF448; KEGG:
FT                   nwi:Nwi_0023 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99001"
FT                   /db_xref="InterPro:IPR007393"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="InterPro:IPR035931"
FT                   /db_xref="InterPro:IPR037465"
FT                   /db_xref="UniProtKB/TrEMBL:B3QAB5"
FT                   /protein_id="ACE99001.1"
FT                   /translation="MLAAETGADLDDGPRAKTPATERMCAVTRQVRPTGELIRFVVGPA
FT                   GEAVADLKRKLPGRGLWVTASREMVTQAVRRRVFAKGFRRDVKAPADLADAIERLLARS
FT                   AQDALAIAAKAGQVVCGFGKVETALKSREAVAVIHATDGAADGIRKLDGLCRQIDEDAT
FT                   AGRKFPRIAALSSAELDLALGRSNVIHAALLAGPAGQTFLSRCQILVRYRLADDGNADA
FT                   ATAGTPIDTPKDAADQDAADEVRANAHNVERLGLLNG"
FT   gene            complement(476678..478291)
FT                   /locus_tag="Rpal_0442"
FT   CDS_pept        complement(476678..478291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0442"
FT                   /product="NusA antitermination factor"
FT                   /note="KEGG: bja:bll0785 transcription elongation factor
FT                   NusA; TIGRFAM: transcription termination factor NusA; PFAM:
FT                   RNA binding S1 domain protein; NusA domain protein; SMART:
FT                   KH domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99002"
FT                   /db_xref="GOA:B3QAB6"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR010213"
FT                   /db_xref="InterPro:IPR010214"
FT                   /db_xref="InterPro:IPR010995"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013735"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR025249"
FT                   /db_xref="InterPro:IPR030842"
FT                   /db_xref="InterPro:IPR036555"
FT                   /db_xref="UniProtKB/TrEMBL:B3QAB6"
FT                   /protein_id="ACE99002.1"
FT                   /translation="MAVSANRLELLQIADAVAREKTIDRSIVIAAMEDAIAKAARARYG
FT                   SETDVHAEIDPKKGELRLSRHMLVVEQVENPANQISLKDAQRANPGAQIGDTIADTLPP
FT                   LEYGRIAAQSAKQVIVQKVREAERDRQYMEFKDRIGDIVNGVVKRVEYGSVIVDLGRGE
FT                   AIIRRDEMLPRESFRNGDRVRAYVFDVRRETRGPQIFLSRTHPQFMAKLFAQEVPEIYD
FT                   GIVEIKAVARDPGSRAKIGVVSRDSSVDPVGACVGMRGSRVQAVVNELQGEKIDIIPWS
FT                   PDIATFVVNALAPAEVSKVVIDEDRERIEVVVPDTNNQLSLAIGRRGQNVRLASQLTGW
FT                   DIDILTESEESERRQADFEKTTRAFMDALNVDEVVGQLLASEGFTSVEELALVDPRELA
FT                   SIEGFDEETAAELQTRASEYLDRIESELEARRLELGVEDALKDVPGVTSKMLVKFGEND
FT                   VKTVEDLAGCATDDLVGWTERKDGAEPVKYPGILDGMEMSREDAEHLIMQARVKAGWID
FT                   ESELASEEEPADEASDESAD"
FT   gene            complement(478294..479073)
FT                   /locus_tag="Rpal_0443"
FT   CDS_pept        complement(478294..479073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0443"
FT                   /product="protein of unknown function DUF150"
FT                   /note="PFAM: protein of unknown function DUF150; KEGG:
FT                   bbt:BBta_0054 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99003"
FT                   /db_xref="GOA:B3QAB7"
FT                   /db_xref="InterPro:IPR003728"
FT                   /db_xref="InterPro:IPR028989"
FT                   /db_xref="InterPro:IPR028998"
FT                   /db_xref="InterPro:IPR035956"
FT                   /db_xref="InterPro:IPR036847"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3QAB7"
FT                   /protein_id="ACE99003.1"
FT                   /translation="MTEPTPAVPETDDLAEPRLVIEPGVAARFCAVAEPVLMAMGYRLV
FT                   RIKVSGDAGCTVQIMAERPDGTMLIDDCEAASRALSPVLDVADPIDRAYRLEISSPGID
FT                   RPLVRRSDFARYAGHLVKIEMAVPHQGRKRYRGLLDGVEGDAVRVQREGATKDEDPLVL
FT                   LPMHDIGDARLVLTDELIAESMRRGKQAERDLKQSLGLAPEPPPHAKRSDPKKSHAPKR
FT                   GPKAAKAPTKPKPQNTKQHRLAADKARRGEIDTSEGD"
FT   gene            479406..480491
FT                   /locus_tag="Rpal_0444"
FT   CDS_pept        479406..480491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0444"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bja:blr0787 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99004"
FT                   /db_xref="InterPro:IPR019285"
FT                   /db_xref="UniProtKB/TrEMBL:B3QAB8"
FT                   /protein_id="ACE99004.1"
FT                   /translation="MPAATSLLPELDDIVRQGDPVRRADAVRRISDLYIRGAESFQPDH
FT                   VALFDGILLTLVPEIDVEVRSELAQRFSEITNAPPELVRQLVHDEDIGIAGPLLRRSTM
FT                   LDDPTLVELARLRGQTHLLAISERLSISPPITDVIVRRGDRDVVRKVAGNAGAEFSATG
FT                   FNGLIRRAAQDGVLAVAVGTRDDLSPPRLKDLLACSTDLVRRRLFESARPSARIAINRA
FT                   MRELAGESRQPSVQRDFDAAQRSVVELHNRGELNEATVIGFARAHQYEETVAALSAMTG
FT                   TRISTLDQMMSGERHDPVLILGKALGFGWATVRALIGLRLGPDRSVACPDVEEAQHNFE
FT                   RLALSTAQRVLGFWKMRQADA"
FT   gene            480615..481463
FT                   /locus_tag="Rpal_0445"
FT   CDS_pept        480615..481463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0445"
FT                   /product="Phytanoyl-CoA dioxygenase"
FT                   /note="PFAM: Phytanoyl-CoA dioxygenase; KEGG: pla:Plav_0212
FT                   phytanoyl-CoA dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99005"
FT                   /db_xref="GOA:B3QAB9"
FT                   /db_xref="InterPro:IPR008775"
FT                   /db_xref="UniProtKB/TrEMBL:B3QAB9"
FT                   /protein_id="ACE99005.1"
FT                   /translation="MLSEADITTHAQRIRDDGYTVIERAADPALVAALIGAVERIERDH
FT                   QLGCAKTSFEGFKTLRVNNLLTYDEVFWDVPLHSSVLPIVEAVLDKECLLSSFCSLVLG
FT                   PGQEAQPIHEDTQLIPLPRPHIPITLNAIWALSDFTATNGATRIIPGSHKYATSPVYGQ
FT                   DYDAVTATMPAGSVMLFDSALWHGGGPNSSDARRFAFSCAYCWGWMRQQENLQLGIPRE
FT                   IAQRFPRRLQELCGYSVYKGQFGHIDNRDPIELLGRERGKRMVWEATDVRSARLAGQVT
FT                   N"
FT   gene            complement(481476..482273)
FT                   /locus_tag="Rpal_0446"
FT   CDS_pept        complement(481476..482273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0446"
FT                   /product="tRNA (guanine-N(7)-)-methyltransferase"
FT                   /EC_number="2.1.1.33"
FT                   /note="KEGG: bra:BRADO0048 tRNA
FT                   (guanine-N(7))-methyltransferase; TIGRFAM: tRNA
FT                   (guanine-N(7)-)-methyltransferase; PFAM: putative
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99006"
FT                   /db_xref="GOA:B3QAC0"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B3QAC0"
FT                   /protein_id="ACE99006.1"
FT                   /translation="MAVLYAGRPVQKCERSRLMFNIDQPDSAPDNEDHDGDVVMHGQGS
FT                   FFGRRKGHKLRAHQADLIENLLPHLSLQIDSPAPEPLTTLFDLPVEHMRLEIGFGGGEH
FT                   LIAEALAHPDTGFIGAEPYVNGMAKILARIEAENIRNIRLFAGDASELLAWVPAGSLAR
FT                   IDLIHPDPWPKRRHWKRRFVQDATVAAMARALTPHGEFRFVCDIDGYTAWTLAHLLRAP
FT                   CFDWLAQRADDWRKPWPNYTMTRYGRKAEREGRRANYLRFERL"
FT   gene            complement(482348..482767)
FT                   /locus_tag="Rpal_0447"
FT   CDS_pept        complement(482348..482767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0447"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   nha:Nham_0026 transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99007"
FT                   /db_xref="GOA:B3QAC1"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B3QAC1"
FT                   /protein_id="ACE99007.1"
FT                   /translation="MSTKAPNPVDKYVGSRVRMRRIMLGMSQEKLGEALGLTFQQVQKY
FT                   EKGTNRVGASRIQQIAEVLQVPVSFLFEGGPSGGLANGNGFSEAPSPSYVSDFLATSEG
FT                   LALTRAFTKITDAKLRRSIVDLVERIAAREADETN"
FT   gene            complement(482968..484578)
FT                   /locus_tag="Rpal_0448"
FT   CDS_pept        complement(482968..484578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0448"
FT                   /product="apolipoprotein N-acyltransferase"
FT                   /note="TIGRFAM: apolipoprotein N-acyltransferase; PFAM:
FT                   Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase; KEGG: nha:Nham_0025 apolipoprotein
FT                   N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99008"
FT                   /db_xref="GOA:B3QAC2"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR004563"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:B3QAC2"
FT                   /protein_id="ACE99008.1"
FT                   /translation="MTRRGVLSRIASGIILAWGWKRAVIALLAGALSSLAMEPFNAWPV
FT                   LFITFPIAVWLIDGSAAGKRRGVPAAAMAGWWFGFGYFVPGLYWIGYAFLVDADTFAWL
FT                   LPAAICGLPAYLALFTALGFALARLLWRPDSLRILSLAVSLTISEWLRGHLLTGFPWNA
FT                   FGYALTEPLALAQSISVIGIWGLTLLTVAIFASPAALIDGGTNARRRWAVPAMALGVLA
FT                   AMAVFGGIRLKLSPTQLVDNVRLRIMQPNLPQDARFNYSAKADVMQKYLSLSDRSTGPK
FT                   STGVRDVSLLIWPESAFPFFLSREADAMAQIAELLPKGTVLLTGAVRPPELPPGRRITR
FT                   AYNSIYAIDHDGSILSVYDKLHLVPFGEFLPYQNLMEKIGFVQLTKVQGGFLSGVARHN
FT                   LELPNAPPLLPLICYEAIFPDEIAIGNNRPGWMLNLTNDGWFGISSGPYQHLQQARMRA
FT                   IEQGLPLVRAANTGVSAVIDPVGRIVAELGLGLEGVLDSGLPAPVAPTIYARVGELPAA
FT                   VLVALVMMLVLLRKRPPGS"
FT   sig_peptide     complement(484468..484578)
FT                   /locus_tag="Rpal_0448"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.956) with cleavage site probability 0.941 at
FT                   residue 37"
FT   gene            complement(484575..485720)
FT                   /locus_tag="Rpal_0449"
FT   CDS_pept        complement(484575..485720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0449"
FT                   /product="CBS domain containing protein"
FT                   /note="PFAM: CBS domain containing protein;
FT                   transporter-associated region; KEGG: bja:bll0792 magnesium
FT                   and cobalt efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99009"
FT                   /db_xref="GOA:B3QAC3"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:B3QAC3"
FT                   /protein_id="ACE99009.1"
FT                   /translation="MPDGDRAENGSQASLQDSTRGQLPAVVHQGEVLHPHGGSWLIRAI
FT                   RSLFGWKPGSVRDDLQVVLDTSPPDDTGFSTLERTMLRNILGLHDRRIADVMVHRADIV
FT                   AIKQDIQLGELLSLFQDAAHSRLVVYNETLDDPVGIVHIRDLVAFMTAKAKVPPATVAK
FT                   RKKALPAGLDLRAIDLKMPLTETGIIRKLLYVPPSMRAIDLLAQMQAARIHLALVVDEY
FT                   GGTDGLVSIEDIVEQIVGEIDDEHDSTEPPSIVRQADGSFIADARASLEDVRAMIGDQF
FT                   VTGEAGEDVETLGGYLVNHVGRLPVRGEVIAGPGTFEFEVLDADPRRVKRLRIGPRKER
FT                   PAPRTRDSRRRETATDSAAPQTTDSGGSTSSPPAGDGTGSP"
FT   gene            complement(485722..486225)
FT                   /locus_tag="Rpal_0450"
FT   CDS_pept        complement(485722..486225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0450"
FT                   /product="protein of unknown function UPF0054"
FT                   /note="PFAM: protein of unknown function UPF0054; KEGG:
FT                   nha:Nham_0023 protein of unknown function UPF0054"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99010"
FT                   /db_xref="GOA:B3QAC4"
FT                   /db_xref="InterPro:IPR002036"
FT                   /db_xref="InterPro:IPR020549"
FT                   /db_xref="InterPro:IPR023091"
FT                   /db_xref="UniProtKB/TrEMBL:B3QAC4"
FT                   /protein_id="ACE99010.1"
FT                   /translation="MTHSARPFTEVVIEADCWQAEASAEATVLRAIETAADAVDADTGG
FT                   AELAVMLTDDDHIRQLNASFRDKDKPTNVLSFPAAQPEVQPDGAPRMLGDIAIAYQTVR
FT                   READDEGKPFDHHLSHLAVHGFLHLVGYDHETDEEAEEMEDAERAILARLGIPDPYAGQ
FT                   DRVS"
FT   gene            complement(486294..487349)
FT                   /locus_tag="Rpal_0451"
FT   CDS_pept        complement(486294..487349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0451"
FT                   /product="PhoH family protein"
FT                   /note="PFAM: PhoH family protein; KH type 1 domain protein;
FT                   KEGG: bbt:BBta_0047 putative phosphate starvation-inducible
FT                   protein, PhoH-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99011"
FT                   /db_xref="GOA:B3QAC5"
FT                   /db_xref="InterPro:IPR003714"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/TrEMBL:B3QAC5"
FT                   /protein_id="ACE99011.1"
FT                   /translation="MVKSAPESSSFVSRRKPDRDSLNPPETQVVIDFDDNRAASALVGP
FT                   YGQNLAQIERRLSVVVDSRGNHITIGGSREGCDAARRVLETLYAQAVSGHDLVQGDVEG
FT                   AIRAVIAQGSLFEFDTKQPSATAFEAINLRKRPVRARTAAQDSYIRALKRHELVFGVGP
FT                   AGTGKTWLAVAHAAQLFERKEVDRIILSRPAVEAGERLGFLPGDLREKVDPYLRPIYDA
FT                   LYDLMDARIVERALQSGEIEIAPLAFMRGRTLTNAAIILDEAQNTTSMQMKMFLTRLGE
FT                   NSRMIITGDPSQVDLPNGQTSGLAEAARLLSGVEGIAQVQFRAEDVIRHELVARIVAAY
FT                   EGAPSPANGKS"
FT   gene            complement(487356..488747)
FT                   /locus_tag="Rpal_0452"
FT   CDS_pept        complement(487356..488747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0452"
FT                   /product="RNA modification enzyme, MiaB family"
FT                   /EC_number="1.3.1.74"
FT                   /note="KEGG: bja:bll0795 hypothetical protein; TIGRFAM: RNA
FT                   modification enzyme, MiaB family; tRNA-i(6)A37
FT                   thiotransferase enzyme MiaB; PFAM: deoxyribonuclease/rho
FT                   motif-related TRAM; Radical SAM domain protein; Protein of
FT                   unknown function UPF0004; SMART: Elongator protein
FT                   3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99012"
FT                   /db_xref="GOA:B3QAC6"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006463"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3QAC6"
FT                   /protein_id="ACE99012.1"
FT                   /translation="MSPPRKLHIKSYGCQMNVYDAQRMVDALAPEGFVETANVDDADLV
FT                   ILNTCHIREKASEKVYSELGRLRVARDEAANHGRRMQIAVAGCVAQAEGEEIIRRAPVV
FT                   DVVVGPQSYHNLPQLLAKAEQHGRALETEFPIEDKFGVLPQPAPDAIRARGISAFVTVQ
FT                   EGCDKFCTFCVVPYTRGAEMSRPVVAIVEDVKRLAENGVREVTLIGQNVNAYHGDGPDG
FT                   RAWSLGRLVRRLAEIPGIVRLRYSTSHPNDVDDDLLAAHRDLPALMPFVHLPVQSGSDR
FT                   ILAAMNRKHTADDYRRVIDRFRSASETIAFSSDFIVGFPGETERDFSATLALVAQIGYA
FT                   GAYSFKYSPRPGTPAADMVEMVPAAVMDERLEQLQQLIDQQQSAFNKAAIGRTVEVLFE
FT                   RAGRKPGQIVGRTAYLQPAHVMAPDSIIGKVLPVRVDSLERYSLLGELASATSRPADAM
FT                   AATGA"
FT   gene            complement(488867..489526)
FT                   /locus_tag="Rpal_0453"
FT   CDS_pept        complement(488867..489526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0453"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   3"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 3; HAD-superfamily hydrolase, subfamily IA, variant
FT                   1; PFAM: Haloacid dehalogenase domain protein hydrolase;
FT                   KEGG: bja:bll0796 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99013"
FT                   /db_xref="GOA:B3QAC7"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:B3QAC7"
FT                   /protein_id="ACE99013.1"
FT                   /translation="MTPELVIFDCDGVLVDSELISCRIHAETLTRYGYPITPDQVAARF
FT                   LGRSGREARREIEAEIGRRFADDIEANLLDALLRAFAETLQPIPFVTDALDTLGRPFCV
FT                   ASSGTLDRIGVALTHAGLHARFAPHLFSAQQVAHGKPAPDLFLFAAAQMGAAPERCVVI
FT                   EDSVPGVLGAKAAGMTVLGFHGGSHCTDATAAALAAAGADRCFDDMRQLTEIIEEI"
FT   gene            complement(489614..490045)
FT                   /locus_tag="Rpal_0454"
FT   CDS_pept        complement(489614..490045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0454"
FT                   /product="ferric uptake regulator, Fur family"
FT                   /note="PFAM: ferric-uptake regulator; KEGG: nha:Nham_0020
FT                   ferric uptake regulator, FUR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99014"
FT                   /db_xref="GOA:B3QAC8"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B3QAC8"
FT                   /protein_id="ACE99014.1"
FT                   /translation="MSEPKATEIEARCAATGMRMTEQRRVIARVLAESEDHPDVEELYT
FT                   RCVAIDDKISISTVYRTVKLFEDAGIIERHDFREGRARYEQMRDSHHDHLINLRDGTVI
FT                   EFTNEEIEKLQAEIARRLGYKLVDHRLELYCVPLEDDKS"
FT   gene            complement(490108..490593)
FT                   /locus_tag="Rpal_0455"
FT   CDS_pept        complement(490108..490593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0455"
FT                   /product="ribosomal-protein-alanine acetyltransferase"
FT                   /note="TIGRFAM: ribosomal-protein-alanine
FT                   acetyltransferase; PFAM: GCN5-related N-acetyltransferase;
FT                   KEGG: bja:bll0798 putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99015"
FT                   /db_xref="GOA:B3QAC9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR006464"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B3QAC9"
FT                   /protein_id="ACE99015.1"
FT                   /translation="MMTWLAEFWGYADTVVETATLRDAPKLAELHAASFHRGWDEQEFA
FT                   DLLSERNTLVHRLRVGRRIIGFVASRIGADEAEILSIAVAASYRGRGLSREMLLTHLGH
FT                   LAGRGVATVFLEVEENNQPARRLYNRTGFQVVGRRERYYRQPNGEQLNALIMRRDLS"
FT   gene            complement(490616..491311)
FT                   /locus_tag="Rpal_0456"
FT   CDS_pept        complement(490616..491311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0456"
FT                   /product="peptidase M22 glycoprotease"
FT                   /note="PFAM: peptidase M22 glycoprotease; KEGG:
FT                   nha:Nham_0018 peptidase M22, glycoprotease"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99016"
FT                   /db_xref="GOA:B3QAD0"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:B3QAD0"
FT                   /protein_id="ACE99016.1"
FT                   /translation="MLILAIDTALDACAAAVLDTEANRLLAGESQAMQRGHAEALMPLL
FT                   GRVMDASGIGFLDIDRIAVTTGPGSFTGLRVGLSAARGIALAAAKPVVGLTTLSAFAAP
FT                   LVSETDETPILSVIDARHDHVYYQLVAGNGTMIVRPRVAPIAEALESARYGAPRLVGNA
FT                   AQLIADRWPALTPPPLAVDQRPAPDIGWLAWLGAAATPEAAPAKPFYLRPPDAKPKIDP
FT                   IAQSAQPAA"
FT   gene            complement(491447..492013)
FT                   /locus_tag="Rpal_0457"
FT   CDS_pept        complement(491447..492013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0457"
FT                   /product="Scaffold protein Nfu/NifU"
FT                   /note="PFAM: nitrogen-fixing NifU domain protein; Scaffold
FT                   protein Nfu/NifU; KEGG: bbt:BBta_0040 putative NifU
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99017"
FT                   /db_xref="GOA:B3QAD1"
FT                   /db_xref="InterPro:IPR001075"
FT                   /db_xref="InterPro:IPR014824"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="InterPro:IPR035433"
FT                   /db_xref="InterPro:IPR036498"
FT                   /db_xref="UniProtKB/TrEMBL:B3QAD1"
FT                   /protein_id="ACE99017.1"
FT                   /translation="MFIQTEPTPNPATLKFIPGRRVLDSGTLEFTDASQAARSPLAARL
FT                   FDIDGVSGVFYGTDFVTVTKDKGEWQHLKPAILGAIMEHYMSGTPILADGKSDGEDGDD
FT                   DEFYADADAETVEIIKDLIETRVRPAVANDGGDITFRGFKDGIVYLNMRGACAGCPSST
FT                   ATLQHGIQNLLKHFVPEVVEVRPVT"
FT   gene            complement(492159..492653)
FT                   /locus_tag="Rpal_0458"
FT   CDS_pept        complement(492159..492653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0458"
FT                   /product="UspA"
FT                   /note="KEGG: nha:Nham_0015 UspA"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99018"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:B3QAD2"
FT                   /protein_id="ACE99018.1"
FT                   /translation="MSSQRRSYESGHKPKCLVIVDDTAEWDRAVYYGSRWAVRVGGGVV
FT                   MLRVIEILDKNQQWLGVADVMRAEAIETAELALDRASGRANGVAGITPERVIREGDTIA
FT                   QVRKVIEQDVDIVMLVLAADDGPEGPGPIVTAMVRHLGTFPVPVMMVASSLTDDDIDAL
FT                   A"
FT   gene            complement(492898..493950)
FT                   /locus_tag="Rpal_0459"
FT   CDS_pept        complement(492898..493950)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0459"
FT                   /product="tryptophanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.2"
FT                   /note="KEGG: nha:Nham_0012 tryptophanyl-tRNA synthetase;
FT                   TIGRFAM: tryptophanyl-tRNA synthetase; PFAM: aminoacyl-tRNA
FT                   synthetase class Ib"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99019"
FT                   /db_xref="GOA:B3QAD3"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024109"
FT                   /db_xref="UniProtKB/TrEMBL:B3QAD3"
FT                   /protein_id="ACE99019.1"
FT                   /translation="MAITQRVFSGIQPTGNLHLGNYLGAIVNFVKMQETHNCVYCVVDL
FT                   HAITVPVTVWGGPDELRKNIREVTAAFIASGIDPKKQIIFNQSQVAEHSELAWVLNCIA
FT                   RLGWLNRMTQFKEKAGKDRENVSVGLYDYPVLMAADILVYRATHVPVGEDQKQHVELTR
FT                   DIAQKFNNDFSASIAAQGFGDAYFPLPEPVITGPATRVMSLRDGTKKMSKSDPSDYSRI
FT                   NLTDDADVIAQKIKKAKTDPEPLPSEEKGLETRPEADNLVGIYAALSGKPKTDVLTEFG
FT                   GAQFSAFKSNLVDLAVAKLSPIADEMKRLSADHAYVDSVLADGSDRARAIAAETMRAVK
FT                   DIMGMVRKTS"
FT   gene            complement(494006..495562)
FT                   /locus_tag="Rpal_0460"
FT   CDS_pept        complement(494006..495562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0460"
FT                   /product="integral membrane protein MviN"
FT                   /note="TIGRFAM: integral membrane protein MviN; PFAM:
FT                   virulence factor MVIN family protein; KEGG: bja:bll0803
FT                   putative virulence factor"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99020"
FT                   /db_xref="GOA:B3QAD4"
FT                   /db_xref="InterPro:IPR004268"
FT                   /db_xref="UniProtKB/TrEMBL:B3QAD4"
FT                   /protein_id="ACE99020.1"
FT                   /translation="MLRPLLTVSAGTLSSRLLGFVRDALVAALLGAGVVADAFLLAFQL
FT                   VNVTRRLLTEGALNAALVPAWLKVREHNGPVAAAAFAGRLLGSIALATLLLAILLGVFM
FT                   PLLIAVLAPGFVGQPALVMATRDARLMLPYLAFAGPVAVMMGLFNAQGKVGLTAFSPLL
FT                   FNASLIIVTAALLLGHDDPATAALILSGTVGIAGLLQLSILAFNGHGERLATPLRAGFD
FT                   AAMRTFFAKAIPGMIANSGPQLLIVAGAIIASAQPAAVSWLYFANRLIELPLGIVGVAM
FT                   GAVLVPELARAVRGGDRTALSEAASRGLELAVGVALPATFGLIVLAEPIVRLLFEHGAF
FT                   SAADAAATAQALAVLAVGLPAQVLAKNWSAAFFAREDTGTPLMATLISVAVALVAAVLL
FT                   GRLFGAAGVAAAISIGAWSNAALLLGRGVQRFGVTIDASARRRLMLIALAAGAMGALLW
FT                   QASSFVLPIAAAGSTLVQAAVLAVLIGGGLIVYAATLILLGVVRPNAALHALRRPRGLR
FT                   D"
FT   sig_peptide     complement(495503..495562)
FT                   /locus_tag="Rpal_0460"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.686) with cleavage site probability 0.527 at
FT                   residue 20"
FT   gene            495903..496904
FT                   /locus_tag="Rpal_0461"
FT   CDS_pept        495903..496904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0461"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein; KEGG: nwi:Nwi_0218 PfkB"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99021"
FT                   /db_xref="GOA:B3QAD5"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:B3QAD5"
FT                   /protein_id="ACE99021.1"
FT                   /translation="MSSAQYDVLAIGNAIFDVLVRTEEDFLVKHGMAKGGMALIDEARA
FT                   AAIYADMGQATEMSGGSAANTIVGLASFGARTAYLGKVKDDQIGKLYTHDIRAAGVTFD
FT                   TKPATDGPATGCSYILVTPDGQRTMNTYLGAAQDLSPADIDEAKIAASAIIYLEGYLWD
FT                   PPQAKEAFLKASKIAHGAGRKVALTLSDAFCVDRYRGEFLELMRSKTVDLIFANEAELH
FT                   SLYQTSDFDAALNLLAQDVSLGVVTRSEKGCAVVDKDGVTLVPAAAIDQLVDTTGAGDL
FT                   FAAGFLFGLVRNLGYENAGRLGALAAAEVIQHIGARPQVSLKELAQQHGLAV"
FT   gene            complement(497127..498821)
FT                   /locus_tag="Rpal_0462"
FT   CDS_pept        complement(497127..498821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0462"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   azo:azo3066 acyl-CoA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99022"
FT                   /db_xref="GOA:B3QAD6"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B3QAD6"
FT                   /protein_id="ACE99022.1"
FT                   /translation="MTSSTPSYVCGVSDAPLLGITIGQALDRAVALWPDREALVSPSHD
FT                   TRWTWRDFAARVDALAAGFLALGLERGARIGIWSMNRPEWTLTQFAAAKAGLILVTINP
FT                   AYRLSELEFALAKVGCAALVTATAFKTSHYMEMLNTLIPELATSPPGALQSAKLPKLRT
FT                   VIQIGGPKAPGTIAFDEVAAMGGARHRDQIAAFASELQFDDAVNIQFTSGTTGSPKGVT
FT                   LTHHNILNNGYFVGRAMKLTEADRICIPVPLYHCFGMVMGNLASVTSGAAMVYPGEGFD
FT                   PLVTLQTASREKCTALYGVPTMFIAELDHPEFASFDLSSLRTGIMAGAPCPVEVMRRVN
FT                   DAMNMREVTIAYGMTETSPVSFQSAVDDPEERRVSTVGRIHPHVEVKVVDLDGKIVPRG
FT                   QRGELCTRGYSVMLGYWDEAEKTADVLDAAGWMHTGDLATIDDEGFCNIVGRIKDMVIR
FT                   GGENLYPREIEEFLYRHPKIQDVQIFGVADDRYGEELCAWVRPRPGETLTADDVRAFCQ
FT                   GQIAHNKIPRYIEFVDEFPMTVTGKIQKFIMREKVESKLGLKAAKTA"
FT   gene            complement(498951..500138)
FT                   /locus_tag="Rpal_0463"
FT   CDS_pept        complement(498951..500138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0463"
FT                   /product="beta-lactamase"
FT                   /note="PFAM: beta-lactamase; KEGG: bja:bll0805 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99023"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:B3QAD7"
FT                   /protein_id="ACE99023.1"
FT                   /translation="MQSSNQIDQSLRQMSERGDIPGVVAIAGNSKEVLYQGAFGKRDLS
FT                   KPEQMTTDSVFWIASMTKAITAAAAMQLVEQGKLSLDEPIGKVLPDLAEPLVLDGFDAD
FT                   GTPKTRPAKSPITLRQLLTHTAGFCYDMWNADMVKYMERHGIPGIIGCQEAALKTPLAS
FT                   DPGTRWEYGINIDFAGKAVEAASGMKLDAYLRDHLFAPLGMTDMGFKIKDEQRKRLVAV
FT                   HARGEDGSLSPIPFEVAQEPEFHMGGGGLYGTAADYLKFTQMILNKGRGNGNQVLKPET
FT                   VAMMGQNHIGDLNVTKLNSAIAFATNDVDLYPGMTKKWGLSFLINTEKTPEGRSAGSLA
FT                   WAGLANTYYWIDPTRDVCGVILMQVLPFADAKCLEAFAAFERGVYAALGAGQQAA"
FT   gene            500379..500705
FT                   /locus_tag="Rpal_0464"
FT   CDS_pept        500379..500705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0464"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bja:blr0806 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99024"
FT                   /db_xref="UniProtKB/TrEMBL:B3QAD8"
FT                   /protein_id="ACE99024.1"
FT                   /translation="MIPTWSDWKRYPQPGRGGNIEAPISPGIYEVRYAQTGALYGFEAV
FT                   DNLAVALAQLPVKSRAGSWFGRRAVQPFPELEYRICATTSRAHARTAADRMVNRRSTWI
FT                   AGAA"
FT   gene            500867..502360
FT                   /locus_tag="Rpal_0465"
FT   CDS_pept        500867..502360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0465"
FT                   /product="succinic semialdehyde dehydrogenase"
FT                   /note="TIGRFAM: succinic semialdehyde dehydrogenase; PFAM:
FT                   Aldehyde Dehydrogenase_; KEGG: bra:BRADO0028
FT                   succinate-semialdehyde dehydrogenase [NADP+] (SSDH)"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99025"
FT                   /db_xref="GOA:B3QAD9"
FT                   /db_xref="InterPro:IPR010102"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:B3QAD9"
FT                   /protein_id="ACE99025.1"
FT                   /translation="MSPTAAARAADQAGSLRDRLKDPSLLREQCYIDGAWSGTSTIAVT
FT                   NPARGQTIAKVPHLGAAEATQAVEAAAQAFPAWAKLTAKQRSNILRKWFELIIANREDL
FT                   ALILTSEQGKPLTEALGEVDIGAAYVEFFAEEARRVYGETIPTQRADARLIAIKQPIGV
FT                   CGAITPWNFPSSMITRKVSPALAAGCTVVLKPAEETPLSAFALAALAEKAGVPKGVFNV
FT                   LTGDAPAIGKVLCEHPAVRFVGFTGSTEVGKILYKQASVGVKKLGLELGGNAPFIVFDD
FT                   ADVDAAVEGAMVSKYRNMGQTCVCANRLYVQDGVYDAFVEKLAAKVKAMKVGDGTEQGV
FT                   TQGPLINEAAVEKTERHIADALSNGAKIITGGKRHALGGTFFEPTVLADVRPDALVAHE
FT                   ETFGPLAPVFRFKDEAEVIKLANASPFGLASYFYARDLGRVWRVAEALESGMVGVNTGL
FT                   ITTEVAPFGGVKESGLGREGSHHGIEEYVEIKYVMMAGI"
FT   gene            complement(502415..503851)
FT                   /locus_tag="Rpal_0466"
FT   CDS_pept        complement(502415..503851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0466"
FT                   /product="protein of unknown function DUF1254"
FT                   /note="PFAM: protein of unknown function DUF1214; protein
FT                   of unknown function DUF1254; KEGG: rle:RL1126 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99026"
FT                   /db_xref="InterPro:IPR010621"
FT                   /db_xref="InterPro:IPR010679"
FT                   /db_xref="InterPro:IPR023289"
FT                   /db_xref="InterPro:IPR037049"
FT                   /db_xref="InterPro:IPR037050"
FT                   /db_xref="UniProtKB/TrEMBL:B3QAE0"
FT                   /protein_id="ACE99026.1"
FT                   /translation="MIGWLKAISAAATTALLLMTAPARSEQAPVSDEEALSLGVDAYLY
FT                   FYPLVTMDLTRKQSTNVQAGKEFGKGPMNSFVSVPAYPPADFRTIVRPNFDTLYSIAWL
FT                   DLSREPMVVTAPDTNGRYYLLPMLDMWTDVFASPGWRTTGTQAQKFLVTAPGWSGAVPA
FT                   GMQRIESPTPIIWIIGRTKTDGPADYAAVHQIQAGYTATPLSQWGKPPVPAPAFVPDPT
FT                   IDMKTPPKQQVDSMPAGQFFAYAAELLKQNPPHITDQPMIARLRRIGLEPGKGFDLGKA
FT                   APNVRKALDAAPAEALKLMSWKMPTMARVTNGWSMNIDTMGVYGNYYLKRAIVAQFGLG
FT                   ANVPEDAIYPVNVADETGKPLDGTSNYVLHFQKGATPPVDAFWSLTLYDSEGFPVPNAL
FT                   QRQALSSWMPLKPNADGSLDLLIQNASPGTEHESNWLPAPKGPFTLTMRMYAPKQEALT
FT                   GRWAPPPVTRVQQPTPLGQQ"
FT   sig_peptide     complement(503774..503851)
FT                   /locus_tag="Rpal_0466"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 26"
FT   gene            complement(503991..504674)
FT                   /locus_tag="Rpal_0467"
FT   CDS_pept        complement(503991..504674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0467"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bja:bll0087 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99027"
FT                   /db_xref="GOA:B3QAE1"
FT                   /db_xref="InterPro:IPR016085"
FT                   /db_xref="InterPro:IPR021140"
FT                   /db_xref="UniProtKB/TrEMBL:B3QAE1"
FT                   /protein_id="ACE99027.1"
FT                   /translation="MWRAFGTVILSALLASAAAAQDAASMKKDMVGQWELATTERSKTC
FT                   VVTLTSEPAAKGLKLTLEPDCAKTLPFTKAIVAWDVKGLDIVRLETADGDSVIDFTEVE
FT                   SGIFEGHRDGEGIYILQNLVAARSLAKSMEQMIGDWTMVRGNGRQVCGLTLTNTEAGND
FT                   NFQAFLKPRCDAQIAGFGPTMWRLEHGAMLLVAPNGDTWRFEADDNAQWRKMPDTADPL
FT                   IMLRQ"
FT   sig_peptide     complement(504612..504674)
FT                   /locus_tag="Rpal_0467"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.969 at
FT                   residue 21"
FT   gene            complement(504677..505663)
FT                   /locus_tag="Rpal_0468"
FT   CDS_pept        complement(504677..505663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0468"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding"
FT                   /note="PFAM: D-isomer specific 2-hydroxyacid dehydrogenase
FT                   catalytic region; D-isomer specific 2-hydroxyacid
FT                   dehydrogenase NAD-binding; KEGG: nha:Nham_0428 D-isomer
FT                   specific 2-hydroxyacid dehydrogenase, NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99028"
FT                   /db_xref="GOA:B3QAE2"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B3QAE2"
FT                   /protein_id="ACE99028.1"
FT                   /translation="MPGETGASKPIDLLIYGPRKEVIDQGFPAGYVLHKCERADDLEKL
FT                   SDEARGRIRGIAVTGLVPTGAAMLARFPKLEIVASFGVGYDHVDSAWAAQHGIIVTNTP
FT                   DVLTEEVADTALGLLIATLREFIRADKYVRAGQWQTQDYPLSTGSLRDRKVGMVGMGRI
FT                   GQAIARRLDAALVPVVYHSRNPAPGVAYKHYPNLIEMAKEVDTLVVITPGGPTTAKLIN
FT                   AEVLDALGPRGVVINVARGSVIDEAALIEALKSGKILAAGLDVFAAEPTVPEELRAMDN
FT                   VVLLPHIGSASVVTRNAMNQLVVDNLKAWFSGRPPLTPVAETPVKGR"
FT   gene            complement(505663..506487)
FT                   /locus_tag="Rpal_0469"
FT   CDS_pept        complement(505663..506487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0469"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: nha:Nham_0427
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99029"
FT                   /db_xref="GOA:B3QAE3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B3QAE3"
FT                   /protein_id="ACE99029.1"
FT                   /translation="MSAQPTSRDETSPFGARAGLRVALPIIVLLAAIVAWDLIVRLNQI
FT                   PPYVLPGPLLVASTLMQDWPVLFGSLLTTLWTTLEGFVAAAVGGIALALLFNQSRLLEY
FT                   SLFPYAVVLQVTPVIAIAPLLLIYLPQETAVIVCAWIVAFFPVLSNTTLGLNSVDRNLA
FT                   GLFRLYGASRWQTLLRLKLPAALPYILGGLRIAGGLSLIGAVVAEIAAGSAGAGSGLAY
FT                   RIAESGYRLNIPRMFAALLLLSTAGIVIYLLLALISHLLLRRWHESALGKDN"
FT   gene            complement(506484..507314)
FT                   /locus_tag="Rpal_0470"
FT   CDS_pept        complement(506484..507314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0470"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bbt:BBta_7481 putative ABC transporter, ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99030"
FT                   /db_xref="GOA:B3QAE4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3QAE4"
FT                   /protein_id="ACE99030.1"
FT                   /translation="MASSPRPSAADAGATRPAIELRGVTKTYRTGTLALGPIDLNIGRG
FT                   EFVSLLGPSGCGKSTALRMIAGLAAPSSGRIEVGTASPRGRGEHPIGFVFQEPTLMPWA
FT                   SIRHNVALPLKLAHVASSEIDRRVDEVLVRVDLSEFADAFPRELSGGMKMRASLARALV
FT                   TRPDILLMDEPFAALDEITRFRLNDDLLTLWRELQMTVVFVTHSVFESVYLSQQVVVMT
FT                   PRPGRIAASFDIDAPTARGEEFRLSADYAAQCREVSRALASASEGALSTREARA"
FT   gene            complement(507323..508465)
FT                   /locus_tag="Rpal_0471"
FT   CDS_pept        complement(507323..508465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0471"
FT                   /product="NMT1/THI5 like domain protein"
FT                   /note="PFAM: NMT1/THI5 like domain protein; KEGG:
FT                   nha:Nham_0425 perplasmic binding protein of ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99031"
FT                   /db_xref="GOA:B3QAE5"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="InterPro:IPR027939"
FT                   /db_xref="UniProtKB/TrEMBL:B3QAE5"
FT                   /protein_id="ACE99031.1"
FT                   /translation="MSPAFLLRALTGVLLAVGVALASPVHASGHGHGAEKPAEKPPEPP
FT                   PPPRPKKPPPPKVQPVRKVPEGGFDKVSFGTNWVAEGEHGGFFQAVADGTYKTYGLDVS
FT                   IVPGGPNVNNRALLIAGKLDFFMTANTLQSFDAVANNVPVVAIAAMFQKDPQVFVSHPE
FT                   SKIETLNDLKPLTLFVSKEGITSYFQWLKSEYGFSEAKVKPYTFNPQPFIIDRRSAMQG
FT                   YVTSEPFTVEQAAKFKPSVLLLADYGLNGYSTLIETRRDLIDKNPDMIQRFVDASIIGW
FT                   YNYLYGDNSAGNAMIKQLNPEMTDEMLAYSVEKMKQYGIVDSGDAIKNGIGAMNDERYA
FT                   SFFDKMARAGVVTRGLDFRKAYTLQFINKGVGVDLRPKQK"
FT   sig_peptide     complement(508382..508465)
FT                   /locus_tag="Rpal_0471"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.803 at
FT                   residue 28"
FT   gene            508595..509407
FT                   /locus_tag="Rpal_0472"
FT   CDS_pept        508595..509407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0472"
FT                   /product="Creatininase"
FT                   /note="PFAM: Creatininase; KEGG: nha:Nham_0424
FT                   creatininase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99032"
FT                   /db_xref="InterPro:IPR003785"
FT                   /db_xref="InterPro:IPR024087"
FT                   /db_xref="UniProtKB/TrEMBL:B3QAE6"
FT                   /protein_id="ACE99032.1"
FT                   /translation="MTKLPPRDWSAIYWPEIAGADPSRWIAVLPLAAIEQHGPHLPLST
FT                   DVTIAEAYLARVRERLPADIPATFLPVQAIGLSTEHLSFPGTLTLSTETALKLWTEIGD
FT                   SIARAGVRKLVMVTSHGGNSAAMGLVAQELRARHQMLVVTTGWARFGMPDGLFAADELR
FT                   HGIHGGATETSIMLAHAPELVRADRIADFRPTSVAMEQTYRWLSAQRPAPFAWAAEDLH
FT                   PSGAIGDASAATAEKGWRLLDHGAGAFCELLADMHRFDLAALSIQPSA"
FT   gene            509782..511851
FT                   /locus_tag="Rpal_0473"
FT   CDS_pept        509782..511851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0473"
FT                   /product="Carbohydrate-selective porin OprB"
FT                   /note="PFAM: Carbohydrate-selective porin OprB; KEGG:
FT                   bja:blr0095 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99033"
FT                   /db_xref="GOA:B3QAE7"
FT                   /db_xref="InterPro:IPR007049"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="InterPro:IPR038673"
FT                   /db_xref="UniProtKB/TrEMBL:B3QAE7"
FT                   /protein_id="ACE99033.1"
FT                   /translation="MIVRRRPARPTSARRDFGSRELSTPHNRISLRPSASALIAGAATA
FT                   AALLLPQGAAAGGIGKQRPDPAYDWSGFYVGAHAGYVRGHAGATLQDATSVAQNSNGAG
FT                   GITAGAQAGYNFVTGSNLLLGVEADISFPSYLPQNAVLSEFDNGTANTLQHLDYYGTVR
FT                   ARLGVIAGRWLGYVTGGLAFEHERYLTDPDAGRVMNARIGWAAGAGVEYGFAPNWSVRI
FT                   EYLYSQYQNASVDLPTGASYATSLNLQTVRVGVNRKIDWFSTGSTDAFPSLAAVADPES
FT                   DRWEIHGQTTFIGQGYPSFRAPYSGTNSLFPGAQFKNTWSTSLFANVRLWDGGELYFNP
FT                   EFLQGYGLSDTVGAGGFPNGEAQKSGFAYPHFSPSRFYLRQTFGLGGEQEQLASSGSQL
FT                   SGKADISRLTLQVGRFSVIDVFDGNSYAHDPRRDFMNWSIWASGAFDYAADKLGLGYGA
FT                   TAELNQKQWAIRAGYFLVDAESNSNNYDMKLLRRGEYVAELETRYSLFGLPGKLRTLGF
FT                   INSTYSGSYRETLNDPSLNLDITQTRRGRIKYGYALNLEQAVTDDIGVFGRWSWNDGKN
FT                   EIMAFTDIDSSLSGGVSIRGQRWGRPDDVIGIAGALNGLSRDHRDFLAAGGLGPLIGDG
FT                   ALNYRRERVFESYYALALNSSWTATADYQLIANPAYNADRGPVSVFSGRVHGEF"
FT   sig_peptide     509782..509952
FT                   /locus_tag="Rpal_0473"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.821 at
FT                   residue 57"
FT   gene            complement(511882..513513)
FT                   /locus_tag="Rpal_0474"
FT   CDS_pept        complement(511882..513513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0474"
FT                   /product="ferredoxin-dependent glutamate synthase"
FT                   /note="PFAM: ferredoxin-dependent glutamate synthase; KEGG:
FT                   nha:Nham_0422 ferredoxin-dependent glutamate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99034"
FT                   /db_xref="GOA:B3QAE8"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024188"
FT                   /db_xref="InterPro:IPR027283"
FT                   /db_xref="UniProtKB/TrEMBL:B3QAE8"
FT                   /protein_id="ACE99034.1"
FT                   /translation="METLLLPLSPRYIVLTISAVLTTLLATLAAFDVDTPMFGVVLVPL
FT                   LVFGALTLLGIHDLLQTSHAVLRNYPIAAHLRFLLEEMRPEMRQYFFESEKDGKPFSRD
FT                   TRALIYQRAKMELDKRPFGTQKDVYGDGYEWMHHSVAPRPHADEPFRITIGGPDCAKPY
FT                   SASVFNISAMSYGALSPNAIRALNAGAKKGGFAHDTGEGGVSPYHREHGGDLIWEIGSG
FT                   YFGCRTRDGRFDPEAFARVATDDQIKMVELKVSQGAKPGHGGVLPMAKISEEIAQIRGV
FT                   GMDEDCVSPPYHKAFSTPIEMMRFIAEMRRLAGGKPTGFKLCVGHPWEFLAICKAMLVT
FT                   GIYPDFIVVDGKEGGTGAAPLEFMDHLGMPMRDGISFVHNALIGIGARDRIKLGAAGKI
FT                   ATGFDVARAMALGADWCNSARGFMFALGCIQSLSCHTDRCPTGVTTQEPSRYRALVVPH
FT                   KLERVYNYHRATLQALAELVAAAGLDHPRDIRPYHFSQRTSPSDVVSLAQLYPALRPGE
FT                   LLEGTDDPRFKQAWAMAQAESFAPLV"
FT   sig_peptide     complement(513421..513513)
FT                   /locus_tag="Rpal_0474"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.650) with cleavage site probability 0.366 at
FT                   residue 31"
FT   gene            513809..514759
FT                   /locus_tag="Rpal_0475"
FT   CDS_pept        513809..514759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0475"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bja:blr0101 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99035"
FT                   /db_xref="GOA:B3QAE9"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="UniProtKB/TrEMBL:B3QAE9"
FT                   /protein_id="ACE99035.1"
FT                   /translation="MQYADRVIVRIVKDYCDASGVDVTLGLDGWLIVLSKGDARHFIYG
FT                   YDFGLNSSVTHRLANDKAATADILAAAGIACVPHRLFMNHEHFKYVPSSGHWSAMLKMQ
FT                   RAHPAGLVLKPNEGTCGHLVFKATTELELELAATAIFAANQNLAIAPYFDIAREVRVIL
FT                   LDRVPMVVYEKKRPTIIGDGARSALQLLLDAVPADRLGAVLANLPAGHAALDAVVPAGA
FT                   QFPLDWRHNLEFGAEPELIGDGELRDTCVAIAAEAARAIGLSFGAVDVVWTAQGPRVLE
FT                   INSGVMIESLSRRFPDLAQQVYTRALDRVMQAMPA"
FT   gene            514851..515852
FT                   /pseudo
FT                   /locus_tag="Rpal_0476"
FT   gene            complement(515920..515996)
FT                   /locus_tag="Rpal_R0008"
FT                   /note="tRNA-Arg5"
FT   tRNA            complement(515920..515996)
FT                   /locus_tag="Rpal_R0008"
FT                   /product="tRNA-Arg"
FT   gene            516207..517538
FT                   /locus_tag="Rpal_0477"
FT   CDS_pept        516207..517538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0477"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bbt:BBta_7591 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99036"
FT                   /db_xref="InterPro:IPR028087"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:B3QAF0"
FT                   /protein_id="ACE99036.1"
FT                   /translation="MAFSRSIARFSRDRRGNIAVIFALVLVPLISAVGCAVDYSRANAL
FT                   RSKLQAAADAASVGAVSRTSPAYVAAGAMSGDGVISSGADDALRIFNGNLNGLTGYTLA
FT                   SSSATVTKASDVVTSQVTFSAQISTMFMKVVGMSAMTVGGTSTATASMPKYIDFYLLLD
FT                   NSPSMGVGATPTDVSAMIAATANKSSDDHCAFACHDVNNKNNYYNLAKALGITTRIDVL
FT                   RSATQQLMDTASATATYSNQFRMAIYDFGASAQTAGLRNLFSLSASLSSAKTAASAIDL
FT                   MTVKGQNDNNDQDTSYTAIFPAINNEISSPGSGVSGSPQKYLFFVSDGVADEYNPSCLK
FT                   PKTGNRCQSPINPALCKTLKDRGIKIAVLYTTYLNLPSNDWYKKWIAPFNAGPYGPSPN
FT                   SEIAQNMEACASPGFYFEVSPTQGIAEAMNALFKKAVADARITS"
FT   sig_peptide     516207..516317
FT                   /locus_tag="Rpal_0477"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.967) with cleavage site probability 0.906 at
FT                   residue 37"
FT   gene            517672..518232
FT                   /locus_tag="Rpal_0478"
FT   CDS_pept        517672..518232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0478"
FT                   /product="protein of unknown function DUF937"
FT                   /note="PFAM: protein of unknown function DUF937; KEGG:
FT                   nha:Nham_0511 protein of unknown function DUF937"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99037"
FT                   /db_xref="InterPro:IPR009282"
FT                   /db_xref="InterPro:IPR027405"
FT                   /db_xref="UniProtKB/TrEMBL:B3QAF1"
FT                   /protein_id="ACE99037.1"
FT                   /translation="MGLLDILNGMQNGPRGPADPQDKSGGMSKFTMAILALLVWKAYKH
FT                   MTSGQPQAAPANQPRPMPAPPPANTGGGWGDFLKGGLGGLVLGGAAGSVLSGGLGDLLR
FT                   QLQHNGLGDAANSWVGHGPNQQIGPSDLANALGADQIDAMTRQTGMSRDELLNGLSRYL
FT                   PDVVDQLTPDGRLPTDDEASRWI"
FT   gene            518290..518586
FT                   /locus_tag="Rpal_0479"
FT   CDS_pept        518290..518586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0479"
FT                   /product="transglycosylase-associated protein"
FT                   /note="KEGG: nha:Nham_0510 transglycosylase-associated
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99038"
FT                   /db_xref="GOA:B3QAF2"
FT                   /db_xref="InterPro:IPR007341"
FT                   /db_xref="UniProtKB/TrEMBL:B3QAF2"
FT                   /protein_id="ACE99038.1"
FT                   /translation="MGGLIWILVVGFVAGIIARVLSPGPNNPQGFVLTTVLGIAGAFLA
FT                   TAIGQMIGHYGPNQGAGFITATVGAVAVLFIWNRLVARRVISDPGNRYPYDPR"
FT   gene            complement(518640..519422)
FT                   /locus_tag="Rpal_0480"
FT   CDS_pept        complement(518640..519422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0480"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; Male sterility
FT                   domain; KR domain protein; KEGG: bja:bll0137 hypothetical
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99039"
FT                   /db_xref="GOA:B3QAF3"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B3QAF3"
FT                   /protein_id="ACE99039.1"
FT                   /translation="MSDGLNVIVTGSASGLGAATAKILAKDGARLVINYASSKDDAEKT
FT                   AEECRKLGAAEVIVVQGDVAKDEDCKRIVEAAAPWGKLDALVNNAGTTKHVAHHLLDQL
FT                   SADDFQRIYAINTVGPYQMVRAARELLVAGAKAAGRASAVVNVSSVAGISGIGSSIAYA
FT                   ASKGALNTMTLSLSRALAPNIRVNAICPGYIDTPWFTKGRGAEEAKQVRDMVVSRVPLK
FT                   IASTAEDIAELVCFLATPKSSSMTGELVRMDAGMHLAG"
FT   gene            519683..520747
FT                   /locus_tag="Rpal_0481"
FT   CDS_pept        519683..520747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0481"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase type 2 domain; KEGG: bja:blr0138
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99040"
FT                   /db_xref="GOA:B3QAF4"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B3QAF4"
FT                   /protein_id="ACE99040.1"
FT                   /translation="MTETDNIVVETAEKIFADLADAQTINADKAETWKAPLWQALSESG
FT                   LPLSWVPEEFGGSGASLAEGFGVLNAAGRAGLAVPLAETMLAGWLLAQGKIAAPEGAMT
FT                   IAPAHPKDHLTLDAEGKLSGRARSVPFAQGAQHIAVLAQSAAGAKIALVLASACRIDKG
FT                   LGVGGDASDIVTFDKVAPIATASAPQGLDQTSLMLMGAVARGLQIAGALETLLDRSVTY
FT                   ANERVAFEKKIGKFQAVQHNLAKLAGETSAALAAATSAADAISSADCFDDAVFLEASAA
FT                   KIRCAEAAEKGAAIAHQVHGAIGFTAEHILHRFSLRALAWRDDFGNESHWAVELGRMVA
FT                   KRGADDLWPLVASR"
FT   gene            520774..521934
FT                   /locus_tag="Rpal_0482"
FT   CDS_pept        520774..521934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0482"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein; KEGG:
FT                   bja:blr0139 putative acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99041"
FT                   /db_xref="GOA:B3QAF5"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B3QAF5"
FT                   /protein_id="ACE99041.1"
FT                   /translation="MTAALRFDPIRLPPVCEELRKEVRAFLAEEIAAGTFDPNKPQRED
FT                   SDAPEFSRRVGERGWLGMTWPKKYGGHERTFLERYVVTEEMRIANAPTRRFFVADRQSG
FT                   PVLLKYAPEHIKMDILPRICRGELCFAIGMSEPNSGSDLFAAKTKATKTDGGYLINGSK
FT                   IWTTSAHIADYMIAIFRTSPPTKENRRHGLTQFLVNMKSPGIKVNPIAQITGQYEFNEV
FT                   VFTDVFVPDDHLLGEVDGAWKQATSELAYERSGPERFLETYYVLTELVRALGPDPDTRG
FT                   AEGIGRLVAQLHTMRRMSVSVAGMLQAGKEPVVEASIVKDIGTIWEQQLPHRVRELAAF
FT                   VDGEASNHATLDELTAFATKLAPKLTIQGGTTEVLRGIIARGLGLR"
FT   gene            521968..522774
FT                   /locus_tag="Rpal_0483"
FT   CDS_pept        521968..522774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0483"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   bja:blr0140 putative enoyl-CoA hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99042"
FT                   /db_xref="GOA:B3QAF6"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:B3QAF6"
FT                   /protein_id="ACE99042.1"
FT                   /translation="MSSYTDIAVDKTGHVATIEIQRPPLNFFDISLIRQIANALDEIDA
FT                   DPPIRATVLAAQGKAFCAGANFGDPARQEADPAVAKGDPADSLGEIGHLYYEAVRIFRA
FT                   KKPIIAAVHGAAIGGGLGLAVSADFRVTCAEARFSANFTKLGFHPGFGLTVTLPELIGK
FT                   NNAELMFYTSRRVTGEEAVQMGLANVLVPINEVRSGALKLAREIAECSPLGLLSTRATM
FT                   RASLADRVMEATKHELAEQTRLRATEDFKEGVKATEERRVAHFKGR"
FT   gene            complement(522919..523683)
FT                   /locus_tag="Rpal_0484"
FT   CDS_pept        complement(522919..523683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0484"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bja:bll0142 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99043"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:B3QAF7"
FT                   /protein_id="ACE99043.1"
FT                   /translation="MAPFLRLRQICLVTEPIEPAASRIATIMGLNICYRDPHVGKYGLE
FT                   NVLLPVDATLLEIVAPTQPGTAAGRFLEKTQGRGGYMAIFCCDDPDARGRHAASLGVRT
FT                   ANVIDHAPYHGVQLHPRDCRAAFIELNHTAGSDNIRGPYPPAGPDWAKAIRTDTTQALT
FT                   AVEMQSPDPADLAAHWGRILELPVETDADGVAELRLPNATFRFVQGASEAMTALTFKVT
FT                   APETVRAAAQAQGVPLTANGFRLAGVEFRLTT"
FT   gene            complement(523686..524471)
FT                   /locus_tag="Rpal_0485"
FT   CDS_pept        complement(523686..524471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0485"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   bbt:BBta_7538 enoyl-CoA hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99044"
FT                   /db_xref="GOA:B3QAF8"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:B3QAF8"
FT                   /protein_id="ACE99044.1"
FT                   /translation="MTDIVLQDLDRGLLTITMNRPDRRNALNQDMIRGLVEAAHRAKDD
FT                   PEVRAVLLKGGGTFCVGGDVKSMAAAGAPPPLEQKVANLRRGMEVSRLLHQMPKPVVAQ
FT                   IDGAAAGAGLSMALACDLRVAGASAKITTAFAKVGLSGDFGGTYFLTQLIGAAKARELY
FT                   LTSPVLTAEQAQALGIVSRVVPDAEVESATRELALSLAQGPTVTLGYIKTNINNAETLS
FT                   LEACFDAEALHHSRCAETADHKEAAAAFVEKRAPVFQGR"
FT   gene            complement(524648..525853)
FT                   /locus_tag="Rpal_0486"
FT   CDS_pept        complement(524648..525853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0486"
FT                   /product="substrate-binding protein"
FT                   /note="KEGG: bja:bll0144 substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99045"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B3QAF9"
FT                   /protein_id="ACE99045.1"
FT                   /translation="MKPFRTTLLACLSIAAITAAQAQSQPPLKLGAILDMSGLYADITG
FT                   TGSETAAKMAVEDFGGTVLGRKVEIIAADHLNKADLSANIARDMLDNQGVEAIIDVAAS
FT                   ATALAAAEIAKARNKIIMFSGPGSIRLSNEACGPYTVHYVFDTFAQANTTGLAAVKQGL
FT                   DTWFFLSADYAFGQDLERDTTNVIKASGGKVLGSVKHPLNTSDFSSFLLQAQSSKAKVI
FT                   GLANAGGDTINAIKQGAEFGITKGGQKISPLLAFISDIDSVGLETAQGLILAEAFYWDL
FT                   NDETRAFSKRFMERTKRMPTSAQAGLYSETMHYLQAVKAAGTTDAAAVTKKMKEMPIND
FT                   FFAKNGKIREDGRMVHDMYLFEVKKPSESKGRWDYYKLLATVPGDQAFQSLADSRCPLV
FT                   KK"
FT   sig_peptide     complement(525785..525853)
FT                   /locus_tag="Rpal_0486"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.874 at
FT                   residue 23"
FT   gene            526207..526995
FT                   /locus_tag="Rpal_0487"
FT   CDS_pept        526207..526995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0487"
FT                   /product="nuclease (SNase domain protein)"
FT                   /note="PFAM: nuclease (SNase domain protein); KEGG:
FT                   nha:Nham_0509 nuclease (SNase-like)"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99046"
FT                   /db_xref="InterPro:IPR016071"
FT                   /db_xref="InterPro:IPR035437"
FT                   /db_xref="UniProtKB/TrEMBL:B3QAG0"
FT                   /protein_id="ACE99046.1"
FT                   /translation="MAFRRNDARWLTAICGGAALLMQAGDAVAAGCMDLPAQGEGVVAS
FT                   VIDPRTLRLTDGREIRLTGIEPAREQHDAEVAALSSLTLGRRVSLHGADDGPDRYGRQL
FT                   AFVGTEPGAELVQRRLLAGGGALVGIDAMPAECRQELLAAEAGARAAAVGIWMARDVIK
FT                   NAANSGDMVTRIGRFTVIEGRITSVREVGSTVYLNFGGRWTRGFAVTISRRIVGLFEAA
FT                   GLAPKSLTGQRIRVRGWVEKRAGASMAVRDVGQIERAGGD"
FT   sig_peptide     526207..526296
FT                   /locus_tag="Rpal_0487"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.973) with cleavage site probability 0.799 at
FT                   residue 30"
FT   gene            527007..528524
FT                   /locus_tag="Rpal_0488"
FT   CDS_pept        527007..528524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0488"
FT                   /product="peptidase M48 Ste24p"
FT                   /note="PFAM: peptidase M48 Ste24p; KEGG: nha:Nham_0508
FT                   peptidase M48, Ste24p"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99047"
FT                   /db_xref="GOA:B3QAG1"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:B3QAG1"
FT                   /protein_id="ACE99047.1"
FT                   /translation="MSSRVNWGAARRNFRKGRRQVAAWLLLGAALTLAGCGDPSRFETG
FT                   PVTAAPSAKPVRPPVQSQAAEREHERILATYGGAYDDPKLEALISGIVDRLVAASDRPD
FT                   LTYKVTILNSGAVNAFALPTGQLYVTRGLIALATDTSELSSVLSHEMAHVLAKHAAIRE
FT                   DQARQAALVARVVTDMGNDPSMTALALAKTKLSMASFSRQQELEADGIGIGISARAQFD
FT                   PYGAARFLTAMERNAALKANRGTGDSRTDFLSSHPATPERVSNAQNNARQYTAPQGGWR
FT                   GERGERDREAYLNAIDNIVYGEDPSEGFVRGRRFLHPKLGFTFQVPDSFTLDNTAQAVI
FT                   GLREGGNQAMRFDVVRVPAEQSLADYLNSGWMENVDKSSTEELTVNGFPTASVTARGEQ
FT                   WQFRVYALRFGSDVYRFIFATRQRTAESDRNARETVNSFRRLSLDEIQAARPLRIKVIS
FT                   VQPGDTVESLSHRMSGVDRPLERFRVLNGLDAHAQVKPRELVKIVID"
FT   sig_peptide     527007..527114
FT                   /locus_tag="Rpal_0488"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.912) with cleavage site probability 0.455 at
FT                   residue 36"
FT   gene            complement(528629..529465)
FT                   /locus_tag="Rpal_0489"
FT   CDS_pept        complement(528629..529465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0489"
FT                   /product="transcriptional regulator, CarD family"
FT                   /note="PFAM: transcription factor CarD; KEGG: bja:bll0156
FT                   probable transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99048"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR042215"
FT                   /db_xref="UniProtKB/TrEMBL:B3QAG2"
FT                   /protein_id="ACE99048.1"
FT                   /translation="MPTKSAKTPAQPAASKPAAATKPAAKPAKAAVAPKAEVNAEVKTE
FT                   VKAPVAKAAAKPEVKQPVAAAKPAAPAPARVEEPKKAVTQRQGFKANEFVVYPAHGVGQ
FT                   ILAIEEQEIAGAKLELFVINFIKDKMTLRVPTAKVGNVGMRKLSDPALVKKALETLKGR
FT                   ARVKRTMWSRRAQEYEAKINSGDIVAIAEVVRDLYRSESQPEQSYSERQLYEAALDRLS
FT                   REIAVVQHITETEAVKEVESQLAKSPRRGAKAEAEAEADADLDGDSDDEAVTDEAA"
FT   gene            complement(529988..530326)
FT                   /locus_tag="Rpal_0490"
FT   CDS_pept        complement(529988..530326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0490"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: bja:bll0157 ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99049"
FT                   /db_xref="GOA:B3QAG3"
FT                   /db_xref="InterPro:IPR000813"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR022569"
FT                   /db_xref="UniProtKB/TrEMBL:B3QAG3"
FT                   /protein_id="ACE99049.1"
FT                   /translation="MTYVVTENCIKCKYTDCVEVCPVDCFYEGDNMLVIHPDECIDCGV
FT                   CEPECPAEAIKPDTEPGLEKWLELNSEYAKTWPNLTQKKDAPADAKEFDGQAGKFEKYF
FT                   SSEPGSGD"
FT   gene            complement(530401..530670)
FT                   /locus_tag="Rpal_0491"
FT   CDS_pept        complement(530401..530670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0491"
FT                   /product="RNA-binding S4 domain protein"
FT                   /note="PFAM: RNA-binding S4 domain protein; KEGG:
FT                   nha:Nham_0505 RNA-binding S4"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99050"
FT                   /db_xref="GOA:B3QAG4"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:B3QAG4"
FT                   /protein_id="ACE99050.1"
FT                   /translation="MERQRLDKWLWHARVVRARTSAAALVERGHVRINGVRETSPGHGI
FT                   KVGDVLTIALDRGVRVLKVVGFTERRGDAESVTGLYADLGMPRE"
FT   gene            complement(530701..533982)
FT                   /locus_tag="Rpal_0492"
FT   CDS_pept        complement(530701..533982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0492"
FT                   /product="helicase domain protein"
FT                   /note="PFAM: helicase domain protein; KEGG: nha:Nham_0504
FT                   helicase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99051"
FT                   /db_xref="GOA:B3QAG5"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3QAG5"
FT                   /protein_id="ACE99051.1"
FT                   /translation="MPNLYSEAFTADRVPGAGVTAVLGPTNTGKTHLAIERMVAHPSGL
FT                   IGLPLRLLAREVYNKIVDKVGANAVALVTGEEKIKPSKPRYWVSTVEAMPRDLDVSFLA
FT                   VDEIQIAADLERGHVFTDRILRRRGRDETLLLGAATMRPMIERLLPGASIVTRPRLSQL
FT                   EYAGDRKLTRQPRRTAIVAFSADEVYAIAELIKRQHGGAAVVLGSLSPRTRNAQVAMFQ
FT                   SGDVDYLIATDAIGMGLNLDVDHVAFASDRKFDGYQFRRLTPAEFAQIGGRAGRATRDG
FT                   TFGTTGRCAPFEPELVNALQNHSFEPVKMLQWRNAELDFASIGALQVSLAESPRHEALT
FT                   RAPVAEDLRVLDHVARDAEVREIAQGKAAVERLWDVCQVPDYRKIAPAAHAELVITLYR
FT                   FLMQKGRIPDSWFAAQVDQADRTDGGIDTLSARIAQIRTWTFVANRPDWLADPEHWQGI
FT                   SRDVENKLSDALHERLTERFVDRRTSVLMRRLRENTMLNTEIGKTGEVIVEGHVIGRLD
FT                   GFTFAPDAAEAGSDAKALQATAQKALAGEIDARAEKLSNAPDDQFILTSDGTIRWTGDA
FT                   VARLVGSDDVLRPRLRIIADDRLAGAPREAVQTRLDLWLKTHVEKILGPLFELGKAEDV
FT                   SGIARGIAFQLIESLGVLERAKIATEMKDLDQPSRATLRKYGVRFGAYHIYFPSLLKPA
FT                   ARALASLLWAQKQDNVDLAALSSAQHLAGSGRTSFPADKALDRDAYRTLGYRLCGERAV
FT                   RVDILERLADLIRPALAWREGASGEKPAGAFDGRSFVVTQAMTSLTGSAGEDFASILKA
FT                   LGYRMERRPAPPPAPKAAETASPATEEAAATSDMSAEDQAILAGAIAFEPSPTAEGDVA
FT                   EAAPTVDEQPAADEPAAVDQPVATAAEPAAEAAAAETAEQPAADASEAPASEVTTAEAS
FT                   SEAASAEAAPAAKAEPELVEVWRPGGRSDEHRPRHDRNRHRNRPQHGAPAGANESESAE
FT                   AKSDRGGGRRGKGEFRRDRRDQEGEGVRREASAEGRPPRERFKGRDKFQDKHQGGKGGR
FT                   DNQGGGSHRQVHSSAPRERDRPMDPNSPFAKLAALKEQLTAGRKD"
FT   gene            complement(534292..535164)
FT                   /locus_tag="Rpal_0493"
FT   CDS_pept        complement(534292..535164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0493"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nha:Nham_0503 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99052"
FT                   /db_xref="InterPro:IPR021457"
FT                   /db_xref="UniProtKB/TrEMBL:B3QAG6"
FT                   /protein_id="ACE99052.1"
FT                   /translation="MNISSRHFANVIPAVTRYAGLGGLLAGAAVLTAAPVAAQGKLDAR
FT                   YEASLAGIEVGKGAWVIQVDDDFYSASATGTTSGVMQAFSGGHGRGEAQGRVINGQLVP
FT                   GNYMASITGGKKTETIRITLANGNVKESSIEPEPPPDDDRIPVTDAHRRGVIDPMTASF
FT                   LRVPGTGDVLSPDSCRVSTPIFDGRMRYDLRMEYKRTETVKAEKGYRGPALVCAVYFNP
FT                   VSGYIPDRAAIKYLIKQRDMEVWLAPIAGTRVLAPFRLKIPTPVGNAMLEATQFISQAT
FT                   PPKSASRAQ"
FT   sig_peptide     complement(535048..535164)
FT                   /locus_tag="Rpal_0493"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.843 at
FT                   residue 39"
FT   gene            535465..535770
FT                   /locus_tag="Rpal_0494"
FT   CDS_pept        535465..535770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0494"
FT                   /product="ribosomal protein L28"
FT                   /note="PFAM: ribosomal protein L28; KEGG: bbt:BBta_7548 50S
FT                   ribosomal protein L28"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99053"
FT                   /db_xref="GOA:B3QAG7"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3QAG7"
FT                   /protein_id="ACE99053.1"
FT                   /translation="MSRRCELTAKGAQVGHKVSHSNIKTKRRFLPNLVNVTFLSDTLGR
FT                   AVRLRVSTNALKSVDHRGGLDAYLLKAREAELSPKAVELKRAIAKKMAGEPVAAAS"
FT   gene            536095..539325
FT                   /locus_tag="Rpal_0495"
FT   CDS_pept        536095..539325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0495"
FT                   /product="multi-sensor hybrid histidine kinase"
FT                   /note="KEGG: bbt:BBta_0531 sensor histidine kinase with
FT                   HAMP, PAS and response regulator receiver domains; TIGRFAM:
FT                   PAS sensor protein; PFAM: response regulator receiver;
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   HAMP region domain protein; histidine kinase A domain
FT                   protein; PAS fold-4 domain protein; PAS fold domain
FT                   protein; SMART: PAS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99054"
FT                   /db_xref="GOA:B3QAG8"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B3QAG8"
FT                   /protein_id="ACE99054.1"
FT                   /translation="MKLSTRLTLAMVALVLVTTAVLGFLNYQNVVDLVMPRALMRLHTH
FT                   AQLNALLIETSLQNTHADAVGAQSSAALRDLLTARRDGLQSGGEEPANWRKRIEARFIA
FT                   EMVAKPSCAILRIIGPEDDGRELVRVDRRGPNNSIRAVPPSELARRGDRTYFKEGMALP
FT                   PNRVAMSKVELNKTAAGLETPYVPTVRTMAPIDAADGTRLGLLVINTDLSGLLKRIRES
FT                   SDGSNIIYVVNADGDYLLHPDRSREFGFDIGKPSRIQDDFPRMSELLLLRKGGDTPTLV
FT                   ADSAGDRFGAGWDWAELPNGPRLAVVEMRPYVSLTSVQTAVRNSTILGGTVAILVAMLM
FT                   AFPLARSLTRPLVRITNSIVAFSSSGVPVKVKTGGGHEINMLAEAFTRMASESQRKAVA
FT                   LASEVEQLSRIAEVLQNTIDNMVDPVLVADANGMVILTNPAARETFGQLSGVGMLNTTR
FT                   SFDRFDADGNPMAQDQSPLLRAYRGETIINFEFAVQPIGSARRSYLIANGRPLRNETGE
FT                   IQGAVMVYHDITKTKKAEDALRRSEQMSRAIIDTALDAFVQLDAQGRITDWSPHAESML
FT                   GWSREEAIGQDFGELALPPDQTREIKTGYRRFIEAIEHDMSVIQGHRIEIEAVRRDGSP
FT                   IALEVSMTALPVEGRFVVNVFMRDLTEKIAFEEQLRQSQKMESIGQLTGGIAHDFNNML
FT                   TVITGTIDIISDGVADQPHLAAIAKLISEAADRGAELTRLLLAFARKQPLRPDETEVNA
FT                   LLSGLQSLLRPTLGEPIEVETVLAPDTWSIYVDRGQLESALVNLAVNARDAMPKGGKLT
FT                   IETSNVVVDPDLGKRFGDLAPGDYVMIAITDSGCGIPETIRSKVFDPFFTTKEVGKGTG
FT                   LGLSMVYGFIKQSGGHITLDSEEGQGTTFRLYLPRAQIQVDAEVAPAIEQNAVGGTETI
FT                   LVVEDDAMVRSYVNAQLKSLGYTTLSVGNAAAALSIGESDTAFDLLFTDVVMPGPMNGV
FT                   QLAAEMIKRRPGLRVLYTSGYSENALIHNDRIDSDVLLLSKPYRRSDLARMIRRALATS
FT                   QEVEAARSTTTTAAEPAKPSRAAAARPA"
FT   sig_peptide     536095..536166
FT                   /locus_tag="Rpal_0495"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.910 at
FT                   residue 24"
FT   gene            complement(539349..540497)
FT                   /locus_tag="Rpal_0496"
FT   CDS_pept        complement(539349..540497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0496"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nha:Nham_0500 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99055"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR014567"
FT                   /db_xref="InterPro:IPR027372"
FT                   /db_xref="UniProtKB/TrEMBL:B3QAG9"
FT                   /protein_id="ACE99055.1"
FT                   /translation="MNAPRGEAGKQSDHTATEDGRAAAAAQDFATTTRRHLLAGGLWLG
FT                   GAATLAGFVPTLALAQTKPVEADELTPPAPRSIEVRARPIDHFDLRDRAHRQFGALQFR
FT                   SGLILTSGFRGFGGLSALRLDPRGERFVAISDKATWFTGRIVYDGTALSGLADVEAAPL
FT                   LGPDGKPLRSRKWYDSESLAFDGGTAYVGFERVNQIVKFDFGRDGIRARGQPIAVPPAL
FT                   RKLPNNKGIESLVMVPKPHPLAGTLIALSERGLDAERNTIGFLIGGKSPGQFSVRRTEN
FT                   YDIADAALMHGGELLILERKFSWFEGVHIRIRRIALSTIVPGATVDGPSIFEADLGNEI
FT                   DNMEGLDVHIDAGGAIVLTMVSDDNFSMLQRTLLLQFTLEAD"
FT   gene            complement(540522..542426)
FT                   /locus_tag="Rpal_0497"
FT   CDS_pept        complement(540522..542426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0497"
FT                   /product="cobalt chelatase, pCobT subunit"
FT                   /EC_number="6.6.1.2"
FT                   /note="KEGG: bbt:BBta_7564 aerobic cobaltochelatase CobT
FT                   subunit (cobalamin biosynthesis); TIGRFAM: cobalt
FT                   chelatase, pCobT subunit; PFAM: Cobalt chelatase CobT
FT                   subunit; SMART: von Willebrand factor type A"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99056"
FT                   /db_xref="GOA:B3QAH0"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR006538"
FT                   /db_xref="InterPro:IPR025861"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:B3QAH0"
FT                   /protein_id="ACE99056.1"
FT                   /translation="MSTTTNSKLRTGSKEAPTEPFKRAVTSCLRAIAKAPELEVTFAAE
FT                   RPGLAPGKARLPEPARKMSKRDAAIVRGHADSIALKLACHDPKVHRKLMPGNPQARGVF
FT                   EAVEQARVEALGARRMAGVAKNLTAMLDDHFHRGKFDEITDRADAPLSDALAMLVRERL
FT                   TGLAPPTAAKKLVDLWRPVLEDKLGPRLDQLEHFADNQAKFGDVIHDMLDALELGDDRD
FT                   TETDEDESQDDKQEGENDQSGAEGEPQGEAAQEMSAEQAEATSDEVSDSQMESAQASTS
FT                   DAFDDSELGEDETPGEATRPHNRGANEPRGPEYHAFAPKFDEIVAAEDLCDHDELERLR
FT                   SYLDKQLAHLQGIVARLANRLQRRLMAQQNRAWDFDLEEGILDPARLSRVVIDPFHPLS
FT                   FMSEKEATFRDTVVTLLLDNSGSMRGRPITVAATCADILARTLERCGVKVEILGFTTRA
FT                   WKGGQSREAWLAAGKPANPGRLNDLRHIIYKSADAPWRRARKNLGLMMREGLLKENIDG
FT                   EALDWAHKRLLGRPEQRKILMMISDGAPVDDSTLSVNPGNYLERHLRHIIEEIETRSPV
FT                   ELIAIGIGHDVTRYYRRAVTIVDAEELGGAITEKLAELFSETATPAATPGPRRHRLHS"
FT   gene            complement(542423..542833)
FT                   /locus_tag="Rpal_0498"
FT   CDS_pept        complement(542423..542833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0498"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   bja:bll0179 putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99057"
FT                   /db_xref="GOA:B3QAH1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B3QAH1"
FT                   /protein_id="ACE99057.1"
FT                   /translation="MPSVSVDRTYGKTKKAVLDGLKAYNKERWGRQKYKRFAVSLRNGE
FT                   QIVGGVVGEMWSTVLFIQYFWIEQAYRGKRHGRKLLAAIEDEARKFGATRSYLDTMSFQ
FT                   APGFYSTCGYKKFGVIDGYPDDVTRHWFMKAL"
FT   gene            complement(542838..543833)
FT                   /locus_tag="Rpal_0499"
FT   CDS_pept        complement(542838..543833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0499"
FT                   /product="cobalt chelatase, pCobS small subunit"
FT                   /EC_number="6.6.1.2"
FT                   /note="KEGG: bja:bll0180 cobalt insertion protein; TIGRFAM:
FT                   cobalt chelatase, pCobS small subunit; PFAM: ATPase
FT                   associated with various cellular activities AAA_5"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99058"
FT                   /db_xref="GOA:B3QAH2"
FT                   /db_xref="InterPro:IPR006537"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR025865"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3QAH2"
FT                   /protein_id="ACE99058.1"
FT                   /translation="MTAATTTAPEITGLPDMKVSVRQVFGIDSDLEVPAYSEVDPHVPD
FT                   VDPDYRFDRATTLAILAGFAKNRRVMVTGFHGTGKSTHIEQVAARLNWPCVRVNLDSHI
FT                   SRIDLVGKDAIVVRDGKQVTEFRDGILPWALQHNVALVFDEYDAGRPDVMFVIQRVLEV
FT                   SGRLTLLDQNKVIKPHPAFRLFATANTIGLGDTSGLYHGTQQINQGQMDRWSIVTTLNY
FT                   LPHDEEVEIILAKAKHYRNAEGRDIVNKMVRLADLTRNAFANGDLSTVMSPRTVITWSE
FT                   NAEIFGDIGFAFRVTFLNKCDELERPLVAEFYQRCFNAELPESSVNIAMS"
FT   gene            544113..544730
FT                   /locus_tag="Rpal_0500"
FT   CDS_pept        544113..544730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0500"
FT                   /product="SNARE associated Golgi protein"
FT                   /note="PFAM: SNARE associated Golgi protein; KEGG:
FT                   bja:blr0181 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99059"
FT                   /db_xref="GOA:B3QAH3"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:B3QAH3"
FT                   /protein_id="ACE99059.1"
FT                   /translation="MSSLLDSLVHFAASHSGLAYLALFMAALLEAVPVVGSLVPGSTVI
FT                   LALSALIPGGELSLAGVLASAIAGALIGDGAAYWVGHRAQRSILSAWPLSNYPDVVAQA
FT                   EAFFVRYGTWAVLFGRFVPPIRAFVPVTAGALQMTPRRFFAVDVPAILLWAPAHVLPGV
FT                   VAATALEHNHATLHHWLPVLAGVAGTLLLGLWAYRRWRGTPA"
FT   gene            complement(544795..545439)
FT                   /locus_tag="Rpal_0501"
FT   CDS_pept        complement(544795..545439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0501"
FT                   /product="heat shock protein DnaJ domain protein"
FT                   /note="PFAM: heat shock protein DnaJ domain protein; KEGG:
FT                   nha:Nham_0496 heat shock protein DnaJ-like"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99060"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:B3QAH4"
FT                   /protein_id="ACE99060.1"
FT                   /translation="MPIDSSKFFDKIRVKPRAAEAAREAVREQVRMCDAPGCTSRAAHR
FT                   APKGRGYEKDYWHFCLNHVREFNQGYNFFEGMNPDDVARYQKDALTGHRPTWKMGQNGA
FT                   KSRARSPEDLEGAADPFNVFNEFTGSRRRRRGPDPADEARAEPRKVFNAERKALQVMGL
FT                   DSDATLEVVKAKYKALVKQHHPDANGGDRSTEDRLIEIIKAYNYLKTVVRS"
FT   gene            545560..545829
FT                   /locus_tag="Rpal_0502"
FT   CDS_pept        545560..545829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0502"
FT                   /product="BolA family protein"
FT                   /note="PFAM: BolA family protein; KEGG: bja:bsr0185
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99061"
FT                   /db_xref="InterPro:IPR002634"
FT                   /db_xref="InterPro:IPR036065"
FT                   /db_xref="UniProtKB/TrEMBL:B3QAH5"
FT                   /protein_id="ACE99061.1"
FT                   /translation="MGTQDTITQKLREAFTPESLAVIDESNLHEGHAGHSGRSETHFRV
FT                   NIVSAAFAGKSRVDRHRMVNDLLAPELKGGVHALAIKAKAPGEA"
FT   gene            complement(545847..547208)
FT                   /locus_tag="Rpal_0503"
FT   CDS_pept        complement(545847..547208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0503"
FT                   /product="protein of unknown function DUF21"
FT                   /note="PFAM: CBS domain containing protein; protein of
FT                   unknown function DUF21; transporter-associated region;
FT                   KEGG: nha:Nham_0492 protein of unknown function DUF21"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99062"
FT                   /db_xref="GOA:B3QAH6"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:B3QAH6"
FT                   /protein_id="ACE99062.1"
FT                   /translation="MNSTLSNVLIAVLLLIANAFYVAAEFALVRSRGFRIKAMVEKQRF
FT                   GAELVQHILGNVEAYLACCQLGITMASLGLGWVGEPTVSALLAPVLQPMGLSESAQHFI
FT                   AFLGGFLFFSSLHIVIGEQVPKTLAIRQPEPVSQWIAYPLHISFILLYPLNWLLNQASR
FT                   GVLKLLGVEENSEHEILTDVEIEGLVGESAEHGKIESGEAEYIQNVFRFGELVVSDVMV
FT                   HRTAMVTVNADQPSEQLVKEVLATEYTRVPLWRDKPENIVGVLHAKDLLRALRAADGDA
FT                   SKLDIGKIALQPWFVPEMRPVSEQLKAFRTRKTHFALVVDEYGEVEGMVTLEDILEEIV
FT                   GDISDEHDVVVAGVRTQPDGSVVVDGSVPIRDLNRAMDWNLPDEEATTVAGLVIHEARS
FT                   IPDRGQNFTFHGFRFRVLRRERNRITALRISPVPRDGEADLIEKKSRKTRAGSV"
FT   sig_peptide     complement(547137..547208)
FT                   /locus_tag="Rpal_0503"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.688 at
FT                   residue 24"
FT   gene            complement(547256..548401)
FT                   /locus_tag="Rpal_0504"
FT   CDS_pept        complement(547256..548401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0504"
FT                   /product="3-dehydroquinate synthase"
FT                   /note="PFAM: iron-containing alcohol dehydrogenase;
FT                   3-dehydroquinate synthase; KEGG: bja:bll0187
FT                   3-dehydroquinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99063"
FT                   /db_xref="GOA:B3QAH7"
FT                   /db_xref="InterPro:IPR016037"
FT                   /db_xref="InterPro:IPR030960"
FT                   /db_xref="InterPro:IPR030963"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3QAH7"
FT                   /protein_id="ACE99063.1"
FT                   /translation="MNAPQKHSAPITVEVALGDRAYEIVIGRDVIASLGERIAKLRPGA
FT                   RTAIVTDRTVAKTWLKRTEEVLDQVGIAHASVIVGEGESSKSYAGLEQVCEALIAAKIE
FT                   RNDLVIALGGGVIGDLAGFSASLLRRGVDFVQVPTSLLAQVDSSVGGKTGINSPQGKNL
FT                   IGTFHQPVLVLADTAILDTLSPRQFRAGYAEVAKYGALGDEAFFAWLEANHAELFSGGA
FT                   AREHAVATSCRAKAAIVARDERETGDRALLNLGHTFGHALEAATGFSDRLFHGEGVAIG
FT                   MVLAAEFSAERGMMPAADAQRLAKHLADVGLPTRLQDIAGFTQEGLADADRLMALMSQD
FT                   KKVKRGELTFILMEGIGRAVIANKVEPAPVRDFLQRKLAQA"
FT   gene            complement(548412..549014)
FT                   /locus_tag="Rpal_0505"
FT   CDS_pept        complement(548412..549014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0505"
FT                   /product="Shikimate kinase"
FT                   /EC_number="2.7.1.71"
FT                   /note="PFAM: shikimate kinase; KEGG: nha:Nham_0490
FT                   shikimate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99064"
FT                   /db_xref="GOA:B3QAH8"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR023000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:B3QAH8"
FT                   /protein_id="ACE99064.1"
FT                   /translation="MSETVPTAAAGRSPQEAEIVAALGDRPVVLIGMMGAGKSTVGRRL
FT                   ALRLGLPFLDADTEIESAAAMTIPEIFETHGEPHFRDGEARVISRLLDGGTKVLATGGG
FT                   AFMREETRDRIREKAISMWLEAEADVILRRVKRRADRPLLKTPDPAGTIARLIAERYPL
FT                   YREADITIASRDVPHEKIVDECVAALHDYLCAAPPQP"
FT   gene            549153..549299
FT                   /locus_tag="Rpal_0506"
FT   CDS_pept        549153..549299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0506"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bja:bsr0189 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99065"
FT                   /db_xref="GOA:B3QAH9"
FT                   /db_xref="UniProtKB/TrEMBL:B3QAH9"
FT                   /protein_id="ACE99065.1"
FT                   /translation="MPTLFRFLTVIGVVGGIIYGTIFALANFVGPNSREMTVTIGPDKF
FT                   LKK"
FT   gene            549316..550335
FT                   /locus_tag="Rpal_0507"
FT   CDS_pept        549316..550335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0507"
FT                   /product="tyrosine recombinase XerD"
FT                   /note="TIGRFAM: tyrosine recombinase XerD; PFAM: integrase
FT                   family protein; integrase domain protein SAM domain
FT                   protein; KEGG: nha:Nham_0488 tyrosine recombinase XerD"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99066"
FT                   /db_xref="GOA:B3QBB3"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR011932"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/TrEMBL:B3QBB3"
FT                   /protein_id="ACE99066.1"
FT                   /translation="MRRPRTTSRTAALPEPEAQAAPLRPASYSDAGLTELFLDMIAAEQ
FT                   GASANTLDAYRRDLADLSHFLSRRRLSIGSADTAALRSYLADLDNRGFATSSVARRLSA
FT                   LRHLFRFLLSERIRADDPAAILAGPKRGRSLPKVLSIADVDRLLACARQEIDAAEGGAR
FT                   LRAARLNCLLEVLYATGLRVSELVSLPLSAARRDARMIVVRGKGDKERLVPLNAGAKQA
FT                   MARYLEEVAVATKETKGAPASKWLFPSFGESGYLTRQHFARDLKDLAARAGLSPRLVSP
FT                   HVLRHAFASHLLHNGADLRIVQTLLGHSDISTTQIYTHVVEERLKSLVRDLHPLGEGR"
FT   gene            complement(550342..550917)
FT                   /locus_tag="Rpal_0508"
FT   CDS_pept        complement(550342..550917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0508"
FT                   /product="cytochrome B561"
FT                   /note="PFAM: cytochrome B561; KEGG: bbt:BBta_5356 putative
FT                   cytochrome b561"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99067"
FT                   /db_xref="GOA:B3QBB4"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:B3QBB4"
FT                   /protein_id="ACE99067.1"
FT                   /translation="MTASDDAPISTDRFMFGRAQRWLHWSMALLIFVAIGLGIVAAYYP
FT                   SGQQPRQGLLELHKSIGFTILALLIVRIVWRLISGEPPYRRPLGHLTEMAARAGHLALY
FT                   GLMLFMPLSGYLFSGAGGYSLPWFGLFQWPRLVPRDHALSEWGQVLHDRGAWVLGAVLA
FT                   LHLGAVCWHQFVKRDEVLSRMTGRASES"
FT   gene            551193..552143
FT                   /locus_tag="Rpal_0509"
FT   CDS_pept        551193..552143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0509"
FT                   /product="acetyl-CoA carboxylase, carboxyl transferase,
FT                   alpha subunit"
FT                   /EC_number="6.4.1.2"
FT                   /note="KEGG: nwi:Nwi_0392 acetyl-CoA carboxylase
FT                   carboxyltransferase subunit alpha; TIGRFAM: acetyl-CoA
FT                   carboxylase, carboxyl transferase, alpha subunit; PFAM:
FT                   acetyl-CoA carboxylase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99068"
FT                   /db_xref="GOA:B3QBB5"
FT                   /db_xref="InterPro:IPR001095"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:B3QBB5"
FT                   /protein_id="ACE99068.1"
FT                   /translation="MRSYLDFEKPVAELDSKIDELRTLAASGSDIHEEIEKIEEKAQQA
FT                   LQDLYAALTPWQKTQVARHPQRPHCVDYIEGLITEFTPLAGDRKFGDDEALVGGFGRFR
FT                   GEAVCVIGQEKGSTTETRLRHNFGMARPEGYRKAVRLMEMADRFDLPVLSLVDTAGAYP
FT                   GIGAEERGQAEAIARSTDACLQLGVPNVALVIGEGGSGGAIAIATANKVLMLEHAVYSV
FT                   ISPEAASSILWRDGTKAQEAANSMKITAQDLLKFGVIDQILAEPKGGAHRDPEAMIATA
FT                   GDAIAAAFAELKGQGRDAIRAKRRQKFLDIGRKLA"
FT   gene            552515..553951
FT                   /locus_tag="Rpal_0510"
FT   CDS_pept        552515..553951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0510"
FT                   /product="protein of unknown function DUF949"
FT                   /note="PFAM: protein of unknown function DUF949; KEGG:
FT                   bbt:BBta_7577 putative exported protein of unknown function
FT                   with transcriptiona regulatory protein domain (C-term)"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99069"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:B3QBB6"
FT                   /protein_id="ACE99069.1"
FT                   /translation="MKKSPLVRALMLTAALATMPLLAGCNSDQMALATNAKANQPVPPK
FT                   LVAAMQEKNMDLQSPILVRLFKQEAELEVWKQDRTGVFQLLKSYPICRWSGDLGPKIRE
FT                   GDRQAPEGFYSISPGQMNPQSSYYLSFNTGYPNAFDKSLGRTGSQLMVHGDCSSRGCYA
FT                   MTDEQIAEIYALGRESFFGGQRAFQLQAYPFKMTPANFAKHRNNPNMPFWKMLKEGYDH
FT                   FEVTRQEPKVDFCEHKYVFDAAPPSGSSRPLQFNASAKCPTYEVRPDIAEAVREKDKQD
FT                   NIKIAELVAKGTPVARLNTGIDGGMNHVFASKIPDASTGLSEVPEDKSLAVASFDRAPG
FT                   TIPPTVNPPRPSDNLLVAAPAESSASAAKARVASASKDDIGGLLAGSRKPGNESTASAR
FT                   PAPSAPVSTAARHEPAPRPQGAAPKAAETKQAAASRPPLKPSVDAETTSSAPARPSGMI
FT                   SGGAPVVSSNSFDSRFSAFR"
FT   sig_peptide     552515..552586
FT                   /locus_tag="Rpal_0510"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.660 at
FT                   residue 24"
FT   gene            complement(554193..557033)
FT                   /locus_tag="Rpal_0511"
FT   CDS_pept        complement(554193..557033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0511"
FT                   /product="preprotein translocase, SecA subunit"
FT                   /note="TIGRFAM: preprotein translocase, SecA subunit; PFAM:
FT                   SEC-C motif domain protein; SecA DEAD domain protein; SecA
FT                   Wing and Scaffold; SecA preprotein cross-linking region;
FT                   KEGG: bja:bll0204 preprotein translocase subunit SecA"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99070"
FT                   /db_xref="GOA:B3QBB7"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3QBB7"
FT                   /protein_id="ACE99070.1"
FT                   /translation="MIGALARKLFGSANDRRVKGYQTRVAAINALEPEVAALSDEALRA
FT                   RTAEFRAELAAGKTLDDLLVPAFATVREAAKRTLGQRHFDVQLIGGMVLHEGDIAEMKT
FT                   GEGKTLVATLAVYLNALAGKGVHVVTVNDYLAKRDSGWMGQIYGFLGMTTGVIVHGLDD
FT                   AQRQAAYACDITYGTNNEYGFDYLRDNMKYRLEDMVQRGHNFAIVDEVDSILIDEARTP
FT                   LIISGPLDDRSDFYNTIDTFIPRLDKSDYDVDEKQRTVTLTEAGMEKIETLLRDAGQLR
FT                   GESLYDVENVSVVHHVNQALRAHALFQRDKDYIVRNDEVVIIDEFTGRMMQGRRYSEGL
FT                   HQALEAKEHVTVQPENQTLASITFQNYFRMYDKLAGMTGTASTEADEFFDIYKLEVVEI
FT                   PTNLPIARLDEDDEVYRTQQEKYAAILAEVERANKRMQPVLVGTASIEKSEVLAEYLKK
FT                   NGYKQIDFTDPKGMDKLYAAARAGKPAKLFAVLNARFHEQEAYIVAEAGVPGAITIATN
FT                   MAGRGTDIKLGGSLEMRIQQEAAHITDEAERAAKITEIKADIERFRDIVLKAEDEIEIE
FT                   PAKGNKPAKTAKRPGGLYIIGSERHESRRIDNQLRGRSGRQGDPGRSKFFLSLEDDLMR
FT                   IFGSDKLDTMLTRLGLKEGEAIIHPWINKALEKAQQKVEARNFDIRKNLLKFDDVQNDQ
FT                   RKVIFDQRIELMKEDSVAETVTDMRHTYIEDLVAKYVPEHAYAEQWDVAGLKAEVERVV
FT                   GLDIPVDEWAKEEGIADEELITRLERVFDEHMAAKVGQWGSDVMRYAEKSILLQTLDHL
FT                   WREHLVMLDHLRQVIGLRGYGQRDPLQEYKSEAFNLFQEMSSHLREAVTAQLMRVEIIP
FT                   PDQPQELPPMEVHKMDPDTGQDEMALANVTLAPAQTTDKADRDPNKPETWGKVGRNEDC
FT                   PCGSGKKYKHCHGRYA"
FT   gene            557376..558326
FT                   /locus_tag="Rpal_0512"
FT   CDS_pept        557376..558326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0512"
FT                   /product="PpiC-type peptidyl-prolyl cis-trans isomerase"
FT                   /note="PFAM: PpiC-type peptidyl-prolyl cis-trans isomerase;
FT                   KEGG: bja:blr0205 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99071"
FT                   /db_xref="GOA:B3QBB8"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:B3QBB8"
FT                   /protein_id="ACE99071.1"
FT                   /translation="MTPASNAVTSGLRAGLLSAAVTGCLAFALLAAPAARAQDANPVLA
FT                   KVNGAEIRQSDVDLAEQELGPSLAQLDPASRKENVLAFLIDMKIVAKAAEDKKIQDNAD
FT                   FKKRLDFARNRLLMDDVLAAEGKAATTDEAMKKVYDEAAKQISGEQEVHARHILVETED
FT                   EAKAVAEELKKGADFAELAKKKSKDPGASDGGDLGFFTKDQMVPEFSAAAFALEPGKIS
FT                   DPIKTQFGWHIIKVEEKRNRKPPSFDQVKAQIEQYVTRKAQSDYVSKLRQAAKIERMDQ
FT                   PAAKPDAAKPDAAKPADAAKPADAAKPATPAPAKK"
FT   sig_peptide     557376..557489
FT                   /locus_tag="Rpal_0512"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.897 at
FT                   residue 38"
FT   gene            complement(558419..561142)
FT                   /locus_tag="Rpal_0513"
FT   CDS_pept        complement(558419..561142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0513"
FT                   /product="DNA mismatch repair protein MutS"
FT                   /note="TIGRFAM: DNA mismatch repair protein MutS; PFAM: DNA
FT                   mismatch repair protein MutS domain protein; MutS III
FT                   domain protein; MutS II domain protein; MutS IV domain
FT                   protein; KEGG: bja:bll0924 DNA mismatch repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99072"
FT                   /db_xref="GOA:B3QBB9"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR005748"
FT                   /db_xref="InterPro:IPR007695"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR007860"
FT                   /db_xref="InterPro:IPR007861"
FT                   /db_xref="InterPro:IPR016151"
FT                   /db_xref="InterPro:IPR017261"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="InterPro:IPR036678"
FT                   /db_xref="UniProtKB/TrEMBL:B3QBB9"
FT                   /protein_id="ACE99072.1"
FT                   /translation="MTIRPDIALPPDAAPPPEAPAKMSPMMEQYHEIKAANPGLLLFYR
FT                   MGDFYELFFEDAEIASRALGITLTKRGKHLGADIPMCGVPVERSDDYLHRLIALGHRVA
FT                   VCEQTEDPAAARARKSVVRRDVVRLITPGTLTEDTLLDARANNYLLAIARARGSAGADR
FT                   IGLAWIDISTGEFCVTECTTAELAATLARINPNEAIVPDALYSDTELAPTLRELAAVTP
FT                   LTRDVFDSATAERRLCDYFAVATMDGLAALSRLEATAAAACVTYVDRTQLGKRPPLSPP
FT                   SREAAGTTMAIDPATRANLELTRTLAGERRGSLLDAIDCTVTAAGSRLLAQRLAAPLTD
FT                   AAAIARRLDAVEAFTGDAGLREQIRSSLRAAPDMARALARLSLGRGGPRDLANLRDGIR
FT                   AADEVIAQLGQLASPPQEIASAMAALQRPSRALCAELGRALADDLPLLKRDGGFVREGY
FT                   EPALDETRKLRDASRLVVASMQARYADDTGIKALKIRHNNVLGYFVEVSAQHGDKLMAP
FT                   PLNATFIHRQTLAGQVRFTTAELGEIEAKIANAGDRALGLELEIFDRLAAMIDAAGEDL
FT                   RAAAHAFALLDVATALAKLASDDNYVRPEVDESLSFAIEGGRHPVVEQALKKAGEPFIA
FT                   NACDLSPGPAQTNGQIWLLTGPNMAGKSTFLRQNALIALLAQVGSFVPAIRARIGIVDR
FT                   LFSRVGAADDLARGRSTFMVEMVETAAILNQASERALVILDEIGRGTATFDGLSIAWAA
FT                   IEHLHEQNRCRSLFATHYHELTALSAKLPRLFNATVRVKEWRGEVVFLHEVLPGSADRS
FT                   YGIQVAKLAGLPPSVVSRAKAVLAKLEANDRGQPKTLIDDLPLFAITARAPAEAAPPSE
FT                   AEQLIDAVKALHPDEMTPREALDALYALKAKLPKAD"
FT   gene            561318..562526
FT                   /locus_tag="Rpal_0514"
FT   CDS_pept        561318..562526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0514"
FT                   /product="beta-ketoadipyl CoA thiolase"
FT                   /EC_number="2.3.1.16"
FT                   /note="KEGG: bja:blr0925 beta-ketoadipyl CoA thiolase;
FT                   TIGRFAM: acetyl-CoA acetyltransferase; beta-ketoadipyl CoA
FT                   thiolase; PFAM: Thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99073"
FT                   /db_xref="GOA:B3QBC0"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR012793"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:B3QBC0"
FT                   /protein_id="ACE99073.1"
FT                   /translation="MADVFVCDAVRTPIGRYGGSLAKVRTDDLAAVPIKALMAKHPDMD
FT                   WSAVDEVFFGCANQAGEDNRNVARMAALLAGLPDSVPGQTLNRLCASGLDAVGAAGRAI
FT                   RGGEIDLAIAGGVESMTRAPFVQGKATEAFARSADIFDTTIGWRFINPLMKQQYGVDSM
FT                   PETGENVAEEFQISRADQDAFAIRSQQRAGAAITAGYFAEEIAPVTYAGGKAGPITVDK
FT                   DEHPRPETTLEGLAKLKPIVRNPGTVTAGNASGVNDGAAALLIASEAAVKKYGLTPRAK
FT                   ILGLASAAVPPRIMGIGPVPATRKLMERLGLKISDFDLIELNEAFASQGIACLRQLGVA
FT                   DDADFVNPHGGAIALGHPLGMSGARLALTAVHGLEKRGGKLALATMCVGVGQGVAMAIE
FT                   KLN"
FT   gene            complement(562706..564268)
FT                   /locus_tag="Rpal_0515"
FT   CDS_pept        complement(562706..564268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0515"
FT                   /product="drug resistance transporter, EmrB/QacA subfamily"
FT                   /note="TIGRFAM: drug resistance transporter, EmrB/QacA
FT                   subfamily; PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bbt:BBta_7638 putative drug resistance transporter,
FT                   EmrB-FarB-QacA family"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99074"
FT                   /db_xref="GOA:B3QBC1"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B3QBC1"
FT                   /protein_id="ACE99074.1"
FT                   /translation="MAGAAQSHAVPGFRRNMVTICAMTATIMQALDTTIANVALPYMQG
FT                   SLSASQDQINWVLTSYIVAAAIMTAPVGWIANRFGRKRIFIICSAGFTIASVMCGLAQD
FT                   ITQMVVFRLLQGVFGAALVPLSQAVMLDSYALHERAKAMSIWGMGVMMGPIMGPSLGAW
FT                   LTETYSWHWVFFVNLPFGAITVLGLAMFMDETDKNQDLKFDWFGFAALAVGIGAMQLAL
FT                   DRGEQLDWFNSPEIIIESIVSVVGFYYFFAHSFTTERPFIQFAIFKDRNFVGGVVFMTV
FT                   MGLVLFSTMALSSPFLQNVEGYPIMTAGLLLASRGCGTFVAMMIVGRIMRYIEARTLIA
FT                   TGLSLTCASLYVMTGWTDQTSVSSVVVTSIIQGFGFGLVFVPLSTVAFMTLPGHLRTDG
FT                   TAMLTLVRNVASSVGISVVIAKLSSGTTTAHAILSEHINPFNNALQMPNVTGMIDLSTT
FT                   TGKAMMDAIVTMQAQIIAFSHDYAMVMFLTAAAVPMAIIIGSTKAALRKQSEAPADHAA
FT                   VME"
FT   gene            complement(564272..565441)
FT                   /locus_tag="Rpal_0516"
FT   CDS_pept        complement(564272..565441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0516"
FT                   /product="secretion protein HlyD family protein"
FT                   /note="PFAM: secretion protein HlyD family protein; KEGG:
FT                   bra:BRADO0542 putative efflux pump protein (HlyD domain),
FT                   EmrA-FarA family"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99075"
FT                   /db_xref="GOA:B3QBC2"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:B3QBC2"
FT                   /protein_id="ACE99075.1"
FT                   /translation="MAEPALKFPTEQQEPAADPAVATSGGPRRGIGGTLRRYRRPLLLI
FT                   VLPLVALIGGVTFYLEGGRYVTTDDAYVGAQKVLITPDVAGKIVEVTVKEGQRVQPGDE
FT                   LFQIDPVPFRLAVAQAQAKLADAKTSHANLVANVKLYGQTIDLVNAGIALKQRDVERKT
FT                   SLVQSRAGSQLDLDNSTAALVTAQAQLQLVKQQQSTALNQLLGDPELPLEKFPAYAQAK
FT                   AALDDAERNLRLSTVRAPMSGTATQVDNIQLGRFVAAGTPVFSVIDTTQPWVDANPKES
FT                   DFTYVAVGQTVTLDVDAFPDHQFKGRVSSLSPGTGAQFAVLPPQNATGNFVKVVQRVPL
FT                   RIALDETDPMIKRLKAGMSVNVAIDTHHRRSLAGLLGFGHAAAATPEHN"
FT   gene            complement(565434..565919)
FT                   /locus_tag="Rpal_0517"
FT   CDS_pept        complement(565434..565919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0517"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; KEGG: bja:bll0933
FT                   transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99076"
FT                   /db_xref="GOA:B3QBC3"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B3QBC3"
FT                   /protein_id="ACE99076.1"
FT                   /translation="MTRGPEDQNFIFAFAEAQRLLRAYADKQASRHGITRAQWAVLAKV
FT                   ERAEGLKQSELAEQMELQPITLTRLIDKLCDHGWLERRSDDSDRRCKRLYLREAARPLL
FT                   GKLAGLRAELTDTALAGLTPEDAQRLVRQMQIIKENLRGAIQHHCHREEKRREEHYG"
FT   gene            566109..566606
FT                   /locus_tag="Rpal_0518"
FT   CDS_pept        566109..566606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0518"
FT                   /product="ferric uptake regulator, Fur family"
FT                   /note="PFAM: ferric-uptake regulator; KEGG: nha:Nham_0618
FT                   putative ferric uptake regulator, FUR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99077"
FT                   /db_xref="GOA:B3QBC4"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B3QBC4"
FT                   /protein_id="ACE99077.1"
FT                   /translation="MGPMTALKPTFPAPGHDHDRCSAEGLEHAERVCAGRSQNLTPIRR
FT                   QVLRALLSSHRPLGAYEVIEELARVMPRPAPITVYRALDFLMQNGLVHRIESRNAFLAC
FT                   GHDHGDAATVAFLICECCGSVAEVPASEVTQRLNEAARQTGFTPKMSVVEITGVCGHCQ
FT                   AA"
FT   gene            566771..567694
FT                   /locus_tag="Rpal_0519"
FT   CDS_pept        566771..567694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0519"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: bja:blr0935 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99078"
FT                   /db_xref="GOA:B3QBC5"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B3QBC5"
FT                   /protein_id="ACE99078.1"
FT                   /translation="MGRPLSAGAIALMLLCCLSWGFNQIAVKLVLPDIPPFLQAAIRSA
FT                   GALIVILIIATSRRVKLFQRDGTLRAGLFAGVLFGLEFVLIYHGLTLTTASRAVVFLYT
FT                   APFFVALGSYRLLGERLRRMQWAGLALSFAGVALAIGVPQADVDASVLLGDLLLVGGGA
FT                   LWAATTLIVKGTRLQRAPAEKGLAYQVAISVPILTGAALLSGETITKMPSTLSIGLMAY
FT                   QTIWVVGLTFLLWFGLVKTYSASKLSAFTFITPLFGVAAGYLIMHDPLTPAFGAAAVLV
FT                   IAGLYLVNRPAPVPAPNDPLLNVTKT"
FT   sig_peptide     566771..566836
FT                   /locus_tag="Rpal_0519"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.985) with cleavage site probability 0.723 at
FT                   residue 22"
FT   gene            567708..569003
FT                   /locus_tag="Rpal_0520"
FT   CDS_pept        567708..569003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0520"
FT                   /product="1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate
FT                   synthase"
FT                   /EC_number="1.17.7.1"
FT                   /note="KEGG: bja:blr0936 4-hydroxy-3-methylbut-2-en-1-yl
FT                   diphosphate synthase; TIGRFAM:
FT                   1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase;
FT                   PFAM: IspG family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99079"
FT                   /db_xref="GOA:B3QBC6"
FT                   /db_xref="InterPro:IPR004588"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR016425"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3QBC6"
FT                   /protein_id="ACE99079.1"
FT                   /translation="MNKLENPLRDDVAGPAPRHQTTQVMVGDVAVGGGAPIVVQSMTNT
FT                   DTADVEGTIKQIAALARAGSEMVRITVDREEAAAAVPHIRDGIRKLGLTTPIIGDFHYI
FT                   GHKLLAEYPACAEALDKYRINPGNVGFKNKRDTQFADIVEIAIKNNKAVRIGANWGSLD
FT                   QELLTKLMDENAASANPRDVRAVTREAMVQSALLSAARAEEIGLPKNKMILSAKVSAVQ
FT                   DLIAVYQDLASRSDYAIHLGLTEAGMGSKGIVASSAALGILLQQGIGDTIRISLTPEPG
FT                   GDRTREVQVGQELLQTMGFRTFVPLVAACPGCGRTTSTTFQELARSIQDFIRDEMPEWR
FT                   SRYPGVENLNVAVMGCIVNGPGESKHANIGISLPGTGETPAAPVFVDGEKFRTLRGENI
FT                   AADFKALVIDYIEQRYGATPKPGAAQMVPAAE"
FT   gene            complement(569246..570898)
FT                   /locus_tag="Rpal_0521"
FT   CDS_pept        complement(569246..570898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0521"
FT                   /product="Na+/H+ antiporter"
FT                   /note="TIGRFAM: Na+/H+ antiporter; PFAM: sodium/hydrogen
FT                   exchanger; KEGG: bja:bll0940 putative Na(+)/H(+) exchanger"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99080"
FT                   /db_xref="GOA:B3QBC7"
FT                   /db_xref="InterPro:IPR004705"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR018422"
FT                   /db_xref="UniProtKB/TrEMBL:B3QBC7"
FT                   /protein_id="ACE99080.1"
FT                   /translation="MQAVAGRFTQNQRGDVEAKFQIFLTLLAVLAGTALLARRVNIAPA
FT                   ILLLIAGITLAFIPGMPAIELPPDLILLLVLPPLIYSASVAMSWREFCANLRAIGLLAI
FT                   GCVIFTACAVAAASHYLIGLPWSVGFLLGAIVAPPDVVAPLAIARKLGLPRRIVVVLEG
FT                   EGLANDATALILYRFAVAAIMTGAFSLTKASGTFVAIMAGELAFGVAVGWLSLRARHWV
FT                   RDPQIEITLSLLTPYIAYWIPEHHGGSGVIATVACGLYISWNGPLLISAATRLQGIFFW
FT                   DLVIYLIEGMLFLLTGFQLRALLERSKEFAFGDILSATLLVAAIVIAARFIWVYPAFYL
FT                   PRFLSRRLRASDPYPSWRTVFVIGFTGVRGAVSLAAALALPYALPGGETFPYRDLILFV
FT                   TFGVILITLVGLGLTLPAVVKLLGVTRVGHREQIAEHDDEITARREALAAAQASLKKIT
FT                   DNRELTDEVLKLLHARHQTRASLLPDPIGSPEHEASAVGIALVRELIAVERKFIHAQLR
FT                   AGKITDEARRRIERDLDLEEASLANRESGPAPL"
FT   gene            571208..572791
FT                   /locus_tag="Rpal_0522"
FT   CDS_pept        571208..572791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0522"
FT                   /product="diguanylate cyclase/phosphodiesterase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; EAL domain protein; KEGG:
FT                   mrd:Mrad2831_4412 diguanylate cyclase/phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99081"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:B3QBC8"
FT                   /protein_id="ACE99081.1"
FT                   /translation="MAIDIGLALISPEGEIVMTNPMFDLAFGAIPHEQLLSRFGFDACR
FT                   EGGKVARPAIFPGDRIYWVDITSFPDGWLISAADISERLRQGIVGAELARTDRLTQLAN
FT                   RLVFHERLADLLAQPADVRRDAAVLTIDLDRFKAINDSLGRNIGDALLCLVAKRISSAL
FT                   TPSDVLARIEADEFGVIQVGRDQPDAAVILAKRLVDLLSRPYLLEGQLINVSAFVGIAL
FT                   PIDDELDVDGVLKNADLALHRAKQERYAGYRVFESAMDESMRARRALETDLRRALALRE
FT                   FSLVYQPQVNLQSRRVAGFEALLRWRCPRRGPVSPLDFIPIAEETGIIGPIGEWVLRTA
FT                   CRDAASWPGDYTVAVNISAIQFTNRSLVATVVSAIADSGLDPRRLELEITESVMLDARG
FT                   NALAVLQQLRGLGVRVSLDDFGTGYSSLGYLRSFPFDKIKIDQSFVREASDDRGNRAIV
FT                   RAIASLGASLGMATVAEGVETEDQLARVAADGCTDVQGYLISRPIPPGEIEHFLAESRN
FT                   VIDAATEVSL"
FT   gene            572809..573252
FT                   /locus_tag="Rpal_0523"
FT   CDS_pept        572809..573252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0523"
FT                   /product="BLUF domain protein"
FT                   /note="PFAM: BLUF domain protein; KEGG: mex:Mext_4031 BLUF
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99082"
FT                   /db_xref="GOA:B3QBC9"
FT                   /db_xref="InterPro:IPR007024"
FT                   /db_xref="InterPro:IPR036046"
FT                   /db_xref="UniProtKB/TrEMBL:B3QBC9"
FT                   /protein_id="ACE99082.1"
FT                   /translation="MPSELYRCVYYSKNLIAGGPARIAEEIESILAAARRNNPTLQVTG
FT                   ALVFNRGLFAQVLEGPCPSVESLFEKISRDERHGDIQVLAFRAVPERLFSNWSMAFLGR
FT                   SREDENLFGHIGPQTGFSTERLEGDRLLEIVRNLAFEEEARAA"
FT   gene            complement(573263..573949)
FT                   /locus_tag="Rpal_0524"
FT   CDS_pept        complement(573263..573949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0524"
FT                   /product="protein of unknown function DUF1345"
FT                   /note="PFAM: protein of unknown function DUF1345; KEGG:
FT                   nha:Nham_0622 protein of unknown function DUF1345"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99083"
FT                   /db_xref="GOA:B3QBD0"
FT                   /db_xref="InterPro:IPR009781"
FT                   /db_xref="UniProtKB/TrEMBL:B3QBD0"
FT                   /protein_id="ACE99083.1"
FT                   /translation="MTEHPDDDPLLLRFRKLPRIVRLVYSRPRLFASIAIGVVAFALLP
FT                   GWLRPVTRALIGWDVSIIVYLALAYTMMARCGVAYIRRNAVLQDDGRFLILMVTAIGAY
FT                   ATIAAIVTELGTAHRGAAELALATFTIALSWAAVHTTFALHYAHEYYRGDREGGLAFPG
FT                   SDEHTEPDYWDFVYFSFVIGMTAQVSDVGITDRTIRRTATAHGVVSFVFNTALVALMVN
FT                   IAASAI"
FT   gene            complement(573957..574883)
FT                   /locus_tag="Rpal_0525"
FT   CDS_pept        complement(573957..574883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0525"
FT                   /product="Polyprenyl synthetase"
FT                   /note="PFAM: Polyprenyl synthetase; KEGG: nha:Nham_0623
FT                   polyprenyl synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99084"
FT                   /db_xref="GOA:B3QBD1"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:B3QBD1"
FT                   /protein_id="ACE99084.1"
FT                   /translation="MATGTSTIDFAKRLDTTAEETEALLGRLLSDELMSDEIARPRRLM
FT                   DAIRYSTLGGGKRLRPFLAVESAAVFGIDRAAALLVGAALECIHCYSLIHDDLPSMDNS
FT                   DLRRGRPTLHKAYDDATAILAGDALLTFAFDIVTRDEVHNDPTVRLLLTRVLARCAGLG
FT                   GMVGGQMLDLAGEGRFGDREPVDVARLQQMKTGALLRYGCVAGAILGQASPDQYRALDD
FT                   YGRALGEAFQIADDLLDVEGDAAALGKPAGADAALGKTTFVTQLGIDGAKQRLRDLIAR
FT                   ADQALAPFGERGEVLRAAARFVAERKS"
FT   gene            574985..575695
FT                   /locus_tag="Rpal_0526"
FT   CDS_pept        574985..575695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0526"
FT                   /product="monofunctional biosynthetic peptidoglycan
FT                   transglycosylase"
FT                   /note="TIGRFAM: monofunctional biosynthetic peptidoglycan
FT                   transglycosylase; PFAM: glycosyl transferase family 51;
FT                   KEGG: nha:Nham_0624 monofunctional biosynthetic
FT                   peptidoglycan transglycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99085"
FT                   /db_xref="GOA:B3QBD2"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR011812"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3QBD2"
FT                   /protein_id="ACE99085.1"
FT                   /translation="MSDPVASAPRTKRVVRIVILVALALLALPYLLTILYGGGQPVSTL
FT                   MLWRWATGAPVSRTWIDIENISPALPRSVVAAEDAKFCSHHGIDWDSVRDVIDDMQDGE
FT                   ASRGGSTITQQVAKNLFLWPGRSMIRKALEAPLALWIDFVLPKQRILEIYLNIAEWGPD
FT                   GQFGAMAGADYAFGRSAAQLSAKEAATLAAILPNPRVRSAKAPGPGVRRLAATYVARAR
FT                   AAELRQCWRENRES"
FT   gene            575857..576039
FT                   /locus_tag="Rpal_0527"
FT   CDS_pept        575857..576039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0527"
FT                   /product="ribosomal protein L32"
FT                   /note="TIGRFAM: ribosomal protein L32; PFAM: ribosomal L32p
FT                   protein; KEGG: bra:BRADO0557 50S ribosomal protein L32"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99086"
FT                   /db_xref="GOA:B3QBD3"
FT                   /db_xref="InterPro:IPR002677"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3QBD3"
FT                   /protein_id="ACE99086.1"
FT                   /translation="MAVPRRKTSPSRRGMRRSADAIKRPTYVEDKDSGELRRPHHLDLK
FT                   TGMYKGRQVLKKKDS"
FT   gene            576282..576905
FT                   /locus_tag="Rpal_0528"
FT   CDS_pept        576282..576905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0528"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bra:BRADO0558 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99087"
FT                   /db_xref="GOA:B3QBD4"
FT                   /db_xref="UniProtKB/TrEMBL:B3QBD4"
FT                   /protein_id="ACE99087.1"
FT                   /translation="MSIIGFPLLLIPVAICNIIVFLMPGLAFDAALTRVVLPSGATWTI
FT                   ALGDTLVALGVLLLLPEVMKAARPGAKYLTDHLLSLLVLGGITAEFVMLPQFANATVAL
FT                   LSLLALVDFLSGIALRSRHKREARAARSAAAKSSAETIEDEPEPVAEPAPVVVPATELA
FT                   PQTVEPTSASAASAASIAEAVLLDRPEPVKPAETAKNEEKSPAR"
FT   gene            complement(576922..577236)
FT                   /locus_tag="Rpal_0529"
FT   CDS_pept        complement(576922..577236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0529"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99088"
FT                   /db_xref="UniProtKB/TrEMBL:B3QBD5"
FT                   /protein_id="ACE99088.1"
FT                   /translation="MAKVWIDDGSDVYSASAEPDCAEAELIEPLPVPVTPPPMRTRYTD
FT                   RLVRPSSNFVAQLMAIDGGYPQTRDCNRAEPGQANAAYRSSTGHAHTAPPTGFKTQRMS
FT                   "
FT   gene            577475..579217
FT                   /locus_tag="Rpal_0530"
FT   CDS_pept        577475..579217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0530"
FT                   /product="diguanylate cyclase/phosphodiesterase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; EAL domain protein; KEGG: bja:blr0951
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99089"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:B3QBD6"
FT                   /protein_id="ACE99089.1"
FT                   /translation="MSSAAPAPRSSTAQTVTAPDSLLLSLLGQAAFVWDLASDTLSWTG
FT                   RAAEFFQDIPAETLATGASFAALLEPSRHVRSDALLNGAAAAGPGCVPYRIEYGIRAST
FT                   AAPVSWIEETGVWFAGPDGRPARVEGIVRINNERHARDEQLLKLSQHDPLTGELNRTHL
FT                   IGALAEAIEEASRFRTSLSFMLVGLDHLARVNDSFGFDVADEVILTIAGRIRNRLRAGD
FT                   QLGRFSGNKFGLVLKNCTVDDAHIAAERFLAAVRDEIVPTKSGPVSLTASIGAVSAPRH
FT                   ARTADEAINRAQEALAAAKHRRSGSFAMWRPNVERDTQRRVNIRVTDEIVTALNERRIV
FT                   LAYEPVVDASSRAPAFHECLVRMKTDDGQVLFAPDIVPVAERLGLIRLVDHRVLELVVA
FT                   ELAAAPGVTLSLNISPDTTIDADWWAGIESLMLAHPGIAERLIVEITETVAIPDLDEVR
FT                   GFVNRLKTLGAKIAIDDFGAGYTSFRNLRALGVDIVKIDGAFVQNIARSADDRAFVQTL
FT                   IDLARRLGIKTVAEWVQDDESAQLLRDWGCDYIQGRLIGLASQQRPWPLAAEAAARLAG
FT                   KAVN"
FT   gene            complement(579348..579938)
FT                   /locus_tag="Rpal_0531"
FT   CDS_pept        complement(579348..579938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0531"
FT                   /product="polyhydroxyalkonate synthesis repressor, PhaR"
FT                   /note="TIGRFAM: polyhydroxyalkanoate synthesis repressor
FT                   PhaR; PFAM: PHB accumulation regulatory domain protein; PHA
FT                   accumulation regulator DNA-binding protein; KEGG:
FT                   bbt:BBta_7615 putative polyhydroxyalkanoate synthesis
FT                   repressor PhaR-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99090"
FT                   /db_xref="GOA:B3QBD7"
FT                   /db_xref="InterPro:IPR007897"
FT                   /db_xref="InterPro:IPR010134"
FT                   /db_xref="InterPro:IPR012909"
FT                   /db_xref="UniProtKB/TrEMBL:B3QBD7"
FT                   /protein_id="ACE99090.1"
FT                   /translation="MAKSDQPTTIKKYANRRLYNTGTSTYVTLEDLATMVKDGEDFLVY
FT                   DAKTGDDITRSVLAQIIFEQENKAGQNLLPTTFLRQLIRFYGDSMQMVVPKYLEQSIDS
FT                   LTREQEKFRKQMASTFSLTPFAPLEETVRRNMELFQQTFSMFVPRPPSHESTDEVPAET
FT                   SGGADSIEDLRRQMKEMQERLERMSLEQPKKDE"
FT   gene            580220..581398
FT                   /locus_tag="Rpal_0532"
FT   CDS_pept        580220..581398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0532"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.9"
FT                   /note="KEGG: bja:bll0226 acetyl-CoA acetyltransferase;
FT                   TIGRFAM: acetyl-CoA acetyltransferase; PFAM: Thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99091"
FT                   /db_xref="GOA:B3QBD8"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:B3QBD8"
FT                   /protein_id="ACE99091.1"
FT                   /translation="MSDDVVIVSAARTAVGSFNGAFANTPAHELGAVAIKAALERGGID
FT                   PAQVSEVIMGQILTAGQGQNPARQASIAAGIPVESPAWGINQLCGSGLRSVALGYQALM
FT                   NGDSDIVIAGGQESMSMAPHAQYLRGGVKMGAVELVDTMLKDGLWDAFNGYHMGNTAEN
FT                   VARQWQITRDQQDEFAVASQQKAEAAQKAGKFKDEIVPVTIKTRKGDIVVDTDEYPRHG
FT                   ATLEAMAKLKPAFEKDGTVTAGSASGINDGAAAVVLMTAKQAEKLGKKPLARIVSWGQA
FT                   GVDPKIMGSGPIPASRAALKKAGWSVGDLDLIEANEAFAAQACAVNKDLGWDTSKVNVN
FT                   GGAIAIGHPIGASGARVLVTLLHEMQKRDSKKGLATLCIGGGMGIAMCLARD"
FT   gene            581581..582306
FT                   /locus_tag="Rpal_0533"
FT   CDS_pept        581581..582306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0533"
FT                   /product="acetoacetyl-CoA reductase"
FT                   /note="TIGRFAM: acetoacetyl-CoA reductase; PFAM:
FT                   NAD-dependent epimerase/dehydratase; short-chain
FT                   dehydrogenase/reductase SDR; KR domain protein; KEGG:
FT                   nha:Nham_3689 acetoacetyl-CoA reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99092"
FT                   /db_xref="GOA:B3QBD9"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011283"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B3QBD9"
FT                   /protein_id="ACE99092.1"
FT                   /translation="MTRVALVTGGTRGIGAAISKALKAAGYKVAASYAGNDSAAEKFKN
FT                   ETGIPVYKWDVSSFDACAEGVKKVEAELGPVDVLVNNAGITRDGAFHKMTLEQWNAVIN
FT                   TNLGSLFNMTRQVIEGMRTRKFGRIVNISSINGQKGQFGQVNYSAAKAGDIGFTKALAL
FT                   ENARGGITVNVICPGYINTEMVQAVPKDVLDKAILPLIPCNRLGEAEEIARAVVFLAGD
FT                   DAGYITGSTLTINGGQYMV"
FT   gene            582383..583249
FT                   /locus_tag="Rpal_0534"
FT   CDS_pept        582383..583249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0534"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: bra:BRADO0564 conserved hypothetical
FT                   protein; putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99093"
FT                   /db_xref="GOA:B3QBE0"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B3QBE0"
FT                   /protein_id="ACE99093.1"
FT                   /translation="MTSRVATLIGLSAILMWSLLAVMTVATGTIPPFQLAAMTFAIGAL
FT                   AAAVGWIVRPQAVRALRQPPLVWAVGVGGLFGYHALYFLALRLAPPAEAGLLNYLWPLL
FT                   IVLFSSLLPGERLKLHHLAGALLGLAGTVLLFTGNGAAIERAYLPGLAAAFVAAFVWAS
FT                   YSVLSRRLSAVPTDAVAGFCFVTALLAAAVHVLIEPTVWPDDALQWTSIVALGIGPVGA
FT                   AFYAWDIGMKRGDIRVLGAASYATPLLSTAFLIVAGYARPSTALAVAALLIAGGGLLAA
FT                   KDMLKRG"
FT   sig_peptide     582383..582469
FT                   /locus_tag="Rpal_0534"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.220 at
FT                   residue 29"
FT   gene            complement(583269..583790)
FT                   /locus_tag="Rpal_0535"
FT   CDS_pept        complement(583269..583790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0535"
FT                   /product="conserved hypothetical protein; putative signal
FT                   peptide; putative protease"
FT                   /note="KEGG: bra:BRADO0756 conserved hypothetical protein;
FT                   putative signal peptide; putative protease"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99094"
FT                   /db_xref="GOA:B3QBE1"
FT                   /db_xref="InterPro:IPR001969"
FT                   /db_xref="InterPro:IPR011969"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="InterPro:IPR034122"
FT                   /db_xref="UniProtKB/TrEMBL:B3QBE1"
FT                   /protein_id="ACE99094.1"
FT                   /translation="MRSIMIFAAALVVLGTAMAQIADRITPAPAQAHAAPHGTIGTAAA
FT                   TPETYGRSISIDRDPRGHFRTDGRIDGQRLSFMVDTGASVVALNESSAARFGLRPSRGD
FT                   YTAKVSTANGQVKAARARIAMLDVGGLIVRDVDALVLPDEALSENLLGLSYLSKLKRFA
FT                   YADGRMVLEQ"
FT   sig_peptide     complement(583731..583790)
FT                   /locus_tag="Rpal_0535"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.989 at
FT                   residue 20"
FT   gene            complement(583921..586398)
FT                   /locus_tag="Rpal_0536"
FT   CDS_pept        complement(583921..586398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0536"
FT                   /product="ATP-dependent helicase HrpB"
FT                   /note="KEGG: bbt:BBta_7352 ATP-dependent helicase; TIGRFAM:
FT                   ATP-dependent helicase HrpB; PFAM: helicase domain protein;
FT                   helicase-associated domain protein; Helicase ATP-dependent
FT                   domain protein; SMART: DEAD-like helicases"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99095"
FT                   /db_xref="GOA:B3QBE2"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR010225"
FT                   /db_xref="InterPro:IPR013689"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3QBE2"
FT                   /protein_id="ACE99095.1"
FT                   /translation="MTRTFDTPLPIDDALDELTAALEASNTAVLVAPPGAGKTTRVPLA
FT                   LLDAPWLRNQKIIVLEPRRIAARASAERMAKTLSEKAGERIGYRVRFGSKVSRATRIEV
FT                   VTEGIFTRQILDDPELNGVAAVLFDEFHERSLDADLGLALARDAQQGLREDLRILVMSA
FT                   TIDGARVARLLGDAPVVESLGRAFPVETRYLGRRSDAPLERLMAEAIAQALRAETGSVL
FT                   AFLPGAAEIRRTETMLRERVQDPGVEIVPLFGALDAAVQDRAIQPAPKGQRKVVLATSI
FT                   AETSLTIEGVRIVVDCGLSRVPRYEPDLGLTRLETVRASRAAVDQRRGRAGRIEPGVCY
FT                   RLWDEPQTASLPAYTQPEILSADLSSLLLDLAQWGVADPSSLAFLDPPPQPALKEAREL
FT                   LGELGALDPDGRITDEGRSLRAMALPPRLARMIVDAAHHGCAEDAAEVAAILTERGLGG
FT                   DSADLDHRRDQFRRDRSQRASSARQMAQRWAAQAASSSPSPQDAFELSSGVLLAFAFPD
FT                   RVARNRGNGSFTLANGRGAAVEQTSALARAPYLAVGELTGSAAQGRILLAAPITLSEIE
FT                   LHFGDQITDADEVSFDRSAMALRARRRRALHAITLSEAPLALTPSDQTARVLAEGLVVA
FT                   GLDRLPWSKQLQQWRGRVMFLRKAEGDPWPDLSDAALADSRENWLVPALFDKTGLKDFS
FT                   ASDLSDALMNLLPWELRARLDREAPTHFEAPTGSKLPIDYEAEQGPTIAVRLQELFGLT
FT                   THPSVAGGAVPLVLELLSPAHRPVQVTRDLPGFWRGSYAGVRADLRGRYPRHPWPEDPA
FT                   SAPPTRRAKPKGT"
FT   gene            586572..587624
FT                   /locus_tag="Rpal_0537"
FT   CDS_pept        586572..587624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0537"
FT                   /product="acyltransferase 3"
FT                   /note="PFAM: acyltransferase 3; KEGG: nwi:Nwi_0358
FT                   acyltransferase 3"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99096"
FT                   /db_xref="GOA:B3QBE3"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:B3QBE3"
FT                   /protein_id="ACE99096.1"
FT                   /translation="MTANGTLAPRMHGGRVDWVDYAKGICIIMVVMMHSVLGVEAAAGQ
FT                   TSFMHYVVEFARPFRMPDFFLISGLFLSVVIDRGWRTYLDRKVVHFAYFYVLWVTIQFA
FT                   FKAPSFAAEMGWAGVAKLYALSFIDPFGTLWFIYLLPIFFVVTKLTRRLPPLLIWGVAA
FT                   LLESLHVATGWMVPDEFCARFFYFYTGYLFARHVFAFSDAARARPALALFGLAVWAVVN
FT                   AVLVHVGATDLPVISLLLGLAGACAIITVGTLLAEKRWLDGLRFCGEHSIVIYLAFFLP
FT                   MAISRSLLLKYAPFLDLGVIAIIVNIAGVVGALIIWKLAMKSRVTFLFERPDAFWIAPR
FT                   KQATRLQAAE"
FT   gene            complement(587743..589302)
FT                   /locus_tag="Rpal_0538"
FT   CDS_pept        complement(587743..589302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0538"
FT                   /product="succinate CoA transferase"
FT                   /EC_number="3.1.2.1"
FT                   /note="KEGG: azo:azo3307 probable coenzyme A transferase;
FT                   TIGRFAM: succinate CoA transferase; PFAM: acetyl-CoA
FT                   hydrolase/transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99097"
FT                   /db_xref="GOA:B3QBE4"
FT                   /db_xref="InterPro:IPR003702"
FT                   /db_xref="InterPro:IPR017821"
FT                   /db_xref="InterPro:IPR026888"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR038460"
FT                   /db_xref="UniProtKB/TrEMBL:B3QBE4"
FT                   /protein_id="ACE99097.1"
FT                   /translation="MVNAERILAPHLRSKVMTAADAAALIPSGAHVGMSGFTGAGYPKL
FT                   LPLALAERINAHHARGQKFKVSVWTGASTAPELDGALAKVDGIEMRLPYQSDPTCRKRI
FT                   NAGRMEYIDIHLSHVAQHAWFGFLGKLDIAVVEVAGIREDGSLIPSSSIGNNKTWLDLA
FT                   DKVILEVNAWQDIRLEGMHDVYYGTQLPPNRKPIPIIASGDRIGEQYLRCDSAKIVAIV
FT                   ETNLPDRNSAFSPPDDTSQAIAGHILDFLGHEVKKGRLPHNLLPLQSGVGNVANAVMAG
FT                   LEDGPFDNLTAYTEVLQDGMLHLLRKGKLAHASATALSLSPEGYDEFLRNLDFYRERIV
FT                   LRQQEISNHPEVIRRLGVIAMNGMIEADIYGNVNSTHVMGTSIMNGIGGSGDFARNSFL
FT                   SFFMTPSAAKGGKISCIVPMTSHVDHTEHDVQVIVTEQGLADLRGLSPKQRAKVIIENC
FT                   AHPTFRPALKEYFKRALEYSPGLHTPHILDEALTFLPNWMANKAAREAWRDDAVVQADA
FT                   WR"
FT   gene            complement(590049..591503)
FT                   /locus_tag="Rpal_0539"
FT   CDS_pept        complement(590049..591503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0539"
FT                   /product="porin"
FT                   /note="PFAM: porin; KEGG: bbt:BBta_3063 putative exported
FT                   protein of unknown function with porin precursor domain"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99098"
FT                   /db_xref="GOA:B3QBE5"
FT                   /db_xref="InterPro:IPR003684"
FT                   /db_xref="UniProtKB/TrEMBL:B3QBE5"
FT                   /protein_id="ACE99098.1"
FT                   /translation="MNIIKQLALGTAAAVIAVGSAQAADLPLKAKAVEYVKVCSIYGAG
FT                   FYYIPGTDTCIKLGGYLRADVTMFGSGGYNAPAWNGNAGQKNRLSNDYIFRSRQDINID
FT                   TRTATEYGVVRTYFDATFNWTTGSDTIANGSLGVYYAFIQFAGFTFGKAVSQFDTPWTG
FT                   YPGNNTSFLIGGYDDVTGINQVSYTAEFGNGVSASISLEDQSSYLQSALYNVSSAPNFL
FT                   AYGANSYAGTSIPDIVGKIRVDQAWGLFQVSAAAHQVRASYYNPALETSGHPSDTWGYA
FT                   VQGALSLKNLPTGPGDSINITATYSNGATRYVLGGVSPNSFAIYGNNSVPGTYQSVAFG
FT                   VAADGVFAGLNNLTGSGIEKTSAWGVRGAFNHNWNPYWSTSLFGSYTKIDYNGTATALI
FT                   CNGLGAGNVAGFNCNPDFAIAQVGTVTRWTPVKNLTLSGEVMYTYLDQASSGVLPLTAS
FT                   ATKPAANYEFKDQGVWSGNLRVQRNF"
FT   sig_peptide     complement(591432..591503)
FT                   /locus_tag="Rpal_0539"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 24"
FT   gene            592093..592605
FT                   /locus_tag="Rpal_0540"
FT   CDS_pept        592093..592605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0540"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; KEGG: bja:blr4984
FT                   transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99099"
FT                   /db_xref="GOA:B3QBE6"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B3QBE6"
FT                   /protein_id="ACE99099.1"
FT                   /translation="MQTKSKADARAPRGSTIDPDLARRFATTVASVTVFLDEIRQFRAK
FT                   SLGISGPQFALLMAVMDLEQGDGVSIRHVAKAVHVDPSFITTQSKLLEKKGLVRRQVDS
FT                   HDARVVKLSLSDKAYKQIAALATDERDLNSFIFEDISGEALEQLTSQLGDLQNRLEKAT
FT                   VKLASGL"
FT   gene            complement(592600..593718)
FT                   /locus_tag="Rpal_0541"
FT   CDS_pept        complement(592600..593718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0541"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bja:bll4985 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99100"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B3QBE7"
FT                   /protein_id="ACE99100.1"
FT                   /translation="MRLVSGIQDHCDVRGLLDHDAYSGEFSRLLCVAQNEGVSFSECVA
FT                   AAKLIRSSNGPGWRQAWEELARSHVQRAEEARRTGNEPEAQKSWLHAANYFMAAAIESG
FT                   PEGAEPALGALARSCLHNYLAHLTPQGETVAIPWLEPRSLEGFYLPVGTYSAETGPVVV
FT                   CIAETRRTKEEILSLVLRSARKRGMTLLCVGLPDEPPSSRAGPETGIPAILDYLIDGRG
FT                   IDAKRIAVISDGSPSSLVTRGIALDGRIAAAVCDGGLWDLWVARQTEACGAALGMVQGC
FT                   ARRPAVSCPMLVPLLASEGIEPGHARQLLTEHHPGNRDILLKVFGETSSGPWTLNGYDP
FT                   ILVADFVFDWVGQQLKAATGDADCIRRLESRL"
FT   gene            complement(593936..594020)
FT                   /locus_tag="Rpal_R0009"
FT                   /note="tRNA-Leu5"
FT   tRNA            complement(593936..594020)
FT                   /locus_tag="Rpal_R0009"
FT                   /product="tRNA-Leu"
FT   gene            594191..594739
FT                   /locus_tag="Rpal_0542"
FT   CDS_pept        594191..594739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0542"
FT                   /product="disulphide bond formation protein DsbB"
FT                   /note="KEGG: nha:Nham_3497 disulphide bond formation
FT                   protein DsbB"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99101"
FT                   /db_xref="GOA:B3QBE8"
FT                   /db_xref="InterPro:IPR003752"
FT                   /db_xref="InterPro:IPR023380"
FT                   /db_xref="InterPro:IPR024199"
FT                   /db_xref="UniProtKB/TrEMBL:B3QBE8"
FT                   /protein_id="ACE99101.1"
FT                   /translation="MSADLIDHRDTLSETGRPERIAGGVGLTVAVVAVAALGLAWFSQL
FT                   VLELAPCKLCLEQRYAYYLDIPLGLLIAFAAWRRAPVGLLAAGLVVLGLMALGNAGLAA
FT                   YHAGVEWRFWAGPSDCSGPILDLSKAGGLLAQLDTVKVVRCDEVQWRFLGLSFAGYNVL
FT                   ASLALAVLCGWGLMRLKRR"
FT   gene            complement(594742..595794)
FT                   /locus_tag="Rpal_0543"
FT   CDS_pept        complement(594742..595794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0543"
FT                   /product="membrane protein AbrB duplication"
FT                   /note="TIGRFAM: membrane protein AbrB duplication; PFAM:
FT                   putative ammonia monooxygenase; KEGG: bja:bll1341
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99102"
FT                   /db_xref="GOA:B3QBE9"
FT                   /db_xref="InterPro:IPR007820"
FT                   /db_xref="InterPro:IPR017516"
FT                   /db_xref="UniProtKB/TrEMBL:B3QBE9"
FT                   /protein_id="ACE99102.1"
FT                   /translation="MTLRSKTLQVIETIAIGSAGGALFYWAQLPGGLITGAMIAVGAAG
FT                   LAGRKMGLPPPLSHIVLMALGVSLGSVVSPTMVHNLASYPVTIGLLAVATFCATFGSSI
FT                   YLQRVHGWDRTSALLAGSPGALSQIIMLATERKADVPGIAVVQVMRVIILTSAVPMLLA
FT                   LIGMAGHGALPSRGPEATPLVLAVLIAVAVGVALLLRLVNFPASWMFGAMLGSSVLHGG
FT                   GWVEGTLPQWAYLAALVGIGTLIGARFGAIKPRTILSYIGAALGSFAVAIAISAVFVIA
FT                   IMLTTPVKLNDLVVAFSPGAMDAMMALALTLHIDPVFVGAHHLSRFIYVSIVTPGIVHL
FT                   FGHSPDDVDD"
FT   gene            595989..596516
FT                   /locus_tag="Rpal_0544"
FT   CDS_pept        595989..596516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0544"
FT                   /product="conserved hypothetical protein; putative signal
FT                   peptide"
FT                   /note="KEGG: bra:BRADO6543 conserved hypothetical protein;
FT                   putative signal peptide"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99103"
FT                   /db_xref="UniProtKB/TrEMBL:B3QBF0"
FT                   /protein_id="ACE99103.1"
FT                   /translation="MRVLRYETRAALLTAAALLTWSAATPAQALTAQECSAKYQAAKTD
FT                   GTLNGQGWNDFRKEHCGAAASTDSKAAEAKPADAKPDAKREAKSEAKPADSKPESKSKA
FT                   KSAAVPSVPQGPAVYPSAIDAKFAQEKPTLARLHTCAQQWKANKAANTTGGLRWIQKGG
FT                   GYWSECNKRLKG"
FT   sig_peptide     595989..596078
FT                   /locus_tag="Rpal_0544"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.985 at
FT                   residue 30"
FT   gene            596670..597053
FT                   /locus_tag="Rpal_0545"
FT   CDS_pept        596670..597053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0545"
FT                   /product="LrgA family protein"
FT                   /note="PFAM: LrgA family protein; KEGG: bja:blr1347
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99104"
FT                   /db_xref="GOA:B3QBF1"
FT                   /db_xref="InterPro:IPR005538"
FT                   /db_xref="UniProtKB/TrEMBL:B3QBF1"
FT                   /protein_id="ACE99104.1"
FT                   /translation="MIASVGLILLCQLVGEVIARGLGLPLPSPVLGLLLLFVLLVVRDY
FT                   IKPLAIGPLGNGGVEDASKGMLAHLSLLFVPAGVGVIQQLDMITTHGIAIMLVLAGSVL
FT                   ITLVVTVVTFVVVARLLAMWVPR"
FT   gene            597050..597772
FT                   /locus_tag="Rpal_0546"
FT   CDS_pept        597050..597772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0546"
FT                   /product="LrgB family protein"
FT                   /note="PFAM: LrgB family protein; KEGG: bja:blr1348
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99105"
FT                   /db_xref="GOA:B3QBF2"
FT                   /db_xref="InterPro:IPR007300"
FT                   /db_xref="UniProtKB/TrEMBL:B3QBF2"
FT                   /protein_id="ACE99105.1"
FT                   /translation="MNANPFSLWVYLSQTPLLWLTVTLLVYAATDAVSQATGRNPLVNP
FT                   VLHAMWIIGVFLWATGTSYTTYFSGAQFVHFLLGPATVALAVPLYENRKLVLAAILPMA
FT                   LALVVGCVTAIVSVVWLAQLAGLPETVVLSLAPKSVTAGVAMGISESLHADPSLTAVAV
FT                   ILTGILGAIVVSPLMNRLGIRDYRARGFAVGLASHGIGTARAFQVDAIAGVFAGIAMSL
FT                   NALITALLVPVLVTLLVR"
FT   gene            597867..598331
FT                   /locus_tag="Rpal_0547"
FT   CDS_pept        597867..598331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0547"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mrd:Mrad2831_1254 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99106"
FT                   /db_xref="GOA:B3QBF3"
FT                   /db_xref="UniProtKB/TrEMBL:B3QBF3"
FT                   /protein_id="ACE99106.1"
FT                   /translation="MSDASVLSAAHAAAPPLRWAMPRPILAIVAALIAAAAAALAVPDA
FT                   ATAANAQSDAELVLLLRFMAGVKAVLALAALGAVVWRLGYAASPFLSAVYLLAPALMVA
FT                   APVLIWQIAPTALGAGLFHGGLALLLLALFADRGQTSKLVRRTLLARHTA"
FT   sig_peptide     597867..597992
FT                   /locus_tag="Rpal_0547"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.871) with cleavage site probability 0.682 at
FT                   residue 42"
FT   gene            complement(598335..599411)
FT                   /locus_tag="Rpal_0548"
FT   CDS_pept        complement(598335..599411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0548"
FT                   /product="phospholipase/Carboxylesterase"
FT                   /note="PFAM: phospholipase/Carboxylesterase; KEGG:
FT                   bra:BRADO6537 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99107"
FT                   /db_xref="GOA:B3QBF4"
FT                   /db_xref="InterPro:IPR003140"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B3QBF4"
FT                   /protein_id="ACE99107.1"
FT                   /translation="MSEAVIDDIVALLPPLLQSLESLGFVARYLHPPEFGDLLKLAGTP
FT                   DEALQTELPRLANWPETFAHLRGPLQTAGEQALTAFAGLRAVDAGQGDLGDVFRALRHL
FT                   PQALEALYPLAANLPPVSSFFLDPDSQENDKLLARLTQPKHPDSGVFHRFNEPGSRGGY
FT                   SLYVPEYYDPDREWPLVMALHGGSGHGRLFLWSWLRDARARGAIVVAPTATGRTWALIG
FT                   EDVDSPNLARILDEVRGHWRIDPSRLLLTGLSDGGTFCYVSGLTSDSPFTHLAPIAASF
FT                   HPLLAGAADSSRLRGLPIQIVHGRHDWMFPVEVARQAHEALVSAGADVSYREIADLSHS
FT                   YPREANVALLDWLKAPAA"
FT   gene            599594..600748
FT                   /locus_tag="Rpal_0549"
FT   CDS_pept        599594..600748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0549"
FT                   /product="protein of unknown function UPF0118"
FT                   /note="PFAM: protein of unknown function UPF0118; KEGG:
FT                   bbt:BBta_2998 putative membrane protein of unknown
FT                   function"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99108"
FT                   /db_xref="GOA:B3QBF5"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:B3QBF5"
FT                   /protein_id="ACE99108.1"
FT                   /translation="MPASENKFFILLLVVATGLFGWILWPLYSAVLWGMVIAILFAPLN
FT                   RGLNRAFGFRRNLAALMSVTIIVLMVLLPMSLLGAALAREAAGMYTKIESGNLDLLKTM
FT                   RELLAARPDWLGDLLSRFGVGNLADIQQRLSAALLRGSQYLAGQALDIGQSTFDFTVNL
FT                   FVMVYLLFFLLRDGDLLAARIRRATPLGVDHQTRLLDKFTVVIRATVKGNMLIALIQGA
FT                   LGGLAFYVLGISGALMWAVVMAFLSLLPAVGAGIVWLPMALYLIASGSVWHGVGLIVWG
FT                   MLVIGMVDNFLRPILVGKDTRMPDYVVLISTLGGLEVFGLNGFVIGPVIAAMFIATWDI
FT                   YSIAREDAGDTPRIGAGTGPAAVAPSEPSGPVPVRSDSGTTPVA"
FT   sig_peptide     599594..599683
FT                   /locus_tag="Rpal_0549"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.602) with cleavage site probability 0.448 at
FT                   residue 30"
FT   gene            complement(600745..601407)
FT                   /locus_tag="Rpal_0550"
FT   CDS_pept        complement(600745..601407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0550"
FT                   /product="anti-ECFsigma factor, ChrR"
FT                   /note="TIGRFAM: anti-sigma factor, ChrR family; KEGG:
FT                   rle:pRL120581 putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99109"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012807"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR025979"
FT                   /db_xref="UniProtKB/TrEMBL:B3QBF6"
FT                   /protein_id="ACE99109.1"
FT                   /translation="MTVRHHIGDDLLLSYAAGTLDEASSLLVATHLALCPHCRARAAAA
FT                   DALGGEMLDALPAAAVTPQLWQNVLARTQDQPETPPAIPATALRPRSDIVIPEPLRSYL
FT                   GTDLAGLRWTRLAPRVQQITIDIPGCRPRARMLRFEAGTRVLEHGHSGRELTLVLHGSL
FT                   CDGAAVMRRGDVAETDEGTEHQPQAGPDGDCICLAVTDAPLRFKSRFARLLQPWFGI"
FT   gene            complement(601404..601991)
FT                   /locus_tag="Rpal_0551"
FT   CDS_pept        complement(601404..601991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0551"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: sigma-70 region 2 domain protein; sigma-70
FT                   region 4 domain protein; Sigma-70 region 4 type 2; KEGG:
FT                   rru:Rru_A0722 RNA polymerase sigma factor RpoE"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99110"
FT                   /db_xref="GOA:B3QBF7"
FT                   /db_xref="InterPro:IPR000838"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:B3QBF7"
FT                   /protein_id="ACE99110.1"
FT                   /translation="MDQLRDGPRPPSAEMADCIVRIAVAQDRAAFETLFRHFAPRLKSY
FT                   FARRGGDPTLAEEITQETMVSVWRSAAQFDPARASASTWIFTIARNLSIDRLRQAKRPG
FT                   FDPHDPAFVPDEEEPPDRRLERTETEQRVREVMETLPFNEKSVLMLSFYENQSHSEIAE
FT                   QLGLPVGTVKSRIRLAFGKLRAALDTTAGEPR"
FT   gene            602382..602483
FT                   /locus_tag="Rpal_0552"
FT   CDS_pept        602382..602483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0552"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99111"
FT                   /db_xref="GOA:B3QBF8"
FT                   /db_xref="UniProtKB/TrEMBL:B3QBF8"
FT                   /protein_id="ACE99111.1"
FT                   /translation="MSMLRKLNGMEAAVIGGALLMTLAPLVPYAMLG"
FT   gene            complement(602619..603500)
FT                   /locus_tag="Rpal_0553"
FT   CDS_pept        complement(602619..603500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0553"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: mrd:Mrad2831_3013 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99112"
FT                   /db_xref="GOA:B3QBF9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037409"
FT                   /db_xref="UniProtKB/TrEMBL:B3QBF9"
FT                   /protein_id="ACE99112.1"
FT                   /translation="MEIRHLRYFAAVARHLNFTAAAESLGVAQPPLSQQIRDLEAEIGT
FT                   PLFERTTRRVALTRAGEDFLKQALAILERADNAVQRARSIGAGTAGILNVGLTGSVLTG
FT                   PLGRAIQQFALNYPNVDLRIHEMSPDRQVAALKSGQTDVSFLRCPPQDAEIASELAWRE
FT                   SVRLVLPKGHALSARKVTLADLRDESFVFLRLEDSLFAKYLWQCCFEAGYAPRVTHQAI
FT                   ESTSLTSLVAAGLGVAIIPEFVSKLAHPDVVYRPIAGPPISADVHALTTAANNPLASQF
FT                   IALVQTLSGKAS"
FT   gene            603606..604913
FT                   /locus_tag="Rpal_0554"
FT   CDS_pept        603606..604913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0554"
FT                   /product="sodium:dicarboxylate symporter"
FT                   /note="PFAM: sodium:dicarboxylate symporter; KEGG:
FT                   mrd:Mrad2831_3012 sodium:dicarboxylate symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99113"
FT                   /db_xref="GOA:B3QBG0"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR018107"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:B3QBG0"
FT                   /protein_id="ACE99113.1"
FT                   /translation="MKRFFASLFGQVVTALVLGVVVGALWPEVGVALKPLGDLFIKLIK
FT                   FAIAPLVFGVVVNGIVGAGDLKKVGRVGLKSLIYFEAVTTLALALGIALAYVFQPGAGM
FT                   NVNTATLDGSALAGYSSHVKEVTGFTDFIMRLVPTTFIDAFAKGDVLQVLIIAILFGAG
FT                   LSLLGERGKPLADSIERITEVLFKIIGIIVKLAPLGVLGAVSFTVAKYGIGSLKQLGLL
FT                   VGLFYVGVALFVFVILGGIMRLAGFSLIKLLAYLREELTVVAGTASSDSVLPQVMRKLE
FT                   RLGIKDSTVGLVIPTGYSFNLDAFSLYLTLATVFIAQATNTPLSFGHLLVILGIALLTS
FT                   KGAHGVPGSAIVVLAATLSAVPDIPLIGLVLVLSVDWFVGIARALGNLVGNCVATVVIA
FT                   AWEGDIDRAQAKRVLNGEVTTDTAAILDAPVAEASA"
FT   sig_peptide     603606..603677
FT                   /locus_tag="Rpal_0554"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.784) with cleavage site probability 0.460 at
FT                   residue 24"
FT   gene            604951..605790
FT                   /locus_tag="Rpal_0555"
FT   CDS_pept        604951..605790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0555"
FT                   /product="allantoin catabolism protein"
FT                   /note="TIGRFAM: allantoin catabolism protein; PFAM: protein
FT                   of unknown function DUF861 cupin_3; Cupin 2 conserved
FT                   barrel domain protein; KEGG: mrd:Mrad2831_3011 allantoin
FT                   catabolism protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99114"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR017627"
FT                   /db_xref="UniProtKB/TrEMBL:B3QBG1"
FT                   /protein_id="ACE99114.1"
FT                   /translation="MNAPTYNPACGGLPPQTALHTGRAVFTEAYAVIPHGVMSDIVTSL
FT                   LPGWTNTRVWILARPLSGFAETFAQYLVEVAPGGRSDHPEPDTQGEGVLFVVGGTPSLD
FT                   LGGNTHALRPGSYAYLPPGCGWRLRNAGSEPARFHWIRKAYEAVPGLDAPDAFVTHESE
FT                   IEPAGMTGTGGTWATTRFVSPEDLRHDMHVNIVTLQPGASIPFEETHVMEHGLFVLEGK
FT                   AVYRLNRDWVEVEAGDFMWLRAFCPQACYAGGPAPFRYLLYKDVNRHPALGRRGLGR"
FT   gene            605787..606299
FT                   /locus_tag="Rpal_0556"
FT   CDS_pept        605787..606299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0556"
FT                   /product="Ureidoglycolate hydrolase"
FT                   /EC_number="3.5.1.116"
FT                   /note="PFAM: Ureidoglycolate hydrolase; KEGG:
FT                   mrd:Mrad2831_3010 ureidoglycolate hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99115"
FT                   /db_xref="GOA:B3QBG2"
FT                   /db_xref="InterPro:IPR007247"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR023525"
FT                   /db_xref="InterPro:IPR024060"
FT                   /db_xref="UniProtKB/TrEMBL:B3QBG2"
FT                   /protein_id="ACE99115.1"
FT                   /translation="MTDTARKIVAQPLSAAAFAPFGQVIDTAQVASRPMNDGRARRFHD
FT                   LAEIEVIGDGARVVVGLVEAQPYAVPLWLNLVERHPLGAQAFVPLNAAPFLVVVCPDES
FT                   GKPGAPQAFVTAPHQGVCYARNTWHSVLTPFGAAQDFVVIDRGGPGVNLEEHLFDEPWI
FT                   VHLSTSR"
FT   gene            complement(606349..606969)
FT                   /locus_tag="Rpal_0557"
FT   CDS_pept        complement(606349..606969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0557"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: dac:Daci_2653 methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99116"
FT                   /db_xref="GOA:B3QBG3"
FT                   /db_xref="InterPro:IPR026669"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:B3QBG3"
FT                   /protein_id="ACE99116.1"
FT                   /translation="MSGFLLLLLPPALWIGWRMASRRTVLPCPSEIAWLVEMENPLARA
FT                   TRSEQVVAQLQPRPGDHAIDIGCGPGRVTLPLARAVGPNGQVTALDVQDGMLAKVAAKA
FT                   AAEALTNIRLLRADVREASVPSGSLDAAVMVMALGEFPSGTEIFPSVHRMLRPGGRLLI
FT                   AESVFDPHYVSRRHVRERVSAAGFRELRCVGNAFGYSVTFERT"
FT   gene            complement(607089..607646)
FT                   /locus_tag="Rpal_0558"
FT   CDS_pept        complement(607089..607646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0558"
FT                   /product="HNH endonuclease"
FT                   /note="PFAM: HNH endonuclease; SMART: HNH nuclease; KEGG:
FT                   bja:bll1367 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99117"
FT                   /db_xref="GOA:B3QBG4"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR029471"
FT                   /db_xref="UniProtKB/TrEMBL:B3QBG4"
FT                   /protein_id="ACE99117.1"
FT                   /translation="MNAHVSHGGWPVLVLNADFRPLSYYPLSLWSWQDAVKAVFLDRVN
FT                   IVAHYDRAVHSPNLEFRLPSVVSLKSFVKPTTNPAFTRFNVFLRDRFVCQYCGAPDDLT
FT                   FDHIIPRSKGGQTTWENVVAACSPCNLRKGNLTPEQAKMFPRQTAFAPTVHQLHRNGRL
FT                   FPPNYLHESWLDYLYWDTELDP"
FT   gene            607927..608925
FT                   /locus_tag="Rpal_0559"
FT   CDS_pept        607927..608925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0559"
FT                   /product="cysteine synthase A"
FT                   /note="TIGRFAM: cysteine synthase; cysteine synthase A;
FT                   PFAM: Pyridoxal-5'-phosphate-dependent protein beta
FT                   subunit; KEGG: bja:bll4682 cysteine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99118"
FT                   /db_xref="GOA:B3QBG5"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005856"
FT                   /db_xref="InterPro:IPR005859"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:B3QBG5"
FT                   /protein_id="ACE99118.1"
FT                   /translation="MSSAATASIKAVAEAPAHRPGRGRVYESIADAYGDTPLVRLNRLP
FT                   QQHGVKATIYAKLEYFNPASSVKDRIGAAMIAALEQEGIIKPDTVLIEPTSGNTGIALA
FT                   FVAAAKGYRLKLVMPESMSIERRKMLAFLGAELVLTEAAKGMKGAVAKAEELVAATPNA
FT                   VMPQQFKNLANPAVHRRTTAEEIWNDTDGAVDIFVAGVGTGGTVSGVGQVLKPRKASLK
FT                   VVAVEPEESPVLSGGAPGPHKIQGIGAGFVPDILDRSVIDEVVKIPSATAIETSRALAR
FT                   HEGIPGGISSGAAIAAAIELGKRPENAGKTIVAIVPSFSERYLSTVLFEGV"
FT   gene            complement(608997..609914)
FT                   /locus_tag="Rpal_0560"
FT   CDS_pept        complement(608997..609914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0560"
FT                   /product="Phosphoribosylaminoimidazolesuccinocarboxamide
FT                   synthase"
FT                   /EC_number="6.3.2.6"
FT                   /note="PFAM: SAICAR synthetase; KEGG: bja:bll0812
FT                   phosphoribosylaminoimidazole-succinocarboxamide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99119"
FT                   /db_xref="GOA:B3QBG6"
FT                   /db_xref="InterPro:IPR001636"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="UniProtKB/TrEMBL:B3QBG6"
FT                   /protein_id="ACE99119.1"
FT                   /translation="MTTMLSSDLPLTKIGRGKVRDIYAVDDDRLLLVTTDRISAFDVVM
FT                   GETIPMKGAVLTQVSAFWFGQLGGVVPHHMISADIDEIIAAVPALQGLRAALAGRTMLC
FT                   RRTTVFPIECVIRGYITGSAWKEYAASGTLAGEKLAAGLTESERLEPPIFSPATKAETG
FT                   HDENITIARMREIVGDEAAYTLESMTRAIYTQGEEVAREQGIIIADTKFEFGRDKDGRI
FT                   ILIDEVMTPDSSRFWAADTYAPGRSQPSFDKQPLRDYLDAERRAGRWNGEAPPPKLPAE
FT                   IVEATSKRYLDAYRRLTGTDLVVT"
FT   gene            complement(609985..610902)
FT                   /locus_tag="Rpal_0561"
FT   CDS_pept        complement(609985..610902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0561"
FT                   /product="Pirin domain protein"
FT                   /note="PFAM: Pirin domain protein; KEGG: bbt:BBta_0019
FT                   putative pirin family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99120"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR008778"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B3QBG7"
FT                   /protein_id="ACE99120.1"
FT                   /translation="MSWMPTNDPVLGDPTTCDALELIIVPRTRDLGDGFAVRRALPHGK
FT                   RQMVGPFIFFDHFGPVQFIAGKGMDVRPHPHIGLATVTYLFDGKIMHRDSEGNIQEIAP
FT                   GAMNLMTAGRGIAHSERTPDVERSVGQSMLGLQSWIALPQASEEIAPSFQHFAAATLPM
FT                   VQDTGFTARVIAGSAFGKASPVTMVSPWFYVEVNAKAGTAVPLDPDHEERAIYVVDGEV
FT                   EIAGERHVGPTLLIFRPGDRITVRAKTDTRMMFLGGDALEGPRHIWWNFVSSSKERIEQ
FT                   AKQDWKTGRFAAVPNESEFIPLPE"
FT   gene            complement(611033..612454)
FT                   /locus_tag="Rpal_0562"
FT   CDS_pept        complement(611033..612454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0562"
FT                   /product="Malonyl-CoA decarboxylase"
FT                   /EC_number="4.1.1.9"
FT                   /note="PFAM: Malonyl-CoA decarboxylase; KEGG: pde:Pden_1720
FT                   malonyl-CoA decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99121"
FT                   /db_xref="GOA:B3QBG8"
FT                   /db_xref="InterPro:IPR007956"
FT                   /db_xref="InterPro:IPR035372"
FT                   /db_xref="InterPro:IPR038351"
FT                   /db_xref="InterPro:IPR038917"
FT                   /db_xref="InterPro:IPR042303"
FT                   /db_xref="UniProtKB/TrEMBL:B3QBG8"
FT                   /protein_id="ACE99121.1"
FT                   /translation="MPIATTADRASEFLGGLFNSLTERGRSLFGLTSSQPMSGDELIAL
FT                   SETLLSRRGEASGVALAASLLAGYEAADEDDKLAFLDALAEQFGPDLAELNAAIEAFRA
FT                   DASAEATGELLRAAEPRRQELIRRLNHAPGGTAALVKMREAVLARIAAHPQLRHVDDDF
FT                   VHLFTSWFNRGFLVLQRIDWTTPANILEKIIRYEQVHTIHDWDDLRARLAPPDRRCYGF
FT                   FHPRLVDEPLIFVEVALTKDSPAAIAPLLDLEREPIAASDATTAVFYSISNTQQGLAGI
FT                   SFGNFLIKQVVEEIKRELPNVQTFVTLSPVPGFAKWLKRERDNPDSTLLDASARTALEA
FT                   LDTPNWFDDADTADRLKPIVLQLAAAYFLQAKGPNGRPLDPVARFHLGNGARLDRLNFL
FT                   GDRSPNGMRQSHGLMVNYLYALGDIEANHEALFERGQIAAASAVRKLVPTKPVSSEPRK
FT                   GNAKTASAPQAAPTA"
FT   gene            complement(612630..613235)
FT                   /locus_tag="Rpal_0563"
FT   CDS_pept        complement(612630..613235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0563"
FT                   /product="PAS fold-4 domain protein"
FT                   /note="PFAM: PAS fold-4 domain protein; KEGG: sma:SAV698
FT                   magnesium or manganese-dependent protein phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99122"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B3QBG9"
FT                   /protein_id="ACE99122.1"
FT                   /translation="MQRFVCEQNIAHFQKLLETAEDEKLRRTLLGLLSSAKRELALLHS
FT                   QLSGADLSPLAYRNRGGDLNSVLAQIRAGFDASDHPYMLIDAGPGLKIIDINDAYARAT
FT                   FTAREAIVGKPLFEIFPDNPAIDTADGVSNVYNSLRAVVETGEPHALAVQRYDMRNTEG
FT                   VFVERYWQSINTPVRDAGGKLICLLHNVEDVTAEVLAN"
FT   gene            complement(613311..614675)
FT                   /locus_tag="Rpal_0564"
FT   CDS_pept        complement(613311..614675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0564"
FT                   /product="MmgE/PrpD family protein"
FT                   /note="PFAM: MmgE/PrpD family protein; KEGG: bja:bll0816
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99123"
FT                   /db_xref="GOA:B3QBH0"
FT                   /db_xref="InterPro:IPR005656"
FT                   /db_xref="InterPro:IPR036148"
FT                   /db_xref="InterPro:IPR042183"
FT                   /db_xref="InterPro:IPR042188"
FT                   /db_xref="UniProtKB/TrEMBL:B3QBH0"
FT                   /protein_id="ACE99123.1"
FT                   /translation="MANETATLAGYVAALQFTDIPQDVLARAKLLTLDFLGSAIRARRE
FT                   AESTPSILQMLQALSLDGAGESTVFGDDKRWTPAVAALLNGALGHSLDFDDTHADSSLH
FT                   PSAPVVPAAFAVGELVGASGRDVLTAIVAGYEVCCRLGNALDPTSHYARGFHPTATAGT
FT                   YGAAAAAAKLFGLSQDQIVAAFGVSGSQAAGSLQFLVNGAWNKRYQVGAAAMNGVIAAT
FT                   LAKNGFIGSTESVEGIHGLLVGYTDTPHPDKAVADLGSVYETMKIGVKPYPSCRYTHAA
FT                   IDALIAMRREHNLTPAQITRVEVGLHKNGITLTGDAPTKRHPRSIVGGQFSMFFTGALA
FT                   LEQGSFGWDDYTRLGDPAIDALADKFDVVRDERLEGKTHPFGARVSITTEDGVHERIYA
FT                   DPSGEPSSFPSDQAMTQKFLQLARPVLDGRAQSFADAVLTLERFAKVSEATALGR"
FT   gene            614846..615958
FT                   /locus_tag="Rpal_0565"
FT   CDS_pept        614846..615958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0565"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nha:Nham_0005 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99124"
FT                   /db_xref="GOA:B3QBH1"
FT                   /db_xref="InterPro:IPR006726"
FT                   /db_xref="UniProtKB/TrEMBL:B3QBH1"
FT                   /protein_id="ACE99124.1"
FT                   /translation="MTSSRTRLLSQWKPRRPQWGLALRITLAALLALGFAQSLHLHLPL
FT                   WAVLTAIIVTQTSVGRSLKTAGDYLIGTIGGAIYGGAITIFVPHHSELGLLGALALAVA
FT                   PLALLAAIKPNLNVATVTAIIVLLVPTITKVEPLASAIDRVLEVGVGAIVGLAVSFVVL
FT                   PSRAQGQALAAAARSLELMADALGALLAGLTKGLDNDALHRLQDGIGASLVTLAEIGAE
FT                   AQRERNAGLSRGPDVAPLVRTLLRLRHDLVIVGRAVTAPLPPSLQNRLGGAVDNLRLAA
FT                   TSHLSACAKALRERRAPPPLGPMEQALAAYVTEVAAVRRDGLIRALPGDQAERFFALGF
FT                   AMEQLHQNFRDLEMRVTEWALPGKPTARVA"
FT   sig_peptide     614846..614971
FT                   /locus_tag="Rpal_0565"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.597 at
FT                   residue 42"
FT   gene            complement(615963..616424)
FT                   /locus_tag="Rpal_0566"
FT   CDS_pept        complement(615963..616424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0566"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mxa:MXAN_4080 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99125"
FT                   /db_xref="GOA:B3QBH2"
FT                   /db_xref="InterPro:IPR018729"
FT                   /db_xref="UniProtKB/TrEMBL:B3QBH2"
FT                   /protein_id="ACE99125.1"
FT                   /translation="MYDVFKFLHVVGVVVLVGNVTITAFWKAFSDMTRDPKIVAHAQRG
FT                   VTVSDFIFTLTGIALIIIGGYGAALVKDMPLFNSFWLVAGQILFVISGLMWFGILIPLQ
FT                   IRQARTARSFAEGGEIPAQYWRDAKTWLIWGITATVPLVAAVFVMIYKI"
FT   gene            616799..617065
FT                   /locus_tag="Rpal_0567"
FT   CDS_pept        616799..617065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0567"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99126"
FT                   /db_xref="UniProtKB/TrEMBL:B3QBH3"
FT                   /protein_id="ACE99126.1"
FT                   /translation="MKQVMLAAALGAAIGVFAAGGASAQTTGPAPQDSTKMNNPMSPGS
FT                   SAGTAKTSTRQGATTGMAAKTSKKHPTKKNDVQPSSMSKGSAK"
FT   sig_peptide     616799..616873
FT                   /locus_tag="Rpal_0567"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.989 at
FT                   residue 25"
FT   gene            617228..618415
FT                   /locus_tag="Rpal_0568"
FT   CDS_pept        617228..618415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0568"
FT                   /product="esterase, PHB depolymerase family"
FT                   /note="TIGRFAM: esterase, PHB depolymerase family; KEGG:
FT                   bja:blr0899 poly(3-hydroxyalkanoate) depolymerase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99127"
FT                   /db_xref="GOA:B3QBH4"
FT                   /db_xref="InterPro:IPR010126"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B3QBH4"
FT                   /protein_id="ACE99127.1"
FT                   /translation="MSLKNPIDFLGQLRKMQSINGLGWGEVPTDNRLIETVSFGTNPGD
FT                   LRMFSFVPKGATQRLPLVVVLHGCTQNAAAYEIGAGWCTLAQRYGFALLLPEQTRTNNP
FT                   NTCFNWFSPDDIRRGSGEVGSIHQMIEHMTRTHQIDQARIFATGLSAGGGMTAALLATY
FT                   PDVFAGGAVIAGLPYGVAHNVRQALKEMRHATPRSGPELGELVRHATAHQGPWPKLAVW
FT                   HGDADHTVDPANADALVRQWLDLHGLAEAPTAQNEVCGYPHRAWRNSSGETVVESYTVT
FT                   GMAHGTPLGAGAGDERYGVAGAYLLDVGISSSYHIAQFFGLTSRIHQPRSADTSAKDRP
FT                   AHDGHHELTTDVARRSRKSAGTGHAEGAAAPPHGKRGIDVGAVITRALTAAGLMK"
FT   gene            618543..618962
FT                   /locus_tag="Rpal_0569"
FT   CDS_pept        618543..618962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0569"
FT                   /product="protein of unknown function DUF1236"
FT                   /note="PFAM: protein of unknown function DUF1236; KEGG:
FT                   nha:Nham_0234 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99128"
FT                   /db_xref="GOA:B3QBH5"
FT                   /db_xref="InterPro:IPR009642"
FT                   /db_xref="UniProtKB/TrEMBL:B3QBH5"
FT                   /protein_id="ACE99128.1"
FT                   /translation="MINRFAGTAIVVLALAAPAVAHAQGVPGGIERGARDGERAAGPVG
FT                   AVVGGTIGGVVGGVAGILGVDDRPQFRSYVVEQRHPSYRYRDEVRVGVVLPGDGVTYYE
FT                   VPDRFGRASEYRYTVVNDRTVLVDPRTHKVVEIIE"
FT   sig_peptide     618543..618614
FT                   /locus_tag="Rpal_0569"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.963 at
FT                   residue 24"
FT   gene            complement(619039..620016)
FT                   /locus_tag="Rpal_0570"
FT   CDS_pept        complement(619039..620016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0570"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; KEGG: bja:blr7666 transcriptional regulatory
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99129"
FT                   /db_xref="GOA:B3QBH6"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR035418"
FT                   /db_xref="UniProtKB/TrEMBL:B3QBH6"
FT                   /protein_id="ACE99129.1"
FT                   /translation="MTVELLNEPLSRYPAFDTADPEELRQALSSVYGAKLVEGPIAADF
FT                   HARSNFVQLDDIALAFGVGTGSIAVEFPEGECARLQIALSGQFTTRSGGTSTAINARQA
FT                   GIISPGRNARTEYGQNYSFTLLRISTSALERKLTTLLGCKPKASLEFEPAANNEAPQVV
FT                   NLRRMLCFLANQLNCSPLPPVVLAELQEAITLLFLSAFRHNYSRQLERESHGIAPKHVR
FT                   QVEEYIEANWMRPITIEKLTALTGISSRGIFKAFQRSRGYSPMAFAKRVRLQHAHNLLS
FT                   DGATPTTVTAAALSCGFSNLGHFARDYRDMFGEKPSETLQRARP"
FT   gene            complement(620277..620942)
FT                   /locus_tag="Rpal_0571"
FT   CDS_pept        complement(620277..620942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0571"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   bbt:BBta_7673 putative enzyme with
FT                   metallo-hydrolase/oxidoreductase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99130"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:B3QBH7"
FT                   /protein_id="ACE99130.1"
FT                   /translation="MSETQTKAKAGAAIIPVTPFQQNCTLLWCEATRKAVVVDPGGDVP
FT                   EILAAIEKTKVDVGAIWLTHGHIDHVGGAADLRDALKVEVIGPHRDDQFLLDNVVNSGR
FT                   SFGIDGVRDVTPDRWLDDGDSVSIGELNFQILHCPGHSPGSVVFFNDAMRFAFVGDVLF
FT                   AGSVGRTDLPGGSHATLIQSITQKLLPLGDDVGFICGHGPGSSFGQERLTNPFLTGEA"
FT   gene            complement(621032..622150)
FT                   /locus_tag="Rpal_0572"
FT   CDS_pept        complement(621032..622150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0572"
FT                   /product="von Willebrand factor type A"
FT                   /note="PFAM: von Willebrand factor type A; KEGG:
FT                   hch:HCH_00942 protein containing VWFA domain"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99131"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:B3QBH8"
FT                   /protein_id="ACE99131.1"
FT                   /translation="MKRITFQTALTLAALALPLSFATAAQARPSVEVAFVLDTTGSMSG
FT                   LIEGAKRKIWSIATTILDDNPDADIRMGLVAYRDIGDDYVVRSVDLTTDIQDLYGQLLQ
FT                   LQARGGGDWPESVNEALDTAINKLHWRQGGDTRRIVFLVGDAPPHMDYAQDTKYPETLA
FT                   VARQKDIIVNAVQAGDARDTARVWHEIADGGRGRYIPIPQDGGQIVVIQTPYDDDIIIL
FT                   QKQINGTVIPYGPAPMQRRTEEKTGQLAKVAASAPASASDMASYINKRARSSSEAVTGG
FT                   GDLVSDVQAGRQKLDQVKEEDLPPELRALPAEQRAAKLDAQMTARKALNDKLAALVKQR
FT                   DAYLLAQRDKQPKQASSFDREVEATLKAQLKR"
FT   sig_peptide     complement(622067..622150)
FT                   /locus_tag="Rpal_0572"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.894 at
FT                   residue 28"
FT   gene            622327..622785
FT                   /locus_tag="Rpal_0573"
FT   CDS_pept        622327..622785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0573"
FT                   /product="protein of unknown function DUF1052"
FT                   /note="PFAM: protein of unknown function DUF1052; KEGG:
FT                   bra:BRADO0513 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99132"
FT                   /db_xref="GOA:B3QBH9"
FT                   /db_xref="InterPro:IPR009394"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/TrEMBL:B3QBH9"
FT                   /protein_id="ACE99132.1"
FT                   /translation="MILPRDLRQSETALNIARGTQRLLRSLGFACVSELPLPSGRRADL
FT                   VALNERGEIWIVEIKSSVEDLRADHKWPDYRAHCDRLFFAFTQDLPCEIFPAETGLIVA
FT                   DGYGAHLHCEAPEHKLPAATRKVMMLRFALAAAQRLGRLSDPQGFADG"
FT   gene            complement(622923..623477)
FT                   /locus_tag="Rpal_0574"
FT   CDS_pept        complement(622923..623477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0574"
FT                   /product="two component transcriptional regulator, Fis
FT                   family"
FT                   /note="PFAM: response regulator receiver; KEGG: bja:bll0904
FT                   two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99133"
FT                   /db_xref="GOA:B3QBI0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B3QBI0"
FT                   /protein_id="ACE99133.1"
FT                   /translation="MNAIPELNDHTDRSLLIVEDDKPFLDRLARAMETRGFAVTACDSV
FT                   SSGLAQIGKAAPAFAVVDLRLGDGNGLDVVSALKRERPDCRAIVLTGYGNIATAVTAVK
FT                   MGAVDYLSKPADADDVVAALLSTGTEKSEPPPNPMSADRVRWEHIQRIYEMCNRNVSET
FT                   ARRLNMHRRTLQRILAKRAPR"
FT   gene            complement(623569..624891)
FT                   /locus_tag="Rpal_0575"
FT   CDS_pept        complement(623569..624891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0575"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; KEGG: nha:Nham_0230
FT                   periplasmic sensor signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99134"
FT                   /db_xref="GOA:B3QBI1"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B3QBI1"
FT                   /protein_id="ACE99134.1"
FT                   /translation="MSDDLISADFRHPRRHVRLDTILRLRWLAALGQLSAIFVVSEGLE
FT                   FDFAVMPCIVIIAVSGLVNLALQIAFNPMQRMEPIYAALLLALNISELAGLLYFTGGLQ
FT                   NPFAFLFLGPVLISATALPTRMTISLGIFAAGCAAFLGYSHLPLPWAGEEPVALPRIYL
FT                   VGVWLSILLAIGVTSLYTFQVTEEARKLADALSAAELVLEREQHLTQLDGLAAAAAHEL
FT                   GTPLSTIFLISRELEKTAPPEMASDLRTLREQAQRCREILGKIAQLSSAGAPFDRMPLS
FT                   TLIEEAVAPHRDFGIAIKIRLAQHGEPEPVVMRNPAILYGIGNILENAVDFARTAVEVN
FT                   AWWNAETVQIVVSDDGPGIKPDVLRRIGEPYLSRRRSADDPNRERSGLGLGVFIARTLL
FT                   ERTGAKVEFRNKTFPDHGAIVQLSWPRNRFETIEKTEETMA"
FT   gene            625002..625796
FT                   /locus_tag="Rpal_0576"
FT   CDS_pept        625002..625796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0576"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bja:blr0906 nodulation ATP-binding protein I"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99135"
FT                   /db_xref="GOA:B3QBI2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3QBI2"
FT                   /protein_id="ACE99135.1"
FT                   /translation="MAIDSVGRADDPAGSSSVSAAIEVSHLVKTYKTTRAVDDISFRVP
FT                   RGSITGLLGGNGAGKTTTIAMIMGLVLPTAGRIRVLGCAMPEQRADVLGRINFESPYVD
FT                   MPSRLTVRQNLTVFGQLYAVPDLRGRIAELAADFDLTDFLDRASGKLSAGQKTRVALAK
FT                   ALINQPELLLLDEPTASLDPDTADWIRSHLESYRKRRGASILLASHNMLEVERLCDRVV
FT                   IMKRGRIEDDDTPSAIMARYHRSTLEEVFLDVARGRARDAES"
FT   gene            625793..626623
FT                   /locus_tag="Rpal_0577"
FT   CDS_pept        625793..626623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0577"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: bbt:BBta_7657
FT                   putative ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99136"
FT                   /db_xref="GOA:B3QBI3"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:B3QBI3"
FT                   /protein_id="ACE99136.1"
FT                   /translation="MRSLVANLELGHGLAWHRISAMVLRYWYLLLSSWPRLFELVYWPA
FT                   LQVITWGFLQSYVAQNAGFFARAGGTLIGAVILWDILFRGQLGFSISFLEEMWARNLGN
FT                   LMMSPLKPLEFLIALMIMSLIRLAIGVVPMVVLAMTLFDFNLFGFGLPLGAFFCNLIFT
FT                   SWALGIFVSGLVLRHGLGAESIVWSLMFGVMPLACVYYPVAVLPHWLQFVAWTLPPTYV
FT                   FEGMRALLIDHQFRGDLMLWALGINVVLFVAAFISFLAMLNSARRHGSLIQSGE"
FT   gene            626762..628090
FT                   /locus_tag="Rpal_0578"
FT   CDS_pept        626762..628090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0578"
FT                   /product="polyhydroxyalkanoate depolymerase, intracellular"
FT                   /note="TIGRFAM: polyhydroxyalkanoate depolymerase,
FT                   intracellular; PFAM: PHB de-polymerase domain protein;
FT                   KEGG: bja:blr0908 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99137"
FT                   /db_xref="InterPro:IPR009656"
FT                   /db_xref="InterPro:IPR010915"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B3QBI4"
FT                   /protein_id="ACE99137.1"
FT                   /translation="MPVVIGEFGRPPDMPAEVSPALTTPMYWFYEMAHASLNPARAMSD
FT                   ATKLAFKNPLNPWSHTEFGKSIAAACEVFERTTRRYGKPEWGLDDTEVNGMRVPIEIHN
FT                   VWEKPFCRLLYFERKLERPLRHPQPRLLIVAPMSGHYATLLRGTVEAFLPTHEVYITDW
FT                   ADARMVPMAAGRFDLDDYVDYVIEMLQTLGGNVHVMAVCQPSVPVLTAVSVMEANEDPF
FT                   VPLSMTLMGGPIDTRRSPTAVNNLAAEKGIDWFRNHVITKVPFPHPGFMRDVYPGFLQL
FT                   NGFISMNLDRHMDAHRNLFNHLVQGDGDLADKHREFYDEYLAVMDLTAEFYLQTVDLVF
FT                   VKHALPKGEMTHRGKLVEPSKVKRVALMTVEGENDDISGLGQTEATHGLCSSIPDNRRV
FT                   HYVQKGVGHYGVFNGSRFRSEIVPRICDFHASSTSDTSARAAE"
FT   gene            628431..629180
FT                   /locus_tag="Rpal_0579"
FT   CDS_pept        628431..629180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0579"
FT                   /product="protein of unknown function DUF45"
FT                   /note="PFAM: protein of unknown function DUF45; KEGG:
FT                   bja:blr0909 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99138"
FT                   /db_xref="InterPro:IPR002725"
FT                   /db_xref="UniProtKB/TrEMBL:B3QBI5"
FT                   /protein_id="ACE99138.1"
FT                   /translation="MARALLYRRPTEPSTIPVRHGSQFFAVRIRRHRRARRYTLRIHPS
FT                   DREAILTMPPRGTLADAKEFAQRHGAWIAARLGRLPKAAPFLPGTLVPLRGHDHKIVHR
FT                   TGRGTVWTEVRESGEKILCVAGETEHIERRVLDFLKREARKDLQKACDRYAPELGVKVT
FT                   RLSIRDQSSRWGSCTSAGSLSFSWRLILAPSYVLDYLAAHEVAHLVEMNHSARFWRVVG
FT                   KVCPQMERAKTWLDSYGNDLHRYGISD"
FT   gene            complement(629453..631672)
FT                   /locus_tag="Rpal_0580"
FT   CDS_pept        complement(629453..631672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0580"
FT                   /product="penicillin-binding protein, 1A family"
FT                   /EC_number="2.4.1.129"
FT                   /note="KEGG: nha:Nham_0227 penicillin-binding protein 1A;
FT                   TIGRFAM: penicillin-binding protein, 1A family; PFAM:
FT                   glycosyl transferase family 51; penicillin-binding protein
FT                   transpeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99139"
FT                   /db_xref="GOA:B3QBI6"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:B3QBI6"
FT                   /protein_id="ACE99139.1"
FT                   /translation="MAWGRKKAGERREPKFGSGESLADMRLTPQDRVNVADDKPKKKPA
FT                   GKAGGGARSKRKPRKGVIASVRQAVGRVVYWSAVAGIWAVLAVVGVMVWVGAHLPPIQS
FT                   LEIPKRPPTITIVADDGSTMAVRGEQAGTNVALKELPPYLPKAFIAIEDRRFYQHFGVD
FT                   PLGIARAAVANVLHRGVSQGGSTLTQQLAKNLFLTQDRTLTRKLQEVELALWLERKHSK
FT                   AEILELYLNRVYFGSGAYGVEAAAQKYFGKSAKDVTLVEAAMLAGLVKSPSRLAPNRNP
FT                   EGAEKRAQIVLAAMADAGFVTDKQAQAAIANPVYTVKPTGAGTINYVADWITEILDDLV
FT                   GQIDQSIIVETSIDPRLQSVAEAAIIDELAAKSVKYKVTQGALVAMTPDGTVRAMIGGR
FT                   NYADSQFNRAVTAKRQPGSAFKPFVYLTAVEAGLTPDTIRQDAPLDLKGWKPENYTHEY
FT                   FGSVTLTQALAMSLNTVAVRLGLEVGPKNVVRTAHRLGIASKLDANPSIALGTSEVTLT
FT                   ELVGAYSTFANGGLLVSPHVVKRIRTLQGNKVLYVRSDEPASRVVDPRAVAMMNTMMQE
FT                   TLRSGTAHKADLPGWVAAGKTGTSQDFRDAWFLGYTSTLVTGVWLGNDDNSPTKKATGG
FT                   GLPVEVWTRFMREALKGETPQPLPGDWSGGPIVSSTPSALGGSLSGAPTGGGTIAQAGP
FT                   RGETQVINAPPPPGSGRMPPPTRANVRPEADAGLDGWLMDRLFGR"
FT   gene            631855..632106
FT                   /locus_tag="Rpal_0581"
FT   CDS_pept        631855..632106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0581"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99140"
FT                   /db_xref="UniProtKB/TrEMBL:B3QBI7"
FT                   /protein_id="ACE99140.1"
FT                   /translation="MTRVLRTAEEIEALLLQDVRGQRHCDKVEAIRIRPCQPCDDTNGA
FT                   NWKVASVDPGQASREFAGAAVMTAMDRLQREVSAIPWE"
FT   gene            complement(632202..632414)
FT                   /locus_tag="Rpal_0582"
FT   CDS_pept        complement(632202..632414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0582"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99141"
FT                   /db_xref="UniProtKB/TrEMBL:B3QBI8"
FT                   /protein_id="ACE99141.1"
FT                   /translation="MRADSTSNRYFTVEQLEELAVAKYIEAALTPAGEERDELLEEAKR
FT                   FASRAKMKSWLMGEIGATPRRRNYH"
FT   gene            complement(632706..633926)
FT                   /locus_tag="Rpal_0583"
FT   CDS_pept        complement(632706..633926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0583"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   bra:BRADO0527 putative branched-chain amino acid ABC
FT                   transporter, periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99142"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B3QBI9"
FT                   /protein_id="ACE99142.1"
FT                   /translation="MKSLYRAAVAALATVALSAAPAAAEKKYDPGASDTEIKIGQTVPF
FT                   SGPASAYAGIGKTQAAYMRMINEQGGINGRKINLIQYDDAYSPPKAVEQVRKLVESDEV
FT                   LLTFQIIGTPSNAAVQKYLNAKKVPQLLASTGATRFTDPKNFPWTMGFNPNYQTEGRIY
FT                   GRYILQHHPDAKIGILFQNDDLGRDYVTGLRAALGDKADKMIVAEASYELTDPTVDSQI
FT                   VKLKSAGATLLYNASTPRFAAQAIKKVADLGWNPVHILDINASPVSATLKPAGLDISKG
FT                   IISVNYGKDPADPQWANDEGVKKYFAFMDKYYPEGDKLNTVNSYGYSTAELLITILKQC
FT                   GDNLTRDNVMKQAANLKNVVGDLSLPGMSVNTSPTDFRVNKQLRMMKFNGERWELFGPI
FT                   IEDDAAM"
FT   sig_peptide     complement(633852..633926)
FT                   /locus_tag="Rpal_0583"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.828 at
FT                   residue 25"
FT   gene            complement(634077..634439)
FT                   /locus_tag="Rpal_0584"
FT   CDS_pept        complement(634077..634439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0584"
FT                   /product="protein of unknown function DUF1304"
FT                   /note="PFAM: protein of unknown function DUF1304; KEGG:
FT                   bja:bll0914 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99143"
FT                   /db_xref="GOA:B3QBJ0"
FT                   /db_xref="InterPro:IPR009732"
FT                   /db_xref="UniProtKB/TrEMBL:B3QBJ0"
FT                   /protein_id="ACE99143.1"
FT                   /translation="MNAAATFLVALVAALHVFFLVLEMFLWTKPLGLKVFRNSPDKAAA
FT                   SAVLAANQGLYNGFLAAGLIWSLLHPNAAVALQLATFFLGCVIVAGLYGAWTVSRRILY
FT                   VQAAPAALALIAAWIA"
FT   gene            634522..634950
FT                   /locus_tag="Rpal_0585"
FT   CDS_pept        634522..634950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0585"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bja:blr0911 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99144"
FT                   /db_xref="InterPro:IPR010753"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:B3QBJ1"
FT                   /protein_id="ACE99144.1"
FT                   /translation="MTGHIDPTKEVFAQFRANDREGPIHMLNLVRLRPRAAYPDGRETT
FT                   GAEAYAAYGRDSGPVFERLGGKVVWQGRFELMLIGPQDEHWDHVFIAEYPSVAAFVEMI
FT                   RDPVYREAVKHRQAAVEDSRLIRLKPLKPGKGFGEIPT"
FT   gene            635045..637786
FT                   /locus_tag="Rpal_0586"
FT   CDS_pept        635045..637786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0586"
FT                   /product="multi-sensor hybrid histidine kinase"
FT                   /note="PFAM: response regulator receiver; ATP-binding
FT                   region ATPase domain protein; histidine kinase HAMP region
FT                   domain protein; histidine kinase A domain protein; KEGG:
FT                   bbt:BBta_4235 putative sensor histidine kinase with a
FT                   CHASE3 and a response regulator receiver domain"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99145"
FT                   /db_xref="GOA:B3QBJ2"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B3QBJ2"
FT                   /protein_id="ACE99145.1"
FT                   /translation="MRLSVRLTLAMTALVACTVAAIGVLAYYNIGRAVVPSGLTRLAYQ
FT                   AKARLGAYESVLRIIRNEVLSARLLPAHLGIARAQRGSGFDPEVGLSDAQWRKHLAAAY
FT                   AGNMRVKPGILAYRLIGVADDGRTLIAVDRHGPNGSVRTVPDAELTRLGGDEAFRRALE
FT                   LTGDEVFFSPIRIFSDANNAGTVPSSPRFTVAAPVRDEEGTVFAVLMVTLDLRPIFERI
FT                   RDVLDNDTDVYFVEADGSYMMTYIDGRILPAEPERRWQDDFPQLAATLGDKPGTAAVFS
FT                   RPDGERVAAAIVMATLSSGVRTAVIETEPLERIMAPATALRTPGLIVGLAAILGAVLLS
FT                   ALLSRSLAKPIAQLTRAVIAFSRTGRLVVPVGLHGESRILADAFDETVAKIDAANAALR
FT                   GKSELLDKTIASMADAVAVLDADGKRVFANPTCVTLFGVAEDIGSERWKLKYKRFLADG
FT                   VTPMPDYDSPAARARRGESFDNVELGIRHGDDPVVQLAASARRIENPDGSFAGAVIVYR
FT                   NLTAFKESERQLRQAQKMQAIGQLTGGVAHDLNNILTVITGGIEILADGVSDRPGLKDV
FT                   AAMVDQAVTRASDLTHGLLSFSRKQPLQPRSIDVNALMLDTVKLLRPTLGAGIEIDVEP
FT