(data stored in ACNUC13767 zone)

EMBL: CP001098

ID   CP001098; SV 1; circular; genomic DNA; STD; PRO; 2578146 BP.
XX
AC   CP001098; AAOZ01000000-AAOZ01000072;
XX
PR   Project:PRJNA16377;
XX
DT   15-JAN-2009 (Rel. 99, Created)
DT   12-DEC-2013 (Rel. 119, Last updated, Version 3)
XX
DE   Halothermothrix orenii H 168, complete genome.
XX
KW   .
XX
OS   Halothermothrix orenii H 168
OC   Bacteria; Firmicutes; Clostridia; Halanaerobiales; Halanaerobiaceae;
OC   Halothermothrix.
XX
RN   [1]
RP   1-2578146
RX   DOI; 10.1371/journal.pone.0004192.
RX   PUBMED; 19145256.
RA   Mavromatis K., Ivanova N., Anderson I., Lykidis A., Hooper S.D., Sun H.,
RA   Kunin V., Lapidus A., Hugenholtz P., Patel B., Kyrpides N.C.;
RT   "Genome analysis of the anaerobic thermohalophilic bacterium
RT   Halothermothrix orenii";
RL   PLoS One 4(1):E4192-E4192(2009).
XX
RN   [2]
RP   1-2578146
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Sun H., Goltsman E., Schmutz J.,
RA   Larimer F., Land M., Hauser L., Kyrpides N., Mavromatis K., Ivanova N.,
RA   Anderson I., Lykidis A.I., Kunin V., Hugenholtz P., Patel B.,
RA   Richardson P.;
RT   ;
RL   Submitted (03-JUN-2008) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; f2e8b9fbb70c8fd962dfd097bd789104.
DR   BioSample; SAMN00623047.
DR   CABRI; DSM 9562.
DR   EnsemblGenomes-Gn; EBG00001126976.
DR   EnsemblGenomes-Gn; EBG00001126977.
DR   EnsemblGenomes-Gn; EBG00001126978.
DR   EnsemblGenomes-Gn; EBG00001126979.
DR   EnsemblGenomes-Gn; EBG00001126980.
DR   EnsemblGenomes-Gn; EBG00001126981.
DR   EnsemblGenomes-Gn; EBG00001126982.
DR   EnsemblGenomes-Gn; EBG00001126983.
DR   EnsemblGenomes-Gn; EBG00001126984.
DR   EnsemblGenomes-Gn; EBG00001126985.
DR   EnsemblGenomes-Gn; EBG00001126986.
DR   EnsemblGenomes-Gn; EBG00001126987.
DR   EnsemblGenomes-Gn; EBG00001126988.
DR   EnsemblGenomes-Gn; EBG00001126989.
DR   EnsemblGenomes-Gn; EBG00001126990.
DR   EnsemblGenomes-Gn; EBG00001126991.
DR   EnsemblGenomes-Gn; EBG00001126992.
DR   EnsemblGenomes-Gn; EBG00001126993.
DR   EnsemblGenomes-Gn; EBG00001126994.
DR   EnsemblGenomes-Gn; EBG00001126995.
DR   EnsemblGenomes-Gn; EBG00001126996.
DR   EnsemblGenomes-Gn; EBG00001126997.
DR   EnsemblGenomes-Gn; EBG00001126998.
DR   EnsemblGenomes-Gn; EBG00001126999.
DR   EnsemblGenomes-Gn; EBG00001127000.
DR   EnsemblGenomes-Gn; EBG00001127001.
DR   EnsemblGenomes-Gn; EBG00001127002.
DR   EnsemblGenomes-Gn; EBG00001127003.
DR   EnsemblGenomes-Gn; EBG00001127004.
DR   EnsemblGenomes-Gn; EBG00001127005.
DR   EnsemblGenomes-Gn; EBG00001127006.
DR   EnsemblGenomes-Gn; EBG00001127007.
DR   EnsemblGenomes-Gn; EBG00001127008.
DR   EnsemblGenomes-Gn; EBG00001127009.
DR   EnsemblGenomes-Gn; EBG00001127010.
DR   EnsemblGenomes-Gn; EBG00001127011.
DR   EnsemblGenomes-Gn; EBG00001127012.
DR   EnsemblGenomes-Gn; EBG00001127013.
DR   EnsemblGenomes-Gn; EBG00001127014.
DR   EnsemblGenomes-Gn; EBG00001127015.
DR   EnsemblGenomes-Gn; EBG00001127017.
DR   EnsemblGenomes-Gn; EBG00001127019.
DR   EnsemblGenomes-Gn; EBG00001127021.
DR   EnsemblGenomes-Gn; EBG00001127023.
DR   EnsemblGenomes-Gn; EBG00001127025.
DR   EnsemblGenomes-Gn; EBG00001127027.
DR   EnsemblGenomes-Gn; EBG00001127029.
DR   EnsemblGenomes-Gn; EBG00001127031.
DR   EnsemblGenomes-Gn; EBG00001127033.
DR   EnsemblGenomes-Gn; EBG00001127035.
DR   EnsemblGenomes-Gn; EBG00001127037.
DR   EnsemblGenomes-Gn; EBG00001127038.
DR   EnsemblGenomes-Gn; EBG00001127039.
DR   EnsemblGenomes-Gn; EBG00001127040.
DR   EnsemblGenomes-Gn; EBG00001127041.
DR   EnsemblGenomes-Gn; EBG00001127042.
DR   EnsemblGenomes-Gn; EBG00001127043.
DR   EnsemblGenomes-Gn; EBG00001127045.
DR   EnsemblGenomes-Gn; EBG00001127047.
DR   EnsemblGenomes-Gn; EBG00001127049.
DR   EnsemblGenomes-Gn; EBG00001127051.
DR   EnsemblGenomes-Gn; EBG00001127053.
DR   EnsemblGenomes-Gn; EBG00001127054.
DR   EnsemblGenomes-Gn; EBG00001127055.
DR   EnsemblGenomes-Gn; EBG00001127056.
DR   EnsemblGenomes-Gn; EBG00001127057.
DR   EnsemblGenomes-Gn; EBG00001127058.
DR   EnsemblGenomes-Gn; EBG00001127059.
DR   EnsemblGenomes-Gn; EBG00001127060.
DR   EnsemblGenomes-Gn; EBG00001127061.
DR   EnsemblGenomes-Gn; EBG00001127062.
DR   EnsemblGenomes-Gn; EBG00001127063.
DR   EnsemblGenomes-Gn; EBG00001127065.
DR   EnsemblGenomes-Gn; EBG00001127067.
DR   EnsemblGenomes-Gn; EBG00001127069.
DR   EnsemblGenomes-Gn; EBG00001127071.
DR   EnsemblGenomes-Gn; EBG00001127072.
DR   EnsemblGenomes-Gn; EBG00001127073.
DR   EnsemblGenomes-Gn; EBG00001127074.
DR   EnsemblGenomes-Gn; EBG00001127076.
DR   EnsemblGenomes-Gn; Hore_R0001.
DR   EnsemblGenomes-Gn; Hore_R0002.
DR   EnsemblGenomes-Gn; Hore_R0003.
DR   EnsemblGenomes-Gn; Hore_R0004.
DR   EnsemblGenomes-Gn; Hore_R0005.
DR   EnsemblGenomes-Gn; Hore_R0006.
DR   EnsemblGenomes-Gn; Hore_R0007.
DR   EnsemblGenomes-Gn; Hore_R0008.
DR   EnsemblGenomes-Gn; Hore_R0009.
DR   EnsemblGenomes-Gn; Hore_R0010.
DR   EnsemblGenomes-Gn; Hore_R0011.
DR   EnsemblGenomes-Gn; Hore_R0012.
DR   EnsemblGenomes-Gn; Hore_R0013.
DR   EnsemblGenomes-Gn; Hore_R0014.
DR   EnsemblGenomes-Gn; Hore_R0015.
DR   EnsemblGenomes-Gn; Hore_R0016.
DR   EnsemblGenomes-Gn; Hore_R0017.
DR   EnsemblGenomes-Gn; Hore_R0018.
DR   EnsemblGenomes-Gn; Hore_R0019.
DR   EnsemblGenomes-Gn; Hore_R0020.
DR   EnsemblGenomes-Gn; Hore_R0021.
DR   EnsemblGenomes-Gn; Hore_R0022.
DR   EnsemblGenomes-Gn; Hore_R0023.
DR   EnsemblGenomes-Gn; Hore_R0024.
DR   EnsemblGenomes-Gn; Hore_R0025.
DR   EnsemblGenomes-Gn; Hore_R0026.
DR   EnsemblGenomes-Gn; Hore_R0027.
DR   EnsemblGenomes-Gn; Hore_R0028.
DR   EnsemblGenomes-Gn; Hore_R0029.
DR   EnsemblGenomes-Gn; Hore_R0030.
DR   EnsemblGenomes-Gn; Hore_R0031.
DR   EnsemblGenomes-Gn; Hore_R0032.
DR   EnsemblGenomes-Gn; Hore_R0033.
DR   EnsemblGenomes-Gn; Hore_R0034.
DR   EnsemblGenomes-Gn; Hore_R0035.
DR   EnsemblGenomes-Gn; Hore_R0036.
DR   EnsemblGenomes-Gn; Hore_R0037.
DR   EnsemblGenomes-Gn; Hore_R0038.
DR   EnsemblGenomes-Gn; Hore_R0039.
DR   EnsemblGenomes-Gn; Hore_R0040.
DR   EnsemblGenomes-Gn; Hore_R0041.
DR   EnsemblGenomes-Gn; Hore_R0042.
DR   EnsemblGenomes-Gn; Hore_R0043.
DR   EnsemblGenomes-Gn; Hore_R0044.
DR   EnsemblGenomes-Gn; Hore_R0045.
DR   EnsemblGenomes-Gn; Hore_R0046.
DR   EnsemblGenomes-Gn; Hore_R0047.
DR   EnsemblGenomes-Gn; Hore_R0048.
DR   EnsemblGenomes-Gn; Hore_R0049.
DR   EnsemblGenomes-Gn; Hore_R0051.
DR   EnsemblGenomes-Gn; Hore_R0052.
DR   EnsemblGenomes-Gn; Hore_R0053.
DR   EnsemblGenomes-Gn; Hore_R0054.
DR   EnsemblGenomes-Gn; Hore_R0055.
DR   EnsemblGenomes-Gn; Hore_R0056.
DR   EnsemblGenomes-Gn; Hore_R0057.
DR   EnsemblGenomes-Gn; Hore_R0058.
DR   EnsemblGenomes-Gn; Hore_R0059.
DR   EnsemblGenomes-Gn; Hore_R0061.
DR   EnsemblGenomes-Gn; Hore_R0063.
DR   EnsemblGenomes-Gn; Hore_R0064.
DR   EnsemblGenomes-Gn; Hore_R0065.
DR   EnsemblGenomes-Gn; Hore_R0066.
DR   EnsemblGenomes-Gn; Hore_R0067.
DR   EnsemblGenomes-Gn; Hore_R0068.
DR   EnsemblGenomes-Gn; Hore_R0069.
DR   EnsemblGenomes-Gn; Hore_R0070.
DR   EnsemblGenomes-Gn; Hore_R0080.
DR   EnsemblGenomes-Gn; Hore_R0082.
DR   EnsemblGenomes-Gn; Hore_R0085.
DR   EnsemblGenomes-Tr; EBT00001718287.
DR   EnsemblGenomes-Tr; EBT00001718288.
DR   EnsemblGenomes-Tr; EBT00001718289.
DR   EnsemblGenomes-Tr; EBT00001718290.
DR   EnsemblGenomes-Tr; EBT00001718291.
DR   EnsemblGenomes-Tr; EBT00001718292.
DR   EnsemblGenomes-Tr; EBT00001718293.
DR   EnsemblGenomes-Tr; EBT00001718294.
DR   EnsemblGenomes-Tr; EBT00001718295.
DR   EnsemblGenomes-Tr; EBT00001718296.
DR   EnsemblGenomes-Tr; EBT00001718297.
DR   EnsemblGenomes-Tr; EBT00001718298.
DR   EnsemblGenomes-Tr; EBT00001718299.
DR   EnsemblGenomes-Tr; EBT00001718300.
DR   EnsemblGenomes-Tr; EBT00001718301.
DR   EnsemblGenomes-Tr; EBT00001718302.
DR   EnsemblGenomes-Tr; EBT00001718303.
DR   EnsemblGenomes-Tr; EBT00001718304.
DR   EnsemblGenomes-Tr; EBT00001718305.
DR   EnsemblGenomes-Tr; EBT00001718306.
DR   EnsemblGenomes-Tr; EBT00001718307.
DR   EnsemblGenomes-Tr; EBT00001718308.
DR   EnsemblGenomes-Tr; EBT00001718309.
DR   EnsemblGenomes-Tr; EBT00001718310.
DR   EnsemblGenomes-Tr; EBT00001718311.
DR   EnsemblGenomes-Tr; EBT00001718312.
DR   EnsemblGenomes-Tr; EBT00001718313.
DR   EnsemblGenomes-Tr; EBT00001718314.
DR   EnsemblGenomes-Tr; EBT00001718315.
DR   EnsemblGenomes-Tr; EBT00001718316.
DR   EnsemblGenomes-Tr; EBT00001718317.
DR   EnsemblGenomes-Tr; EBT00001718318.
DR   EnsemblGenomes-Tr; EBT00001718319.
DR   EnsemblGenomes-Tr; EBT00001718320.
DR   EnsemblGenomes-Tr; EBT00001718321.
DR   EnsemblGenomes-Tr; EBT00001718322.
DR   EnsemblGenomes-Tr; EBT00001718323.
DR   EnsemblGenomes-Tr; EBT00001718324.
DR   EnsemblGenomes-Tr; EBT00001718325.
DR   EnsemblGenomes-Tr; EBT00001718326.
DR   EnsemblGenomes-Tr; EBT00001718327.
DR   EnsemblGenomes-Tr; EBT00001718328.
DR   EnsemblGenomes-Tr; EBT00001718329.
DR   EnsemblGenomes-Tr; EBT00001718330.
DR   EnsemblGenomes-Tr; EBT00001718331.
DR   EnsemblGenomes-Tr; EBT00001718332.
DR   EnsemblGenomes-Tr; EBT00001718333.
DR   EnsemblGenomes-Tr; EBT00001718334.
DR   EnsemblGenomes-Tr; EBT00001718335.
DR   EnsemblGenomes-Tr; EBT00001718336.
DR   EnsemblGenomes-Tr; EBT00001718337.
DR   EnsemblGenomes-Tr; EBT00001718338.
DR   EnsemblGenomes-Tr; EBT00001718339.
DR   EnsemblGenomes-Tr; EBT00001718340.
DR   EnsemblGenomes-Tr; EBT00001718341.
DR   EnsemblGenomes-Tr; EBT00001718342.
DR   EnsemblGenomes-Tr; EBT00001718343.
DR   EnsemblGenomes-Tr; EBT00001718344.
DR   EnsemblGenomes-Tr; EBT00001718345.
DR   EnsemblGenomes-Tr; EBT00001718346.
DR   EnsemblGenomes-Tr; EBT00001718347.
DR   EnsemblGenomes-Tr; EBT00001718348.
DR   EnsemblGenomes-Tr; EBT00001718349.
DR   EnsemblGenomes-Tr; EBT00001718350.
DR   EnsemblGenomes-Tr; EBT00001718351.
DR   EnsemblGenomes-Tr; EBT00001718352.
DR   EnsemblGenomes-Tr; EBT00001718353.
DR   EnsemblGenomes-Tr; EBT00001718354.
DR   EnsemblGenomes-Tr; EBT00001718355.
DR   EnsemblGenomes-Tr; EBT00001718356.
DR   EnsemblGenomes-Tr; EBT00001718357.
DR   EnsemblGenomes-Tr; EBT00001718358.
DR   EnsemblGenomes-Tr; EBT00001718359.
DR   EnsemblGenomes-Tr; EBT00001718360.
DR   EnsemblGenomes-Tr; EBT00001718361.
DR   EnsemblGenomes-Tr; EBT00001718362.
DR   EnsemblGenomes-Tr; EBT00001718363.
DR   EnsemblGenomes-Tr; EBT00001718364.
DR   EnsemblGenomes-Tr; EBT00001718365.
DR   EnsemblGenomes-Tr; EBT00001718366.
DR   EnsemblGenomes-Tr; Hore_R0001-1.
DR   EnsemblGenomes-Tr; Hore_R0002-1.
DR   EnsemblGenomes-Tr; Hore_R0003-1.
DR   EnsemblGenomes-Tr; Hore_R0004-1.
DR   EnsemblGenomes-Tr; Hore_R0005-1.
DR   EnsemblGenomes-Tr; Hore_R0006-1.
DR   EnsemblGenomes-Tr; Hore_R0007-1.
DR   EnsemblGenomes-Tr; Hore_R0008-1.
DR   EnsemblGenomes-Tr; Hore_R0009-1.
DR   EnsemblGenomes-Tr; Hore_R0010-1.
DR   EnsemblGenomes-Tr; Hore_R0011-1.
DR   EnsemblGenomes-Tr; Hore_R0012-1.
DR   EnsemblGenomes-Tr; Hore_R0013-1.
DR   EnsemblGenomes-Tr; Hore_R0014-1.
DR   EnsemblGenomes-Tr; Hore_R0015-1.
DR   EnsemblGenomes-Tr; Hore_R0016-1.
DR   EnsemblGenomes-Tr; Hore_R0017-1.
DR   EnsemblGenomes-Tr; Hore_R0018-1.
DR   EnsemblGenomes-Tr; Hore_R0019-1.
DR   EnsemblGenomes-Tr; Hore_R0020-1.
DR   EnsemblGenomes-Tr; Hore_R0021-1.
DR   EnsemblGenomes-Tr; Hore_R0022-1.
DR   EnsemblGenomes-Tr; Hore_R0023-1.
DR   EnsemblGenomes-Tr; Hore_R0024-1.
DR   EnsemblGenomes-Tr; Hore_R0025-1.
DR   EnsemblGenomes-Tr; Hore_R0026-1.
DR   EnsemblGenomes-Tr; Hore_R0027-1.
DR   EnsemblGenomes-Tr; Hore_R0028-1.
DR   EnsemblGenomes-Tr; Hore_R0029-1.
DR   EnsemblGenomes-Tr; Hore_R0030-1.
DR   EnsemblGenomes-Tr; Hore_R0031-1.
DR   EnsemblGenomes-Tr; Hore_R0032-1.
DR   EnsemblGenomes-Tr; Hore_R0033-1.
DR   EnsemblGenomes-Tr; Hore_R0034-1.
DR   EnsemblGenomes-Tr; Hore_R0035-1.
DR   EnsemblGenomes-Tr; Hore_R0036-1.
DR   EnsemblGenomes-Tr; Hore_R0037-1.
DR   EnsemblGenomes-Tr; Hore_R0038-1.
DR   EnsemblGenomes-Tr; Hore_R0039-1.
DR   EnsemblGenomes-Tr; Hore_R0040-1.
DR   EnsemblGenomes-Tr; Hore_R0041-1.
DR   EnsemblGenomes-Tr; Hore_R0042-1.
DR   EnsemblGenomes-Tr; Hore_R0043-1.
DR   EnsemblGenomes-Tr; Hore_R0044-1.
DR   EnsemblGenomes-Tr; Hore_R0045-1.
DR   EnsemblGenomes-Tr; Hore_R0046-1.
DR   EnsemblGenomes-Tr; Hore_R0047-1.
DR   EnsemblGenomes-Tr; Hore_R0048-1.
DR   EnsemblGenomes-Tr; Hore_R0049-1.
DR   EnsemblGenomes-Tr; Hore_R0051-1.
DR   EnsemblGenomes-Tr; Hore_R0052-1.
DR   EnsemblGenomes-Tr; Hore_R0053-1.
DR   EnsemblGenomes-Tr; Hore_R0054-1.
DR   EnsemblGenomes-Tr; Hore_R0055-1.
DR   EnsemblGenomes-Tr; Hore_R0056-1.
DR   EnsemblGenomes-Tr; Hore_R0057-1.
DR   EnsemblGenomes-Tr; Hore_R0058-1.
DR   EnsemblGenomes-Tr; Hore_R0059-1.
DR   EnsemblGenomes-Tr; Hore_R0061-1.
DR   EnsemblGenomes-Tr; Hore_R0063-1.
DR   EnsemblGenomes-Tr; Hore_R0064-1.
DR   EnsemblGenomes-Tr; Hore_R0065-1.
DR   EnsemblGenomes-Tr; Hore_R0066-1.
DR   EnsemblGenomes-Tr; Hore_R0067-1.
DR   EnsemblGenomes-Tr; Hore_R0068-1.
DR   EnsemblGenomes-Tr; Hore_R0069-1.
DR   EnsemblGenomes-Tr; Hore_R0070-1.
DR   EnsemblGenomes-Tr; Hore_R0080-1.
DR   EnsemblGenomes-Tr; Hore_R0082-1.
DR   EnsemblGenomes-Tr; Hore_R0085-1.
DR   EuropePMC; PMC2626281; 19145256.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00167; Purine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00234; glmS.
DR   RFAM; RF00379; ydaO-yuaA.
DR   RFAM; RF00442; ykkC-yxkD.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00557; L10_leader.
DR   RFAM; RF01051; c-di-GMP-I.
DR   RFAM; RF01071; OLE.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01750; pfl.
DR   RFAM; RF01786; c-di-GMP-II.
DR   RFAM; RF01831; THF.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP001098.
DR   SILVA-SSU; CP001098.
DR   StrainInfo; 302651; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4001068
CC   Source DNA and bacteria available from Bharat Patel
CC   (b.patel@griffith.edu.au)
CC   Contacts: Bharat Patel (b.patel@griffith.edu.au)
CC             Nikos C Kyrpides (NCKyrpides@lbl.gov)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-PGF
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2578146
FT                   /organism="Halothermothrix orenii H 168"
FT                   /strain="H 168; DSM 9562"
FT                   /mol_type="genomic DNA"
FT                   /note="type strain of Halothermothrix orenii"
FT                   /db_xref="taxon:373903"
FT   gene            593..1984
FT                   /locus_tag="Hore_00010"
FT   CDS_pept        593..1984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_00010"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="PFAM: Bacterial dnaA protein helix-turn-helix
FT                   domain; Bacterial dnaA protein; TIGRFAM: chromosomal
FT                   replication initiator protein DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_00010"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68764"
FT                   /db_xref="GOA:B8CZN4"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:B8CZN4"
FT                   /protein_id="ACL68764.1"
FT                   /translation="MSFSQDELNHIWQETLSKIKEKLSNPSFRTWFSDTEAHSLVNNQL
FT                   IVKVPNDFIKDWLESRYLELIEEVIKNLTNSNWKIVLMSPEELDELDNKDRARVETRDK
FT                   VKSKNNKKNSNIEIPNGLNPKYTFDTFVVGNSNRFAHAASLAVAEAPARAYNPLFIYGD
FT                   VGLGKTHLMQAIAHFILDHNPDKKVVYVSSETFTNELINAIKDDRTVEFRNKYRNIDIL
FT                   LVDDIQFLAGKERTQEEFFHTFNSLHEANKQLIISSDRPPKEIPTLEERLRSRFEWGLI
FT                   TDIQKPDLETRIAILRKKADLEDLEVPNEVIIYIANKIQSNIRELEGALIKVIAYSSLV
FT                   NREIDIDLAQEALKDLVAKDNNAPKQITIDHIKKVVADYYNLTIEDMDSKKRTQNIAFP
FT                   RQIAMYLSRELTSSSLPQIGENFGGRDHTTVIHAHNKVTKKYEDDLDFKKMIDKLVEKI
FT                   KTGTR"
FT   gene            2332..3435
FT                   /locus_tag="Hore_00020"
FT   CDS_pept        2332..3435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_00020"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /note="PFAM: DNA polymerase III beta subunit, N-terminal
FT                   domain; DNA polymerase III beta subunit, central domain;
FT                   DNA polymerase III beta subunit, C-terminal domain;
FT                   TIGRFAM: DNA polymerase III, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_00020"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68765"
FT                   /db_xref="GOA:B8CZN5"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:B8CZN5"
FT                   /protein_id="ACL68765.1"
FT                   /translation="MEFTISQKDFSRSINIVQRAVSSKNTMPILTGIYLEARKDKGLHM
FT                   KATDLELGIEYWVKADIITEGKIVLPASHLSGIIRELPDDNINFKADLDKYEAELTCLS
FT                   SRFKIKGFDADEFPQLPEVNIPHKITLNCGDLNRLIDEVKFSTSTDQTQPALTGGSMVI
FT                   DSGKIRMVATNTYRLSLSSLDLDGSPEGKKEVILPGNTLSELSHLLDDDGEVEILIGDN
FT                   YVRFNFNGIVLVSRVIEGQFPNYQQVLPKEYNTKVRVDRNNLLRSVRRVSLIARLDSNV
FT                   ISISVKDNKMIITSQDSEEGFAREEIEIESQGPEQNINIDAGYLLDVLKVLNDDVVILE
FT                   LIGPLNPLTLKKENSDDFIYLVMPVRR"
FT   gene            3451..3669
FT                   /locus_tag="Hore_00030"
FT   CDS_pept        3451..3669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_00030"
FT                   /product="RNA-binding S4 domain protein"
FT                   /note="PFAM: S4 domain; TIGRFAM: S4 domain protein YaaA"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_00030"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68766"
FT                   /db_xref="GOA:B8CZN6"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:B8CZN6"
FT                   /protein_id="ACL68766.1"
FT                   /translation="MKDIKINTEKIKLDQLLKYANIVATGGQAKNLIQAGKVMVNGEEE
FT                   LRRGRKLVPGDEVQLVGENTVYRVTRD"
FT   gene            3670..4797
FT                   /locus_tag="Hore_00040"
FT   CDS_pept        3670..4797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_00040"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="PFAM: RecF/RecN/SMC N terminal domain; TIGRFAM: recF
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_00040"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68767"
FT                   /db_xref="GOA:B8CZN7"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8CZN7"
FT                   /protein_id="ACL68767.1"
FT                   /translation="MYIDRIYLKDFRNLTENLIKLDNRLNVFVGLNGQGKTNFLEAVYL
FT                   MGTASSHRTNADRELIRWNQDRAVVQLYLVKRDEKLKISLEINKKVKKLEINDVPQERV
FT                   SELLGNLNVVLFSPEDLKLVKEGPHFRRKFLDTELSQVKPYYHYLLKKYNHILSQRNNL
FT                   LKELMTGNKSDTTLLEVWDEQLVEIGAKIIQNRIEVIDKLKILARLSHRQITDGLENIT
FT                   LSYESSLSDRIEEKELEEIKIIFRNKLVNNRNEEITRGYTLAGPQRDDLKITMNGIDIR
FT                   KYGSQGQQRTAALSLKLAELEFMKSEQGEYPVLLLDDVFSELDNKRRHRLIDIMAHRVQ
FT                   TFITATDFFNLNEINTPSIKVFKVRNGLITRYKSL"
FT   gene            4821..5090
FT                   /locus_tag="Hore_00050"
FT   CDS_pept        4821..5090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_00050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_00050"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68768"
FT                   /db_xref="InterPro:IPR007169"
FT                   /db_xref="UniProtKB/TrEMBL:B8CZN8"
FT                   /protein_id="ACL68768.1"
FT                   /translation="MFLHLGDGYMIPTRDIVLIGDLEKVNQSEVSQEFMEIATEEGFVI
FT                   DYSDGNPKSFVLTGETVYLSMISSHTLAKRVKELFKENGGNSNG"
FT   gene            5083..7011
FT                   /locus_tag="Hore_00060"
FT   CDS_pept        5083..7011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_00060"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="PFAM: Histidine kinase-, DNA gyrase B-, and
FT                   HSP90-like ATPase; DNA gyrase B subunit, carboxyl terminus;
FT                   DNA gyrase B; Toprim domain; TIGRFAM: DNA gyrase, B
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_00060"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68769"
FT                   /db_xref="GOA:B8CZN9"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B8CZN9"
FT                   /protein_id="ACL68769.1"
FT                   /translation="MAEESFLNNKGNYEAEHIQVLEGLEAVRKRPGMYIGSTGMDGLHH
FT                   LVYEVVDNSIDEAMQGYCDLIEVIIKPGNIITVKDNGRGIPVDPHPKLKKPAVEVVLTV
FT                   LHAGGKFGGDGYKVSGGLHGVGVSVVNALSKWLEVEVCWRDGKVYHQKYNRGIPVYDLK
FT                   VIGECSGTGTTISFKPDEEIFEDVNFKYKVLAQRLKELAFLNKGVRIILRDEREEEARQ
FT                   DEYCFEGGLVSFVKYLNKNKNPLFDEPFYLEEKDENREVEIAIQYNDGYVDSIFTFANN
FT                   INTREGGTHLSGFKSALTRTVNDYARSKGILKENDENLTGEDIREGITAIISVRLTDPQ
FT                   FEGQTKTKLGNSEIRGFVDSALSSNLRTFLEENPKIGKIIVEKARSAARARKAAKKARE
FT                   LTRRKGALSNTALPGKLADCSSRDTENTEIYIVEGDSAGGSAKQGRDRKFQAILPLRGK
FT                   ILNVEKARLNKILNNEEIRALITAIGTGIGDEFDINKARYGKIIIMTDADVDGAHIRTL
FT                   LLTFFYRYMRPLIENGMIYIAQPPLYKVKKGRREEYVYNDRGLQKLLNDIGRDKITLQR
FT                   YKGLGEMNPDQLWETTMNPENRIILKVKIEDAVVADETFTTLMGDKVQPRREFIQEHAH
FT                   EVQNLDV"
FT   gene            7134..9584
FT                   /locus_tag="Hore_00070"
FT   CDS_pept        7134..9584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_00070"
FT                   /product="DNA gyrase, A subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="PFAM: DNA gyrase C-terminal domain, beta-propeller;
FT                   DNA gyrase C-terminal domain, beta-propeller; DNA gyrase
FT                   C-terminal domain, beta-propeller; DNA gyrase C-terminal
FT                   domain, beta-propeller; DNA gyrase C-terminal domain,
FT                   beta-propeller; DNA gyrase C-terminal domain,
FT                   beta-propeller; DNA gyrase/topoisomerase IV, subunit A;
FT                   TIGRFAM: DNA gyrase, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_00070"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68770"
FT                   /db_xref="GOA:B8CZP0"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:B8CZP0"
FT                   /protein_id="ACL68770.1"
FT                   /translation="MVMDINNGKVLEVDIENEMKGAYLDYAMSVIVSRALPDVRDGLKP
FT                   VQRRILYALHDLGITPNKPHKKSARVVGEVLGKYHPHGDTAVYDTMVRMAQEFSFRYPL
FT                   VDGHGNFGSIDGDSAAAMRYTEVRMARLTTELLRDIDKNTVDFAPNFDESLEEPEVLPA
FT                   RLPNLLMNGVSGIAVGMSTNIPPHNLGEVIDGVVALIDNPDLEVKDLMKIIKGPDFPTG
FT                   GIIMGKDKIYQAYKTGRGRLKVRGKARIEEDKNGKSKIIITEIPYQVNKARLVEKIANL
FT                   VRDEKITGISDLRDESDRRGLRIVIELKKGTVPKVILNRLYKYTQLQVTYGVIMLALVD
FT                   GMPRVLTLKELLNHYLEHQKEVVTRRTKYQLDKAEARAHILEGLRIALANIDDIVQLIR
FT                   EAPDVDTARRGLIENFNLTEKQAEAILRMRLQRLTGLERDKIEAEYKELKEKIAYYRSI
FT                   LADEGKLLGIIKDELLELKEKFQDERRTEISIQAVDLDVEDLIPEEQVVITLTHHGYIK
FT                   RMPIDIYRSQRRGGKGIIGINTKEEDFVEHVFTTSTHHYFLFFTNKGKVYRLRVFEIPQ
FT                   ASRQARGTAIVNLLELEEEERITTVIPIREFDEERYLVMVTRNGMIKKTPLAEYESRYT
FT                   GLIGLTLRDEDELIDVKYTDGNQSVIIVTHRGKAIHFKENEVRSMGRTAMGVKAITLED
FT                   GDYVVGMGVDSEGDDLLVITEKGYGKRTPLEEYRLQSRGGKGLITANITEKNGNLAGVK
FT                   VVREDHDLILITSEGIIIRTRVEGISRLGRNTLGVKVIRLEEGDRVVSLARISPEEKDI
FT                   EEMD"
FT   gene            complement(9719..9913)
FT                   /locus_tag="Hore_00080"
FT   CDS_pept        complement(9719..9913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_00080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_00080"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68771"
FT                   /db_xref="UniProtKB/TrEMBL:B8CZP1"
FT                   /protein_id="ACL68771.1"
FT                   /translation="MPYLIGLTGFKTAVSIARGENWLFDQKINNGEYKIPTIITPIMTI
FT                   DKYNLVTVEDRWKKRNIKW"
FT   gene            complement(10003..10833)
FT                   /locus_tag="Hore_00090"
FT   CDS_pept        complement(10003..10833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_00090"
FT                   /product="ABC-type sugar transport system periplasmic
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_00090"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68772"
FT                   /db_xref="GOA:B8CZP2"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B8CZP2"
FT                   /protein_id="ACL68772.1"
FT                   /translation="MDFLKSVVLSSVVLSNVLFIKKFIKILYTHYQKVNRKIIYISLII
FT                   GIISLMVIPLSGCSPASGESKKPEKVKIGVTVATMKYDVFYLIKEAMFDNQERENATLI
FT                   WKDAGYDEKRQAQHIDEFIKEKVDVVIIHPVNPITSGKLVKKLSSKKIPVLALRRLPYE
FT                   VGLDGYIPANNFRIGMEQAIYVADQIDHEGKVVILKGDKKTNSAQLITWGNKQILKKEP
FT                   GIKIVAEKWHEFDKVEEAAKTTRQALEKYPDIKAILANNSRLAMQAVKVLKEKN"
FT   gene            11120..12715
FT                   /locus_tag="Hore_00100"
FT   CDS_pept        11120..12715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_00100"
FT                   /product="GerA spore germination protein"
FT                   /note="PFAM: Bacillus/Clostridium GerA spore germination
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_00100"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68773"
FT                   /db_xref="GOA:B8CZP3"
FT                   /db_xref="InterPro:IPR004995"
FT                   /db_xref="UniProtKB/TrEMBL:B8CZP3"
FT                   /protein_id="ACL68773.1"
FT                   /translation="MNWERIKERIDEIISSNTDRPGEKTSKKKLTRDIKKNEKTIEDII
FT                   GFSDDVNFREFKLGKKLKIKATLIYIDSLVDKKTINESILEPLFTEEFFSDNVENLTTD
FT                   DIVKFVRDNTMTINEVKVTEKLEDTIEGILNGDSVLLVDGYEQVMVLNTKGWEKRSVSE
FT                   PVVESVIRGPRDGFTETLAVNTGLIRRRVKHPSLRIKNYNIGRFSKTSVSICYIEGIAN
FT                   KHLVEEVKERINNINIDNIGSSGFVEQLIEDSHLSPFPQILSTERPDRVAANLMEGRVA
FT                   VVVDNTPFVLILPMTISIFFQSPEDYHERFLVANFIRIIRGIAAFLSLTLPSIYIALIS
FT                   FHPEMLPTRLALAFAGGRGMVPFPSYLEAFIMEGAMELLREASIRLPNPIGPTIGIVGA
FT                   LIVGEAAVSASIVSPFMVIIVAVTTIASFTIPDYGSAIALRILRFPLMVVTTIFGLYGL
FT                   IWGLIAITIHLASLKSFGIPYLTPLAPSRLSDLKDLVVRAPFWLMYRRPKYLRTKDEKR
FT                   FSSKGDDDQNERTR"
FT   gene            12699..13796
FT                   /locus_tag="Hore_00110"
FT   CDS_pept        12699..13796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_00110"
FT                   /product="spore germination protein"
FT                   /note="PFAM: Spore germination protein; TIGRFAM: spore
FT                   germination protein (amino acid permease)"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_00110"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68774"
FT                   /db_xref="GOA:B8CZP4"
FT                   /db_xref="InterPro:IPR004761"
FT                   /db_xref="UniProtKB/TrEMBL:B8CZP4"
FT                   /protein_id="ACL68774.1"
FT                   /translation="MKEHGKLSERQFAGIIANTMVGVGVLILPKTATKFAGTAGWIALL
FT                   LGGVIALFFLFLILKLGTRFPENTLMEYAPRIIGKIPGTLVSLIFCTYWFLLSSLIFRV
FT                   FAEMMVDAILLNTPIEVIIISMLILVAYLSRHDVEVFGRVNELFFIFLIIPAVFGLAVS
FT                   LKQVTGIKLLPLLGNGLPSILINTRELFFSFVGFEIIFLFIPSITTLGKVYNYGFKGWL
FT                   SPAAIYLAVVIIGIGVFGTRELQNLMWPTLELVKVINFPGLILERVEAIFIAFWVIAVF
FT                   TTVTNLFYSSVVGATQVLKLSDHKTLVYPLLPLFYFFSTYPQNIYEVLNYMNVMGKFGG
FT                   LVIITVTPLLYIISLIRNIKGGQKA"
FT   gene            13793..14968
FT                   /locus_tag="Hore_00120"
FT   CDS_pept        13793..14968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_00120"
FT                   /product="spore germination B3 GerAC family protein"
FT                   /note="PFAM: Spore germination B3/ GerAC like, C-terminal;
FT                   TIGRFAM: germination protein, Ger(x)C family"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_00120"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68775"
FT                   /db_xref="GOA:B8CZP5"
FT                   /db_xref="InterPro:IPR008844"
FT                   /db_xref="InterPro:IPR038501"
FT                   /db_xref="UniProtKB/TrEMBL:B8CZP5"
FT                   /protein_id="ACL68775.1"
FT                   /translation="MKSRILPAIMVIVLISILLTGCWDLKDIDERATVLAIGIDYADIP
FT                   QPGNFEGSYMVKVTLQIAISEQMTGGAGQAPPMGEQVVWNISSTGATMARAIELCQEKL
FT                   KYSLFFGHVRILIFGQKVAQNGVNQFLNYFRNHPMFRRLSYILVSKGDAADVLKTFPKS
FT                   ATIQAMFLMNMVETAQNTGRMPDIPFMEFVVRLIDKGIDPVAIMVSSHKDSVVNTGVAV
FT                   FRGDNMVGSLDLYETWNFIQITENQRGGIEVVRDVEDELGRVTIQLTGVNSNVRPIIQK
FT                   NGKVKFIIDMEVEGRIVSQETQTDYNDPVLFSALEERVEKEYKRELEQMINKVQKQFKA
FT                   DIFGFGQQLRAYQNREWKEINNWRKAFSEGELDLTIYVDIRRMGMSTFTKK"
FT   gene            complement(15393..15677)
FT                   /locus_tag="Hore_00130"
FT   CDS_pept        complement(15393..15677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_00130"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_00130"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68776"
FT                   /db_xref="GOA:B8CZP6"
FT                   /db_xref="InterPro:IPR012206"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:B8CZP6"
FT                   /protein_id="ACL68776.1"
FT                   /translation="MTSFLKNNENPLKYVNIIPAGKSHIHIRNKKVCLDCENKPCTYYC
FT                   PARVFFWEVNEIKILFERCIECGACPWGCPRENIDWVYPPGGYGVKYEV"
FT   gene            complement(15680..16846)
FT                   /locus_tag="Hore_00140"
FT   CDS_pept        complement(15680..16846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_00140"
FT                   /product="Electron-transferring-flavoprotein dehydrogenase"
FT                   /EC_number="1.5.5.1"
FT                   /note="PFAM: Glucose inhibited division protein A; FAD
FT                   dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_00140"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68777"
FT                   /db_xref="GOA:B8CZP7"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR039651"
FT                   /db_xref="UniProtKB/TrEMBL:B8CZP7"
FT                   /protein_id="ACL68777.1"
FT                   /translation="MIYREATAQIVPNFWEEAPVERAIVTDTLWFMDQTSAVQVGFTGL
FT                   NYAKPPYNKFSVIRSRFDHWLAKKAEEAGAHLMTSCLVKDLIFEKEGLTGKKVAGVVLD
FT                   DGSKLYSDAVILAEGAMADLAAKAGLRREISADSLKIYVKEILALPREIIEARFNLEKD
FT                   EGVIIGMVGFPTSGAVGKGGIWTNRDSISLVVGGYLNQIVNKGLNLYQLLNRLKKHPMI
FT                   RRLIEGAKTVQYMSHLIPKGGYKSLPQFYDNGILITGDAGMLVSGRHGTDIAMLSGKYA
FT                   AETALQAKARGDFSKKTLSSYENKLKNTFFMRAIESNKEARDYYREYPDSDFVFSKTLN
FT                   EVAYEFFKEGLKTQDEKLNEIIEEVKEIQSLQKNIRDIYSGLQHWRVF"
FT   gene            17281..17748
FT                   /locus_tag="Hore_00150"
FT   CDS_pept        17281..17748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_00150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_00150"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68778"
FT                   /db_xref="GOA:B8CZP8"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR011566"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:B8CZP8"
FT                   /protein_id="ACL68778.1"
FT                   /translation="MVEDSKLLKWLNWFYTLELAQTDLYLNQAKGSKDRYMARVLIKLG
FT                   EIEKTHALRFSDIIVKLGGKPTRIGALFSYLSGYIPGRLTPYIGTVNLFYVNYMMETIA
FT                   IRDYKGLIKKINPKRKYRKELLDILVENLIDEDLHRSWFKDRRESLLNLKK"
FT   gene            18276..18533
FT                   /locus_tag="Hore_00160"
FT   CDS_pept        18276..18533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_00160"
FT                   /product="predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_00160"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68779"
FT                   /db_xref="GOA:B8CZP9"
FT                   /db_xref="InterPro:IPR018649"
FT                   /db_xref="UniProtKB/TrEMBL:B8CZP9"
FT                   /protein_id="ACL68779.1"
FT                   /translation="MGWFCAPYRGFGMFGGFFGLLINGLIIALIIWVVVKLVKGINFKT
FT                   NTRVYKATGKGEALEIVKERYARGEITKEEFERMKKDLEE"
FT   gene            18626..19411
FT                   /locus_tag="Hore_00170"
FT   CDS_pept        18626..19411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_00170"
FT                   /product="zinc/iron permease"
FT                   /note="PFAM: ZIP Zinc transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_00170"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68780"
FT                   /db_xref="GOA:B8CZQ0"
FT                   /db_xref="InterPro:IPR003689"
FT                   /db_xref="UniProtKB/TrEMBL:B8CZQ0"
FT                   /protein_id="ACL68780.1"
FT                   /translation="MIEEYLSHFNMVYLGLLASLVAGLATGIGGLPVLFTKNISQKILN
FT                   SMLGFAAGIMLAATSFSLIIPAISYGGGGVKGASIAFFGIILGGFFLDSIDRYFPNTNL
FT                   LSGSIDENPNLKRIWLFATAITLHNFPEGLAVGVGFGNGDVLNGMSLAIAIGLQNIPEG
FT                   LAVALPFVREGVNKWKAVGIALATGLVEPVGGILGAGLVQISRPLLPVFLAFAAGAMLF
FT                   VISYEIIPESQKDAMFSKLSSHALLLGFVIMMFLDNVLG"
FT   gene            19830..21373
FT                   /locus_tag="Hore_R0001"
FT   rRNA            19830..21373
FT                   /locus_tag="Hore_R0001"
FT                   /product="16S ribosomal RNA"
FT   gene            21909..24517
FT                   /locus_tag="Hore_R0002"
FT   rRNA            21909..24517
FT                   /locus_tag="Hore_R0002"
FT                   /product="23S ribosomal RNA"
FT   gene            24666..24781
FT                   /locus_tag="Hore_R0003"
FT   rRNA            24666..24781
FT                   /locus_tag="Hore_R0003"
FT                   /product="5S ribosomal RNA"
FT   gene            24792..24866
FT                   /locus_tag="Hore_R0004"
FT   tRNA            24792..24866
FT                   /locus_tag="Hore_R0004"
FT                   /product="tRNA-Gln"
FT   gene            24887..24962
FT                   /locus_tag="Hore_R0005"
FT   tRNA            24887..24962
FT                   /locus_tag="Hore_R0005"
FT                   /product="tRNA-Lys"
FT   gene            24968..25044
FT                   /locus_tag="Hore_R0006"
FT   tRNA            24968..25044
FT                   /locus_tag="Hore_R0006"
FT                   /product="tRNA-Met"
FT   gene            25053..25129
FT                   /locus_tag="Hore_R0007"
FT   tRNA            25053..25129
FT                   /locus_tag="Hore_R0007"
FT                   /product="tRNA-Gly"
FT   gene            25174..25249
FT                   /locus_tag="Hore_R0008"
FT   tRNA            25174..25249
FT                   /locus_tag="Hore_R0008"
FT                   /product="tRNA-Met"
FT   gene            25253..25345
FT                   /locus_tag="Hore_R0009"
FT   tRNA            25253..25345
FT                   /locus_tag="Hore_R0009"
FT                   /product="tRNA-Ser"
FT   gene            25364..25439
FT                   /locus_tag="Hore_R0010"
FT   tRNA            25364..25439
FT                   /locus_tag="Hore_R0010"
FT                   /product="tRNA-Glu"
FT   gene            25442..25517
FT                   /locus_tag="Hore_R0011"
FT   tRNA            25442..25517
FT                   /locus_tag="Hore_R0011"
FT                   /product="tRNA-Val"
FT   gene            25525..25602
FT                   /locus_tag="Hore_R0012"
FT   tRNA            25525..25602
FT                   /locus_tag="Hore_R0012"
FT                   /product="tRNA-Asp"
FT   gene            25610..25685
FT                   /locus_tag="Hore_R0013"
FT   tRNA            25610..25685
FT                   /locus_tag="Hore_R0013"
FT                   /product="tRNA-Thr"
FT   gene            25688..25763
FT                   /locus_tag="Hore_R0014"
FT   tRNA            25688..25763
FT                   /locus_tag="Hore_R0014"
FT                   /product="tRNA-Ala"
FT   gene            25785..25870
FT                   /locus_tag="Hore_R0015"
FT   tRNA            25785..25870
FT                   /locus_tag="Hore_R0015"
FT                   /product="tRNA-Tyr"
FT   gene            25872..25946
FT                   /locus_tag="Hore_R0016"
FT   tRNA            25872..25946
FT                   /locus_tag="Hore_R0016"
FT                   /product="tRNA-Gly"
FT   gene            26191..27204
FT                   /locus_tag="Hore_00180"
FT   CDS_pept        26191..27204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_00180"
FT                   /product="transport system permease protein"
FT                   /note="PFAM: FecCD transport family"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_00180"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68781"
FT                   /db_xref="GOA:B8D027"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:B8D027"
FT                   /protein_id="ACL68781.1"
FT                   /translation="MKLNYSRKIIFLALIVLLIVVFILSLAVGSVHIPIHQIWAIILDH
FT                   ADSNETYKIIIKDIRLPRIILSFLVGSALAVSGVVFQGVIRNPMVDPYIIGVSAGAGTA
FT                   VTLAILFNWSITFLWFDTMPIMAFLGSLLTIFTVYRMARVNKKTPVTTFLLAGVAVGFL
FT                   LNAVMSFLMVFVTGDLYKVVYWLMGSLITEGWKEVKIIVPYYILGLIPVVFYLKDLNIL
FT                   LLGEESAHNLGVNVERVKSILIFSGALLTAAAVSVSGIIGFIGLIVPHISRLIIGPDHR
FT                   RLLPFSWLLGGLFLVVSDDLARTLIKPSEIPVGIITALVGAPYFIYLLKKKKDNLW"
FT   gene            27211..28467
FT                   /locus_tag="Hore_00190"
FT   CDS_pept        27211..28467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_00190"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_00190"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68782"
FT                   /db_xref="GOA:B8D028"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8D028"
FT                   /protein_id="ACL68782.1"
FT                   /translation="MIEIKNLNFGYYNKAILKNVSLSIENKEFIGIIGPNGSGKSTLLK
FT                   NLSKILSPESGLIYLNKRLLNDYSVKELSRILSVVPQDTSIQFNFTVYDLILMGRNPYM
FT                   DNWGRVTREDKVIVEEVMELTDTSKLRDKKVRELSGGERQRVIIARALAQQPEILLLDE
FT                   PTASLDINYQQEIFELLSHLNKTMNLTILLVSHDLNLTGQYCKRLILLKDGKIFAAGSP
FT                   EEVLTPANIKKVYNTEVKVLNNPISNKPYVVLIPGKEKKRQRIKPTQKPRVHLICGGGS
FT                   GKELMNTLHQQGYRVSTGVLNQGDSDWEKAMELGIPVVEIPPFAPICEKSLKDNVALIR
FT                   ESDVIVVADTPFGYGNIDNLKAISGIKDKPIIIVNSHNIKEKDYTDGLANKYWSEMEKR
FT                   ANCYSVKNEDEVLSYLNKL"
FT   gene            28875..29462
FT                   /locus_tag="Hore_00200"
FT   CDS_pept        28875..29462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_00200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_00200"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68783"
FT                   /db_xref="InterPro:IPR018865"
FT                   /db_xref="UniProtKB/TrEMBL:B8D029"
FT                   /protein_id="ACL68783.1"
FT                   /translation="MNCSQCGKTAINQVEGQPLCVDCYLKLQQAIQMQNNRYLEEMNYL
FT                   SDMMEATLGVYGVLPKYKINQPNQYINTGKISFNNINVDRSVIGAINPGEVKKIDVAME
FT                   QIKKSGNDELVAALKDFTEKIIESNELKQEEKNELLEQVSFIASQTALPKEKQKKSIVK
FT                   PIMNNIKEIVSTIGTLYNLWEKVKPFLDNIFS"
FT   gene            complement(29641..30039)
FT                   /locus_tag="Hore_00210"
FT   CDS_pept        complement(29641..30039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_00210"
FT                   /product="death-on-curing family protein"
FT                   /note="PFAM: Prophage maintenance system killer protein;
FT                   TIGRFAM: death-on-curing family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_00210"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68784"
FT                   /db_xref="GOA:B8D030"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR006440"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="UniProtKB/TrEMBL:B8D030"
FT                   /protein_id="ACL68784.1"
FT                   /translation="MKKIKFIPKKVILYFYDQLLQTYGGKHGIRDEKLLDSALEQPKAT
FT                   YEGKYLHDTLMDMAAAYGYHLCNNHPFIDGNKRIALVAMDVFLQRNGYEIVASEKETYK
FT                   IMIKLSAGQLSKKELTKWLEKNTSPLQD"
FT   gene            complement(30036..30260)
FT                   /locus_tag="Hore_00220"
FT   CDS_pept        complement(30036..30260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_00220"
FT                   /product="transcriptional regulator/antitoxin, MazE"
FT                   /note="PFAM: SpoVT / AbrB like domain; TIGRFAM: putative
FT                   addiction module antidote"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_00220"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68785"
FT                   /db_xref="GOA:B8D031"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR013432"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:B8D031"
FT                   /protein_id="ACL68785.1"
FT                   /translation="MRSIKLRKVGNSFGFTIPKELIEKYNLKEGEELHVIEMSEGFTLT
FT                   PFDPEFENWASAFEKTNKKFKNTLRELSK"
FT   gene            30613..30894
FT                   /locus_tag="Hore_00230"
FT   CDS_pept        30613..30894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_00230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_00230"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68786"
FT                   /db_xref="GOA:B8D032"
FT                   /db_xref="UniProtKB/TrEMBL:B8D032"
FT                   /protein_id="ACL68786.1"
FT                   /translation="MELIFITAPTSIIIIFIIFRYEKLRKIKKYFFDLFYVEDNKWFGR
FT                   FAMYFYLLYIFNYLIHSILIKNILGFFVIISVIIGFPLLYRIVIKINP"
FT   gene            31073..31786
FT                   /locus_tag="Hore_00240"
FT   CDS_pept        31073..31786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_00240"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   1"
FT                   /note="PFAM: haloacid dehalogenase-like hydrolase; TIGRFAM:
FT                   haloacid dehalogenase superfamily, subfamily IA, variant 1
FT                   with third motif having Dx(3-4)D or Dx(3-4)E"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_00240"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68787"
FT                   /db_xref="GOA:B8D033"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:B8D033"
FT                   /protein_id="ACL68787.1"
FT                   /translation="MIKAIIFDIDDTLISHTSAIKKGSKNFYDKFIAEKGFTLSEFQDI
FT                   WKEEHDKYMEQYLKKEITFQEQKILRLKGVFSRFGENISSAEAKEFFNYYLSAYENNWT
FT                   LFSDVCLELLNDYLLGIISDGDSDQQRKKLKNKSIIDFFDTVVISGDLGISKPDKRIFK
FT                   KCLNDLDINSYEALYIGDNYKKDFIGAINSVLYAGLIDRNADKKIEYVGNGFIINSLEL
FT                   IPEIIKEINKNKDVG"
FT   gene            31940..32761
FT                   /locus_tag="Hore_00250"
FT   CDS_pept        31940..32761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_00250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_00250"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68788"
FT                   /db_xref="UniProtKB/TrEMBL:B8D034"
FT                   /protein_id="ACL68788.1"
FT                   /translation="MSNQRFKFTKVLNHGTNNPIVNRLSLQFFELFKTNLINLSDKKIE
FT                   KIKEFLHECTLDLIKAQELFKNYLELQNETINKIIEEKEIKIKENVIQYNDPSYELNKY
FT                   FEDFLIRNVIALRKTIKIAECVFDKKFDGPKDLLKYLKKVFTNEKEYIKMLNEDSKWYK
FT                   ELYDYRGKVEHSKLEITNFEVYLDKNDKPLVKKQILVDKNCTLEEYMDVTLYNVFSYCE
FT                   DFTVMLLKLHCSDIMRIVQIPENQRENHRNFKYTYDLREDLKSKLLDKEDS"
FT   gene            32974..33846
FT                   /locus_tag="Hore_00260"
FT   CDS_pept        32974..33846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_00260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_00260"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68789"
FT                   /db_xref="InterPro:IPR022104"
FT                   /db_xref="UniProtKB/TrEMBL:B8D035"
FT                   /protein_id="ACL68789.1"
FT                   /translation="MACSRSSALLHTAISAMITAIETYNKPDHKYREETFSILALNAWE
FT                   LLLKAKVLKEKDNDIRELYIYERRTLKNGTKSKRRYIKRNRTGNPMTISMGKTLVLIEN
FT                   EGLGNIDQAVKANLDALTEIRDNSIHLINMSSDLSKAIQELGTATLQNFVKLTKKWFDH
FT                   DLSQYNFYLMPLAFFRDFDSALAVNLTSEETNIAKYLTSLHHSYDKGGKNEDEYAVTLE
FT                   LNVRLKRSALSTAARLALGDDPDAIPVTLTEEDIRSLYPWDYKELTERLQDSRSIILFE
FT                   KNLRKINDM"
FT   gene            34102..34926
FT                   /pseudo
FT                   /locus_tag="Hore_00270"
FT   gene            35574..35870
FT                   /locus_tag="Hore_00280"
FT   CDS_pept        35574..35870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_00280"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_00280"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68790"
FT                   /db_xref="GOA:B8CXV6"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:B8CXV6"
FT                   /protein_id="ACL68790.1"
FT                   /translation="MGRKKYSEEFKREAVELSFSSDKSCTVIAKELGISYHNLIRWRRE
FT                   YKNKGDLAFPGNGKQKLTPEQEEIQRLKKELNDIKIERDILKKAVRIFSKEPK"
FT   gene            35867..36742
FT                   /locus_tag="Hore_00290"
FT   CDS_pept        35867..36742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_00290"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase core domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_00290"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68791"
FT                   /db_xref="GOA:B8D037"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B8D037"
FT                   /protein_id="ACL68791.1"
FT                   /translation="MIYGFIRDHSNEFAVEKMCQVLNVSRSGYYSWLNRKPGKRELTNK
FT                   KLKLKIAEIYWQTRGRCGSPRIHKQLKKEGYHYNIKRIERLMRIMGLKAIQKRKFKRTT
FT                   NSDNNLPLKNNLLKRNFSVTQPDKVWVSDITYIPTKEGWLYLSVVIDLYSRKVVGWSMD
FT                   NHMTKRLVIDALEMAVLNRNPSRGLIFHSDRGSQYASHDFQKTLWKYGIISSMSRKGDC
FT                   WDNAVAESFFATLKTELIFHNKYQSRAQAKRDIFEYIEIFYNRIRLHSSLDYKSPEDYE
FT                   KERKTSKLCV"
FT   gene            36919..37542
FT                   /locus_tag="Hore_00300"
FT   CDS_pept        36919..37542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_00300"
FT                   /product="Abortive infection protein"
FT                   /note="PFAM: CAAX amino terminal protease family"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_00300"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68792"
FT                   /db_xref="GOA:B8D038"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:B8D038"
FT                   /protein_id="ACL68792.1"
FT                   /translation="MQTFIFKYLMNAIFQLILFSLLPLVFYIITRRTIKGFLAYIGLKK
FT                   VAYIKSFKKIILLFLAAYSFNLITITIIYLKGELAKINAIGSSFSDDDLGMIFLILSVL
FT                   IYSFIQTGLSEEIFFRGFLAKRLISKTGYFYGNLIQAITFGSIHYFSLNGASTKVRILE
FT                   MITATIMGYFYCYINERKTNGSIVIGWIFHAITNTATVIIFLVL"
FT   gene            complement(37748..38152)
FT                   /locus_tag="Hore_00310"
FT   CDS_pept        complement(37748..38152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_00310"
FT                   /product="predicted nucleic acid-binding protein, contains
FT                   PIN domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_00310"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68793"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:B8D039"
FT                   /protein_id="ACL68793.1"
FT                   /translation="MIITLDVSAAIEFIMGRKYQPFIKSKLEKADWIIAPTLFIYEASN
FT                   VMWKYHSIKNYPQDKLLRKLRQILNIIDQFVEPKNIYEEAISVSFKIDHPVYDAMYLVT
FT                   SRRKNAKLLTMDNRLIKAASKLEIPVYDFN"
FT   gene            complement(38149..38397)
FT                   /locus_tag="Hore_00320"
FT   CDS_pept        complement(38149..38397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_00320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_00320"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68794"
FT                   /db_xref="GOA:B8D040"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:B8D040"
FT                   /protein_id="ACL68794.1"
FT                   /translation="MPTLQVRNLPEHIYNKIVELAEEDRRSITQETIILLEKALEMEKQ
FT                   NKKHRKKLLNKIINETKSDNFDNVPDPVPLIREDRQR"
FT   gene            38734..39270
FT                   /locus_tag="Hore_00330"
FT   CDS_pept        38734..39270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_00330"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: Acetyltransferase (GNAT) family"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_00330"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68795"
FT                   /db_xref="GOA:B8D041"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B8D041"
FT                   /protein_id="ACL68795.1"
FT                   /translation="MTIKYKKLTKDEVRLSLFSNFNRYQEVKKCWRKDNGEWILKEICF
FT                   TEQWGPDEYKYLVKCLKNTIETGGTVFGAFKKNVLVGFASLENHLFGTKNEYLQLSNIH
FT                   ISYENRGMRIGKRLFYLVCERAIEMGAKKLYISAHSAEETQAFYKALGCIEAKEYNEAL
FT                   VSQEPCDCQLEYSLL"
FT   gene            39302..39514
FT                   /pseudo
FT                   /locus_tag="Hore_00340"
FT   gene            39531..40334
FT                   /locus_tag="Hore_00350"
FT   CDS_pept        39531..40334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_00350"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_00350"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68796"
FT                   /db_xref="GOA:B8D042"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:B8D042"
FT                   /protein_id="ACL68796.1"
FT                   /translation="MGWYQMFYKIKNTLFIIKAEIIRYLQETFSYRVGIISDIIVLSIL
FT                   YLSLIFLNTGTKLGLYYQTGDSPSLLLLGYIFWSYSISAISRISSEIRTEQVKGTLQQK
FT                   FMAIIPFNFILIGTILSNLMINSIVAIAIIIISKIIAGVNIIFTWPSFIALLITLAGMY
FT                   GIALIFGAITLRVKKIGQLVFITQVILLFISDTMTKTYISESLGKIIPLSAGIDLARKA
FT                   VGGLNVNIIDWSILITVSTLWLVVGIYAFKKSQKYVKKHGLLNTY"
FT   gene            41095..41493
FT                   /locus_tag="Hore_00360"
FT   CDS_pept        41095..41493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_00360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_00360"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68797"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:B8D043"
FT                   /protein_id="ACL68797.1"
FT                   /translation="MNIFIKDILSIQPSQLYINKEKLGRVNKYLDSVNIEDINPLPIKK
FT                   IGNNIFFTDGHTRAYALYKRGIRKIKVYWDKDDLDWDFYLNCVCLCKEEKIYSIKDLED
FT                   KIVDPEDYFELWIKRCEKMYDDLKASSN"
FT   gene            41781..42023
FT                   /locus_tag="Hore_00370"
FT   CDS_pept        41781..42023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_00370"
FT                   /product="Uncharacterized protein family (UPF0180)"
FT                   /note="PFAM: Uncharacterized protein family (UPF0180)"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_00370"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68798"
FT                   /db_xref="InterPro:IPR005370"
FT                   /db_xref="UniProtKB/TrEMBL:B8D044"
FT                   /protein_id="ACL68798.1"
FT                   /translation="MARKIAVEEGLSNIAQELERFGYQVVNLTNQNMREADAIVISGQD
FT                   RNMMNREDITSKAQIIDARGLTAVQVRNELENRLI"
FT   gene            42408..43676
FT                   /locus_tag="Hore_00380"
FT   CDS_pept        42408..43676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_00380"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: Bacterial extracellular solute-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_00380"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68799"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:B8D045"
FT                   /protein_id="ACL68799.1"
FT                   /translation="MRNKSLIVLLVVSLLLVCYGTGLAKTTVRIAGFGGNDQVIVEELL
FT                   NKFVRPELADEGIEIIYEPIADDYQRYLLNSLSAGTAADLFYMDIFWAKNVIKEGLVEP
FT                   LDSYLAKSEVISKEDIVPSLLEGFTYEGKLYGIPKDFNSLALFYNKDLFDIAGIPYPNE
FT                   ADTWKTLEYKLRKVVEFFEKEGEEIHGLALQPEYARMGAFAYAAGWEPFVNGKTNLQDP
FT                   KFVKAFKWYTGLKEKGLGIMPADIGQGWGGGAFANGNFAACLEGAWIIGFLRDQAPNLN
FT                   YGATLLPKCSDTDERGNFIFTVAWGINANSKNKEAAFRVLETLTSPEAQQWVLERGLAI
FT                   PSRKSLADNPYFEKQTKEAQANKVVFMGASRGNIKPYSFRDYGGEWMEPINTALNEVMS
FT                   GQSTVEEALKTAQERLEQDIMNK"
FT   gene            43746..44894
FT                   /locus_tag="Hore_00390"
FT   CDS_pept        43746..44894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_00390"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: Binding-protein-dependent transport system
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_00390"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68800"
FT                   /db_xref="GOA:B8D046"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B8D046"
FT                   /protein_id="ACL68800.1"
FT                   /translation="MQKKWAYWKEKMAPYVLLAPFLFWFIIFFGYAFIRVVYFSFTKYN
FT                   LFDPPTFVGFKNYLDLFREYLFGVAFRNTLMYSIIVTTVQTIFALILAVVMNQKIKGIR
FT                   FFRAAYYMPSVTSSVVITLIFIWLFQRKGLINYLVTLYHSYGKMIGVFFLLLIAMQALL
FT                   VFKEKRQGRPVKYLEPSYLVLSILFAAIVTYILRIMGYITVVDVKPVDIIWLNTREKVF
FT                   GWLGPLSFARPLGAIMILNIWTTIPTFMLIYLAGLQDIPSSLYEAAEVDGANTWQKFRY
FT                   VTIPQLRHITFLVVTLGLIGTLQVFDQIAIVGDQAPLESIVTLAYYVYRNTFPSSATPH
FT                   AGMASAGAIVLALITLTLVLIRKKNIRRGERLIWPVLKRKKI"
FT   gene            44864..46255
FT                   /locus_tag="Hore_00400"
FT   CDS_pept        44864..46255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_00400"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: Binding-protein-dependent transport system
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_00400"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68801"
FT                   /db_xref="GOA:B8D047"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B8D047"
FT                   /protein_id="ACL68801.1"
FT                   /translation="MARLKTKENIEEINLKIRRKRWRNVAAIYLILLIFSILFMGPFLF
FT                   GAISSLKDNPVEWPPTLKTAQLSPKNWIGAYRVARQGGGGGFFGCLKPGHNVSFRATYL
FT                   YPDGKEITPPQARVSKRLAGYGKSAFELDKKFAVDYIEVKSVEEIERQKTDKGTKVIYE
FT                   ITLTNPSQYTFDKVPVDVQVPYKVKFVEADFEPNRLERLGMVQSWDNIVSGTIPYIFHN
FT                   YHRVFNENYSRTTGRSLFLTWIFNSFFLSITRVITTIIVASMAGYVLARLNFAGKKVLF
FT                   ILVLFSMMIPLQVTFVSNYLVLRDGIFGLTKLFGVDTLLNSLSGVIIWGMVAGNSVFIM
FT                   KQFFEGLPKSLEESARIDGASTYTIFSRIMLPLAKPALGALTILTFQGAWNDFFLPLVV
FT                   ITSPMDRFPLTVGLLSFRRIYGAGGMDWGPVLAGAIISALPIIILFVVFQRYFVEGISF
FT                   SGMKG"
FT   gene            46539..47552
FT                   /locus_tag="Hore_00410"
FT   CDS_pept        46539..47552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_00410"
FT                   /product="transcriptional regulator, LacI family"
FT                   /EC_number="5.1.1.1"
FT                   /note="PFAM: Periplasmic binding proteins and sugar binding
FT                   domain of the LacI family; Bacterial regulatory proteins,
FT                   lacI family"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_00410"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68802"
FT                   /db_xref="GOA:B8D048"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B8D048"
FT                   /protein_id="ACL68802.1"
FT                   /translation="MSVTIKDIAKRLGVSATAVSKALNDRDDVSEELKRKVLKVAEELD
FT                   YSANTIAKRLVTNKSNTIGVFMLSRRESEQRETVGFQFLSGILEEANKNGYDIVLFSTN
FT                   SDLLDEKSYIKLCKERRVEGAIFTGLRLDDPHIPEIKKAKFPITIIDTELDDAENVGFI
FT                   TTDNLSGVHKALEYLWKLGHRRIAMINGHHQAQVSKRRYQAFKEFLTQKGVFDEDLVFY
FT                   GDFTKNSGYKAALKILELNEPPTAVFSASDLMALGAIKAFKDKGLILPRDMSIIGYDNI
FT                   TSSEYTDPSLTTVAQDSVNMGREAVRLVLDGLDGGTMKKKVLEAKLVIRDSCARCC"
FT   gene            47678..50020
FT                   /locus_tag="Hore_00420"
FT   CDS_pept        47678..50020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_00420"
FT                   /product="Kojibiose phosphorylase"
FT                   /EC_number="2.4.1.230"
FT                   /note="PFAM: Glycosyl hydrolase family 65 central catalytic
FT                   domain; Glycosyl hydrolase family 65, N-terminal domain;
FT                   Glycosyl hydrolase family 65, C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_00420"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68803"
FT                   /db_xref="GOA:B8D049"
FT                   /db_xref="InterPro:IPR005194"
FT                   /db_xref="InterPro:IPR005195"
FT                   /db_xref="InterPro:IPR005196"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR017045"
FT                   /db_xref="InterPro:IPR037018"
FT                   /db_xref="UniProtKB/TrEMBL:B8D049"
FT                   /protein_id="ACL68803.1"
FT                   /translation="MAIAYNLGKGEYKNWIISETEFNENNLPKFETIFSLGNGYMGLRA
FT                   ATEEHYFNETRGCYVAGMFDRFKGEVAELPNIPDYVGMEIKLDGERFNLNQGKIISYHR
FT                   YLNVKDGELVREVEWQSPAGNITKLVFKRFVSLANLHLAGFKIKIIPVNYSGKVAIKTG
FT                   YNGQVTNSGVQHFVEGDKRVLPDGKSYLTVRTQESGIFTIVAGKFRFLINASEINPQQQ
FT                   IVTGRRQLFLRSEYELKENECLEMEKCVIVYTGRDLEFKDKDIDSGDIVETALTTLDKA
FT                   GTKRYEELFSEHRQKWHKLWHEIDIEIGGPDFDQLAVRFAQYHLVQMTPSHDSRISVAA
FT                   KGLSGEGYKGHVFWDTEIFILPFFIYTFPQIARKLLEYRYHTLDGARKKARENGYKGAM
FT                   YPWESADTGEETTPEFGEVDIKTGKPIRIWCGEIEQHITADVAYAIWHYYQVTGDKEFM
FT                   YNYGTEIFMETARFWASRLEYNQGLDRYEIKDVIGPDEYSEHVNNNAYTNYMVKWHLEK
FT                   AIDIYNWLSDDSRDILEKIINKIALKEDELNEWKKKKDKIYLPFQEDSKVIPQFDGFMD
FT                   QDVIDISSYRGDVGAIMKAYSWDEITSSQVIKQADVVMLLYLLGEDFSHEVKEKNYHYY
FT                   EPKTLHDSSLSPSIHAIMGKEIGDLDEAYRYFNKSTTIDLGRNMRSCDAGLHSASLGGI
FT                   WQAVVLGFGGVKVKDNVLNIDPMLPEKWDYLNFKLKWQGMPIRVEIRNDRVSVSFLNDD
FT                   KAMLKDVSVMVKGRNLQLNNNKAVVNL"
FT   gene            50126..50776
FT                   /locus_tag="Hore_00430"
FT   CDS_pept        50126..50776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_00430"
FT                   /product="beta-phosphoglucomutase"
FT                   /EC_number="5.4.2.6"
FT                   /note="PFAM: haloacid dehalogenase-like hydrolase; TIGRFAM:
FT                   beta-phosphoglucomutase family hydrolase;
FT                   beta-phosphoglucomutase; haloacid dehalogenase superfamily,
FT                   subfamily IA, variant 3 with third motif having DD or ED;
FT                   haloacid dehalogenase superfamily, subfamily IA, variant 1
FT                   with third motif having Dx(3-4)D or Dx(3-4)E"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_00430"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68804"
FT                   /db_xref="GOA:B8D050"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR010972"
FT                   /db_xref="InterPro:IPR010976"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:B8D050"
FT                   /protein_id="ACL68804.1"
FT                   /translation="MIIHREIKGFIFDLDGVITDTAELHYRSWKKLADEEGIPFTREDN
FT                   EQLRGVSRRKSLELLLNGREVPEEKKLEMMDRKNNYYKEFIKQITEEDLLPGAKELLDE
FT                   LKSRGYKLAVASASKNAKPVIKNLGVEHVFDQISDGYSVEKTKPAPDLFLYTAKQLGLK
FT                   PEECVVIEDAEAGIEAALAAGMTAVGIGPEERVGKAHFRYDKVADINLDDILA"
FT   gene            50996..52012
FT                   /locus_tag="Hore_00440"
FT   CDS_pept        50996..52012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_00440"
FT                   /product="transcriptional regulator, LacI family"
FT                   /EC_number="5.1.1.1"
FT                   /note="PFAM: Periplasmic binding proteins and sugar binding
FT                   domain of the LacI family; Sigma-54, DNA binding domain;
FT                   Bacterial regulatory proteins, lacI family"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_00440"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68805"
FT                   /db_xref="GOA:B8D051"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B8D051"
FT                   /protein_id="ACL68805.1"
FT                   /translation="MPLTLKDIAKIAGVAESTVSRAINNKPGVGEETRKKILKIVEEYN
FT                   FQPNKLAQGLAKKQTHILALLLPDLSNPNYPTIIKSIEEVANENGYQVVLCNTDNNPEK
FT                   EKGYLELVERNQVDGAIVVGGELADRHILNLALNKNASLVLVNRLCEELTIPTVLVDSA
FT                   RGAYLATEHLIDQGISEIALIMGLDREFLESEKLEGYKQALTDNGIELNEKLIVQTEGS
FT                   REAGYRAFLELMKKGVTPGGFFATSDLLAAGLVEAIKMGGYLIPEDFSVVGYGDSLVSS
FT                   IITPPLTVVAEPLTRLGKLAARNLINLLNGKQPAEIIKVLNPSIKVRNSSTPHIKDK"
FT   gene            52044..53162
FT                   /locus_tag="Hore_00450"
FT   CDS_pept        52044..53162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_00450"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: TOBE domain; TOBE domain; ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_00450"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68806"
FT                   /db_xref="GOA:B8D052"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005116"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040582"
FT                   /db_xref="UniProtKB/TrEMBL:B8D052"
FT                   /protein_id="ACL68806.1"
FT                   /translation="MASVTLENVVKRFDDVVAVNNANLEIRDKEFLVLVGPSGCGKSTT
FT                   LRMIAGLEEITEGTIKIGDTVVNDVPPKDRDIAMVFQNYALYPHMDVYNNMAFSLKLRK
FT                   FPKDEIDRRVKEAARILGIEDLLDRKPKQLSGGQRQRVALGRAIVREPKVFLMDEPLSN
FT                   LDAKLRVQMRTELSKLHDRLQTTVIYVTHDQVEAMTMGDRIVVLRDGVIQQVDDPLTLY
FT                   NKPNNMFVAGFIGSPAMNFLDCKLVKEGDKYYLDGHGSFKIAIPEDKINEAPEIKEYEG
FT                   REVVFGIRPEDLVDASIKHDFDVTDDNSFTANVEVVEPMGSEIYLYLGINDHSMIARVE
FT                   AESTAQVGDNVKLGVDTRKMHVFDAETEEAIF"
FT   gene            complement(53218..53511)
FT                   /locus_tag="Hore_00460"
FT   CDS_pept        complement(53218..53511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_00460"
FT                   /product="YabP family protein"
FT                   /note="PFAM: YabP family; TIGRFAM: sporulation protein
FT                   YabP"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_00460"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68807"
FT                   /db_xref="InterPro:IPR012504"
FT                   /db_xref="InterPro:IPR022476"
FT                   /db_xref="InterPro:IPR038705"
FT                   /db_xref="UniProtKB/TrEMBL:B8D053"
FT                   /protein_id="ACL68807.1"
FT                   /translation="MDKKKNNSGQKTTPARHTLSLNNRKELELDGVREVISYNEDKIIM
FT                   QTSMGVLEIKGKELNIQKLNLDEGTVKIKGHFSSLDYSDREPGKNFMNRLFR"
FT   gene            53551..53667
FT                   /locus_tag="Hore_00470"
FT   CDS_pept        53551..53667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_00470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_00470"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68808"
FT                   /db_xref="UniProtKB/TrEMBL:B8D054"
FT                   /protein_id="ACL68808.1"
FT                   /translation="MFNSYLSKFHNKNELYKEPDLAANYKIIYDDLNIFKYI"
FT   gene            53950..55980
FT                   /locus_tag="Hore_00480"
FT   CDS_pept        53950..55980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_00480"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: HAMP domain; Methyl-accepting chemotaxis
FT                   protein (MCP) signaling domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_00480"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68809"
FT                   /db_xref="GOA:B8D055"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:B8D055"
FT                   /protein_id="ACL68809.1"
FT                   /translation="MFLKKLNIFSPIYRILKKIISSYSLYTKLLLFFLIVMIIPLGLTF
FT                   YNDYRLTNDSLEKRLDEKILTGKNFVERIYESDINRVEGLAVIKASDTSIQETVATKNL
FT                   LQLMNILRPAFINKNNIDLAAILDSKGKVITRRGNLPNKDYKLESRYIEGINDKRISVN
FT                   QIEMTTEGIVIKGAQAITDPDQANLVHGIFLTGLVMDKSYWIDLSQDLGMEIILFDKDG
FT                   QPVTASFSNEKLSKISLKTNTEDSNNIWVDHLISDTEYRMVAFPVTDHNSKIIAYLGVT
FT                   TPKTPILNAGNKMKQSMIIYALIGASIAILVGIFLARSISKRVKGLISVVERVAEGDLS
FT                   QKIKIKGRDEIAYLGKSLNQMVNNLKGLVIEVMSSSNQVASAAQELAGSSQEATAITEQ
FT                   VTATSENISDGTAEQVEKINEASLIIKEMSRSIQEVAKGAQEVAGKSKTARNQVELGQE
FT                   ALEDLLHQIDKIGEIVEQSARVIKQLDTRSKEINKIIGLISEITEQTDLLALNAAIEAA
FT                   RAGEHGRGFAVVADEVRTLANQSNEAATNISKIIEEIQNDTQKAVDVMDEGTTVVEEGN
FT                   FAAGKAKDTFAGIRQAVEDTSKIAESIAEATREQKHGSDEMVTAIEEINNISQNTAQGA
FT                   GQINQAISEQSQTIEGISNSSETLAIMADKLRGLIDKFKTE"
FT   gene            56327..56635
FT                   /locus_tag="Hore_00490"
FT   CDS_pept        56327..56635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_00490"
FT                   /product="essential protein for formation of the spore
FT                   cortex"
FT                   /note="TIGRFAM: spore cortex biosynthesis protein YabQ"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_00490"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68810"
FT                   /db_xref="GOA:B8D056"
FT                   /db_xref="InterPro:IPR019074"
FT                   /db_xref="UniProtKB/TrEMBL:B8D056"
FT                   /protein_id="ACL68810.1"
FT                   /translation="MGKAGGKKMEDVLYQIFSFSVMFGYGLMLGIFLDLYRGIIKGLNI
FT                   RGIMKNILDILFGIIAGLIGFIILIYTNWVNLRFYIILAILLGFGLYYGLKSRWDNR"
FT   gene            56638..56919
FT                   /locus_tag="Hore_00500"
FT   CDS_pept        56638..56919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_00500"
FT                   /product="Septum formation initiator"
FT                   /note="PFAM: Septum formation initiator; TIGRFAM: cell
FT                   division protein FtsL"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_00500"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68811"
FT                   /db_xref="GOA:B8D057"
FT                   /db_xref="InterPro:IPR007060"
FT                   /db_xref="InterPro:IPR023081"
FT                   /db_xref="UniProtKB/TrEMBL:B8D057"
FT                   /protein_id="ACL68811.1"
FT                   /translation="MTNFITSKGFKVLLVIFLIFMAIKFYNNYRAISRLEKQVSNLHQE
FT                   IKIARARNTRLKEQLKNVDDPSYIEKIARKELGLVKPGELLLIPIEEE"
FT   gene            56965..59133
FT                   /locus_tag="Hore_00510"
FT   CDS_pept        56965..59133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_00510"
FT                   /product="RNA binding S1 domain protein"
FT                   /note="PFAM: S1 RNA binding domain; TIGRFAM: competence
FT                   protein ComEA helix-hairpin-helix repeat region"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_00510"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68812"
FT                   /db_xref="GOA:B8D058"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018974"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR023319"
FT                   /db_xref="InterPro:IPR023323"
FT                   /db_xref="InterPro:IPR032639"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="InterPro:IPR041692"
FT                   /db_xref="UniProtKB/TrEMBL:B8D058"
FT                   /protein_id="ACL68812.1"
FT                   /translation="MNQRIIGQISKELKLKTNQVKGTVKLLDEGNTVPFIARYRKEVTG
FT                   GLDEAQIRTIEERLEYLRSLQKRKEEVIRLIEEQGKLTPELEEKIKKASILQEVEDLYR
FT                   PYKQKRRTRATRAKEKGLEPLAKLMWTQELTSGNPEDIGKEYINPEVELESIEDVYQGA
FT                   RDIIAEWVSDDAGIRKEIRKITFKQGVIQSTCKDSETDDEGKYEMYYDYREPVSKIPPH
FT                   RVLAINRGEKDEVLQVKVLAPEEDIIELIKDRVVNNPESIFYNDIIEAIKDGYKRLIAP
FT                   SIEREVRNSLTEKAEEHAINIFSKNLRNLLLQPPLRGHTVMGIDPAYRTGCKVCVVDPT
FT                   GRLLDTATIYPHPPQSRTGEAKKVVKGLINEYQVTTIAIGNGTASRETEFMVADIIKEL
FT                   KNTQVNYVIVNEAGASVYSASKLARKEFPELDVAMRGAISIARRLQDPLAELVKIDPKS
FT                   IGVGLYQHDVNQKNLEKSLGNVVESAVNYVGVDLNTASPSLLKYVAGINSRVASNIVKY
FT                   REENGKFETRDELLKVKGLGKKTFTQAAGFLRIPDGTNPLDNTPIHPESYQAAKGLLQD
FT                   VGFKLLDITDKEKLKEVREELDSINIKSRAEKLETGIPTLKDIVDALKKPGRDPRDELP
FT                   KPIFRSDVLKMEDLEAGMLLQGTVRNVVDFGAFVDIGVKVDGLVHISEMSHDYVDDPLK
FT                   VVQVGDTVKVKILEVDERRNRISLSMKL"
FT   gene            59206..59580
FT                   /locus_tag="Hore_00520"
FT   CDS_pept        59206..59580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_00520"
FT                   /product="RNA binding S1 domain protein"
FT                   /note="PFAM: S1 RNA binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_00520"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68813"
FT                   /db_xref="GOA:B8D059"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:B8D059"
FT                   /protein_id="ACL68813.1"
FT                   /translation="MSIDVGSTVEGKVTGITKFGAFVELPGGDTGLIHISEIANTYVKD
FT                   VGNYLKKNDTVKVKVINIDKDGKIGLSIKRLDNPSDRVDSAPNMSFEEKMAKFLKESNE
FT                   KLQDLKNQKAKRGGRYKKTR"
FT   gene            59688..60227
FT                   /locus_tag="Hore_00530"
FT   CDS_pept        59688..60227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_00530"
FT                   /product="uncharacterized conserved protein"
FT                   /note="PFAM: Protein of unknown function (DUF501)"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_00530"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68814"
FT                   /db_xref="InterPro:IPR007511"
FT                   /db_xref="UniProtKB/TrEMBL:B8D060"
FT                   /protein_id="ACL68814.1"
FT                   /translation="MKVSKSELEIIRKQLGREPDNLGGIPLKCPFEKPAVLLTLPYSSD
FT                   KGIFPTTFWLSCPYLVKEVSRLEEKGLVKELTEKINKNPALKEELERAHKIYAQKRRSL
FT                   LGEDEVAELRRGSPDILKVLLESGVGGIRNKEGIKCLHTHLADYLVNGVNPVGRLVWEK
FT                   LDWPERCNLCRMEAGE"
FT   gene            60224..61141
FT                   /locus_tag="Hore_00540"
FT   CDS_pept        60224..61141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_00540"
FT                   /product="Exopolyphosphatase"
FT                   /EC_number="3.6.1.11"
FT                   /note="PFAM: Ppx/GppA phosphatase family"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_00540"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68815"
FT                   /db_xref="GOA:B8D061"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="UniProtKB/TrEMBL:B8D061"
FT                   /protein_id="ACL68815.1"
FT                   /translation="MMKVGAIDVGTNSCRMLAVEQYGDKLEEICFDLKTTRLGQGVDEK
FT                   RLLNYDAVRRTLYAIEFFVNKMEGLGVERIRIVGTSALRDVRNSNILLDVVKRRTGYEL
FT                   EVISGVEEARLTYTGASFDINGNDFLIIDIGGGSTEFIWQQPSGLSFKSLDMGAVRMTE
FT                   RYIKTPDKPVDSQDLARIKEVINRMLKGKLKLNPAGINVIGVGGTITTLAAIDLKMKKY
FT                   DRDKVHGYKITRDKIEEILLRLAGKTLEERRKIVGLQPERADIIVAGTIIALAIIDYLA
FT                   LDHITVSEHDILYGLIKEMLDLSH"
FT   gene            61173..61261
FT                   /locus_tag="Hore_R0017"
FT   tRNA            61173..61261
FT                   /locus_tag="Hore_R0017"
FT                   /product="tRNA-Leu"
FT   gene            61533..63905
FT                   /locus_tag="Hore_00550"
FT   CDS_pept        61533..63905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_00550"
FT                   /product="Serine/threonine specific protein phosphatase
FT                   spoIIE"
FT                   /EC_number="3.1.3.16"
FT                   /note="PFAM: Stage II sporulation protein E (SpoIIE);
FT                   TIGRFAM: stage II sporulation protein E"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_00550"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68816"
FT                   /db_xref="GOA:B8D062"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:B8D062"
FT                   /protein_id="ACL68816.1"
FT                   /translation="MFGQVESVKNYSFLKDNIKTKSKLSYFFYYLIIGVLGFILGRAEV
FT                   FSGYYPFSLIYWMGFALESPLVMIYITVVSGAGLAWNGDYLNLIYLLAGFSGVILSSFF
FT                   KKGKDSIFFPVATGLCYLALSIVRGIIYQKPLYWFVITGIEALGIILVFLLLKGTRIHI
FT                   FDKQGFVKASPVVLLITSLGFLVGIANIDFVPFFVLHTFIYLFVSGVAYISGFSYAVTV
FT                   SVLYGLILSGLGLIPFVVMLRILIIGVITGLFKRKPKYMFIVGYFLTFLVYSGFSPGLY
FT                   DLKEAGYGFGIALALYLVISESLWVQLLSGLKPSPSRVKKLKTDNELNKIFKQHLLELS
FT                   RVFKELSVTFKEVLPDEEEEENLEDLAFILKNKVCQRCPRLKICWKKERADTYMKLSRL
FT                   VEKARKAGKIEKPMFNNLFKDKCPFINKIIGGVKSSYEIYQVNKFWRERLDDKQRIVSE
FT                   QLAGLSEIIQQFSQSSGIVLRDNPTLSHIYERAVNRGIDVYNLEVDTNIYSSRLNIVAE
FT                   MEPCSDTRPCEEQLLPLISSEYQYNFRVINKKCGNKLKDIPCKLLYAPRGSYSLEYAVL
FT                   QKASTGKISGDTYLFRPLRDGKDLIVLSDGMGVGKKAYQESKAAVNLLEKIIEAGFDRD
FT                   LAIRTINSALYFRSQEESFTTLDIGFFDTFTGELIFNKIGAVSSFVKRGFEVLQIKASS
FT                   LPVGILEKVEISTHSVNLKENDFVIMVTDGVLDSSPDIQDKEGWFMRILQNCSFDNPRE
FT                   LASYLMEVVTGAQGGVDDDLTIIVFKVNKFLEKKQEI"
FT   gene            63977..65383
FT                   /locus_tag="Hore_00560"
FT   CDS_pept        63977..65383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_00560"
FT                   /product="tRNA(Ile)-lysidine synthetase"
FT                   /note="PFAM: PP-loop family; TIGRFAM: tRNA(Ile)-lysidine
FT                   synthetase, N-terminal domain; tRNA(Ile)-lysidine
FT                   synthetase, C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_00560"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68817"
FT                   /db_xref="GOA:B8D063"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR012796"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:B8D063"
FT                   /protein_id="ACL68817.1"
FT                   /translation="MELLKKFREYINHHKLIKKGDGVLVGVSGGPDSLTLLDMLVRVKD
FT                   EYGLKLVVFHLDHKFRQEAAREARYVSNITNNYGLKCIIEEFDVPGLMNDEGLSPEEAA
FT                   RKVRFNLMIKWVNSLNLNKIAVAHNKDDLVETVFLHMFRGTGLKGLTGIDPVSRIGGVE
FT                   VIHPLLNIYRQEIMDYCQRRNLNPVYDPTNQETIYTRNKIRHHIIPYIEDEINPGLKDV
FT                   IYQMAEVVREENNFLDYQAEKNLKKVLVDKGQDYVILSLEKLFKLPLVIRRRITSLVNS
FT                   KLKGEDNNLYRKHYEMVENLIKSKVTGKRFDLPDGVVVEKSYDKIIFRKNKKINEYCIN
FT                   FNIPAEIDLPRGIILKVSEEKLPSNWRQLVQNPGICLCDLEKIELPLIVRPRKPGDRFI
FT                   PLGMKGYKKVKNFFIDEKIPRYQRENIPVILDNKGRIIWLAGLRMDDRFKITDDTKKIV
FT                   RFEITNNKEE"
FT   gene            65387..65947
FT                   /locus_tag="Hore_00570"
FT   CDS_pept        65387..65947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_00570"
FT                   /product="hypoxanthine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.8"
FT                   /note="PFAM: Phosphoribosyl transferase domain; TIGRFAM:
FT                   hypoxanthine phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_00570"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68818"
FT                   /db_xref="GOA:B8D064"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005904"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:B8D064"
FT                   /protein_id="ACL68818.1"
FT                   /translation="MPSTNIMMKDIKEIIIPEEVIQNRIKELGEEISNSYDPEDEVIMV
FT                   CILRGAVIFAADLARHINLPVTIDFMDVSSYGQGTSSSGVVRIIKDLEENIENKHVLIV
FT                   EDIIDTGLTLKHVVDMLKTREPASIKIVTLLDKPERRVEKQVEVDFNGFEVPDKFVVGY
FT                   GLDYAEKYRNLPFIGVLKEELYS"
FT   gene            66050..67942
FT                   /locus_tag="Hore_00580"
FT   CDS_pept        66050..67942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_00580"
FT                   /product="ATP-dependent metalloprotease FtsH"
FT                   /EC_number="3.6.4.3"
FT                   /note="PFAM: ATPase family associated with various cellular
FT                   activities (AAA); Peptidase family M41; FtsH Extracellular;
FT                   TIGRFAM: ATP-dependent metalloprotease FtsH"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_00580"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68819"
FT                   /db_xref="GOA:B8D065"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8D065"
FT                   /protein_id="ACL68819.1"
FT                   /translation="MNNFMKNIGFYLVLIALSILVAQFFVDTDVNTIVDTDVNTIKDFT
FT                   YSDLINYVEQGKINEVTIIGNEAVKGTYNHREFNVPIPPEAVPDLMAELREADVEIKTE
FT                   PEPTAPWWTGMLAYILPIILLIGAWFFIMQRMQGGGSQMMSFGKSRARLSENGKKVTFE
FT                   DVANYEEVKEELQEVVEFLKNPDKFTRMGAKVPKGVLLVGPPGTGKTLLARAVAGEAGV
FT                   PFFIISGSDFVEMFVGVGASRVRDLFEQGKKNAPCIIFIDELDAVGRQRGAGLGGGHDE
FT                   REQTLNQLLVEMDGFEPNEGIIVMAATNRPDVLDPALLRPGRFDRQVVVDKPDVKGRMG
FT                   ILKIHLRNKPVADDVDVEVLAKRTPGFTGADMENLANEAAILAVRRRKNKITMEDFDDA
FT                   IDKVIAGPAKKSKVMSERERKLVAYHETGHALVGDLLEHADRTHKISIVPRGRAGGMRW
FT                   ALPKEDKNFMSKQELLDQITVLLGGRASESIFLEDISTGAQNDLERATKLARAMVTEYG
FT                   MSEKLGPLTLGHKHDEQIFLGRDISRQRNYSEEIAAEIDKEVSSIIEYCYQRAEKILQE
FT                   NTAKVERIVRELLDRETLDAEQLQKLIKGEPLDDDSIDNSTDENENREHENNDK"
FT   gene            68192..69574
FT                   /locus_tag="Hore_00590"
FT   CDS_pept        68192..69574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_00590"
FT                   /product="Sodium:solute symporter"
FT                   /note="PFAM: Sodium:solute symporter family; TIGRFAM: SSS
FT                   sodium solute transporter superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_00590"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68820"
FT                   /db_xref="GOA:B8D066"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:B8D066"
FT                   /protein_id="ACL68820.1"
FT                   /translation="MVLTTVIVYMLLLLAIGYWANRKIKGLTDYLLAGRRLGLWLTAGA
FT                   LAATHFGGGMVVGGGEYGFIHGFSGAWYGISCGIGLLFLSFLTAGKFRDLSLYTVPDYL
FT                   AHRYGGKTVRVLGAILSVVAIIGIIAAQVLAAKSALAILGIKGNAGAIIATLIFIIYTV
FT                   LGGLWAATITDFIQVIIAGVGTVIAASMVLSNTGGLSGLKESLSTVSPGVDYFNLFGFG
FT                   WTTILWILLPTVMYTLIGQDFYQRLFASKDGITARKASFIGGIFLIIISFFPVITGMGA
FT                   RMYFPEMTDASMALPRLVQELFPLGLGAVFLAALLAAIMSTADSLLTAGTSHLIKDFWF
FT                   EVFNRGQDRDKGQILTISRVTTGVLGLLALIIALLVPTVIDALIYSYTMYTAGVFIPLI
FT                   GGVLWRGATRKGAISAIFAGSLVAITGILTGFEAWGIPVEVYSAVISLVFFVVISLADK
FT                   KD"
FT   gene            69708..71372
FT                   /locus_tag="Hore_00600"
FT   CDS_pept        69708..71372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_00600"
FT                   /product="Formate--tetrahydrofolate ligase"
FT                   /EC_number="6.3.4.3"
FT                   /note="PFAM: Formate--tetrahydrofolate ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_00600"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68821"
FT                   /db_xref="GOA:B8D067"
FT                   /db_xref="InterPro:IPR000559"
FT                   /db_xref="InterPro:IPR020628"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8D067"
FT                   /protein_id="ACL68821.1"
FT                   /translation="MKSDIEIAQDARMEPIEEIAEKAGLHKDQIELYGKYKAKVNTDII
FT                   DDDKKDGKLVLVTAITPTPAGEGKTTTTVGLGQALNLLGKKAIIALREPSLGPTMGIKG
FT                   GAAGGGYSQVLPMEDINLHFTGDIHAIGAAHNLLSAVIDNHIKQGNDLGIDPTSVTWKR
FT                   VVDMNDRALRNIVVGLGGKAHGVPREDGFMITVASEIMAILCLANNLEDLKNKISNIVV
FT                   GYTYDGEAITAGDLKVSGAMTALLKDAIKPNLVQTLENTPAFIHGGPFANIAHGCNSIM
FT                   ATKMALKLGEITVTEAGFGADLGAEKFFNIKCRYAGLNPDAAVVVATVRALKMHGGVDK
FT                   DSLSEENLDALARGFENLEKHLENVSKFGVPSVVAINRFPGDTEAELNLVRDKCEEMGV
FT                   PVAISEVWARGGEGGLDLARKLVDVLENTPGQFSYLYDVNFPITDKIEKIAKEIYGADG
FT                   VNYTSKALKQIDKYTELGYDKLPICMAKTQSSISDDPSLKGRPRGFRINVREVNLSAGA
FT                   GFIIPLTGPVLTMPGLPKKPAAEGIDIDADGKISGLF"
FT   gene            71776..72297
FT                   /locus_tag="Hore_00610"
FT   CDS_pept        71776..72297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_00610"
FT                   /product="signal transduction histidine kinase, LytS"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_00610"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68822"
FT                   /db_xref="GOA:B8D068"
FT                   /db_xref="InterPro:IPR009825"
FT                   /db_xref="InterPro:IPR030949"
FT                   /db_xref="UniProtKB/TrEMBL:B8D068"
FT                   /protein_id="ACL68822.1"
FT                   /translation="MISTRKIVYLAFLTAISIVLTRFLSIRLPMAGVESIRIGFGGLPI
FT                   ILAGVAFGPLAGGLVGFISDLVGYFINPMGAYMPHFTLTSALTGIIPGLVVFYLFRQKR
FT                   TFWTLLVAIGIGQGITSVVLVPYFLQSLFLVPIKATIIPRMIGQLIHIPLYTYLSMVLI
FT                   NNKAINLTKD"
FT   gene            72532..73437
FT                   /locus_tag="Hore_00620"
FT   CDS_pept        72532..73437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_00620"
FT                   /product="quinolinate synthetase complex, A subunit"
FT                   /EC_number="2.1.1.63"
FT                   /note="PFAM: Quinolinate synthetase A protein; TIGRFAM:
FT                   quinolinate synthetase complex, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_00620"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68823"
FT                   /db_xref="GOA:B8D069"
FT                   /db_xref="InterPro:IPR003473"
FT                   /db_xref="InterPro:IPR023066"
FT                   /db_xref="InterPro:IPR036094"
FT                   /db_xref="UniProtKB/TrEMBL:B8D069"
FT                   /protein_id="ACL68823.1"
FT                   /translation="MGKEVIERIKELKKERNAVILAHNYQIGEVQDVADFVGDSFGLSR
FT                   KAAETDADVIVFCGVKFMAESAKILSPEKTVLLPEKEAGCPLASMVDVDGLKEMKKKYP
FT                   GATVVTYVNSTAAVKAESDICCTSSNALKVVESVPGNQVLFVPDKNLGQYVARRTSKEV
FT                   IIWDGYCTTHHRVDPEEVKEVKAAHPDAPIVVHPECPPEVVELADHVDSTAGILKYCRE
FT                   SEADTIIVGTEQGLIHRLNKENPDKKFFVLSPKLICPNMKKTNLDKVLKSLEKMETRVE
FT                   IPENIRTRAYNALKKMLEVK"
FT   gene            73468..75066
FT                   /locus_tag="Hore_00630"
FT   CDS_pept        73468..75066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_00630"
FT                   /product="L-aspartate oxidase"
FT                   /EC_number="1.4.3.16"
FT                   /note="PFAM: Fumarate reductase/succinate dehydrogenase
FT                   flavoprotein C-terminal domain; Pyridine
FT                   nucleotide-disulphide oxidoreductase; FAD binding domain;
FT                   FAD dependent oxidoreductase; TIGRFAM: L-aspartate oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_00630"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68824"
FT                   /db_xref="GOA:B8D070"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR005288"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:B8D070"
FT                   /protein_id="ACL68824.1"
FT                   /translation="MGDIKYKTTDFVIIGTGIAGLYTALKLASLGEVSVLTKEKLEDSN
FT                   TQYAQGGIAAVIDRGDSWKLHMEDTLKAGAGICDEKAVEVLVTEGPDRVRELIKMGTRF
FT                   DHIEGELDLTREGAHSKRRILHARGDATGEEIRESLTRAITKSKNISLKEENFMIDLVK
FT                   LNRGNHVDGVLVWDNNQKKYIVYLARAVILASGGCGQVYHNTSNPEVTTGDGVAAAYRA
FT                   GAIIMDMEFIQFHPTVFYNKHGSSFLISESLRGEGAVLRNSEGKRFMDKYHDLAELAPR
FT                   DVVARAILQEMERDNKPHVWLDITHKDADFVKNRFPTIFRTLKEHGIDITRDWVPVVPA
FT                   AHYMMGGVRTDTYGRTNLIGLYAVGEVACTGVHGANRLASNSLLEGLVFGNRIYRALKM
FT                   EADVLPLPEENLKVPQLLPYGKVMVIKQIKEELKKKMSHQVGIIRSEKTLKDMIKWIEE
FT                   TEVKLNKFKYSNVELWELKNMLSVAGIISRSALLRKESRGGHFREDYPEIKPGWGNKHV
FT                   LVDKLSPEGRIHEVK"
FT   gene            75053..75895
FT                   /locus_tag="Hore_00640"
FT   CDS_pept        75053..75895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_00640"
FT                   /product="nicotinate-nucleotide pyrophosphorylase"
FT                   /EC_number="2.4.2.19"
FT                   /note="PFAM: Quinolinate phosphoribosyl transferase,
FT                   N-terminal domain; Quinolinate phosphoribosyl transferase,
FT                   C-terminal domain; TIGRFAM: nicotinate-nucleotide
FT                   pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_00640"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68825"
FT                   /db_xref="GOA:B8D071"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR004393"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022412"
FT                   /db_xref="InterPro:IPR027277"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR037128"
FT                   /db_xref="UniProtKB/TrEMBL:B8D071"
FT                   /protein_id="ACL68825.1"
FT                   /translation="MKLNNIYLEKVIIEALEEDIGFGDLTTDYLIPSTHRSSGKIIVKE
FT                   DGVVAGVGVARSVFEAVNSKIEFKAMVRDGDQVRAGDVIIKITGPTAGILKGERTALNF
FT                   MQRLSGIATKTCRLVTKVKDFPVRVVDTRKTTPTLRQLEKYAVRVGGGYNHRFGLYDAV
FT                   MVKDNHIKAAGGIKKAVTTLRRNIPHTTKIEVEVTTLTEVEEALEAGADIIMLDNMDIE
FT                   TMAEAVKQIEGKALVEASGGIDENTIIEVARTGVDVISVGALTHQIESLDISLNLDSD"
FT   gene            complement(76101..77303)
FT                   /locus_tag="Hore_00650"
FT   CDS_pept        complement(76101..77303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_00650"
FT                   /product="2-alkenal reductase"
FT                   /EC_number="1.3.1.74"
FT                   /note="PFAM: PDZ domain (Also known as DHR or GLGF);
FT                   Trypsin"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_00650"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68826"
FT                   /db_xref="GOA:B8D072"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:B8D072"
FT                   /protein_id="ACL68826.1"
FT                   /translation="MSRSKRKIMLFAIILAVVFTTGIFVGSHYELTPTKIYADQENGSL
FT                   VENNEENPADQDKIVITDTNIFADIAAKVDAGVVKVTSYTKVQGGQYSDPFFNDPFFRY
FT                   FFGDQLPYPEQQPRLEEGFGTGFIVSKDGYIVTNEHVIHGAEKIEVTIKGFDKPVPAEI
FT                   AWSDFSLDLAVLKVNVDRDLTPIKLGDSDKIRPGDWVIAIGNPFGFEHTVTIGVVSALG
FT                   RPIQIPTQDGQVRTYRNLIQTDAAINPGNSGGPLLNIDGEVIGINTAVSAQGQGIGFAI
FT                   PANEVKEIVNDLKTKGEVIRPWIGIYMNKITPDVKEYFNLDNTEGAIIVGVVENSPAAE
FT                   AGIKPYDIIKEIDRKPVNTPEDVVNIVKNKKVGDKVLLKILRNGDPRLIFVEIGKRPNQ
FT                   F"
FT   gene            77808..78788
FT                   /locus_tag="Hore_00660"
FT   CDS_pept        77808..78788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_00660"
FT                   /product="biotin (acetyl-CoA carboxylase) synthetase"
FT                   /EC_number="6.3.4.15"
FT                   /note="PFAM: Biotin protein ligase C terminal domain; HTH
FT                   domain; Biotin/lipoate A/B protein ligase family; TIGRFAM:
FT                   BirA biotin operon repressor domain; birA,
FT                   biotin-[acetyl-CoA-carboxylase] ligase region"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_00660"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68827"
FT                   /db_xref="GOA:B8D073"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR030855"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B8D073"
FT                   /protein_id="ACL68827.1"
FT                   /translation="MELNKKEIELVKILHNNNGKFISGENISDTLGVSRTAVWKYIKNL
FT                   RKKGYIIESVPRRGYHLVEVPDKITVTEVLAGLKTNLIGKEVRVFSSIDSTNNKARELA
FT                   KGGASGGTIVIAEEQTGGKGRLGRKWYSPPYTGLWFSVIVRPHLPSNRAPFLTIITSLV
FT                   VKKAINKLGIEVLIKWPNDILIRGKKVCGILSEIMATPDVINTAIIGIGINVNQDSFPS
FT                   KIPLATSLKQVCGHNVNRIELLQDILMEFENYYNRLKDGCYRDLVTEWKNSMDILGKEV
FT                   DIVAGNEIISGKVVSISRRGELVLIDPDGNKHLFWAGDVTLRQKD"
FT   gene            78930..79937
FT                   /locus_tag="Hore_00670"
FT   CDS_pept        78930..79937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_00670"
FT                   /product="basic membrane lipoprotein"
FT                   /note="PFAM: Basic membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_00670"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68828"
FT                   /db_xref="GOA:B8D074"
FT                   /db_xref="InterPro:IPR003760"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B8D074"
FT                   /protein_id="ACL68828.1"
FT                   /translation="MKRSNLILTILIVAIIIAGAVYYLNQGEEEQAVKDTFKVGMVTDV
FT                   GGLGDQSFNDAAYRGLKRAEEELGIEIEVVESNAMTDYVPNLSSLAEQDYDMVWAIGFL
FT                   MMDALNQVAEMYPDTTFGLVDAVVDKPNVASVTFKEEEGSFLVGLIAGKMTETGKVGYV
FT                   GGMEMPLIQKFQAGYEAGVKAANPDAEIMIGYTGAFDDPAAGKELALTQFGQGADIIYH
FT                   ASGACGIGVIEAAEEKGLYAIGVDSPQAHLAPENVLTSMVKRVDVAVYNEVKSLYEGNF
FT                   EPGHKIYGLAENGVGPSEHANEMVPEDVMELVEEYKEKIINGEYTVPTKPEDVE"
FT   gene            80027..80800
FT                   /locus_tag="Hore_00680"
FT   CDS_pept        80027..80800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_00680"
FT                   /product="pantothenate kinase"
FT                   /EC_number="2.7.1.33"
FT                   /note="PFAM: Bordetella pertussis Bvg accessory factor
FT                   family; TIGRFAM: transcriptional activator, putative, Baf
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_00680"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68829"
FT                   /db_xref="GOA:B8D075"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8D075"
FT                   /protein_id="ACL68829.1"
FT                   /translation="MILAIDVGNTNTVMGIYKKDKLIQHWRISTDKNKTPDEYGILFLN
FT                   LFNSANVNYKRIDGIILSSVVPPLVRILKKMTTRYFNLEPLVVGPGIRTGINLKMDNPR
FT                   EVGADQVVNAVAAYHKYGGPLIIVDFGTATTFCAVSERGEYLGGAIAPGIGISAEALYS
FT                   YAAKLPRVEFKTPGQAIGKNTVAGMQSGIIYGFVGLVEALVKRFKDELKETPEVIATGG
FT                   LVSLIASETDEIDKVDPFLTLDGLYYIAKINGIVE"
FT   gene            80808..81809
FT                   /locus_tag="Hore_00690"
FT   CDS_pept        80808..81809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_00690"
FT                   /product="putative TIM-barrel protein, nifR3 family"
FT                   /note="PFAM: Dihydrouridine synthase (Dus); Dihydroorotate
FT                   dehydrogenase; TIGRFAM: putative TIM-barrel protein, nifR3
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_00690"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68830"
FT                   /db_xref="GOA:B8D076"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR024036"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:B8D076"
FT                   /protein_id="ACL68830.1"
FT                   /translation="MKIGNLIVENPIILAPMAGVTDYPFRQISREMNCQLIYTEMVSSK
FT                   GLIYGNRKTRDLMDFDRGKKGLIGIQIFGGDPETMARAAVQIKNHYRPDLIDINMGCPT
FT                   PKIVKNGSGAALMKVPERAKRVMEAVASAVDIPVTVKIRMGWDHSHVNAVDIAKIAEEV
FT                   GLKAVAIHGRTREDFYRGEANWDIIREVKREVTIPVIGNGDVFTPEDAKKMMEETGCDG
FT                   VMVARGVRGNPWLLKRAYYLVKKGEHLPGPTWEERINMAIKHLDMAVAYYGEKVAIPRM
FT                   RKHIGWYLKGLPGNSDIKDRVNKMNCYQGVKEVLIKYRTELGQKEKNNTFIP"
FT   gene            complement(81799..83241)
FT                   /locus_tag="Hore_00700"
FT   CDS_pept        complement(81799..83241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_00700"
FT                   /product="UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--lysine
FT                   ligase"
FT                   /EC_number="6.3.2.7"
FT                   /note="PFAM: Mur ligase middle domain; Mur ligase family,
FT                   catalytic domain; TIGRFAM: UDP-N-acetylmuramyl-tripeptide
FT                   synthetases"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_00700"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68831"
FT                   /db_xref="GOA:B8D077"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005761"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:B8D077"
FT                   /protein_id="ACL68831.1"
FT                   /translation="MVMERKEDLPAFTDITCDSREVKPGYAFVAITGFKNDGHNFIEEA
FT                   INKGASVIFTEKEIKSRSGIPIVRVKDSRSILGKLAAEFYNYPSRKLKLIGVTGTNGKT
FT                   TTTHLIYHLLNYKGKNSGLIGTVKVDTGKRTIPGNLTTPEPVTLQKYLDEMVKHNLNYA
FT                   CMEVSSHGIKLKRITGSQFAIKVGTNITVDHFDLHSDFSDYVQVKKSFLEDKNPHTLVL
FT                   LNNDDHYLSSFGNIAKNQIGYGITTNTDITAENINYSGITTDFVYSLNKSIKTSQGNKI
FT                   GPMKVPINLKIPGEHNIYNALVAITIGLYYGLTPEKIQDFFGQFRGIWRRFQVIYNKDF
FT                   AIIDDCAHNPGSYGAVFKTVSQLKYKNLLIVNAIRGNRGAQINKGNAETIGKWLKKFHN
FT                   YYLLTTNCNDVVKPIDKVSPEEEKVFLQALDKNNIKYSHLDQLKPALKNVLDKVTPDDI
FT                   ILLLGAHAMDEAGDMILEMIKE"
FT   gene            83509..84039
FT                   /locus_tag="Hore_00710"
FT   CDS_pept        83509..84039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_00710"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_00710"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68832"
FT                   /db_xref="UniProtKB/TrEMBL:B8D078"
FT                   /protein_id="ACL68832.1"
FT                   /translation="MDFFRVGDKVIYKKKIERTITKILKMREKGLSQSKVAGEINVERS
FT                   FISRLESIGEVRKGEKIALIGFPIANKQEITEIAKKNGVEFILLLTEEERWDFIKNKSS
FT                   LEIFNLLMEILTRLKEFDLLIFLGSDMRLDLVDKLMDGKIVGIELGNSPLKENIYVDPD
FT                   RIEEIIKNFSIDD"
FT   gene            84121..85038
FT                   /locus_tag="Hore_00720"
FT   CDS_pept        84121..85038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_00720"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_00720"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68833"
FT                   /db_xref="UniProtKB/TrEMBL:B8D079"
FT                   /protein_id="ACL68833.1"
FT                   /translation="MKKVLSISLGSSKRDHRVETDILGEKFIIERKGTDGDKKKAARLF
FT                   AEYDGKYDAFGMGGIDLYIYSGKNRYAFRDARKLIKDVKKTPTVDGSGLKNSLERKVVR
FT                   YLYNEMGLDFEGKNVLMVSAMDRFGMAETFNELGANIVFGDLIFCLGVPVSIKSLKTLD
FT                   ILARVVAPVVTMLPFELVYPTGDKQNSGVNKKKYWKYYNRADIIAGDFHYIKRYMPERL
FT                   DNKIIITNTVTRENIEELKRKGVAMLVTTTPNLNGRSFGTNVMEGVLVALSGKQPDEMT
FT                   TSDYLELLDKIGFKPTVFNFKEDQ"
FT   gene            85052..86140
FT                   /locus_tag="Hore_00730"
FT   CDS_pept        85052..86140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_00730"
FT                   /product="Shikimate/quinate 5-dehydrogenase"
FT                   /note="PFAM: Tetrahydrofolate dehydrogenase/cyclohydrolase,
FT                   NAD(P)-binding domain; Polysaccharide biosynthesis protein;
FT                   Shikimate / quinate 5-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_00730"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68834"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8D080"
FT                   /protein_id="ACL68834.1"
FT                   /translation="MNKFAFIIHPLELDDVARKFSWASKVPDYIVEKFVRTLPAIKASH
FT                   ITGIRSKTGKEVEGYFVVCPLTSEQMLKLPADKVIKKIIKAGKKAEKLGAQIIGLGAFT
FT                   SVVGDKGITVAKALDVPVTTGNSYTVATAIEGTKLAARKMGHDIKKARVTVVGATGSIG
FT                   RAVSLILGEDIKHLSLVARDEKKLSALQEEVLEVNPELDVSYSTDVSEAVRESQIVISA
FT                   SGAVKALIDADDLQPGTVVCDVARPRDVAERVGRERDDVLVIEGGIVEVPGPVNFNFNF
FT                   GYPPKTSYACMAETMILTLEERFENYSLGPVLELKKVKESLKLAKKHGFKLAGLRSFER
FT                   PLSEKQIALIRENAEEKMSAVF"
FT   gene            86296..86781
FT                   /locus_tag="Hore_00740"
FT   CDS_pept        86296..86781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_00740"
FT                   /product="transcription elongation factor GreA"
FT                   /note="PFAM: Prokaryotic transcription elongation factor,
FT                   GreA/GreB, N-terminal domain; Prokaryotic transcription
FT                   elongation factor, GreA/GreB, C-terminal domain; TIGRFAM:
FT                   transcription elongation factor GreA"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_00740"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68835"
FT                   /db_xref="GOA:B8D081"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR006359"
FT                   /db_xref="InterPro:IPR018151"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028624"
FT                   /db_xref="InterPro:IPR036805"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:B8D081"
FT                   /protein_id="ACL68835.1"
FT                   /translation="MANEVLLTQEGYEKLEKELDYLVNVKRRQVAKRIKVAREFGDIGE
FT                   NSEYDDAKNEQAFIEGRIKEIENMLRNARIIKDEEVTGDTVNLGTTVKLKDRSTDEVFS
FT                   YTIVGSAEADPLNFKISNESPIGKAIIGHKIGDVVKVEVPSGIMEYEILAIEKTKKT"
FT   gene            86800..88275
FT                   /locus_tag="Hore_00750"
FT   CDS_pept        86800..88275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_00750"
FT                   /product="Lysyl-tRNA synthetase"
FT                   /EC_number="6.1.1.6"
FT                   /note="PFAM: OB-fold nucleic acid binding domain; tRNA
FT                   synthetases class II (D, K and N); TIGRFAM: lysyl-tRNA
FT                   synthetase-related protein GenX; lysyl-tRNA synthetase,
FT                   eukaryotic and non-spirochete bacterial"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_00750"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68836"
FT                   /db_xref="GOA:B8D082"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="InterPro:IPR034762"
FT                   /db_xref="UniProtKB/TrEMBL:B8D082"
FT                   /protein_id="ACL68836.1"
FT                   /translation="MTEGNIEDFNELIAQRLENKKELEKNGIKTYGEKYPVSNHAREIE
FT                   DNFEEFEGKKVSLSGRIMAKRTHGKASFADIQDVTGKIQLYVKVDIVGEKEYELFTGLD
FT                   IGDIIGVTGEVFKTRRGQISVKVHSFRLLTKSLRPLPEKWHGLRDKELRYRQRYLDLIV
FT                   NPEVRKTFITRSKIIREIRKYLEDKGFLEVETPMMHPIAGGANARPFITHHNALDIDLY
FT                   LRIAPELYLKRLIVGGFERVFEINRNFRNEGMSYKHNPEFTMLELYQAQADYHDMMDLT
FT                   EDLIYNVAKKVLGTTKISYQGQEIDLTPPWNRVTMVEAVKEHTGVDFNEIKSDEEARKA
FT                   AEGLGIELEGKPSRGKVLNEIFEEKVEDKLVQPTFIMDYPIEVSPLAKRKDDNPDFTYR
FT                   FEAFINSWEIANAFSELNNPIDQRERFEEQVKQRAQGDDEAQMMDEDYVRALEYGMPPT
FT                   GGLGIGIDRLIMVLTDSPSIRDVILFPTMRPEK"
FT   gene            88378..88776
FT                   /locus_tag="Hore_00760"
FT   CDS_pept        88378..88776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_00760"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: Uncharacterized protein family UPF0047;
FT                   TIGRFAM: conserved hypothetical protein TIGR00149"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_00760"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68837"
FT                   /db_xref="InterPro:IPR001602"
FT                   /db_xref="InterPro:IPR035917"
FT                   /db_xref="UniProtKB/TrEMBL:B8D083"
FT                   /protein_id="ACL68837.1"
FT                   /translation="MFKEFHVKTTGRVQLIDITDKVRDCLNEAGIENGILTVFTPHTTA
FT                   AITINENADPDVKRDIISEINKVIPFDDNYKHLEGNSAAHIKSSLFGVSESIIINNKRM
FT                   RLGRWQGIYFCEFDGPRRRKVYVQIIGK"
FT   gene            88980..90116
FT                   /locus_tag="Hore_00770"
FT   CDS_pept        88980..90116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_00770"
FT                   /product="ROK family protein"
FT                   /note="PFAM: ROK family"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_00770"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68838"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B8D084"
FT                   /protein_id="ACL68838.1"
FT                   /translation="MQRGNMKLMKKINRALIIQTLSQQGPLSRADLTKITDLSPTTISS
FT                   ITEELIQEGLIVEVGEGESKGGRRPILLDINPEDFYILSVNIAVDVMYVYLFNLKFQVI
FT                   NSVHDLIKKPVSPNLDSQLKELVQKVVENSNIGKKNVVGMGIGATGIINKEKGLITYSA
FT                   SLGISDYPLLDKVKREYDFPILLENDTNLAALGEKKFGCGRQLTNFFYIMIGSAIGGGI
FT                   IIDNEIYRGKFGGAGEFGHITVEKDGPLCECGNQGCLNAVLTPYITVRSREEFRKSFQE
FT                   IIKDDNFDSCRYHEFCEYLAMAITNYTKLFDPEAIVLGGEIARIAPERFYIDLEKYIKR
FT                   MSLKGMNSKIPVLPSSIRTNAVVLGGACLCFDNLYNNV"
FT   gene            90301..91536
FT                   /locus_tag="Hore_00780"
FT   CDS_pept        90301..91536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_00780"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: Bacterial extracellular solute-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_00780"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68839"
FT                   /db_xref="GOA:B8D085"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006060"
FT                   /db_xref="UniProtKB/TrEMBL:B8D085"
FT                   /protein_id="ACL68839.1"
FT                   /translation="MSKRIISILTVGLLLVAMLTGTVMAGKVKLRFLQPGGNLYKQSVE
FT                   FAKEYMKLHPNVEIEVIEVGWSDAYSKIMTMVAAGNAPDIMYIGTRWIPALAQMNAIQP
FT                   LDKFISEEKKDLYFDSLLKGTYYQGKLYALPRSFSTKALIYRTDLIPEPPETWDELVEV
FT                   AKRVQKEHEGIYGFGIAGAKHVSTTTQFFNYVYQNGGSIFDSEGNILLDSPQSVKALQF
FT                   YVDLYRKHKVVPNPIEYNREELPNLFKTGKIAMFVCGPWAKPMIGLDPDNEKVPYASAP
FT                   LPRGRYMATTLVSDSLVLSSQSEHIDEAWKYLNWITSLENQKKHDLINGMAPAMEKELE
FT                   DPAFTEDPFFKTYVDMIPKGQPQPLPLAWEPFQDVITGAIQKALLGMATPEEALKEAVT
FT                   RIEAENLAPVKH"
FT   gene            91772..92560
FT                   /locus_tag="Hore_00790"
FT   CDS_pept        91772..92560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_00790"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: Binding-protein-dependent transport system
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_00790"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68840"
FT                   /db_xref="GOA:B8D086"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B8D086"
FT                   /protein_id="ACL68840.1"
FT                   /translation="MSFRNSFFHEILIRPWEGTKFVAFSNYFKLLSSGDFWSSFSRTIG
FT                   WTVSSVIGKTVIGLIIALLLNKKFRGRGIYRTLILVPWVTPQVIGAIVWKWIYNGEYGM
FT                   LNYVLIKLGFLEQGHSWLGNPDTAFLSCLIDDIWVGIPFMSIVFLAGLQAIPQEMYEAA
FT                   QVDGAGKLKQLFFITLPQLKPVFLTATILSTIWTFNSFNIIWTLTRGGPVNATEILVVK
FT                   TYKTAFQKFNIGLGSTYAVIIFIILMIFSITYWRRFNDEL"
FT   gene            92550..93392
FT                   /locus_tag="Hore_00800"
FT   CDS_pept        92550..93392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_00800"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: Binding-protein-dependent transport system
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_00800"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68841"
FT                   /db_xref="GOA:B8D087"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B8D087"
FT                   /protein_id="ACL68841.1"
FT                   /translation="MNSRVWERVDRVITHFLLILLLGILLFPALIMISTALKTFDGVFT
FT                   WPPTLFPRIIQWSNFSRVLFGKYQFYQYFINSFIVAGVTSLVCILLGLPASYAFSRFRF
FT                   YGKKLFLFAILATQMFSPVILIIPLYKVMKSAGLMDTYFALIIANTAFALPMSIWLLTG
FT                   YLQSIPVSLEEAAMIDGTSRIGALFKIILPLAAPGIITSGIYAFILAWNDLIFALTFIT
FT                   KQGMRPITLALTDFAGKNVIYWNDMMAAAVLSVLPVAFLFSLVQKYLVQGLTAGSVKG"
FT   gene            93505..94767
FT                   /locus_tag="Hore_00810"
FT   CDS_pept        93505..94767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_00810"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: Oxidoreductase family, NAD-binding Rossmann
FT                   fold"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_00810"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68842"
FT                   /db_xref="GOA:B8D088"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8D088"
FT                   /protein_id="ACL68842.1"
FT                   /translation="MVSEPVTVAVLGAGNRGREAYGEYILRHPEEIRVVAVAEPDKDKR
FT                   SLFSKEHNIPEENQFSSWEELLSRERLADGIIIATLDKMHIEPTRKALKRGYDILLEKP
FT                   IAPTLQETISIAREAQKYSNNILVAHVLRYTNFYRGLKEILKKGIIGKIRFVDHIENIG
FT                   FYHFAHSYVRGNWRNTEVAAPIILAKSCHDMDILYWLLEKKCKNLSSHASLEYFTEKNQ
FT                   PEGASDRCLYCGVEEDCPYSARKIYLNENTGWPASVITTDLSYEGRYKALKEGPYGRCV
FT                   FKCDNNVPEVQTVRMLFEDDIEVNFALTAFSNEITRTTNIYGSKGEIRADFENGVIEIY
FT                   EFGRHKSVMTINKDTGGHGGGDTGLMKHFVKVLRGELKTEGLTSLSASIESHIMAFAAE
FT                   KARDRKSVISLDELKNDIINK"
FT   gene            95256..96799
FT                   /locus_tag="Hore_R0018"
FT   rRNA            95256..96799
FT                   /locus_tag="Hore_R0018"
FT                   /product="16S ribosomal RNA"
FT   gene            96876..96952
FT                   /locus_tag="Hore_R0019"
FT   tRNA            96876..96952
FT                   /locus_tag="Hore_R0019"
FT                   /product="tRNA-Ile"
FT   gene            96962..97037
FT                   /locus_tag="Hore_R0020"
FT   tRNA            96962..97037
FT                   /locus_tag="Hore_R0020"
FT                   /product="tRNA-Ala"
FT   gene            97436..100044
FT                   /locus_tag="Hore_R0021"
FT   rRNA            97436..100044
FT                   /locus_tag="Hore_R0021"
FT                   /product="23S ribosomal RNA"
FT   gene            complement(100377..100637)
FT                   /locus_tag="Hore_00820"
FT   CDS_pept        complement(100377..100637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_00820"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_00820"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68843"
FT                   /db_xref="UniProtKB/TrEMBL:B8D089"
FT                   /protein_id="ACL68843.1"
FT                   /translation="MFEKMVTELTSKITIDNLQKIKDDDPQKYDETLKLIITITEVATH
FT                   ILNNSPGFRKAFAEIHKEFLKHPESREVIDAALKAYNDYTS"
FT   gene            100815..101957
FT                   /locus_tag="Hore_00830"
FT   CDS_pept        100815..101957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_00830"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_00830"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68844"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR025275"
FT                   /db_xref="UniProtKB/TrEMBL:B8D090"
FT                   /protein_id="ACL68844.1"
FT                   /translation="MFLKKILITLFLFLFFIVVLPGMIHNFSQARASLLKPRLELEVTK
FT                   NQFNLIEKKFKLPEFYVKGVYISGWVAGMPDRMEKIIEMIENTPLNSVVIDIKDEHGYI
FT                   SYKTRVEKAWKIGAVKLKIKNIKMLLKLLKSKGIYTIGRVVVFKDPVLAKKRPDLALDV
FT                   LDPLRIKKNIYWVDPTSIEVWRYNIEIAKEAARLGFDEIQFDYIRYPVSRFKINLKGPY
FT                   KYKLDKTKPINSFISYAKKELSKLSTPVSIDVFGLTTAVEDDLGIGQNLKYLGSIIDII
FT                   SPMVYPSHYAPGSYGIEDPEMSPYKIVYNSMKDALDKFENNKVVFRPWLQDFSLKKQYS
FT                   HREVMAQIRAVQDLGLKEWLLWNPRCRYTEKAFRPPLQME"
FT   gene            102182..102655
FT                   /locus_tag="Hore_00840"
FT   CDS_pept        102182..102655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_00840"
FT                   /product="transcriptional repressor, CtsR"
FT                   /note="PFAM: Firmicute transcriptional repressor of class
FT                   III stress genes (CtsR)"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_00840"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68845"
FT                   /db_xref="GOA:B8D091"
FT                   /db_xref="InterPro:IPR008463"
FT                   /db_xref="InterPro:IPR040465"
FT                   /db_xref="InterPro:IPR041473"
FT                   /db_xref="InterPro:IPR041902"
FT                   /db_xref="InterPro:IPR041908"
FT                   /db_xref="UniProtKB/TrEMBL:B8D091"
FT                   /protein_id="ACL68845.1"
FT                   /translation="MASLADQIEKYLRKLLTKYEGEVEIKRNQLASDFDCVPSQINYVL
FT                   NTRFTVEKGYLVESQRGGGGYIRIIRVSLDSNRKTLKELISRIDGPITQREAEGIIDRL
FT                   FDNNFITEKERDIMKVAVNRKYINVELPHRDYIRSRLLRGMLKTIIKHEDEEG"
FT   gene            102658..103170
FT                   /locus_tag="Hore_00850"
FT   CDS_pept        102658..103170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_00850"
FT                   /product="UvrB/UvrC protein"
FT                   /note="PFAM: UvrB/uvrC motif"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_00850"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68846"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR025542"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="UniProtKB/TrEMBL:B8D092"
FT                   /protein_id="ACL68846.1"
FT                   /translation="MLCQRCGKREATVHLTKIINGEKNEIFLCKECAQETGQMPFKGED
FT                   PFSFQNLLSGILNPELGLGNEPRVQKLKCDNCGLSYQEFSEKGLFGCSECYQHFGNRLS
FT                   PLIKRIHGSNGHTGKVPKRRGGDLRIKREIEELRKELELEVERENFEKAAELRDKIRDL
FT                   EKKLGGN"
FT   gene            103173..104222
FT                   /locus_tag="Hore_00860"
FT   CDS_pept        103173..104222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_00860"
FT                   /product="Arginine kinase"
FT                   /EC_number="2.7.3.3"
FT                   /note="PFAM: ATP:guanido phosphotransferase, C-terminal
FT                   catalytic domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_00860"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68847"
FT                   /db_xref="GOA:B8D093"
FT                   /db_xref="InterPro:IPR000749"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR022414"
FT                   /db_xref="InterPro:IPR022415"
FT                   /db_xref="InterPro:IPR023660"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8D093"
FT                   /protein_id="ACL68847.1"
FT                   /translation="MSLKDLINKNLSHWVAGQGPERDIVLSSRIRLARNLDTIPYPNRA
FT                   DKDSKEEVTKRVLDATSKQGKIKLHYIKMDDLPEVEREVLVEKHLISPAHAKAGEGKGV
FT                   LLNDNETISIMINEEDHLRLQVLIPGLQLEGAWETASELDDLLEEKLDFAFSQKWGYLS
FT                   ACPTNVGTGLRASVMVHLPALNLTNNINKMLGAISKVGLTVRGIYGEGSEYVGNLYQIS
FT                   NQVTLGHTEKEIIANLKSVTSQIIEQERQARNLLLKEKEIEVRDRVNRSFGILSHAYQI
FT                   SSEEALRMLSNVKLGIDMGIITDVDTGVLSELMVLIRPAHLQKLEGKELTPTERDIKRA
FT                   ELIKTRLNM"
FT   gene            104235..106655
FT                   /locus_tag="Hore_00870"
FT   CDS_pept        104235..106655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_00870"
FT                   /product="ATPase AAA-2 domain protein"
FT                   /note="PFAM: UvrB/uvrC motif; ATPase family associated with
FT                   various cellular activities (AAA); Clp amino terminal
FT                   domain; Clp amino terminal domain; ATPase family associated
FT                   with various cellular activities (AAA)"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_00870"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68848"
FT                   /db_xref="GOA:B8D094"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:B8D094"
FT                   /protein_id="ACL68848.1"
FT                   /translation="MFGRFTERARKVLSLAEKEAVGFKHNYVGTEHILLGLVKEGQGVA
FT                   AKALKDVGISEEKVKEQITKLIGEGNQEVSGPISLTPRSKKVLNLALDEARRLGHNYIG
FT                   TEHILLGLIREGEGVAVRILANLNNGDLQNIREQVIELLGGKGNTRHQDGTRRSETPNL
FT                   DEYSRDLTKLADQVKLDPVIGREKEIERVIQVLSRRTKNNPVLIGEPGVGKTAIVEGLA
FT                   QRIVDESVPDVLLNKRVVALDLSSIVAGSKYRGEFEKRLKAVMNDIVKSGNIILFIDEL
FT                   HTLVGAGAAEGAIDAANILKPALARGELQAIGATTLDEYRKYIEKDPALERRFQSILVE
FT                   EPTPEETIEILKGLRDPYEAHHKVKISDEAIKAAVNLSHRYITDRFLPDKAIDLIDEAA
FT                   SRVRLGSDTRPPELKDLNKKLEEVKKEKEAAVKNQEFEKAAELRDKEKELEKEFENIQE
FT                   KWEKEKEKSESTVTTEEIAEIVSSWTGIPVTKLEQAETAKLLHLEEELHKRVVGQDEAI
FT                   QAVSQAVRRARAGLKDPKRPIGSFIFLGPTGVGKTELARALAEAMFNDEETMVRIDMSE
FT                   YMEKHAVSRLVGSPPGYVGHEEGGQLTEPIRRRPYSVVLFDEIEKAHPDVFNILLQILE
FT                   DGHLTDTHGRRVDFKNTVVIMTSNVGANFIEKQSRLGFKAGNDEKQNYEDMKDKLMSDL
FT                   RRTFRPEFLNRVDEIIVFHALNRDHIKQIVDLMLDDVKKRLEDKEIDIEVTEGAKHVLA
FT                   EKGFDSEFGARPLRRTIQRMVENPLSEKILEGKVKEGDKVVVDEQDGKVVVGK"
FT   gene            106731..108086
FT                   /locus_tag="Hore_00880"
FT   CDS_pept        106731..108086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_00880"
FT                   /product="DNA repair protein RadA"
FT                   /EC_number="2.1.1.63"
FT                   /note="PFAM: DnaB-like helicase C terminal domain; TIGRFAM:
FT                   DNA repair protein RadA"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_00880"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68849"
FT                   /db_xref="GOA:B8D095"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/TrEMBL:B8D095"
FT                   /protein_id="ACL68849.1"
FT                   /translation="MPRPKTYYICSECGYKSAKWMGRCLNCGAWNTFQELDEEAIEEKV
FT                   DIKVTPSSITDIKAGACPRLSSGIGEFDRVLGGGVVPGSLILLGGAPGIGKSTLVLQMA
FT                   RHFSEKYGKVLYVSGEESASQLKMRAGRLGAINEDLYVLSETNFQQIYGVIQNEKYELI
FT                   IIDSIQTIFDPRIESTPGSISQVKEVTNRLLIQAKKLEVPIVLIGHVTKEGHLAGPRVL
FT                   EHLVDTVLQFEGDRNYIYRILRAVKNRFGSTNEIGVFEMMGSGMREVVNPSEIFLKGRA
FT                   QGVSGSVIVPVVEGSRPLLVEVQALVTYSSFGTPQRLTTGVDRKRVSILLAVLEKKAGI
FT                   NFHNQDVNINITGGLKVEEPALDLGIITAILSSCKDQEVAPDLAVIGEVGLAGEIRAVS
FT                   QIERRLSELKKMGFKEVVIPGGNISGLDFDPDINIVEVKNVNDLMKILFNRR"
FT   gene            108091..109170
FT                   /locus_tag="Hore_00890"
FT   CDS_pept        108091..109170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_00890"
FT                   /product="predicted nucleic-acid-binding protein (contains
FT                   the HHH domain)"
FT                   /note="PFAM: Helix-hairpin-helix motif; Domain of unknown
FT                   function DUF147"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_00890"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68850"
FT                   /db_xref="GOA:B8D096"
FT                   /db_xref="InterPro:IPR003390"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR018906"
FT                   /db_xref="InterPro:IPR023763"
FT                   /db_xref="InterPro:IPR036888"
FT                   /db_xref="InterPro:IPR038331"
FT                   /db_xref="UniProtKB/TrEMBL:B8D096"
FT                   /protein_id="ACL68850.1"
FT                   /translation="MDGKKVSWGEVLKILAPGTLLREGLENVLRAKTGALIVIGDSEEV
FT                   LGIVDGGFNINAELTPARLYELAKMDGAMVLNSSADRILCANAQLIPDPTIPSSETGTR
FT                   HRTAERVAKQTNQLVIAISQRRDIISLYKGDSKHVLEDIRIVLAKANQAVQTLEKYRSV
FT                   LDQALINLSALEFEDLVTIADVVTVIQRTEMVLKIQKEIEKYISELGSEGRLIKMQLEE
FT                   LITDVREEGVLLIKDYIEENEEGEIPDAKELLDELIDWTTDEMLSLNTISKALGHGGGI
FT                   NSMDLSVEPRGYRILRKIPRLPMPVIDNLVGHFGSLQKVLNAFPDELDDVDGVGEVRAK
FT                   AIKDGLRRLRDQVLLDRHI"
FT   gene            109298..109828
FT                   /locus_tag="Hore_00900"
FT   CDS_pept        109298..109828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_00900"
FT                   /product="transcriptional regulator, CarD family"
FT                   /note="PFAM: CarD-like/TRCF domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_00900"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68851"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR042215"
FT                   /db_xref="UniProtKB/TrEMBL:B8D097"
FT                   /protein_id="ACL68851.1"
FT                   /translation="MANEEGLINKMFKVGDKVVYPNHGAGTIVGIETKNILGEEKKYYI
FT                   MKLPIGDMKVMIPVEKVEEIGVRNIIDEEEADNVLKLLKGDKSKMSQNWNRRYRANMEK
FT                   LKTGDIYEVGEVVRNLTIRDHEKGLSTGEKKMLSNARQILISELVLAKDMDEKEVEEII
FT                   DNVFEENPNLDEE"
FT   gene            109934..111028
FT                   /locus_tag="Hore_00910"
FT   CDS_pept        109934..111028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_00910"
FT                   /product="PilT protein domain protein"
FT                   /note="PFAM: PIN domain; TRAM domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_00910"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68852"
FT                   /db_xref="GOA:B8D098"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:B8D098"
FT                   /protein_id="ACL68852.1"
FT                   /translation="MLKKFMRFILGIFGALIGYQIVHILGINHQVVFSWKELDSVFLRP
FT                   QFIGIVSGWVVGFFLISYLIERLLELILNFEGKLKEITWKRVVTALLGLITGIIFGAII
FT                   NFTFSIPKIPRVGMPIQILINLIFAYLGLSFSLYKEDEIGTLIFDSGRNTKNNSNQESA
FT                   SYKILDTSVIIDGRIADICKSGFIEGVLIIPEFVLEELRHIADSSDVLKRNRGRRGLDI
FT                   LKQMQKDPNIKVEIFEQDFDDIQEVDSKLVKLAQVLGARVITNDYNLNKVAELQGVNVL
FT                   NINELANAVKPIVLPGEEMDVKVIKEGKEDGQGVGYLDDGTMIVVDNGINYMGEKVSVL
FT                   VTSILQTAAGRMIFAKPKAQEQVM"
FT   gene            111039..111728
FT                   /locus_tag="Hore_00920"
FT   CDS_pept        111039..111728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_00920"
FT                   /product="2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase"
FT                   /EC_number="2.7.7.60"
FT                   /note="PFAM: Uncharacterized protein family UPF0007;
FT                   TIGRFAM: 2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_00920"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68853"
FT                   /db_xref="GOA:B8D099"
FT                   /db_xref="InterPro:IPR001228"
FT                   /db_xref="InterPro:IPR018294"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR034683"
FT                   /db_xref="UniProtKB/TrEMBL:B8D099"
FT                   /protein_id="ACL68853.1"
FT                   /translation="MKVGVIIPAAGQGRRMGRDMNKQYLLLNGRPILAHTLSLFFSSGK
FT                   KFDQITVVVRPQEKEYCYQNVIQKYFPGKPIKLVSGGETRRESVYAGLKSFSPEIDYVI
FT                   IHDGARPLMPYPVLERVLKGIVEYDAVTTGVRVKDTIKFINGGGFVSNTPDRGKLIAVQ
FT                   TPQAFRYDIIKKAHEEISSDIQVTDDAFLVEKLGYPVKVIKGSYDNIKVTTPVDLIIAE
FT                   AILKTGD"
FT   gene            111733..112230
FT                   /locus_tag="Hore_00930"
FT   CDS_pept        111733..112230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_00930"
FT                   /product="2C-methyl-D-erythritol 2,4-cyclodiphosphate
FT                   synthase"
FT                   /EC_number="4.6.1.12"
FT                   /note="PFAM: YgbB family; TIGRFAM: 2C-methyl-D-erythritol
FT                   2,4-cyclodiphosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_00930"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68854"
FT                   /db_xref="GOA:B8D0A0"
FT                   /db_xref="InterPro:IPR003526"
FT                   /db_xref="InterPro:IPR020555"
FT                   /db_xref="InterPro:IPR036571"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8D0A0"
FT                   /protein_id="ACL68854.1"
FT                   /translation="MRIGIGFDVHPLKKGETLILGGVHIQGEYGLAGHSDADVLTHALM
FT                   DAILGAMGEADIGYHFPDTDPSYRGISSLKLLKKVYNMMKPRGFSIGNIDLIIMAQSPK
FT                   LSPYYNKIKENYTRILQLDSSRINIKATTTENLGFVGREEGIAAQAAVLLIDTKEGDIN
FT                   AG"
FT   gene            112220..113008
FT                   /locus_tag="Hore_00940"
FT   CDS_pept        112220..113008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_00940"
FT                   /product="CBS domain containing protein"
FT                   /note="PFAM: HutP; CBS domain pair"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_00940"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68855"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR015111"
FT                   /db_xref="UniProtKB/TrEMBL:B8D0A1"
FT                   /protein_id="ACL68855.1"
FT                   /translation="MLVKNIMSKDPITISPETTVVEAEKLMSINNIGRLIVVEDEGLVG
FT                   ILTDGDLVIQHDLNAPIDKFMSREVITISQNATVQEAAKVLSDHGIGGLPVLDEDGKLV
FT                   GIVTADDIVYGYLKDEEEERKMEKKTITPESSAIYLAMTRSREYEEYWLDKIKGYGYKG
FT                   AITQTGASAEKLPIKLRESTTVAAIARGVISENAREKIAVSNAVKDAYSQLALINPGLG
FT                   GGFKIAVVKGDGYVSVAIFGKFGHALVDGPEQLAIGTSVI"
FT   gene            113314..114786
FT                   /locus_tag="Hore_00950"
FT   CDS_pept        113314..114786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_00950"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /EC_number="6.1.1.17"
FT                   /note="PFAM: tRNA synthetases class I (E and Q), catalytic
FT                   domain; TIGRFAM: glutamyl-tRNA synthetase, bacterial
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_00950"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68856"
FT                   /db_xref="GOA:B8D0A2"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/TrEMBL:B8D0A2"
FT                   /protein_id="ACL68856.1"
FT                   /translation="MGSIRLRFPPSPTGRIHIGNIRTALFNWLWARKQGGTLVLRIEDT
FT                   DRERSATEFEEIIIRELQWLGLDVDEGVNKGGDYGPYRQSERLDIYKKYANKLLEEDKA
FT                   YYCYCTPEELEQMRKEARARGEMPRYNGRCRHLTDEERKKLESEGRKPVIRFKLPDEEQ
FT                   EIIVNDQIKGKVSFQTSVLDDFIIFKSDGMPTYNFAVVIDDALMKITDVIRGEDHLSNT
FT                   PKQLLLYEALGFEPPRFAHLPLILNKDREKLKKRSNDDAVYIGEYRRKGYLPEALFNYL
FT                   ALLGWAPRDGQELLSREELIRRFELKDVNKSGAVFDIDKLNWLNGKYIRNADIKRIVDL
FT                   SIPYLKEAGLITGEVDASLYRWLVKVIDVARTGVDYLKQIPEETSLFFKKNVEFEDKSK
FT                   AIEEFSQDGVTEVFTTLVNKLKQLETLTPEAIDGIFKEMKKELPVSPRTIYHPVRLALT
FT                   GLNSGPEIKNVIYILGINEVEKRLNEALNMTE"
FT   gene            115070..116524
FT                   /locus_tag="Hore_00960"
FT   CDS_pept        115070..116524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_00960"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /EC_number="6.1.1.16"
FT                   /note="PFAM: tRNA synthetases class I (C) catalytic domain;
FT                   DALR domain; tRNA synthetases class I (M); TIGRFAM:
FT                   cysteinyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_00960"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68857"
FT                   /db_xref="GOA:B8D0A3"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/TrEMBL:B8D0A3"
FT                   /protein_id="ACL68857.1"
FT                   /translation="MLRVYNTLSRKKEKFTPLETGKVRMYVCGLTVQNYAHIGHIRSAV
FT                   NYDVIRRYLEYKGYEVTYVQNFTDINEKIVARAREEGLRPLELADKYTKAYLEDIEKMK
FT                   IKRADVYCRATDTIKEIIKMVKKLLDKGYAYEVNGNVYFSVEKFSDYGKLSGRNLEEMQ
FT                   AGARVEVNEEKRHPMDFALWKKAPAGEISWDSPWGKGWPGWHIECSAMSIKYLGKRIDI
FT                   HGGGTDLIFPHHENEIAQSESCTGEKPFVKYWLHNGSVNLKGEKMSKSLGNFFTVREIL
FT                   KEFKPDEVRYFLLTKHYRSPIDFNFEEVEAARKSWRKLVNTYQVMVQILEKGVITKNKI
FT                   TENTKGENTIISILNKKEKEFEEAMDDDFNTARATGVMHELAREINTFVNSPEFELNGE
FT                   TSKVLKKAQNLFDRFSDILGLDLAFSSSDEVDNEILNNLVDFILEIRDEARQEKNWQLA
FT                   DRIRDGLEDLGFEIKDTPHGVRWERK"
FT   gene            116529..116915
FT                   /locus_tag="Hore_00970"
FT   CDS_pept        116529..116915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_00970"
FT                   /product="ribonuclease III"
FT                   /note="PFAM: RNase3 domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_00970"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68858"
FT                   /db_xref="GOA:B8D0A4"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR008226"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="UniProtKB/TrEMBL:B8D0A4"
FT                   /protein_id="ACL68858.1"
FT                   /translation="MTNKVNLMSPGHLAYVGDSVYELLVRNYLVNQGIYPLNKVHKNAV
FT                   RLVNAAAQARGLRAIEDKLEDKEKAIVRRGRNFNSGSSPRNMKIADYRLSTGLEALFGY
FT                   LYLNGNYDRIKELWSLLIKELEGE"
FT   gene            116918..117604
FT                   /locus_tag="Hore_00980"
FT   CDS_pept        116918..117604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_00980"
FT                   /product="thymidylate synthase, flavin-dependent"
FT                   /EC_number="2.1.1.148"
FT                   /note="PFAM: Thymidylate synthase complementing protein;
FT                   TIGRFAM: thymidylate synthase, flavin-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_00980"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68859"
FT                   /db_xref="GOA:B8D0A5"
FT                   /db_xref="InterPro:IPR003669"
FT                   /db_xref="InterPro:IPR036098"
FT                   /db_xref="UniProtKB/TrEMBL:B8D0A5"
FT                   /protein_id="ACL68859.1"
FT                   /translation="MEVRPEAKLIDYTPDPEKNVAISARLCYSKKGPEQLMEEMSREEI
FT                   EKLVRKVVSMGHLSTLEHTYFYFHIQCSRVTSHQLVRQRIGVSYSQRSQRYVSEEDFDY
FT                   IIPPSIQKNSEALKAFREYMEISKEAYKSLLDKGIPKEDARFLLPAVKTNLVVSYNARS
FT                   LMHFFRLRCCNRAQWEIRSIANQMLFQVRKVAPVLFEKAGPTCEVEGYCPEGEFSCGRI
FT                   DNIKTS"
FT   gene            117621..118355
FT                   /locus_tag="Hore_00990"
FT   CDS_pept        117621..118355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_00990"
FT                   /product="RNA methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="PFAM: RNA 2'-O ribose methyltransferase substrate
FT                   binding; SpoU rRNA Methylase family; TIGRFAM: rRNA
FT                   methylase, putative, group 3"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_00990"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68860"
FT                   /db_xref="GOA:B8D0A6"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:B8D0A6"
FT                   /protein_id="ACL68860.1"
FT                   /translation="MAQIEGRNPVIEAIKSGRTIKKIFIQEGVRGKKVDRIIKEASRFN
FT                   IPLQKAKKDFLDKKARSHSHQGIIAMADDIKYVSPREMVEIAREKGEDPFIIILDQVQD
FT                   PHNLGAIIRTAYAAGAHGLIYPRKRSADITPVVTKASAGAVNHLPLAKVSNINYTIADL
FT                   KDMGLWITGTDVRGTRPYYSADYKGPVGLVIGNEGKGMRRLVKENCDFVVNIPMSGELG
FT                   SLNASVAAGVVIFEVVRQRRST"
FT   gene            118418..119065
FT                   /locus_tag="Hore_01000"
FT   CDS_pept        118418..119065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_01000"
FT                   /product="sporulation sigma factor SigH"
FT                   /note="PFAM: Sigma-70 region 2; Sigma-70, region 4;
FT                   TIGRFAM: RNA polymerase sigma factor, sigma-70 family; RNA
FT                   polymerase sigma-H factor"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_01000"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68861"
FT                   /db_xref="GOA:B8D0A7"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014218"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR016371"
FT                   /db_xref="UniProtKB/TrEMBL:B8D0A7"
FT                   /protein_id="ACL68861.1"
FT                   /translation="MKGNAQEKYDYEDYNQLGDEELVELVHKGDKIAEETLIKRYKNFV
FT                   LAKSRSYFLVGADREDIVQEGMIGLYKAIRDYKVDRLASFRAFAELCITRQIITAIKAA
FT                   TRQKHQPLNSYVSLNRPIYDEESDRTLLDVLNGGKLSDPEELFVSKETYNLIENKITEM
FT                   LSQLELNVLQEYLEGKSYQDIAESLDKHVKSVDNALQRVKRKLEIFLEKHNI"
FT   gene            119180..120373
FT                   /locus_tag="Hore_01010"
FT   CDS_pept        119180..120373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_01010"
FT                   /product="translation elongation factor Tu"
FT                   /note="PFAM: Elongation factor Tu GTP binding domain;
FT                   Elongation factor Tu C-terminal domain; Elongation factor
FT                   Tu domain 2; TIGRFAM: translation elongation factor TU;
FT                   small GTP-binding protein domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_01010"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68862"
FT                   /db_xref="GOA:B8D0A8"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/TrEMBL:B8D0A8"
FT                   /protein_id="ACL68862.1"
FT                   /translation="MAKEKFERTKPHVNIGTIGHVDHGKTTLTAAITAVLSNLGSAEVM
FT                   PFDSIDNAPEEKERGITIATSHVEYETANRHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VVSAADGPMPQTREHILLARQVGVPSIVVFLNKADMVDDEELIELVEMEVRELLNEYEF
FT                   PGDDVPVIVGSALQALENPDPEGEWGKKIIELMEAVDEYIPEPERDKDKPFLMPVEDVF
FT                   SITGRGTVATGRVERGTLHPGDEVEIIGIKETQETVVTGVEMFRKLLDEAVAGDNIGAL
FT                   LRGIGRDEIERGQVLAKPGSITPHTHFKAEVYVLTKEEGGRHTPFFEGYRPQFYFRTTD
FT                   VTGTISLPEGVEMVMPGDNVEMEVKLITPIAMEEGLRFAIREGGRTVGAGVVSQIIE"
FT   gene            120562..120729
FT                   /locus_tag="Hore_01020"
FT   CDS_pept        120562..120729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_01020"
FT                   /product="ribosomal protein L33"
FT                   /note="PFAM: Ribosomal protein L33; TIGRFAM: ribosomal
FT                   protein L33, bacterial type"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_01020"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68863"
FT                   /db_xref="GOA:B8D0A9"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/TrEMBL:B8D0A9"
FT                   /protein_id="ACL68863.1"
FT                   /translation="MRGWQYMREIITLECTECKNRNYTTTKNKNNTRERLELKKYCKHC
FT                   QKHTLHRETK"
FT   gene            120826..121026
FT                   /locus_tag="Hore_01030"
FT   CDS_pept        120826..121026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_01030"
FT                   /product="preprotein translocase, SecE subunit"
FT                   /note="PFAM: SecE/Sec61-gamma subunits of protein
FT                   translocation complex; TIGRFAM: preprotein translocase,
FT                   SecE subunit, bacterial"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_01030"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68864"
FT                   /db_xref="GOA:B8D0B0"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:B8D0B0"
FT                   /protein_id="ACL68864.1"
FT                   /translation="MAGLSFFGKIKKFFRNFKAELKKVNWPRKKELSSYTAVVLVTVVA
FT                   LIIFIGVMDYILTSIITPLIM"
FT   gene            121067..121597
FT                   /locus_tag="Hore_01040"
FT   CDS_pept        121067..121597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_01040"
FT                   /product="NusG antitermination factor"
FT                   /note="PFAM: Domain of unknown function (DUF1967);
FT                   Transcription termination factor nusG; KOW motif; TIGRFAM:
FT                   transcription termination/antitermination factor NusG"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_01040"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68865"
FT                   /db_xref="GOA:B8D0B1"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:B8D0B1"
FT                   /protein_id="ACL68865.1"
FT                   /translation="MEEEKKWYVVHTYSGHENKVKANLEKRIKATDMEDKIFRILVPTE
FT                   EKIESKKGKQKKVEKRIFPGYVLVEMIMTDDSWYVVRNTPGVTGFVSSGTKPLPLQPEE
FT                   AKHILRGMGIEDDKIELDFGVGDKVKIVDGPFEEFIGEIKEVHPQQSKVKVLVSMFGRE
FT                   TPLELEFSQIEKI"
FT   gene            121626..122048
FT                   /locus_tag="Hore_01050"
FT   CDS_pept        121626..122048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_01050"
FT                   /product="ribosomal protein L11"
FT                   /note="PFAM: Ribosomal protein L11, N-terminal domain;
FT                   Ribosomal protein L11, RNA binding domain; TIGRFAM: 50S
FT                   ribosomal protein L11"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_01050"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68866"
FT                   /db_xref="GOA:B8D0B2"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8D0B2"
FT                   /protein_id="ACL68866.1"
FT                   /translation="MAKKVIGKIKLQIPAGKANPAPPVGPALGQHGVNIMEFCKAFNAK
FT                   TQDQAGMIIPVEITVYADRSFDFITKTPPASDLLKKAAGLERASGQPNINKVGTVTKED
FT                   IKEIAELKMPDLNAGSLEAAMRMIEGTARSMGIVVK"
FT   gene            122123..122830
FT                   /locus_tag="Hore_01060"
FT   CDS_pept        122123..122830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_01060"
FT                   /product="ribosomal protein L1"
FT                   /note="PFAM: Ribosomal protein L1p/L10e family; TIGRFAM:
FT                   ribosomal protein L1, bacterial/chloroplast"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_01060"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68867"
FT                   /db_xref="GOA:B8D0B3"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8D0B3"
FT                   /protein_id="ACL68867.1"
FT                   /translation="MAKHGKRYQESRKKVDREKLYSPADALELVKDIASANFDETVDLA
FT                   VKLGVDPKHADQNVRGAVVLPKGTGKEVKVIVFAKGEKAKEAEEAGADVVGADDLAEKI
FT                   KGGWLDFDVAIATPDMMSVVGKLGRILGPKGLMPNPKVGTVTFELEKAVKDAKAGKIEY
FT                   RVDKNGNIHLPIGKVSFPVDDLMENFKTIIDVLLRERPASAKGRYMRSVTVSSTMGPGI
FT                   KVDPNQAIDLIRK"
FT   misc_feature    122879..123034
FT                   /note="Ribosomal protein L10 leader"
FT   gene            123077..123595
FT                   /locus_tag="Hore_01070"
FT   CDS_pept        123077..123595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_01070"
FT                   /product="ribosomal protein L10"
FT                   /note="PFAM: Ribosomal protein L10"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_01070"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68868"
FT                   /db_xref="GOA:B8D0B4"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8D0B4"
FT                   /protein_id="ACL68868.1"
FT                   /translation="MPRPEKEAVVNELTDKLSSAKSLVLTDYKGLDVATITELRAKLRE
FT                   AGVEYRVVKNTLARIAAKKAEIEEINEVLVGPTAIAFGIEDAVSPAKVLVDFAKEHEEL
FT                   EIKGGVLNGEVIDDEKIKSLAKIPPREELLAKAFAGMKAPLTGFVNVLQGNIRNLVNVL
FT                   NQIKDQKDE"
FT   gene            123656..124027
FT                   /locus_tag="Hore_01080"
FT   CDS_pept        123656..124027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_01080"
FT                   /product="ribosomal protein L7/L12"
FT                   /note="PFAM: Ribosomal protein L7/L12 C-terminal domain;
FT                   TIGRFAM: ribosomal protein L7/L12"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_01080"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68869"
FT                   /db_xref="GOA:B8D0B5"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8D0B5"
FT                   /protein_id="ACL68869.1"
FT                   /translation="MTKEEIIEAIENMTVLELAELVEELEEKFGVSAAAPVAMAAVPGA
FT                   QGGEQQEEKTEFDVHLAEIGGKKINVIKVVREVTGLGLKDAKALVDDAPTNVKEGVSKE
FT                   EAEEIKSKLEDAGATVELK"
FT   gene            124653..127925
FT                   /locus_tag="Hore_01090"
FT   CDS_pept        124653..127925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_01090"
FT                   /product="DNA-directed RNA polymerase, beta subunit"
FT                   /EC_number="2.7.7.6"
FT                   /note="PFAM: RNA polymerase beta subunit; RNA polymerase
FT                   Rpb2, domain 2; RNA polymerase Rpb2, domain 7; RNA
FT                   polymerase Rpb2, domain 6; RNA polymerase Rpb2, domain 3;
FT                   TIGRFAM: DNA-directed RNA polymerase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_01090"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68870"
FT                   /db_xref="GOA:B8D0B6"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="InterPro:IPR042107"
FT                   /db_xref="UniProtKB/TrEMBL:B8D0B6"
FT                   /protein_id="ACL68870.1"
FT                   /translation="MAKGLRRERYSFAKIEDAHEAPYLLNTQISSYNWFLEEGLKEVFE
FT                   EISPIEDFSENLVLEFVDYHLGEPKYNEEECRDRDATYAAPLQVKVRLINKDTGEVKEQ
FT                   EVFMGDFPLMTDKGTFIINGAERVVVNQLIRSSGVYFGEERTKDGRRLVSANIIPNRGA
FT                   WIEFEYDKKRIVSVRVDRTRKMPSTVLFRALGYGTDAELIDLFGEHEVIHDTLERDNTD
FT                   SQEEALIELYKRLRPGEPPTVESAKNLLESLFFDPKRYDLALVGRYKINKKLGLDIDPD
FT                   KKCLDKRDIVETVRYLLRIIDNDPEASIDDIDHLGNRRLKTVGELLQNQFRIGLSRMER
FT                   VVKERMTIQDIDVVTPQALINTRPVVASIQEFFGSSQLSQFMDQTNPLSELTHKRRLSA
FT                   LGPGGLSRDRAGFEVRDVHHSHYGRICPIETPEGPNIGLIGSMSTYARTNKFGFLETPY
FT                   RKVVNGKATNEIEYLTADEEDKYTIAQANEPFDEDGNFLNDLVIARHRGDILEVSPEKV
FT                   DYMDVSPKQLVGVSASMIPFLENDDANRALMGANMQRQAVPLIKPDAPIVATGMEYRAA
FT                   KDSGVVIIAKNSGVVTRVTADEIVIKTDDGKIDTYKILKFKRSNQGSCINQRPIVRKGQ
FT                   RVDKGDVIADGPSTDHGEMALGRNTLIAFMPWEGYNYEDAILISEKLVKEDAFTSVHIE
FT                   EYEAEARDTKLGPEEITRDIPNVGENALKNLDERGIIRVGAEVKEGDILVGKVTPKGET
FT                   ELSAEERLLRAIFGEKAREVRDTSLKVPHGEEGIIVDVKVFSRENGDELKPGVNKLVRV
FT                   YVATKRKISVGDKMAGRHGNKGVISRILPEEDMPFLPNGEPVEVVLNPLGVPSRMNIGQ
FT                   VLETHLGLAAKALGLYVETPVFNGALEEEVEDLLEKAGFDRDGKTVLYDGRTGEPFDNR
FT                   VTVGYMYVLKLHHLVDDKIHARSTGPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGA
FT                   AYSLQEMLTIKSDDVVGRVKTYEAIVKGENVPEPGIPESFKVLIKEMQSLGLDAKIFTE
FT                   DEEELQIAEEEEEFTDTAKKLGLDMDLSDNNKKGSEKDSSEE"
FT   gene            127965..131462
FT                   /locus_tag="Hore_01100"
FT   CDS_pept        127965..131462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_01100"
FT                   /product="DNA-directed RNA polymerase, beta' subunit"
FT                   /EC_number="2.7.7.6"
FT                   /note="PFAM: RNA polymerase Rpb1, domain 1; RNA polymerase
FT                   Rpb1, domain 2; RNA polymerase Rpb1, domain 5; RNA
FT                   polymerase Rpb1, domain 4; RNA polymerase Rpb1, domain 3;
FT                   TIGRFAM: DNA-directed RNA polymerase, beta' subunit,
FT                   predominant form"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_01100"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68871"
FT                   /db_xref="GOA:B8D0B7"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/TrEMBL:B8D0B7"
FT                   /protein_id="ACL68871.1"
FT                   /translation="MKKGERPLFNVNSFDSMKISVASPEQIRDWSRGEVKKPETINYRT
FT                   LKPEKDGLFCEKIFGPTKDYECHCGKYKRVRYKGVVCDRCGVEVTHSKVRRERMGHIEL
FT                   AAPCTHIWFFKGIPSRLGLILDMSPRALEKVIYFVSYIVIDAGESPLSEKQLLSETEYR
FT                   EARQKYGDSFEAGMGAEAVKELLKKIDVGAEVKRLKKEVKEASGQRRKRAIRRLEVLDG
FT                   LNKSGIKPEWLVLEVIPVIPPDLRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLLDL
FT                   GAPEIIIRNEKRMLQEAVDALIDNGRRGRPVTGAGNRPLKSLSDMLKGKQGRFRQNLLG
FT                   KRVDYSGRSVIVVGPELKMHQCGLPKKMALELFKPFVMKGLVDKGLAHNIKNAKRMVER
FT                   VDDEVWGVLEEVIEDHPVLLNRAPTLHRLGIQAFEPVLVEGKAIKLHPLVCTAYNADFD
FT                   GDQMAVHVPLSAEAQIESRVLMLSTSNILAPSDGSPITVPTQDMVIGIYYLTTIKDGEK
FT                   GEGKLFASPEEAIKAYDTGKVSLQARVKVRLDGKLVETSPGRVIFNEALPEKMEFINYQ
FT                   VDKSELGDIVADLHEKFGNDITARALDKIKELGYDFATRSGITIAVSDASISPAKEKIL
FT                   NEAEEEVRNIEQHYRRGAITENERYQKVVDIWNKAKDAVTDALLDHLGEDNNIYMMAIS
FT                   GARGNTSQISQLAGMRGLMADPSGRILDIPIRSSFREGLNVMEFFISTHGARKGLADTA
FT                   IRTADSGYLTRRLVDVSQDVIIREDDCGTENGIYVEAIGGKGDDAIETLAERCIGRLAA
FT                   EDIVDPSNDKVIVKRDELITRDKMKEINAAGIERVKIRSVLTCETKHGVCRKCYGRNLA
FT                   TGKLVDIGEAIGIIAAQSIGEPGTQLTMRTFHTGGVAGDDITQGLPRVEELFEGRTPKG
FT                   QAIITEKTGRVKILEKRNSRRIVIEDDDGKKKTYQVPYGSKVIVKDGQMVKAGDKLTEG
FT                   PLDPSTVLKIKGVDEVQDYLLQEVQKVYRSQGVEINDKHIEVIIRQMMRKVRIIDPGDT
FT                   DFLPGSLVDRLEFNEINHKMVDEGKQPATCKPELLGITKASLATDSFLSAASFQETTRV
FT                   LTEASLEGKVDPLLGLKENVIIGQLIPAGTGMKYYRDISMLDDNGQPIPGSIDELVEE"
FT   gene            131728..131976
FT                   /locus_tag="Hore_01110"
FT   CDS_pept        131728..131976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_01110"
FT                   /product="ribosomal protein L7Ae/L30e/S12e/Gadd45"
FT                   /note="PFAM: Ribosomal protein L7Ae/L30e/S12e/Gadd45
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_01110"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68872"
FT                   /db_xref="GOA:B8D0B8"
FT                   /db_xref="InterPro:IPR004038"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:B8D0B8"
FT                   /protein_id="ACL68872.1"
FT                   /translation="MMLTELKNIDNKVVGTKQTLKAIKNSEVKKVFLAEDIDKPLYNQI
FT                   VETATQYDVPIEKVDSKLRLGRACGIDVSAACAALLK"
FT   gene            131995..132366
FT                   /locus_tag="Hore_01120"
FT   CDS_pept        131995..132366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_01120"
FT                   /product="ribosomal protein S12"
FT                   /note="PFAM: Ribosomal protein S12; TIGRFAM: ribosomal
FT                   protein S12, bacterial/organelle"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_01120"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68873"
FT                   /db_xref="GOA:B8D0B9"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8D0B9"
FT                   /protein_id="ACL68873.1"
FT                   /translation="MPTINQLIRKGRKKVKKKKTAPALQGSPQKRGVCTRVYTATPKKP
FT                   NSALRKVARVRLTNGIEVTAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGALDA
FT                   AGVEGRKQGRSKYGVKKPK"
FT   gene            132387..132854
FT                   /locus_tag="Hore_01130"
FT   CDS_pept        132387..132854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_01130"
FT                   /product="ribosomal protein S7"
FT                   /note="PFAM: Ribosomal protein S7p/S5e; TIGRFAM: ribosomal
FT                   protein S7, bacterial/organelle"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_01130"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68874"
FT                   /db_xref="GOA:B8D0C0"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/TrEMBL:B8D0C0"
FT                   /protein_id="ACL68874.1"
FT                   /translation="MRKNRATKRRVNPDPVYNDVIIARFINKIMYDGKKGLAERIMYQA
FT                   MDLIKERTGENPVELVKKALDNVMPVLEVKSRRVGGSNYQVPVEVSEPRRVSLGIRWIV
FT                   EAARNRGERTMVERLASELLDASNNTGGAVKKKEDVHRMAEANRAFAHYRW"
FT   gene            132890..134959
FT                   /locus_tag="Hore_01140"
FT   CDS_pept        132890..134959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_01140"
FT                   /product="translation elongation factor G"
FT                   /note="PFAM: Elongation factor G C-terminus; Elongation
FT                   factor Tu domain 2; Elongation factor Tu GTP binding
FT                   domain; Elongation factor G, domain IV; TIGRFAM:
FT                   translation elongation factor EF-G; small GTP-binding
FT                   protein domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_01140"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68875"
FT                   /db_xref="GOA:B8D0C1"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8D0C1"
FT                   /protein_id="ACL68875.1"
FT                   /translation="MARQYPLKKTRNIGIMAHIDAGKTTTTERILYYTGRVHKMGEVHD
FT                   GAAVMDWMEQEQERGITITSAATTCEWQKHRINIIDTPGHVDFTVEVERSLRVLDGAIA
FT                   LFCAVGGVEPQSETVWRQADKYQVPRIAFVNKMDRMGADFFHVIEMMEDRLGANAVPLQ
FT                   IPIGSEDDFEGIVDLVTMDAVVYKDDLGVKYERVDIPEDYREQAEEYRENLLEAISELD
FT                   DEIMMKYLEGEEITTDELKTALRKGVLDVEIVPVLCGSAFKNKGVQLLLDAVIDYLPSP
FT                   VDVPPVEGMNPDTEEEEIRKAGDDEPFSALAFKIMADPYVGKLTFFRVYSGVLEAGSYV
FT                   YNSTKGHKERIGRILQMHANHREERESVHAGDLAAAVGLKNTATGDTLCDEDHPIVLES
FT                   MEFPEPVISVAIEPKSQAEQDKLSLALQRLAEEDPTFKVRTDEETGQTIIRGMGELHLE
FT                   VIVDRLLREFKVDANIGRPQVAYRETITRKVTDVEGKFIRQSGGRGQYGHVIIDIEPLE
FT                   EGEGFEFVNKIVGGAIPKEYIPAVEDGIVEAMENGVLAGYPAVDLKITLKDGSYHEVDS
FT                   SEMAFKIAGSIAFKEGAQKASPVILEPIMDVEVVVPEEYMGDVIGDLNGRRGNVQGMER
FT                   RASAQVVKAYVPLAEMFGYATDLRSKTQGRATYTMQFSHYEPVPDNIAKEIIGK"
FT   gene            134987..136180
FT                   /locus_tag="Hore_01150"
FT   CDS_pept        134987..136180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_01150"
FT                   /product="translation elongation factor Tu"
FT                   /note="PFAM: Elongation factor Tu GTP binding domain;
FT                   Elongation factor Tu C-terminal domain; Elongation factor
FT                   Tu domain 2; TIGRFAM: translation elongation factor TU;
FT                   small GTP-binding protein domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_01150"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68876"
FT                   /db_xref="GOA:B8D0A8"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/TrEMBL:B8D0A8"
FT                   /protein_id="ACL68876.1"
FT                   /translation="MAKEKFERTKPHVNIGTIGHVDHGKTTLTAAITAVLSNLGSAEVM
FT                   PFDSIDNAPEEKERGITIATSHVEYETANRHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VVSAADGPMPQTREHILLARQVGVPSIVVFLNKADMVDDEELIELVEMEVRELLNEYEF
FT                   PGDDVPVIVGSALQALENPDPEGEWGKKIIELMEAVDEYIPEPERDKDKPFLMPVEDVF
FT                   SITGRGTVATGRVERGTLHPGDEVEIIGIKETQETVVTGVEMFRKLLDEAVAGDNIGAL
FT                   LRGIGRDEIERGQVLAKPGSITPHTHFKAEVYVLTKEEGGRHTPFFEGYRPQFYFRTTD
FT                   VTGTISLPEGVEMVMPGDNVEMEVKLITPIAMEEGLRFAIREGGRTVGAGVVSQIIE"
FT   gene            136334..136645
FT                   /locus_tag="Hore_01160"
FT   CDS_pept        136334..136645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_01160"
FT                   /product="ribosomal protein S10"
FT                   /note="PFAM: Ribosomal protein S10p/S20e; TIGRFAM:
FT                   ribosomal protein S10, bacterial/organelle"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_01160"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68877"
FT                   /db_xref="GOA:B8D0C3"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/TrEMBL:B8D0C3"
FT                   /protein_id="ACL68877.1"
FT                   /translation="MAKHEKIRIRLKAYEHELLDQSAQKIVATAKRTGAEVSGPIPLPT
FT                   EKEVYTVLRSPHVHKDSREQFEMRTHKRLIDIVDPTSKTVDALMRLDLPAGVNIEIKL"
FT   gene            136663..137298
FT                   /locus_tag="Hore_01170"
FT   CDS_pept        136663..137298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_01170"
FT                   /product="ribosomal protein L3"
FT                   /note="PFAM: Ribosomal protein L3"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_01170"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68878"
FT                   /db_xref="GOA:B8D0C4"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8D0C4"
FT                   /protein_id="ACL68878.1"
FT                   /translation="MAKGIIGKKLGMTQIFDDDGNVIPVTVVQAGPCVVIQKKVEERDG
FT                   YNALQVGFEDVPEHRVNKPLKGHFERAGVKPKKHVKEFMDFPEDLNEGDEITVDIFEEG
FT                   ELVDVTGISKGKGFAGTIKRWNFSRGPMSHGSRFHRAPGSIGAVDASRVFKGQKLPGRM
FT                   GHDRVTIQNLEVVRVDSEKNLLLIKGSVPGPNKGILTIREAVKKASNA"
FT   gene            137328..137957
FT                   /locus_tag="Hore_01180"
FT   CDS_pept        137328..137957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_01180"
FT                   /product="ribosomal protein L4/L1e"
FT                   /note="PFAM: Ribosomal protein L4/L1 family"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_01180"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68879"
FT                   /db_xref="GOA:B8D0C5"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8D0C5"
FT                   /protein_id="ACL68879.1"
FT                   /translation="MPQVAKYDTTGNRVGDIDLADNVFNEEVNEHVVHQVVTAQLATMR
FT                   RGTASTKTRGEVSGGGRKPWRQKGTGRARHGSIRSPLWVGGGIVFGPRPRKHIKKVPKK
FT                   VKKLALRSILSYKSQNEELIILDELKFDTPKTKQVVELLSNLNLEGKKVLIILPDKDAN
FT                   IYLSARNIPGVKTLVVDALNAFDLLNNDCIVMSEEAVKRVEEVLAR"
FT   gene            137954..138244
FT                   /locus_tag="Hore_01190"
FT   CDS_pept        137954..138244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_01190"
FT                   /product="Ribosomal protein L25/L23"
FT                   /note="PFAM: Ribosomal protein L23"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_01190"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68880"
FT                   /db_xref="GOA:B8D0C6"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/TrEMBL:B8D0C6"
FT                   /protein_id="ACL68880.1"
FT                   /translation="MKDPRDIIIEPIVTEQSMDLIEENNTYTFKVAKDANKIEIKKAVE
FT                   EIFNVDVIKVNTINVRGKKRRLGWHEGKRPDWKKAMVRLSEGDRIEIFEGM"
FT   gene            138272..139105
FT                   /locus_tag="Hore_01200"
FT   CDS_pept        138272..139105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_01200"
FT                   /product="ribosomal protein L2"
FT                   /note="PFAM: Ribosomal Proteins L2, C-terminal domain;
FT                   Ribosomal Proteins L2, RNA binding domain; TIGRFAM:
FT                   ribosomal protein L2, bacterial/organellar"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_01200"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68881"
FT                   /db_xref="GOA:B8D0C7"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8D0C7"
FT                   /protein_id="ACL68881.1"
FT                   /translation="MAIKKFKPTTPSRRFMTVSAFDEITRREPEKSLLAPLKKTGGRNS
FT                   YGRVTVRHRGGGHKRRYRIIDFKRDKDGVPARVASIEYDPNRSARIALLHYVDGEKRYI
FT                   LAPNKLQVGDTVKSGEDAEIKPGNALKLKNIPVGTIIHNIELKPGKGGQLARAAGTMAQ
FT                   ILAKEGKYAHIKLPSGEVRLISLECKATIGQVGNIDHENISIGKAGRKRWLGKRPHVRG
FT                   VAMNPVDHPHGGGEGRTSTGRHPVTPWGKRTLGKKTRKRKASDKYIIRSRRARKR"
FT   gene            139127..139411
FT                   /locus_tag="Hore_01210"
FT   CDS_pept        139127..139411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_01210"
FT                   /product="ribosomal protein S19"
FT                   /note="PFAM: Ribosomal protein S19; TIGRFAM: ribosomal
FT                   protein S19, bacterial/organelle"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_01210"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68882"
FT                   /db_xref="GOA:B8D0C8"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8D0C8"
FT                   /protein_id="ACL68882.1"
FT                   /translation="MGRSLKKGPYVDKKLLNKIKEMNESGKKKVIKTWSRDSTIFPEMV
FT                   GHTIAVHDGQKHVPVYITEDMVGHKLGEFAPTRKFRGHGAHTERSTALK"
FT   gene            139462..139803
FT                   /locus_tag="Hore_01220"
FT   CDS_pept        139462..139803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_01220"
FT                   /product="ribosomal protein L22"
FT                   /note="PFAM: Ribosomal protein L22p/L17e; TIGRFAM:
FT                   ribosomal protein L22, bacterial type"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_01220"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68883"
FT                   /db_xref="GOA:B8D0C9"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8D0C9"
FT                   /protein_id="ACL68883.1"
FT                   /translation="MEARAVAKYVRVSPRKARQVIDLIRGKEIGEALGILKHTPKKASS
FT                   IIEKVLNSAIANAENNHDMMVEDLYVSKAYVDEGPTMKRYRARAMGQAGLIRKRTSHIT
FT                   IVVSEKKEG"
FT   gene            139807..140451
FT                   /locus_tag="Hore_01230"
FT   CDS_pept        139807..140451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_01230"
FT                   /product="ribosomal protein S3"
FT                   /note="PFAM: Ribosomal protein S3, C-terminal domain; KH
FT                   domain; Ribosomal protein S3, N-terminal domain; TIGRFAM:
FT                   ribosomal protein S3, eukaryotic/archaeal type; ribosomal
FT                   protein S3, bacterial type"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_01230"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68884"
FT                   /db_xref="GOA:B8D0D0"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8D0D0"
FT                   /protein_id="ACL68884.1"
FT                   /translation="MGQKVHPHGLRVGVIKDWDAKWYADKNNYADLLQEDLKIRNHVKN
FT                   KMYDAGISRIVIERVANRLKLDVYTARPGMVIGRGGSEVDALRKDIEQMTGKNVQINVV
FT                   EVEDPELDAQLVAENIAAQLERRISFRRAMKQAMNRAMRMGAEGFKVQSSGRLGGAEMA
FT                   RTEGYSDGRVPLHTLRADIDYGFAEAYTTYGKIGVKVWINKGEVLPEVEDK"
FT   gene            140479..140913
FT                   /locus_tag="Hore_01240"
FT   CDS_pept        140479..140913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_01240"
FT                   /product="ribosomal protein L16"
FT                   /note="PFAM: Ribosomal protein L16p/L10e; TIGRFAM:
FT                   ribosomal protein L16, bacterial/organelle"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_01240"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68885"
FT                   /db_xref="GOA:B8D0D1"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8D0D1"
FT                   /protein_id="ACL68885.1"
FT                   /translation="MLIPKRVKYRKQHRGRMTGKAKRGNRITFGEYGLQALEPAWITNR
FT                   QIEAARVAITRSLKRGGKVWIKIFPDKPVTAKPAETRMGGGKGAPEKWVAVVKPGRIMF
FT                   EVAGVSEELAREAIRLASHKLPIKTRFVKREEMDGEANES"
FT   gene            140891..141106
FT                   /locus_tag="Hore_01250"
FT   CDS_pept        140891..141106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_01250"
FT                   /product="ribosomal protein L29"
FT                   /note="PFAM: Ribosomal L29 protein; TIGRFAM: ribosomal
FT                   protein L29"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_01250"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68886"
FT                   /db_xref="GOA:B8D0D2"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/TrEMBL:B8D0D2"
FT                   /protein_id="ACL68886.1"
FT                   /translation="MVRPMRADELRELTDAELQQKLREFKEELFNLRFQHATAQLENPM
FT                   RIREVKRTIARIKTIMRERELGIKRA"
FT   gene            141130..141390
FT                   /locus_tag="Hore_01260"
FT   CDS_pept        141130..141390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_01260"
FT                   /product="ribosomal protein S17"
FT                   /note="PFAM: Ribosomal protein S17"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_01260"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68887"
FT                   /db_xref="GOA:B8D0D3"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/TrEMBL:B8D0D3"
FT                   /protein_id="ACL68887.1"
FT                   /translation="MVVERNKRKERVGVVVSDKMDKTVTVAVERRTQHHLYKKVMKKTK
FT                   KFKAHDEENKCGVGDKVRIMETRPLSKNKRWRVVEIIEKAK"
FT   gene            141416..141784
FT                   /locus_tag="Hore_01270"
FT   CDS_pept        141416..141784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_01270"
FT                   /product="ribosomal protein L14"
FT                   /note="PFAM: Ribosomal protein L14p/L23e; TIGRFAM:
FT                   ribosomal protein L14, bacterial/organelle"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_01270"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68888"
FT                   /db_xref="GOA:B8D0D4"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8D0D4"
FT                   /protein_id="ACL68888.1"
FT                   /translation="MIQAESRLRVADNTGARELLCIRVLGGSRKRYAGVGDIIVATVKE
FT                   AIPDGMVKKGEVVKAVVVRTKKETRRPDGSYIKFDENAAVLIDKANNPRGTRIFGPVAR
FT                   ELREKNFMKIISLAPEVL"
FT   gene            141798..142112
FT                   /locus_tag="Hore_01280"
FT   CDS_pept        141798..142112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_01280"
FT                   /product="ribosomal protein L24"
FT                   /note="PFAM: KOW motif; TIGRFAM: ribosomal protein L24,
FT                   bacterial/organelle"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_01280"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68889"
FT                   /db_xref="GOA:B8D0D5"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8D0D5"
FT                   /protein_id="ACL68889.1"
FT                   /translation="MRVKKGDLVEVIAGKDRGKRGKVLRVIPREDRVIVEGINIVHRHM
FT                   RPTPDMPQGGIVKNEAPIHISNVMLVCPNCDEKTRIGATYLEDGQKVRKCKKCDEVVDK
FT                   "
FT   gene            142143..142682
FT                   /locus_tag="Hore_01290"
FT   CDS_pept        142143..142682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_01290"
FT                   /product="ribosomal protein L5"
FT                   /note="PFAM: ribosomal L5P family C-terminus; Ribosomal
FT                   protein L5"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_01290"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68890"
FT                   /db_xref="GOA:B8D0D6"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8D0D6"
FT                   /protein_id="ACL68890.1"
FT                   /translation="MSVLAEQYKEEIVPKLMDKFDYENIMAVPRVEKVVVNVGMGELKE
FT                   DPKLIDVVVNDIASITGQKPVITRAKKSVANFKIREGMPIGAKVTLRGETMYEFLYKLV
FT                   NVTLPRIRDFRGVSPKSFDGRGNYNIGIREHIVFPEIEIDKVDKVYGLEITIVTSAETD
FT                   EEAYELLKLMGMPFNQ"
FT   gene            142699..142884
FT                   /locus_tag="Hore_01300"
FT   CDS_pept        142699..142884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_01300"
FT                   /product="ribosomal protein S14"
FT                   /note="PFAM: Ribosomal protein S14p/S29e"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_01300"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68891"
FT                   /db_xref="GOA:B8D0D7"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023053"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8D0D7"
FT                   /protein_id="ACL68891.1"
FT                   /translation="MTRKALMEKAKKEPKYSTRKVNRCKRCGRARGYMRKFDLCRICFR
FT                   ELAHKGEIPGVKKASW"
FT   gene            142907..143305
FT                   /locus_tag="Hore_01310"
FT   CDS_pept        142907..143305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_01310"
FT                   /product="ribosomal protein S8"
FT                   /note="PFAM: Ribosomal protein S8"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_01310"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68892"
FT                   /db_xref="GOA:B8D0D8"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8D0D8"
FT                   /protein_id="ACL68892.1"
FT                   /translation="MNITDPIADMLTRIRNANDTNKDVVNIPASNMKISIARILKEEGY
FT                   IKDYKVIEKKPQNALRIYLKYSKNGEKVISGLKRISKPGLRVYVKKDEVPKVLGGLGIA
FT                   VLSTSRGILTDKQARQEGIGGEVLCYVW"
FT   gene            143344..143883
FT                   /locus_tag="Hore_01320"
FT   CDS_pept        143344..143883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_01320"
FT                   /product="ribosomal protein L6"
FT                   /note="PFAM: Ribosomal protein L6; Ribosomal protein L6"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_01320"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68893"
FT                   /db_xref="GOA:B8D0D9"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8D0D9"
FT                   /protein_id="ACL68893.1"
FT                   /translation="MSRIGKLPVDIPEKVDVSVNDNLVTVKGPKGELTKEFNNKKVTVE
FT                   VKDGQVLVRRVHDKDKDARAFQGLTRSLIDSMVEGVTNGFEKKLEMVGVGYNAKKKGKD
FT                   LELEVGYSHPVIIEAEDGIEFDVEKNNKIVVRGIDKQQVGEMAAKVRAVRKPEPYKGKG
FT                   IRYEGEHIRRKEGKTG"
FT   gene            143902..144258
FT                   /locus_tag="Hore_01330"
FT   CDS_pept        143902..144258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_01330"
FT                   /product="ribosomal protein L18"
FT                   /note="PFAM: Ribosomal L18p/L5e family; TIGRFAM: ribosomal
FT                   protein L18, bacterial type"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_01330"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68894"
FT                   /db_xref="GOA:B8D0E0"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/TrEMBL:B8D0E0"
FT                   /protein_id="ACL68894.1"
FT                   /translation="MDKRLARKRRHLRIRNKIFGTPERPRMSVFRSKKNIYVQVIDDIS
FT                   GHTLVSASSLDPAIRDEIDNGGNVEAAKKVGELVAERALEKGIKKVVFDRGGNRYHGRI
FT                   KALAEAARAKGLKF"
FT   gene            144277..144777
FT                   /locus_tag="Hore_01340"
FT   CDS_pept        144277..144777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_01340"
FT                   /product="ribosomal protein S5"
FT                   /note="PFAM: Ribosomal protein S5, C-terminal domain;
FT                   Ribosomal protein S5, N-terminal domain; TIGRFAM: ribosomal
FT                   protein S5, bacterial/organelle type"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_01340"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68895"
FT                   /db_xref="GOA:B8D0E1"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:B8D0E1"
FT                   /protein_id="ACL68895.1"
FT                   /translation="MKNIDPDKLDLEERVVNINRVAKVVKGGRRFSFSALVVVGDGNGH
FT                   VGVGFGKANEVPEAIRKGVEDGKKNLIKVPIVNTTIPHEIVGEFGAGKVLLKPAAPGTG
FT                   VIAGGPVRAVVELAGIGDILTKSLGSSNPINMVKATLTGLSQLKTIEEVADLRGKDVEE
FT                   LMG"
FT   gene            144796..145239
FT                   /locus_tag="Hore_01350"
FT   CDS_pept        144796..145239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_01350"
FT                   /product="ribosomal protein L15"
FT                   /note="PFAM: Ribosomal protein L15; Ribosomal protein L15
FT                   amino terminal region; TIGRFAM: ribosomal protein L15,
FT                   bacterial/organelle"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_01350"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68896"
FT                   /db_xref="GOA:B8D0E2"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8D0E2"
FT                   /protein_id="ACL68896.1"
FT                   /translation="MKLHDLRPAKDAKKKRKRVGRGTGSGRGFTSGRGSKGQNARSGGG
FT                   VRPTFEGGQTPLFRKLPKKGFNNIFKKVYNEVNVYQLNKFNKGEEVTPEKLLEKGIIDK
FT                   VARSGVKILGNGELDKALTVKAHAFTKSAREKIEAAGGKAEVI"
FT   gene            145240..146508
FT                   /locus_tag="Hore_01360"
FT   CDS_pept        145240..146508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_01360"
FT                   /product="preprotein translocase, SecY subunit"
FT                   /note="PFAM: eubacterial secY protein; TIGRFAM: preprotein
FT                   translocase, SecY subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_01360"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68897"
FT                   /db_xref="GOA:B8D0S8"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:B8D0S8"
FT                   /protein_id="ACL68897.1"
FT                   /translation="MISALKNAFKVKEIRKKILFVLGMMVVYRIGAHIPVPGIDVVKLR
FT                   EILFQGTAQGVFDYLDLFAGGALRNFTIFAMSITPYITASIILQLLTGVIPRLEELQKQ
FT                   GVEGRKKLTQYTRYGTVVLAIIQAFGITMLIGRHNVIVNPNLFNLMLIVISLTAGTAFL
FT                   MWLGEQITDKGIGNGISIIIFTSIISRFPSYIHRNWELYKTGDITALNILFFLVLAVVI
FT                   IAGVIFIQQGERRIPVQYSKRVVGRKVYGGRSTHIPMRINQAGVIPVIFAQAVLQFPTV
FT                   IAAVLPYGWAQDIATALEPGKPVHLVLYAAMIFFFTYFWTAFTFNPEEVADNMRKSGAF
FT                   IPGIRPGKATENFLTRILVRVTLAGAIFLTVIAIMPYFISDITRVRISFGGTSLLIMTG
FT                   VALQTMQQIESQLLMRHYEGFMK"
FT   gene            146525..147175
FT                   /locus_tag="Hore_01370"
FT   CDS_pept        146525..147175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_01370"
FT                   /product="Adenylate kinase"
FT                   /EC_number="2.7.4.3"
FT                   /note="PFAM: Adenylate kinase, active site lid; Adenylate
FT                   kinase; TIGRFAM: adenylate kinases"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_01370"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68898"
FT                   /db_xref="GOA:B8D0S9"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR007862"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/TrEMBL:B8D0S9"
FT                   /protein_id="ACL68898.1"
FT                   /translation="MNIVLLGLPGAGKGTQAKKMSQEYNLPHIATGDIFRQAIREETPL
FT                   GKEAKKYLDSGELVPDEITIGIVRERIQKDDCDNGFILDGFPRTLNQARALTGMLEDMG
FT                   RKIDVALYIKVKEEELIKRLSGRRVCQECGAAYHVVYNPPKEEGICDLCKGKLIQRSDD
FT                   KEETVKNRIRINKEKMEDLIEYYRNQGNLKTVESTGGIDEVFNKIQEIIGAGV"
FT   gene            147176..147931
FT                   /locus_tag="Hore_01380"
FT   CDS_pept        147176..147931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_01380"
FT                   /product="methionine aminopeptidase, type I"
FT                   /EC_number="3.4.11.18"
FT                   /note="PFAM: metallopeptidase family M24; TIGRFAM:
FT                   methionine aminopeptidase, type I"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_01380"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68899"
FT                   /db_xref="GOA:B8D0T0"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:B8D0T0"
FT                   /protein_id="ACL68899.1"
FT                   /translation="MIILKSPREINIMREANRIVAEVHARLAEEISPGITTADIDKLGE
FT                   ELIRKKGGIPSFKGYRGYPASVCVSINDEVVHGIPSKKRVIESGDVVSLDIGVIYEGFH
FT                   GDAARTLGVGEVSKEASRLIEITEQSFFHGIEQAKPGNRLSDISHAVQNYVEKNGFSVV
FT                   REYVGHGIGRDMHEDPQIPNFGPPGRGPLLKEGMTLAIEPMVNAGGYMVKTLADGWTVV
FT                   TKDGSLSAHYENTIAVTKDGPVILSCLES"
FT   gene            148010..148294
FT                   /locus_tag="Hore_01390"
FT   CDS_pept        148010..148294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_01390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_01390"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68900"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR041985"
FT                   /db_xref="UniProtKB/TrEMBL:B8D0T1"
FT                   /protein_id="ACL68900.1"
FT                   /translation="MCGKFQLGEMVKSIAGRDTGKYYIVVKIDNEKYVQVADGDKKRLE
FT                   RPKRKNVKHLKPAGFVHKELQIWLSNGKRVRNEDIKKIIKDFVKNEEAN"
FT   gene            148299..148526
FT                   /locus_tag="Hore_01400"
FT   CDS_pept        148299..148526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_01400"
FT                   /product="translation initiation factor IF-1"
FT                   /note="PFAM: Translation initiation factor 1A / IF-1; S1
FT                   RNA binding domain; TIGRFAM: translation initiation factor
FT                   IF-1"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_01400"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68901"
FT                   /db_xref="GOA:B8D0T2"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:B8D0T2"
FT                   /protein_id="ACL68901.1"
FT                   /translation="MAKEEAIEVQGTVVEPLPNAMFRVELDNGHKVLAHVSGKMRMNYI
FT                   RILPGDKVTVELSPYDLSRGRIIYRHKTKK"
FT   gene            148550..148663
FT                   /locus_tag="Hore_01410"
FT   CDS_pept        148550..148663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_01410"
FT                   /product="ribosomal protein L36"
FT                   /note="PFAM: Ribosomal protein L36; TIGRFAM: ribosomal
FT                   protein L36, bacterial type"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_01410"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68902"
FT                   /db_xref="GOA:B8D0T3"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8D0T3"
FT                   /protein_id="ACL68902.1"
FT                   /translation="MKVRPSVKPICDKCKVIRRKGKVRVICENPKHKQRQG"
FT   gene            148688..149056
FT                   /locus_tag="Hore_01420"
FT   CDS_pept        148688..149056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_01420"
FT                   /product="ribosomal protein S13"
FT                   /note="PFAM: Ribosomal protein S13/S18"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_01420"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68903"
FT                   /db_xref="GOA:B8D0T4"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8D0T4"
FT                   /protein_id="ACL68903.1"
FT                   /translation="MARIAGVDLPRNKRVEIGLTYIYGIGRSTSNKILKVTGIDPDTRV
FT                   KDLTEAEIAKLREEVDKYQVEGDLRREIRANIKRLMDIGCYRGIRHRKNLPVRGQRTRT
FT                   NARTRKGPKKTVGVRRAK"
FT   gene            149078..149476
FT                   /locus_tag="Hore_01430"
FT   CDS_pept        149078..149476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_01430"
FT                   /product="ribosomal protein S11"
FT                   /note="PFAM: Ribosomal protein S11"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_01430"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68904"
FT                   /db_xref="GOA:B8D0T5"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/TrEMBL:B8D0T5"
FT                   /protein_id="ACL68904.1"
FT                   /translation="MAKGKKKVRRKKKKIKRNIEKGQAHIKSTFNNTVVTITDKEGNVI
FT                   AWSSGGKVGYKGSRKSTPFAAQLAAEDAAKQAMDQGLKEVEIYVKGPGSGRESAIRSLQ
FT                   ATGLNVSIIKDVTPIPHNGCRPPKRRRI"
FT   gene            149519..150145
FT                   /locus_tag="Hore_01440"
FT   CDS_pept        149519..150145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_01440"
FT                   /product="ribosomal protein S4"
FT                   /note="PFAM: Ribosomal protein S4/S9 N-terminal domain; S4
FT                   domain; TIGRFAM: ribosomal protein S4, bacterial/organelle
FT                   type"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_01440"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68905"
FT                   /db_xref="GOA:B8D0T6"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8D0T6"
FT                   /protein_id="ACL68905.1"
FT                   /translation="MARYKGPVCRLCRREGEKLYLKGQRCYTDKCAIDRRSYPPGEHGR
FT                   RRNKPTEYGMQLREKQKVKRIYGILEKQFKRYFDMAEKMPGVTGENFLSILERRLDNVV
FT                   YRLGLATSRNEARQFVLHGHILVNGRKVNIPSYLVDEGDVISVKDSSRKSKRFKEVFEF
FT                   NEDLTPPKWLSVNLEKAEGKVVAMPTREDIDYPVEEHLIVEFYSR"
FT   gene            150187..151131
FT                   /locus_tag="Hore_01450"
FT   CDS_pept        150187..151131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_01450"
FT                   /product="DNA-directed RNA polymerase, alpha subunit"
FT                   /EC_number="2.7.7.6"
FT                   /note="PFAM: RNA polymerase Rpb3/RpoA insert domain;
FT                   Bacterial RNA polymerase, alpha chain C terminal domain;
FT                   RNA polymerase Rpb3/Rpb11 dimerisation domain; TIGRFAM:
FT                   DNA-directed RNA polymerase, alpha subunit, bacterial and
FT                   chloroplast-type"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_01450"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68906"
FT                   /db_xref="GOA:B8D0T7"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/TrEMBL:B8D0T7"
FT                   /protein_id="ACL68906.1"
FT                   /translation="MIEIEKPKIEKVECTDNYGKFEVAPLERGYGITLGNSLRRVLLSS
FT                   LPGAAITSVKIEGVRHEFSTIPGVVEDVSEVILNLKGVVLKYKGEDIEKITLNCEGEGE
FT                   VTAGDFKTSGDIEVINPDHHIATLAEGGKLQLEATVEFGRGYVTAEENKEHFDRVIGLI
FT                   PIDSSFSPIERANFKVENTRVGQVTDYDRLVLEVYTNGSISPEDAISLAAKIMVEHLEL
FT                   FLNLTDEVTDVEIMVEKEEEEKDKILDTTIEELDLSVRSSNCLKRAGINTVGELINKTE
FT                   DDLMKVRNLGKKSLQEIKEKLNELDLKLKEPEI"
FT   gene            151148..151492
FT                   /locus_tag="Hore_01460"
FT   CDS_pept        151148..151492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_01460"
FT                   /product="ribosomal protein L17"
FT                   /note="PFAM: Ribosomal protein L17; TIGRFAM: ribosomal
FT                   protein L17"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_01460"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68907"
FT                   /db_xref="GOA:B8D0T8"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8D0T8"
FT                   /protein_id="ACL68907.1"
FT                   /translation="MPQRKLGKTGAHRKAMFRNMLTDFFRHGRIETTLPKAKELRSLAE
FT                   KMITTAKTNDLSSRRKVLKYVKDKEVVKKLFDEIAPRYSERPGGYTRILKMYPRRGDAA
FT                   EKAIIELVEE"
FT   gene            151509..152330
FT                   /locus_tag="Hore_01470"
FT   CDS_pept        151509..152330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_01470"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter; TIGRFAM: cobalt transport
FT                   protein ATP-binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_01470"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68908"
FT                   /db_xref="GOA:B8D0T9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015856"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030947"
FT                   /db_xref="UniProtKB/TrEMBL:B8D0T9"
FT                   /protein_id="ACL68908.1"
FT                   /translation="MSLVEAKGVGYSYQEAGTDEPALKNIDLTVESGEFVAIIGSNGSG
FT                   KSTLARLLNVLLVPTEGEILIDGLKTSEKENIWEIRQKVGIVFQNPDNQLVATTVENDV
FT                   AFGLENLGVPSREIRLRVDNALKMVGMNGFQEHETHKLSGGQKQRVAIAGVIAMESDCI
FT                   VLDEPTAMLDPRGRKEVMDTVTYLNKEKGITIIHITHFMEEAALADKIYVMHQGQIYKS
FT                   GTPRDIFQDVEGLKSVNLDVPQVVELANNLRKAGMTVPRILSIDELVSCLC"
FT   gene            152324..153175
FT                   /locus_tag="Hore_01480"
FT   CDS_pept        152324..153175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_01480"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter; TIGRFAM: cobalt transport
FT                   protein ATP-binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_01480"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68909"
FT                   /db_xref="GOA:B8D0U0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015856"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030946"
FT                   /db_xref="UniProtKB/TrEMBL:B8D0U0"
FT                   /protein_id="ACL68909.1"
FT                   /translation="MLIQLKDVSHIYSGQNEKALESVNLRIQSNEFIGIVGHTGSGKST
FT                   LVQLFNGLIKPSEGKVFIEGIDIHQKKVSKREIRQKIGLVFQYPEHQLFEETIYDEVAF
FT                   GPRNLDLSEEEIKKRVIQALSLVGMDYETYKDRSPFHLSGGQQRKIAIAGVLAMMPEVL
FT                   ILDEPTAGLDPRGREQLIKLLKQLHRDYKMTVILISHRMEEISQLSNRVLVLSRGRIVM
FT                   DGKPEEVFTRVDEIRKLGLDLPQITEVLWELKNRGLRVRTDIFNVEEATREIITKMRES
FT                   QC"
FT   gene            153169..153960
FT                   /locus_tag="Hore_01490"
FT   CDS_pept        153169..153960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_01490"
FT                   /product="cobalt transport protein"
FT                   /note="PFAM: Cobalt transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_01490"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68910"
FT                   /db_xref="GOA:B8D0U1"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="InterPro:IPR024919"
FT                   /db_xref="UniProtKB/TrEMBL:B8D0U1"
FT                   /protein_id="ACL68910.1"
FT                   /translation="MLTDITIGQYIPGNTIVHNLDPRIKIIISIILITALFFIKSFTGF
FT                   LYFLLYITFIIFLAKLPVKRIIKGLKPILFLVILTLLLHVLFTRGGKVLWQWWVIRIDE
FT                   HGLFTGLFMASRILLLIAFTSLLTLTTSPLQLTDGIEYLLSPFKRIGVPANELAMMMTI
FT                   ALRFIPTLMEEAEKIMKAQKARGADFESGSIVQRARNLIPLLVPLFISAFRRADDLALA
FT                   MESRCYRGGEGRTRLHELQIQRRDIFSLIMSTIIAIFISFF"
FT   gene            154116..154856
FT                   /locus_tag="Hore_01500"
FT   CDS_pept        154116..154856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_01500"
FT                   /product="pseudouridylate synthase I"
FT                   /EC_number="4.2.1.70"
FT                   /EC_number="5.4.99.12"
FT                   /note="PFAM: tRNA pseudouridine synthase; tRNA
FT                   pseudouridine synthase; TIGRFAM: pseudouridylate synthase
FT                   I"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_01500"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68911"
FT                   /db_xref="GOA:B8D0U2"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:B8D0U2"
FT                   /protein_id="ACL68911.1"
FT                   /translation="MERNIKITVEYDGTNYSGWQIQNNTPETIQGVLSKCLFDINKSPV
FT                   KLIGASRTDAGVHARGQVANFRLKVGIPVERIPLALNSKLPPDIVCKDAEEVTEDFHAR
FT                   FDARGKRYIYRILNSEYPSPFLRNYTYFIPHNLNIDKMREAGSLLIGEHDFASFQASGG
FT                   SNKTTVRTITKLDIYRDQYQIKIEVCGNGFLYKMVRIIAGTLIEVGLGKRTVKSVGQLL
FT                   EIKDRDRAGFTAPPRGLTLIEVFY"
FT   gene            155009..155437
FT                   /locus_tag="Hore_01510"
FT   CDS_pept        155009..155437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_01510"
FT                   /product="ribosomal protein L13"
FT                   /note="PFAM: Ribosomal protein L13; TIGRFAM: ribosomal
FT                   protein L13, bacterial type"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_01510"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68912"
FT                   /db_xref="GOA:B8D0U3"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR023563"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/TrEMBL:B8D0U3"
FT                   /protein_id="ACL68912.1"
FT                   /translation="MSTYMAKPHEVERQWYVVDATDKVLGRLATKIAEILRGKHKPTFT
FT                   PHVDTGDYVIVVNADKVKLTGRKWEQKKYYRHSGYPGGLKEMSYEKLLQTKPELIIEKA
FT                   VRGMLPHNRLGRKMIKKLKVYAGPDHPHEAQKPEKLEL"
FT   gene            155457..155852
FT                   /locus_tag="Hore_01520"
FT   CDS_pept        155457..155852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_01520"
FT                   /product="ribosomal protein S9"
FT                   /note="PFAM: Ribosomal protein S9/S16"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_01520"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68913"
FT                   /db_xref="GOA:B8D0U4"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/TrEMBL:B8D0U4"
FT                   /protein_id="ACL68913.1"
FT                   /translation="MAAEVQYWGTGRRKTSTARVRLVPGSGKILINGKDVKEYFGRETL
FT                   IKDLKSPLELTNNLDSFDVLVNVNGGGLSGQAGAIRHGIARALLRVDKDYRKPLKKAGY
FT                   LTRDPRMKERKKYGLKKARKAPQFSKR"
FT   gene            156147..156974
FT                   /locus_tag="Hore_01530"
FT   CDS_pept        156147..156974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_01530"
FT                   /product="Extradiol ring-cleavage dioxygenase class III
FT                   protein subunit B"
FT                   /note="PFAM: Catalytic LigB subunit of aromatic
FT                   ring-opening dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_01530"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68914"
FT                   /db_xref="GOA:B8D0U5"
FT                   /db_xref="InterPro:IPR004183"
FT                   /db_xref="UniProtKB/TrEMBL:B8D0U5"
FT                   /protein_id="ACL68914.1"
FT                   /translation="MGVRMAALAPHPPIIIPEIGGRERDRVKKTITSMTRLAEDIKNVD
FT                   PDILITISPHGPVFSDAISIIYQEELTGDFSEFGAPEVNFKIDINLELIDRLKKNADKE
FT                   GIDVFTLNKQSLQNYSISPRLDHGVMVPLYFIQEAGVNKPVLPLTMGLLEYETLYKFGY
FT                   IINRTLDEMDLKAVIVASGDLSHRLKPGAPAGYSPVGRKFDQKLIELLEKKSYRKILKL
FT                   DKGLIEKAGECGLRPLIIMLGAIQNLELDVDIMSYEGPFGVGYAVVEFYQMEG"
FT   gene            156978..157502
FT                   /locus_tag="Hore_01535"
FT   CDS_pept        156978..157502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_01535"
FT                   /product="AMMECR1 domain protein"
FT                   /note="PFAM: AMMECR1; TIGRFAM: conserved hypothetical
FT                   protein TIGR00296"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_01535"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68915"
FT                   /db_xref="InterPro:IPR002733"
FT                   /db_xref="InterPro:IPR023473"
FT                   /db_xref="InterPro:IPR027485"
FT                   /db_xref="InterPro:IPR027623"
FT                   /db_xref="InterPro:IPR036071"
FT                   /db_xref="UniProtKB/TrEMBL:B8D0U6"
FT                   /protein_id="ACL68915.1"
FT                   /translation="MSKLSSYITGLARKTIEVYIKEGRQIKELTDLPEELKKRAGVFVS
FT                   LKKDGKLRGCIGTFLPTQDNIAQEIIKNAISAAVHDPRFGPVRVEELNKIEISVDILTE
FT                   PEKVNNRNELDPHKYGILVKKGHRTGLLLPDLEGIDSVEKQLEIARLKAGIRPDEEVEI
FT                   YRFQVKRYKER"
FT   gene            157508..158497
FT                   /locus_tag="Hore_01540"
FT   CDS_pept        157508..158497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_01540"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_01540"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68916"
FT                   /db_xref="GOA:B8D0U7"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR016431"
FT                   /db_xref="InterPro:IPR027596"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="UniProtKB/TrEMBL:B8D0U7"
FT                   /protein_id="ACL68916.1"
FT                   /translation="MEKAGFYIKMDNDKVQCLLCPHTCEIPVGEKGRCKVRVNEKGELI
FT                   LKNYGVITSMAIDPVEKKPLYHFYPGTRILSLGTYSCNFTCKHCQNWQISQEKPEVVTS
FT                   YSPKEVADLARDKNVIGVAYTYSEPSIWFEYVLKTSQVVKSNGMKNVLVTNGFINKKPL
FT                   KELIPYIDGINIDLKAYNPDFYQRICGGKLKPVLENIKYLRDKVHIEITTLLIPGLNDS
FT                   TEELEDMFQWLNSLDPDIPLHITRYFPRYRLNLPPTSIDELKEAYDLAKRYLNYVYLGN
FT                   INLDQGRDTVCPHCGQVVIERNIRVINRIKDGRCPWCGQEIKGEFRNK"
FT   gene            complement(159060..159788)
FT                   /locus_tag="Hore_01550"
FT   CDS_pept        complement(159060..159788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_01550"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_01550"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68917"
FT                   /db_xref="GOA:B8D0U8"
FT                   /db_xref="UniProtKB/TrEMBL:B8D0U8"
FT                   /protein_id="ACL68917.1"
FT                   /translation="MKERPLYVHKINYKDILIIVGFWYFMAAFGYLTRGLVFPYTPVLT
FT                   SIFHFLFVISGRLIFLALVIFYLVSLYGVDFRTLGLSTKNLKKEILLGTSLIFSLLFAV
FT                   LFLVNIPLSYKSLSGSNFNPLYTFDKPEHFINSIFSVIIIYPGTIIIALSEAFLLINIF
FT                   YRTLLGKLKPFPGLIISSFAYSILLLTSGPTQIIIKFIAAFITIFLYRKTRSLITPSIF
FT                   LAGYYTFYIIYIYGWEFIKF"
FT   gene            160135..161484
FT                   /locus_tag="Hore_01560"
FT   CDS_pept        160135..161484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_01560"
FT                   /product="phosphoglucosamine mutase"
FT                   /EC_number="5.4.2.10"
FT                   /note="PFAM: Phosphoglucomutase/phosphomannomutase,
FT                   alpha/beta/alpha domain II;
FT                   Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha
FT                   domain III; Phosphoglucomutase/phosphomannomutase,
FT                   C-terminal domain; Phosphoglucomutase/phosphomannomutase,
FT                   alpha/beta/alpha domain I; TIGRFAM: phosphoglucosamine
FT                   mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_01560"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68918"
FT                   /db_xref="GOA:B8D0U9"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR006352"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8D0U9"
FT                   /protein_id="ACL68918.1"
FT                   /translation="MGKLFGTDGVRGVANKELTGELAYKLGRAGGYYLTRDYKGGKKPV
FT                   VLIGKDTRISGDMLEAGLVAGLTSAGIDVIKLGIIPTPGVSFLTSSLDVQGGVMISASH
FT                   NPIADNGIKFFNQKGYKLTDEMEDEIENLIFNKLETIPYPTHEKIGVVDSAPEYYHKYV
FT                   DYLKETVDSDFSGLKIVVDCANGAAYKVAPEVLKKLRADVMVINGSSDGHKINVNCGST
FT                   NPEILRQKVIDEKADLGIAHDGDADRVIMVDERGQVVDGDKIMAICALDMMERGVLNKN
FT                   TLVTTPYSNLALKEIMEEKGGQVVITKNGDRYVLKEMLENGYNLGGEKSGHIIFLDYNN
FT                   TGDGVLTALQVVNIVKRTGHKLSELAAVLKPWPQRLANIKVKYKQKLKTSELIKQEISK
FT                   AEQLLGTEGRVFVRASGTEPVIRLMLEGKDEKRLLELEKKLGSIIEEELN"
FT   gene            161831..163657
FT                   /locus_tag="Hore_01570"
FT   CDS_pept        161831..163657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_01570"
FT                   /product="glucosamine--fructose-6-phosphate
FT                   aminotransferase, isomerizing"
FT                   /EC_number="2.6.1.16"
FT                   /note="PFAM: Glutamine amidotransferases class-II; SIS
FT                   domain; SIS domain; TIGRFAM:
FT                   glucosamine--fructose-6-phosphate aminotransferase
FT                   (isomerizing)"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_01570"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68919"
FT                   /db_xref="GOA:B8D0V0"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:B8D0V0"
FT                   /protein_id="ACL68919.1"
FT                   /translation="MCGIVGYIGEEEAPSILLEGLKRLEYRGYDSAGIAVSDGYNINVV
FT                   KKAGKLKELENIVFSSPPAGTAGIGHTRWATHGVPSEKNSHPHYDCHENIVVVHNGIIE
FT                   NFQELKEGLEAAGHSFVSDTDTEVIAHLIEDYYNGDLKDAVFKAVQKLDGSYALAVMTK
FT                   EEPNKIIAVRKDSPLIIGKGQGENYIASDIPAFLNNTRSFYILDDGEIAEVSKDKVVIY
FT                   DKNGVSIDKEIFKVDWDPEMAEKNGYEHYMLKEIHEQPDALRRVLANRVSTQGVNLDEI
FT                   GLTAEELKKYSQIQVVACGTAYYSGMVGKYIIEELARIPVKVDVASEFRYSNPIIDKDT
FT                   LVIVVSQSGETADTLAGLRLAREKGAEVLALTNVVGSTIAREADRVLYLKAGPEIAVAS
FT                   TKAYLTMVSVFYLLAVQFAKIKGTINDDEYMGLVSDLIRLPELASETIKVSEEKAKEKA
FT                   RYFIDYDNSFYIGRNFDYTIALEGALKLKEISYLHAEAYPAGELKHGPLALIEEGIPVV
FT                   AVVTRRSLYDKMLSNIKEVKARGANITAVAIAGDAEVEKAVDDVIFIPECNEFFSGLLA
FT                   VIPLQLLAYYTAVGRGFDVDQPRNLAKSVTVE"
FT   gene            163908..164909
FT                   /locus_tag="Hore_01580"
FT   CDS_pept        163908..164909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_01580"
FT                   /product="galactose-1-phosphate uridylyltransferase"
FT                   /EC_number="2.7.7.12"
FT                   /note="PFAM: Galactose-1-phosphate uridyl transferase,
FT                   C-terminal domain; Galactose-1-phosphate uridyl
FT                   transferase, N-terminal domain; TIGRFAM:
FT                   galactose-1-phosphate uridylyltransferase, family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_01580"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68920"
FT                   /db_xref="GOA:B8D0V1"
FT                   /db_xref="InterPro:IPR001937"
FT                   /db_xref="InterPro:IPR005849"
FT                   /db_xref="InterPro:IPR005850"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:B8D0V1"
FT                   /protein_id="ACL68920.1"
FT                   /translation="MSEIRKDIITGNYVVIAVERSKRPHDFAHKRPPKKGGFCPFCYGN
FT                   EQETPPEVAALRPDENTEPDTPGWEIRIVPNKFGAVKPDIELKDCKDGIYSYVTGRGAA
FT                   EVVIESPRHDSTLGSHEPEHVNNLLKMIRDRYNELGSDENISYVQVFKNFGPTAGASLE
FT                   HPHWQIISTPLIPTNVMDELKGTENYYRKHGTCPYCEMIEEELKDGSRIVAENDYFVAL
FT                   CPYASRFPFETWILPKEHNNCFGKLTGKEFGELTEMLQGIVKKLELGFDYPPYNIVVHS
FT                   NPVDGVDRDYYHWHIEILPRLAIMAVFELGTGYHINPTPPEIAADSLKEIGG"
FT   gene            164939..166507
FT                   /locus_tag="Hore_01590"
FT   CDS_pept        164939..166507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_01590"
FT                   /product="uncharacterized protein, probably involved in
FT                   trehalose biosynthesis"
FT                   /note="TIGRFAM: trehalose synthase-fused probable
FT                   maltokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_01590"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68921"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:B8D0V2"
FT                   /protein_id="ACL68921.1"
FT                   /translation="MALVTAYSFGEIIKELDNIISSIEPKKFKETRWFRKKADDLIGVE
FT                   LVDYGVLEYKPDERLVIPAVVSFHMQDRVNNTGYEELYYLPLVINKNYDEKCLLLLEIE
FT                   NTSYTAYVYEGIYSLEYNRVLDEFVKREGSLEMEKGGYLQAELLNYYNNVTRSYSLTEV
FT                   SSNSLALIERSSIIKTYRKMVPGVNPDLEIGLSLIRETGFRNFPEIKGYVSYQKNNINY
FT                   DICLIEQYVNNEGDVWAYTQRFLSRYLHYVSDNPGKDSLFTYLDPFIEEMEYLGEVIGE
FT                   LHLSLSGIEQDNFKPRKPTLAEIEAWHEEVQQNTELLFKLLKKNKNNINNDYNYYRVLN
FT                   MVLDKEKTIFGAVKRIFGLKDSLGKYMRVHGDLHLEQILKTEDDFMVLDFEGEPLKSIQ
FT                   HRRMKYSPLKDIAGMMRSFNYAGYAGYFDFVKKNQGINDRGRFIKAISLWEEEARTSFL
FT                   TGYQNKIRENNGDFLPPEDKFDQVLALFKIEKALYEGIYEINNRPDWLHIPLQGILDCV
FT                   EEIAD"
FT   gene            166560..167774
FT                   /locus_tag="Hore_01600"
FT   CDS_pept        166560..167774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_01600"
FT                   /product="glycogen synthase"
FT                   /note="PFAM: Glycosyl transferases group 1; TIGRFAM:
FT                   glycogen synthase, Corynebacterium family"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_01600"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68922"
FT                   /db_xref="GOA:B8D0V3"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR011875"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:B8D0V3"
FT                   /protein_id="ACL68922.1"
FT                   /translation="MDNLKVTMLTKEYPPYIYGGAGVHVDYLTGALKDIMNVEVRCFGD
FT                   QEGNKKGIDVTGYHPWEDLSEGSDIRFRKVLDPFSVDLAMVKDPIDSHLVHAHTWYTFM
FT                   AGFLAKKLYNIPLVTTIHSLEPLRPWKEEQLGRGYQLSLWMEKMGIENSDKVIAVSGEM
FT                   KKDILKYYDVDEDRVEVIYNGIDLDQYRYTDSDTYRRKYGIDLDKPYVLFVGRITRQKG
FT                   IIHLVNAIKYINENTQVVLCAGAPDTEEIEKEMTEKVAAIQEKRDGVIWINEMVSKEAV
FT                   IEFYSNAAVFCCPSVYEPFGIINLEAMACQTPVVASAVGGIKEVVVDGETGFLVNYEQK
FT                   DEKTGEPKNPEAFSKSLAEKINMVLEDDKLAKEMGKKGRERVEKYFSWESIARQTKKLY
FT                   ESIVQ"
FT   gene            complement(167834..168445)
FT                   /locus_tag="Hore_01610"
FT   CDS_pept        complement(167834..168445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_01610"
FT                   /product="Accessory gene regulator B"
FT                   /note="PFAM: Accessory gene regulator B"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_01610"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68923"
FT                   /db_xref="GOA:B8D0V4"
FT                   /db_xref="InterPro:IPR006741"
FT                   /db_xref="UniProtKB/TrEMBL:B8D0V4"
FT                   /protein_id="ACL68923.1"
FT                   /translation="MIKQVSDSMARYIRKTLNLSERREAYLRYGFQVIIGLLIEIIAIL
FT                   GSAYFLGIFWPVMIALITFLILRPYAGGVHLPRYSLCLIVSLIVFLAIGLISIYITLAT
FT                   PSLIIWLIIITTFSLFMVNKYAPADTEVHPIKEPDRRQKLKNVSFKILTIWFVIASLVT
FT                   IYFDQYSHLVLASSLGIIAEILVLHPFFYYLVDNYLPEHD"
FT   gene            169098..169481
FT                   /locus_tag="Hore_01620"
FT   CDS_pept        169098..169481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_01620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_01620"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68924"
FT                   /db_xref="GOA:B8D0V5"
FT                   /db_xref="UniProtKB/TrEMBL:B8D0V5"
FT                   /protein_id="ACL68924.1"
FT                   /translation="MENLNLILLLLSITENYILSIFILSILDKKISFKRLTLMSIGVSI
FT                   FVLSIRTLPVTPVMNIFVAMSAQILLVRYLYGIPILLGGIAAGLTDTIYMTLETILIPL
FT                   LGFIFNVELNMAMNTPLIRIKFL"
FT   gene            169496..170473
FT                   /locus_tag="Hore_01630"
FT   CDS_pept        169496..170473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_01630"
FT                   /product="signal transduction histidine kinase regulating
FT                   citrate/malate metabolism"
FT                   /note="PFAM: Histidine kinase-, DNA gyrase B-, and
FT                   HSP90-like ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_01630"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68925"
FT                   /db_xref="GOA:B8D0V6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR039506"
FT                   /db_xref="UniProtKB/TrEMBL:B8D0V6"
FT                   /protein_id="ACL68925.1"
FT                   /translation="MLLIVWLIKRYNINFREGFFHLSPDEIELIGKEEVKREKKITSTL
FT                   LLALFFIIIQGMFINMYNWSRRLSHLFDIELSFFTSSEFINIIVIILSIFLIWLVQHMV
FT                   GMLKIQRNEIIEKIKRKSKERLDWELRMQYHDFNHHLGMLSMMLQMDQVSAAKKYLKGM
FT                   VKELGKIKKLESSGNPALNALIQSKIARGQKMGVKIDVELVNPLKGEYIPDWELVRVCG
FT                   NLLDNSIEALQQLPRDTEKRVKIEIDGEKDILTISVTTFGVVIPDEIKEHIFERGFTSK
FT                   KEKGHGLGLAICKEITDKYQGQISIRKDEERETTTFTVKLPKNT"
FT   gene            170592..171308
FT                   /locus_tag="Hore_01640"
FT   CDS_pept        170592..171308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_01640"
FT                   /product="two component transcriptional regulator, LytTR
FT                   family"
FT                   /note="PFAM: LytTr DNA-binding domain; Response regulator
FT                   receiver domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_01640"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68926"
FT                   /db_xref="GOA:B8D0V7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B8D0V7"
FT                   /protein_id="ACL68926.1"
FT                   /translation="MTPEIIICDDDPQMVDLLVNFCESKLKLHILDKATKGQAVIDMVK
FT                   KSNPDILLLDINLPDMDGIQVARQIREFNPFVKIIFITGHENYYRDAFDVYAYDYISKD
FT                   SLTTRLPQSVKRIKEEMKLNRIKENGSNWHQITVNKKQHYINEDDIIYIKSEGRKLVIV
FT                   TYEEEYVTYGNLKDWGLKLGSTFFKCHRSYLINLNKIKEIRGGIPETVVIMGNRQKIPV
FT                   SRFRVSELKRVLNMAG"
FT   gene            171420..171689
FT                   /locus_tag="Hore_01650"
FT   CDS_pept        171420..171689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_01650"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_01650"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68927"
FT                   /db_xref="InterPro:IPR021637"
FT                   /db_xref="InterPro:IPR024702"
FT                   /db_xref="InterPro:IPR038292"
FT                   /db_xref="UniProtKB/TrEMBL:B8D0V8"
FT                   /protein_id="ACL68927.1"
FT                   /translation="MERYSDWDKWKKNLGQAVNLGKKIGLSEETVVKVGEKIGDFLEKR
FT                   VEPENREQRVLKELWDVASQDEQRHLASMIVKMVQKDGKEGDRA"
FT   gene            171770..172147
FT                   /locus_tag="Hore_01660"
FT   CDS_pept        171770..172147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_01660"
FT                   /product="Holo-(acyl-carrier-protein) synthase"
FT                   /EC_number="2.7.8.7"
FT                   /note="PFAM: 4'-phosphopantetheinyl transferase
FT                   superfamily; TIGRFAM: holo-[acyl-carrier-protein] synthase;
FT                   phosphopantethiene--protein transferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_01660"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68928"
FT                   /db_xref="GOA:B8D0V9"
FT                   /db_xref="InterPro:IPR002582"
FT                   /db_xref="InterPro:IPR004568"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8D0V9"
FT                   /protein_id="ACL68928.1"
FT                   /translation="MIRGIGIDIVEVNRISDMVDKWGERFLNKVYTPYEVNYCKFKSNT
FT                   YECLAGRFAAKEAFVKMLGTGFKHIYFKDIEVRSDEKGKPYLRIKGNADRLTKESGIKR
FT                   IHLSISHERKFAIAFVVGEEG"
FT   gene            172150..173691
FT                   /locus_tag="Hore_01670"
FT   CDS_pept        172150..173691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_01670"
FT                   /product="carbohydrate kinase, YjeF related protein"
FT                   /note="PFAM: YjeF-related protein N-terminus; Carbohydrate
FT                   kinase; TIGRFAM: yjeF N-terminal region; yjeF C-terminal
FT                   region, hydroxyethylthiazole kinase-related"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_01670"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68929"
FT                   /db_xref="GOA:B8D0W0"
FT                   /db_xref="InterPro:IPR000631"
FT                   /db_xref="InterPro:IPR004443"
FT                   /db_xref="InterPro:IPR017953"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR030677"
FT                   /db_xref="InterPro:IPR036652"
FT                   /db_xref="UniProtKB/TrEMBL:B8D0W0"
FT                   /protein_id="ACL68929.1"
FT                   /translation="MVVLTPGQMRKADQLAIKAGIPDLVLMEVAGRETAERVRHLLPEP
FT                   GHVVIFAGKGNNGGDGLVAARYLDMWGYDVNLVLLRPGDEYRGSSAANFKACKARSINI
FT                   SIFSDVKTRLNKELERADLVIDAMLGTGLTGEVRGEFARAIEMINDQSCPVVSVDIPSG
FT                   VEGETGRVLGMAVKADLTVTMACPKVGLLVYPGKKYVGNLHVVDIGIPGEIIMKVKPDH
FT                   FVLTENEARLLLPEREVDGHKGSFGRVLMVGGSRGMSGAPSLGGLAALRVGAGLVEVAV
FT                   PESIQPLVAITASELITSGLPEKDGKLNTNSDSIITKKAERADVLALGPGLGRGRGIRT
FT                   VVASVIKKAKKPVVLDADALNEIESPDILKESEVPLILTPHPGEMARLLDTDIKGVQSN
FT                   RIKIAREFATTYSVYLILKGADTVIALPDGTIYINDTGNEGMATAGSGDVLTGMVSGLI
FT                   AQGLDIQEAVVLAPYLHGLSGDKARDNVTSYSLTAGTIIEFIAGAIMDLTTSVIN"
FT   gene            173717..174856
FT                   /locus_tag="Hore_01680"
FT   CDS_pept        173717..174856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_01680"
FT                   /product="alanine racemase"
FT                   /EC_number="5.1.1.1"
FT                   /note="PFAM: Alanine racemase, C-terminal domain; Alanine
FT                   racemase, N-terminal domain; TIGRFAM: alanine racemase"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_01680"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68930"
FT                   /db_xref="GOA:B8D0W1"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR011079"
FT                   /db_xref="InterPro:IPR020622"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8D0W1"
FT                   /protein_id="ACL68930.1"
FT                   /translation="MNKRITRPTWAEIDLSCLQFNFNQVKEILGSNVKIMSVVKADAYG
FT                   HGVIPVAKTLVEAGTQRLAVAIPEEGVELREAGLSVPIQVLGEVLPSQYELLFKYDLIP
FT                   TVGREETALSLNRLAAKYNVVKKVHIKVDTGMGRIGVRPREAVGFVKKVNSLSNIKIEG
FT                   LMTHFASADERDKSYTYEQWDKFKQVLDGLNKLRIDIPIKHSSNSAAIIDFKKFGLDMV
FT                   RPGIMLYGLKPSRDLINNIDLKPVLTWKTRIVYLKEVPPGTGISYGTTYVTNRKSKIAT
FT                   LPVGYADGYPRILSNQGQVLVRGRKAPIRGRVCMDQIMIDVTEIPDVRVGDEVVLIGEQ
FT                   GTQKISATDIAEKADTINYEIVCGISQRVPREYKNKIGG"
FT   gene            174860..175141
FT                   /locus_tag="Hore_01690"
FT   CDS_pept        174860..175141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_01690"
FT                   /product="Phosphotransferase system, phosphocarrier protein
FT                   HPr"
FT                   /note="PFAM: PTS HPr component phosphorylation site;
FT                   TIGRFAM: Phosphotransferase System HPr (HPr) Family"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_01690"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68931"
FT                   /db_xref="GOA:B8D0W2"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/TrEMBL:B8D0W2"
FT                   /protein_id="ACL68931.1"
FT                   /translation="MITKQVYVNIKTGLHARPASYFVDVASKFVSDINISFSGVTVNAK
FT                   SIIGVLSLSVGEGDQVTLVVDGPDEEEALDALEKILSGEDGLLDNQVG"
FT   gene            175176..175724
FT                   /locus_tag="Hore_01700"
FT   CDS_pept        175176..175724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_01700"
FT                   /product="dCTP deaminase"
FT                   /EC_number="3.5.4.13"
FT                   /note="PFAM: 2'-deoxycytidine 5'-triphosphate deaminase
FT                   (DCD); dUTPase; TIGRFAM: deoxycytidine triphosphate
FT                   deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_01700"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68932"
FT                   /db_xref="GOA:B8D0W3"
FT                   /db_xref="InterPro:IPR011962"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8D0W3"
FT                   /protein_id="ACL68932.1"
FT                   /translation="MILSDRTINQMIKNGELVVEPLEEYQIQPASIDLRLGSSFLKIDE
FT                   NLMEVMTLNDEIKYVNLERKEIIVPPNSFLLATTREYIKLPPDITAFVEGRSSIGRMGL
FT                   FIQNAGWVDPGFEGQITLELYNANRLPIKLTAGRRICQLVLARMDKEAKTPYQGKYLYQ
FT                   KKAVGSRVYQDLENKQNKN"
FT   gene            175754..178018
FT                   /locus_tag="Hore_01710"
FT   CDS_pept        175754..178018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_01710"
FT                   /product="putative DNA helicase"
FT                   /note="PFAM: DbpA RNA binding domain; TIGRFAM: DNA
FT                   helicase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_01710"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68933"
FT                   /db_xref="GOA:B8D0W4"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004483"
FT                   /db_xref="InterPro:IPR005580"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041677"
FT                   /db_xref="InterPro:IPR041679"
FT                   /db_xref="UniProtKB/TrEMBL:B8D0W4"
FT                   /protein_id="ACL68933.1"
FT                   /translation="MKEIIVTGINDKIGPGDIVGAFINETKIDNNDIGKINIRKNKAIV
FT                   ELADEVAEKVINIMDGNKVGGLQVKVYPGYNRNRREKNHRYTKKVSNYVNKFKELVELE
FT                   RKEEMERHEIEIKRLSGEERQKNGRAILHLRGRDEGTGLGNKYIVKFVRQWQGEKLPET
FT                   EIKVGDLVMISKHNPLDSSNPTATVVEKTNYSITVVFDKKPPSFIYKKGLRMDLYVNDI
FT                   TFQRMLSALDQIRRAKGNLGRIRNILLGIKKPGWYRREPEIIEWVNDDLNLSQKNAVKK
FT                   AIQARDIYLIQGPPGTGKTVTAVEVVNQAVKSGKRVLATAESNVAVDNLVERLVGYGLN
FT                   VIRVGHPFRVTPLLREHTLDYRVLDHPLYKKALNLREKASDLKEKQEGLTSPSGQWRRG
FT                   MSDKQIRINARKNRSFRGVPAKRIKEMAKWLGIQEEINQLFDKINSLEERAVRDLLNSA
FT                   DVVCSTNSTAGSELLEGWEFELVVIDEATQATEPGALIPLIKAQKAVLIGDHKQLPPTV
FT                   LSQKADKQGLSKSLFERLYSLYGDKYCSLLEIQYRMNDLIMEFSNSHFYGGRLKSAPEV
FT                   RNHTLRDLGIEISEGKCFTEKGFDPDNPVVFLDTSNMEARERSLPNSDSYDNPVEAEIV
FT                   LDLVGEALKLGLEQRHIAVITPYKDQVDLLNHLSRFENLEINTVDGFQGREKEVVMISL
FT                   VRSNKHRNIGFLRDLRRLNVAITRPKRKLIIIGDSNTISGHEVYSSLVDYVRENGLFYT
FT                   L"
FT   gene            178127..178282
FT                   /locus_tag="Hore_01720"
FT   CDS_pept        178127..178282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_01720"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_01720"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68934"
FT                   /db_xref="GOA:B8D0W5"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:B8D0W5"
FT                   /protein_id="ACL68934.1"
FT                   /translation="MFKKKRDKELTEEQRKEIAKKMIEGYKKMAALNKELAEDGLISRE
FT                   ADETDG"
FT   gene            178570..178845
FT                   /locus_tag="Hore_01730"
FT   CDS_pept        178570..178845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_01730"
FT                   /product="putative transcriptional regulator, CopG family"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_01730"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68935"
FT                   /db_xref="GOA:B8D0W6"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:B8D0W6"
FT                   /protein_id="ACL68935.1"
FT                   /translation="MGNLKRVMVSLPTSLLKEVDGFVQKGSGNRSEFIREAMKLYLHEK
FT                   KRQEIREQMRTGYMEMSDINRELADEGITYDALTINFYEKSLAECE"
FT   gene            178847..179197
FT                   /locus_tag="Hore_01740"
FT   CDS_pept        178847..179197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_01740"
FT                   /product="transcriptional modulator of MazE/toxin, MazF"
FT                   /note="PFAM: PemK-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_01740"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68936"
FT                   /db_xref="GOA:B8D0W7"
FT                   /db_xref="InterPro:IPR003477"
FT                   /db_xref="InterPro:IPR011067"
FT                   /db_xref="UniProtKB/TrEMBL:B8D0W7"
FT                   /protein_id="ACL68936.1"
FT                   /translation="MNVTRGDVFYADLNPVVGSEQGGVRPVLIIQNDIGNKYSPTVIVA
FT                   AITSKINKAKLPTHVEIAASESNLEKDSVILLEQIRTIDKKRLQRHVTHLDNGIIEKVD
FT                   EAIEISLGLIEL"
FT   gene            179440..180444
FT                   /locus_tag="Hore_01750"
FT   CDS_pept        179440..180444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_01750"
FT                   /product="asparaginase"
FT                   /EC_number="3.5.1.1"
FT                   /note="PFAM: L-asparaginase II"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_01750"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68937"
FT                   /db_xref="GOA:B8D0W8"
FT                   /db_xref="InterPro:IPR010349"
FT                   /db_xref="UniProtKB/TrEMBL:B8D0W8"
FT                   /protein_id="ACL68937.1"
FT                   /translation="MPTKIAEVYRGKLVESIHRGDIVVVTTDERITYYSGSRDKVTYWR
FT                   SAAKPIQALPVIFSGAAEKYGLTPEEIAIMAASHSGENLHVETVKGILNKIGLDESALK
FT                   CGVHPPVHKETARNIWMKGGKVSPLHNNCSGKHAGLLTLCQFYGWSIDDYLNQDHPLQR
FT                   LLLEVISDITGVPESDIELGVDGCGVVVFGLPLKNMAYAYARLANPEYLPSKYRKAARH
FT                   IVESMTSYPEMVGGSERFNTDLLTVAGDKLVAKSGAEGVFCIGVFGGPGVAVKIEDGNS
FT                   RGIPPVVINLLKQLNLLTPEEIAKMRKYHKPAVKNNRKEKVGFIKPVFTLNKA"
FT   gene            180621..181778
FT                   /locus_tag="Hore_01760"
FT   CDS_pept        180621..181778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_01760"
FT                   /product="amidohydrolase"
FT                   /note="PFAM: Amidohydrolase family; Amidohydrolase family"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_01760"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68938"
FT                   /db_xref="GOA:B8D0W9"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B8D0W9"
FT                   /protein_id="ACL68938.1"
FT                   /translation="MLALVKGKVLTMAGKRYEEGLVIIDKGKIREVGPYRKPPADVEVI
FT                   DVSGKVVMPGLIDAHTHLGIGEDGLGWEGRDYNEMTDPITPHLRAIDAINPEDDGFATA
FT                   RKNGVTTVMTGPGSANVLGGESVAVKTMGKTVDEMIIKNPVGIKAAFGENPKRVYHNQK
FT                   KSPSTRMAVAALMREAFMEAQDYLKSKEEKISKNKAFKRNLKMESLARVIKGEIPLKAH
FT                   AHRADDIMTILRIAREFNIKVTLEHCTEGHKIAEEIVRSGVPAIVGPTLTGKTKVELKN
FT                   RTFETPGILSKAGVKVALMSDHPVIPVENLTVYAALAVKSGMNREEALKAITINPAEIL
FT                   GIDDRVGSLEPGKDADLVVFDRDPLDIMSKVEMVFINGDRVMDLK"
FT   gene            182203..183957
FT                   /locus_tag="Hore_01770"
FT   CDS_pept        182203..183957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_01770"
FT                   /product="putative PAS/PAC sensor protein"
FT                   /note="PFAM: Putative Fe-S cluster; PAS fold; PAS fold;
FT                   Iron only hydrogenase large subunit, C-terminal domain;
FT                   4Fe-4S binding domain; 4Fe-4S binding domain; TIGRFAM: PAS
FT                   domain S-box"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_01770"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68939"
FT                   /db_xref="GOA:B8D0X0"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR004108"
FT                   /db_xref="InterPro:IPR007202"
FT                   /db_xref="InterPro:IPR009016"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B8D0X0"
FT                   /protein_id="ACL68939.1"
FT                   /translation="MTVLKIKETDCQDCYKCVRFCPVKAIKIKDGHASIIGERCLGDGG
FT                   CVEICPQKAKEVRQDWPVVKDWLEKGEEIIVSLAPSYLVAYRNKSPQNLVNTLYSLGFK
FT                   KVEETAIWADYVARAHQELLTMDEKNKNILREKGIFRVKKPVITSSCPGVVKLIDYYYP
FT                   HLKEHLAPVLSPMMAHGKYLKEQAPERKVVFVGPCAAKKEEATRAGYIDAVLTFTEIQE
FT                   LIKSEGNEVEVKQDITPELATEKGAFFPASGGFYKTAGLKVTEIDNKFLTVTGIEKLQE
FT                   LFSSFEKVQNLELIEAMACEGGCLAGAFFPDSASLWERRQKLLERIEQQERKKIVGEQN
FT                   LEQNVKLTFMNLNLDNKTNDPEEPDEEDIKKILAKTGKYTEQDELNCGACGYNTCREKA
FT                   RAVYYGWAELEMCLPYMRQRAESLANKFLESVPNGVVVIDSTFTIQEVNPTILEMFNRE
FT                   GVNLIGKTLDELLTDISHFAEVMETQIQKEGKIKHGDRVFEELIFPIEDEDLIVGIFSD
FT                   ITEMEKQRKDLKDLKQETLLNARKVIDKQMRVAQEIAGLLGETTAETKVTLSRLIDIIS
FT                   GEEEKNDG"
FT   gene            183947..185122
FT                   /locus_tag="Hore_01780"
FT   CDS_pept        183947..185122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_01780"
FT                   /product="Serine/threonine specific protein phosphatase"
FT                   /EC_number="3.1.3.16"
FT                   /note="PFAM: Stage II sporulation protein E (SpoIIE)"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_01780"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68940"
FT                   /db_xref="GOA:B8D0X1"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:B8D0X1"
FT                   /protein_id="ACL68940.1"
FT                   /translation="MMVEKGIRQLKKFNEELCGDKVEVYHDDRRFLMALSDGLGSGVKA
FT                   NILATLTSKIIITMVKEGMGLSDVIDTIGKTLPICQVRNISYATFTIVEIDKINSIATL
FT                   IEFDNPGALIFRDNRLIEIEGVKEEFKNHKVKKSIFKLQYGDILVLFSDGVIHAGIGAK
FT                   LKLGWPRKEVARYIHKIIRRREGISMEELADWLAEACNNFYDNKPGDDTTIAAIRVRPS
FT                   QSVTILVGPPKDRSKDKEVTELLMKEEGKKIVCGGTTSKLVARELGKNIKVELDEKSKN
FT                   MSKVGQIPPGGTIEGIDLVTEGVLTLQRVYSVLSGEEKLPKGNYGINKTLYTFVETLRE
FT                   SDVITFLVGRAINPAYQNPDLPLATGVKEHLINKIASILQRQGKRVNIKYF"
FT   gene            185134..185637
FT                   /locus_tag="Hore_01790"
FT   CDS_pept        185134..185637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_01790"
FT                   /product="NADH dehydrogenase I subunit E"
FT                   /EC_number="1.6.5.3"
FT                   /note="PFAM: Respiratory-chain NADH dehydrogenase 24 Kd
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_01790"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68941"
FT                   /db_xref="GOA:B8D0X2"
FT                   /db_xref="InterPro:IPR002023"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR041921"
FT                   /db_xref="InterPro:IPR042128"
FT                   /db_xref="UniProtKB/TrEMBL:B8D0X2"
FT                   /protein_id="ACL68941.1"
FT                   /translation="MADKEAARHNFTRVNEIIEKHGKDQSKLIPILQEVQKEYRYLPEE
FT                   ILTYIATVMDLSPATVYGVATFYAQFSLDPKGKYVINVCDGTACHVSGSLPVLNAIRKK
FT                   LNLEDGKFTTDDLMFTVETVSCLGACGLAPVVTINGKVYGKMTPEAIEVIIDELMGRDT
FT                   DDQE"
FT   gene            185624..187498
FT                   /locus_tag="Hore_01800"
FT   CDS_pept        185624..187498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_01800"
FT                   /product="NADH dehydrogenase I subunit F"
FT                   /EC_number="1.6.5.3"
FT                   /note="PFAM: Respiratory-chain NADH dehydrogenase 51 Kd
FT                   subunit; 4Fe-4S binding domain; 4Fe-4S binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_01800"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68942"
FT                   /db_xref="GOA:B8D0X3"
FT                   /db_xref="InterPro:IPR011538"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="InterPro:IPR019575"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR037207"
FT                   /db_xref="InterPro:IPR037225"
FT                   /db_xref="UniProtKB/TrEMBL:B8D0X3"
FT                   /protein_id="ACL68942.1"
FT                   /translation="MIKSKTDLEEAIKKAKDKLQEEGLRILVCAGTGCVAGGSLEIFDE
FT                   LKKKVENLSLPVKVGLLEEKESNVTVKTSGCHGFCEKGPLVKIEPLGILFTKVSQDDVD
FT                   EIINDTIKAGKLVDKLIYKSPDGEAYSNEKEIPFYANQNRIALSNCGNIDPEDLDDYLA
FT                   HGGYKALSKALLEMSPEEVCKEVTESGLRGRGGGGFPTGKKWEFAYREKADQKYVIVNG
FT                   DEGDPGAFMDRSIMEGDPHRVIEGITIAGYATGATKGYIYVRAEYPLAVKRLRKAINDA
FT                   YDQGLLGEDILGSGFDFDLMIKEGAGAFVCGEETALMASIEGKRGMPNPKPPFPAQSGL
FT                   WGKPTTINNVETLANVPQIILKGADWFTSLGTENSPGTKTFAITGDVANTGLIEVPMGM
FT                   TLRELVYDIGGGIKNNNKFKAVQIGGPSGGCLTEEHLDMPMDFDSLQEVGAMIGSGGLV
FT                   VMDENTCMVEVARFFMEFTQNESCGKCVLCREGTKQMLKILERIVEGKGTMEDLDLLEE
FT                   LALAVKDGSLCGLGKTAPNPVLTTLKYFRDEYEAHVKDKKCPAGVCEALKSYKINPDLC
FT                   KGCSLCARKCPVDAISGKVKEPFVIDQDKCIKCGACYEACKFNAVEVG"
FT   gene            187499..189499
FT                   /locus_tag="Hore_01810"
FT   CDS_pept        187499..189499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_01810"
FT                   /product="NADH dehydrogenase I subunit G"
FT                   /EC_number="1.6.5.3"
FT                   /note="PFAM: Iron only hydrogenase large subunit,
FT                   C-terminal domain; 4Fe-4S binding domain; 2Fe-2S
FT                   iron-sulfur cluster binding domain; Iron hydrogenase small
FT                   subunit; TIGRFAM: hydrogenases, Fe-only"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_01810"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68943"
FT                   /db_xref="GOA:B8D0X4"
FT                   /db_xref="InterPro:IPR000283"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR003149"
FT                   /db_xref="InterPro:IPR004108"
FT                   /db_xref="InterPro:IPR009016"
FT                   /db_xref="InterPro:IPR013352"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019574"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036991"
FT                   /db_xref="UniProtKB/TrEMBL:B8D0X4"
FT                   /protein_id="ACL68943.1"
FT                   /translation="MSDTLVINGKTVAINGEKNLLELIRKQGIELPTFCYHSELSVYGA
FT                   CRMCLVEEENMGIIATCSTAPQPGMNIKTHSPRVQRIRKMALELLLANHDRDCTTCSRN
FT                   GNCKLQDLAQRFGIDEVRFGTREEVLPVDNSSPSIVRNPNKCILCGDCVRTCQEIQGIG
FT                   VLDFANRGSKSIVAPAFNKDLIEVDCVACGQCVAVCPTGALTIKSDISRVWEAINDPAK
FT                   TVVVQIAPAVRVAIGEEFGMEPGEIQMGQLVAALKRLGFDKVFDTSFAADLTVMEETAE
FT                   FIERFKEGKKLPQFTSCCPAWVKYAEEYAQDFLDNLSSCKSPQQMFGSVAKRFYSQDLG
FT                   IDPEDMVVVSIMPCTAKKFEAQRPEFITDGVPDVDVVITTQEVASMIKKSGLVFSELGI
FT                   ESLDMPLGFSTGAGVIFGVTGGVSEAVLRNAYEKITGDNLDDVEFKEVRGFDGIKEAEV
FT                   ELDGKTVRLAVVHGLSNVGDLIKAIKKGEKEYDLIEVMACPGGCIGGGGQPTPNNTEVR
FT                   EKRAQGMYNCDKLSALHKSQENPMVNDFYRRWFGEENSDVTHKHLHTSYEEKQRINTKG
FT                   IELNTSESSEEVVPVQVCVGTCCYLHGSYDLLQGLIERVEEEGLSDKVDIEATFCFENC
FT                   KNAPSVKVGNQLLSKVESVDDILKHLKPALK"
FT   gene            complement(189781..190083)
FT                   /locus_tag="Hore_01820"
FT   CDS_pept        complement(189781..190083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_01820"
FT                   /product="branched-chain amino acid transport"
FT                   /note="PFAM: Branched-chain amino acid transport protein
FT                   (AzlD)"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_01820"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68944"
FT                   /db_xref="GOA:B8D0X5"
FT                   /db_xref="InterPro:IPR008407"
FT                   /db_xref="UniProtKB/TrEMBL:B8D0X5"
FT                   /protein_id="ACL68944.1"
FT                   /translation="MNDNLLFIVTGMAVVTYLPRLIPMLFFHQLDLPPFLQRFLRFIPY
FT                   AVLTSLIFPGILFSTGNPVSALAGGLVAVILALYEVNLFLVVIGSICGVFLTGLF"
FT   gene            complement(190076..190786)
FT                   /locus_tag="Hore_01830"
FT   CDS_pept        complement(190076..190786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_01830"
FT                   /product="AzlC family protein"
FT                   /note="PFAM: AzlC protein; TIGRFAM: 4-azaleucine resistance
FT                   probable transporter AzlC"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_01830"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68945"
FT                   /db_xref="GOA:B8D0X6"
FT                   /db_xref="InterPro:IPR011606"
FT                   /db_xref="UniProtKB/TrEMBL:B8D0X6"
FT                   /protein_id="ACL68945.1"
FT                   /translation="MRSRDDFLSGMKKALPVAFGYIPIAITYGILAENTGIPAYITVLM
FT                   SVVVFAGASQFVALNLIALGLGSWEIISTTFVVNFRHFLMSASLSQKIIRKISGKLIPI
FT                   ISFGVTDESFSILSMVSTKKLNSYFILGVNTLGYLAWVGGSFAGVYLGRGLPEALQNSM
FT                   GIALYAMFIGLLIPNIKKSRAALGISLMALVTNSFLYWSPFRVLSTGWKIIITTVVVSA
FT                   TGAFLFPEEVITNE"
FT   gene            190951..191499
FT                   /locus_tag="Hore_01840"
FT   CDS_pept        190951..191499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_01840"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: Cupin domain; Helix-turn-helix"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_01840"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68946"
FT                   /db_xref="GOA:B8D0X7"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B8D0X7"
FT                   /protein_id="ACL68946.1"
FT                   /translation="MNEINANIGKKLRKLRIGKGYSLGDLEEIAGVSKSMLGQIERGKT
FT                   NPTVKTLWKVARSLNVPFSFFIEEETSPVKVFSPSKEVLVSGKKGRYRVYPLMPLNRTK
FT                   NFEIYLMEIEPGYSYKSEPHSQGVEEFVMVKEGILRLTVNSKEYKAREEEIIHFPGDRV
FT                   HIYHNISETPLKAYVLVCY"
FT   gene            191584..192645
FT                   /locus_tag="Hore_01850"
FT   CDS_pept        191584..192645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_01850"
FT                   /product="histidinol phosphate aminotransferase"
FT                   /EC_number="2.6.1.9"
FT                   /note="PFAM: Aminotransferase class I and II; TIGRFAM:
FT                   histidinol-phosphate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_01850"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68947"
FT                   /db_xref="GOA:B8D0X8"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR005861"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B8D0X8"
FT                   /protein_id="ACL68947.1"
FT                   /translation="MSKYWSNTIKDIEPYVPGEQPKDKTYIKLNTNENPYPPSPRVIKA
FT                   IKENTNNNLRLYPDPGCDNLKEAIASYYNLDRDQVFVGNGSDEVLAFSFMAFFDRERPL
FT                   LFPTITYSFYPVYCRLLNIEYRQVPLQDDFTLNVEEFYRENHGIIFPNPNAPTGIYLPL
FT                   SKVEKIVAYNIDKVVIIDEAYIDFGGKSAVSLIDKYPNLLIVQTFSKSRSLAGLRIGFA
FT                   MGNKKLIEGLNRVKNSINSYTLDTLAMIAAREAIKDDKYFEETRLKIIKTRDRVAKNLR
FT                   KIGFKVLDSRANFIFISHQSYPACDLFNELKDKGILVRYFNQPGISNYLRVSVGTEREM
FT                   DVFIKTIEEIISG"
FT   gene            192843..193217
FT                   /locus_tag="Hore_01860"
FT   CDS_pept        192843..193217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_01860"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_01860"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68948"
FT                   /db_xref="GOA:B8D0X9"
FT                   /db_xref="InterPro:IPR025273"
FT                   /db_xref="UniProtKB/TrEMBL:B8D0X9"
FT                   /protein_id="ACL68948.1"
FT                   /translation="MSEGTKEVSSAPLILGIIGGVLGIPASFCAGACAGFITAMSSTAE
FT                   EASAVADFYMWVCLIGAVLGLIFAIRSKKSPKSSGIVMIIAAVLTGFTVIAGNGLALIA
FT                   GILFLIAGILSINEAKKVAA"
FT   gene            193362..194135
FT                   /locus_tag="Hore_01870"
FT   CDS_pept        193362..194135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_01870"
FT                   /product="prolipoprotein diacylglyceryl transferase"
FT                   /EC_number="2.4.99.-"
FT                   /note="PFAM: Prolipoprotein diacylglyceryl transferase;
FT                   TIGRFAM: prolipoprotein diacylglyceryl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_01870"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68949"
FT                   /db_xref="GOA:B8D0Y0"
FT                   /db_xref="InterPro:IPR001640"
FT                   /db_xref="UniProtKB/TrEMBL:B8D0Y0"
FT                   /protein_id="ACL68949.1"
FT                   /translation="MLPYIILGKQVYIPTYNLMFGIGLILGILVFESGLKKVALTRVEY
FT                   ERMYTIIPLSIVIAFIGALFFDYLVHGHLGGFTFYGGLVSGAIVFLIFLRIYNLNIYKF
FT                   LNLLIPSVIIGHAVGRIGCFLAGCCYGKPTDSLLGVIFPAGSLSSLKYGMGTRVHPTQL
FT                   YESVFLFLLFIVIIKLVPFYKRFGIYLTGYGLFRFLIEFLRGDNRGIIFNQEFFSPSQF
FT                   ISILLMSAGIIYLNKIVLPEGDIDELHSDNQTGTL"
FT   gene            194098..194808
FT                   /locus_tag="Hore_01880"
FT   CDS_pept        194098..194808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_01880"
FT                   /product="DNA alkylation repair enzyme"
FT                   /note="PFAM: DNA alkylation repair enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_01880"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68950"
FT                   /db_xref="InterPro:IPR014825"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:B8D0Y1"
FT                   /protein_id="ACL68950.1"
FT                   /translation="MNYIQIIKQELYKYREPEKADFLPGFFKCYPGGYGEGDQFIGVRV
FT                   PHQRKVAKKYYKQISLKDVSKLLNDPVHEYRLTGLFILINKYQKADQNKKQEIVDLYLN
FT                   HLDGVNNWDLVDSSADKILGDFLFNRDKSLLYKLAKSGELWKQRIAIIATKYFIKKNQY
FT                   RHTLEIAKLLLNHDHDLIHKAVGWMLREVGKRNQAIEINFLKKHYKKMPRTMLRYAIEK
FT                   FEPKLRKKFLNGQI"
FT   gene            194836..195729
FT                   /locus_tag="Hore_01890"
FT   CDS_pept        194836..195729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_01890"
FT                   /product="uncharacterized membrane protein"
FT                   /note="PFAM: Integral membrane protein DUF125;
FT                   Rubrerythrin"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_01890"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68951"
FT                   /db_xref="GOA:B8D0Y2"
FT                   /db_xref="InterPro:IPR008217"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR039376"
FT                   /db_xref="UniProtKB/TrEMBL:B8D0Y2"
FT                   /protein_id="ACL68951.1"
FT                   /translation="MTEGKKEKQLDSRTKKMILDYQKNEITEYKIYTRLAKRIKDKNNK
FT                   KVLEEIGRDELKHYEFWKKHTGQDVKPSKWKVFFYYWIAVIFGLTFGIKLMEKGEEEAQ
FT                   VIYKQVADKIPGAASIMEDEYRHEHELLNLLEEEHLQYVGSVVLGLNDALVELTGTLAG
FT                   LSFALKNTNLIAIAGLITGIAASFSMGASEYLSTKSESDHGEALKSSMYTGGAYIITVF
FT                   FLVLPFLLLAGYMTALLVTILLAILIIFVFNYYIAVAKDLDFKKRFLEMATISLGVAVL
FT                   SFGIGYLVRVFLGVDV"
FT   misc_feature    195827..196114
FT                   /note="T-box leader"
FT   gene            196169..197080
FT                   /locus_tag="Hore_01900"
FT   CDS_pept        196169..197080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_01900"
FT                   /product="Prephenate dehydratase"
FT                   /EC_number="4.2.1.51"
FT                   /note="PFAM: ACT domain; Prephenate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_01900"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68952"
FT                   /db_xref="GOA:B8D0Y3"
FT                   /db_xref="InterPro:IPR001086"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR008242"
FT                   /db_xref="InterPro:IPR018528"
FT                   /db_xref="UniProtKB/TrEMBL:B8D0Y3"
FT                   /protein_id="ACL68952.1"
FT                   /translation="MCPARYGYLGPGGTFCEKAALKYFGGGHEMISFRTIKEVVRNVKE
FT                   GSIEKGVIPLENSLEGSVNLSLDLLVKESNIIITGEVIIPINHNLIGQKGLEVGNIKKV
FT                   LSHPQAIAQTADFIEENLPQAEIIYTESTAAAAECALKNRELAVIGSDQIAHLYGLSVI
FT                   AEGIQDDDENYTRFIIISRSKGKFFYSTGYNNYQDTKKMYKTSIVCTPEVNKPGVLYEM
FT                   LGEFAARKINLTRIESRPTRKKLGEYLFYIDLEGHYHDPLVAGALKEVRNMSGLFKILG
FT                   CYFKDNIKEGSSEKDAKCKKRA"
FT   gene            197055..198173
FT                   /locus_tag="Hore_01910"
FT   CDS_pept        197055..198173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_01910"
FT                   /product="Histidinol-phosphate transaminase"
FT                   /EC_number="2.6.1.9"
FT                   /note="PFAM: Aminotransferase class I and II; TIGRFAM:
FT                   histidinol-phosphate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_01910"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68953"
FT                   /db_xref="GOA:B8D0Y4"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR005861"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B8D0Y4"
FT                   /protein_id="ACL68953.1"
FT                   /translation="MLNVKRGLKSWKRIVRDEVHNIKPYIPGKPIKEVKEELGLAEVYK
FT                   LASNENPLGVSPRVKEVLTRETVNINRYPDGASRSLKRSLSDKLGVKEDMIAIGNGSDG
FT                   LLKVIAEAFLDNNSQAVISYPSFVEYKFVSQLMGTQLIRVWMKNYHQNLEALARGVTSK
FT                   TKLIFLTNPHNPAGTIFRKDELEQFLSQIPDDVIVVLDEAYHEFVQDESYPDGIEYVKQ
FT                   GYPVIVLRTFSKAYGLAGLRLGYAISAPDIIETLMKVRDPFNVNHLAEKAGQAALEDKD
FT                   FLEATIRNNEQGKEYLYTELDKIGVGYVPTQANFVLIRTGVDSIKMFKELLKHGVIVRP
FT                   GKPLGYPHHLRVSIGLPEENEAFIRGLKLTLE"
FT   gene            198239..199402
FT                   /locus_tag="Hore_01920"
FT   CDS_pept        198239..199402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_01920"
FT                   /product="glutamate 5-kinase"
FT                   /EC_number="2.7.2.11"
FT                   /note="PFAM: Amino acid kinase family; PUA domain; TIGRFAM:
FT                   glutamate 5-kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_01920"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68954"
FT                   /db_xref="GOA:B8D0Y5"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR005715"
FT                   /db_xref="InterPro:IPR011529"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR019797"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR041739"
FT                   /db_xref="UniProtKB/TrEMBL:B8D0Y5"
FT                   /protein_id="ACL68954.1"
FT                   /translation="MGRGRKKKYNRVVVKVGSSTLTHPGGKLNITRIDHLVRQLVDLKN
FT                   QGREVLLVTSGAIAAGMGDMNLDVRPGSIPEQQALAALGQGVLIGLYNKFFREYGEKGA
FT                   QILLTASDLEDRGRYLNAFNTLLTLLKHGVIPVINENDTVATQEIKFGDNDTLSARVAG
FT                   LVEADLLIVLSDVEGLYNGVPGEGSDLEVIRVVEDITPDVEGLAGGRGSSVGTGGMITK
FT                   IKAARIAVNSGVTMVIGPGYEKNVLLSLVDMLEKGNNYNKGTTFLPKQDYLTKRKQWLR
FT                   FNLPVSGSIKVDKGAETALVYRGKSLLPGGITGVEGDFSEGEPVRVINHSGKEIGRGLV
FT                   NYSSEEIRVIQGHHTTDISSLLGYMKQEEVIHRDNLVIERGKIDNGD"
FT   gene            199392..200648
FT                   /locus_tag="Hore_01930"
FT   CDS_pept        199392..200648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_01930"
FT                   /product="gamma-glutamyl phosphate reductase"
FT                   /EC_number="1.2.1.41"
FT                   /note="PFAM: Aldehyde dehydrogenase family; TIGRFAM:
FT                   gamma-glutamyl phosphate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_01930"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68955"
FT                   /db_xref="GOA:B8D0Y6"
FT                   /db_xref="InterPro:IPR000965"
FT                   /db_xref="InterPro:IPR012134"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR020593"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8D0Y6"
FT                   /protein_id="ACL68955.1"
FT                   /translation="MEIKEQVVFQARKASKASRKLSGIATDVKNKALAAIAEKLVQAKD
FT                   EIIRANNIDMERGREKGLSKALLDRLELNEKRIEGMAEGLKELVKLEDPVGEVIKMWKR
FT                   PNGLQIGQMRVPLGVIGMIYEARPNVTVDAAGLCLKTGNAVILRGGSEAINSNKILARI
FT                   IEDTAVAAGLPEGCVQLIQTTDRKAVKVLFNLTEYLDVLIPRGGAGLINRVIAEAKVPV
FT                   IQTGVGNCHVYVDSEADLDMALDIVFNAKTSRPAVCNAAESLLVHRQVADEFLPELYKL
FT                   FRENNVELRGCENTRAILPGIKKAVDDDWSREYLDYIMAVKIVDSFDKAVEHINTYGTK
FT                   HSEAIITENYTRAHRFLQEIDAAAVYVNASTRFTDGGQFGLGAEIGISTQKLHARGPMG
FT                   LEELTTTKYIIFGQGQIRE"
FT   gene            200658..201458
FT                   /locus_tag="Hore_01940"
FT   CDS_pept        200658..201458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_01940"
FT                   /product="pyrroline-5-carboxylate reductase"
FT                   /EC_number="1.5.1.2"
FT                   /note="PFAM: NADP oxidoreductase coenzyme F420-dependent;
FT                   NAD-dependent glycerol-3-phosphate dehydrogenase
FT                   N-terminus; TIGRFAM: pyrroline-5-carboxylate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_01940"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68956"
FT                   /db_xref="GOA:B8D0Y7"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR029036"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8D0Y7"
FT                   /protein_id="ACL68956.1"
FT                   /translation="MKLCIIGLGKMGTTLLYGILDNNILEAKDIIGCDPVVDEREHNKD
FT                   YRGIRTTGSNYRGVEQADNILLAVKPQVLKNVLQGIKPASENKLFISIAAGVSTDRIKE
FT                   NLPESCRVIRVMPNTPALVNQGVSAISPGEKATDDDIEFVKKICNGVGKGVVIEEHLID
FT                   AVTGLSGSGPAYIYVIIEALADAGVLNGLSRDLALELAVRTVAGSAEMVLKTGQHPGQL
FT                   KDMVTSPGGTTINGLQVIEKRGLRGILMEAVSRAVERSRELGEE"
FT   gene            201573..202049
FT                   /locus_tag="Hore_01950"
FT   CDS_pept        201573..202049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_01950"
FT                   /product="conserved hypothetical nucleotide-binding protein
FT                   TIGR00150"
FT                   /note="PFAM: Uncharacterized P-loop hydrolase UPF0079;
FT                   TIGRFAM: conserved hypothetical nucleotide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_01950"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68957"
FT                   /db_xref="GOA:B8D0Y8"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8D0Y8"
FT                   /protein_id="ACL68957.1"
FT                   /translation="MSQETWQVISDSVGETLKIGKITGELVEPGQIILLAGDLGAGKTV
FT                   FTRGLAEGLGVDEDVTSPTYNLINEYDGDLPLFHMDLYRLEEEEDIYDIGFEEYLDREG
FT                   VVVIEWPDIVYDVIPQDFIYVKIEKSNHDTRRKLTFEAEGEKSKRLLEGLAQKC"
FT   gene            202043..202762
FT                   /locus_tag="Hore_01960"
FT   CDS_pept        202043..202762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_01960"
FT                   /product="O-sialoglycoprotein endopeptidase"
FT                   /EC_number="3.4.24.57"
FT                   /note="PFAM: Glycoprotease family"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_01960"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68958"
FT                   /db_xref="GOA:B8D0Y9"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:B8D0Y9"
FT                   /protein_id="ACL68958.1"
FT                   /translation="MLVMGIDTSGAVGSVGLYNDDGVLGEINIKLKRRHSERLLPVIDR
FT                   LLMECGREIDQINGVGVVTGPGSFTGLRIGMSTAKSFAQVLNIPVVGLSSLDILAYNLI
FT                   IAEGWIVPVIDARNARVYTSLYRGWSRDIKNAKVRDERALSVNDLINELSSIDDGKPFY
FT                   FVGNGVEEYREVWEKAGFNCVLAPRSAGIPHGGSIAELSFYHLKNGQGQNYLEVSANYL
FT                   KRPQAEINWERKHKSGD"
FT   gene            202764..203219
FT                   /locus_tag="Hore_01970"
FT   CDS_pept        202764..203219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_01970"
FT                   /product="SSU ribosomal protein S18P alanine
FT                   acetyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /note="PFAM: Acetyltransferase (GNAT) family; TIGRFAM:
FT                   ribosomal-protein-alanine acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_01970"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68959"
FT                   /db_xref="GOA:B8D0Z0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR006464"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B8D0Z0"
FT                   /protein_id="ACL68959.1"
FT                   /translation="MGLTIRPMEESDLPRVLEIEGKCFQAPWSKKAFLRELQDNKYSLY
FT                   LSGWLDGRLVGYIGSWIIKDELHITNLAVDPGYRRRGLATRLINNLMNFAEDQGLKEVT
FT                   LEVRVSNKAAIRLYEKLGFIPIGCYVGYYKNNNEDALVMWKGLKNEE"
FT   gene            203209..204225
FT                   /locus_tag="Hore_01980"
FT   CDS_pept        203209..204225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_01980"
FT                   /product="putative metalloendopeptidase, glycoprotease
FT                   family"
FT                   /EC_number="3.4.24.57"
FT                   /note="PFAM: Glycoprotease family; TIGRFAM:
FT                   metalloendopeptidase, putative, glycoprotease family"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_01980"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68960"
FT                   /db_xref="GOA:B8D0Z1"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/TrEMBL:B8D0Z1"
FT                   /protein_id="ACL68960.1"
FT                   /translation="MKNKNVIILAIETSCDETAAAVVKNGVEVLSNIVASQVDWHRKYG
FT                   GVVPEIASRKHLEFINPVVKEALDRAGLTFKDLDAVACTYGPGLVGGLLVGLSAAKAIA
FT                   YATGKPFIGVNHIAGHIYANFISHNDIELPAACLTISGGHTDLLYFKNRGEYKILGRTR
FT                   DDAAGEAFDKTARVLKLGYPGGPAIEKAARDGNPRAVDFPRPFLEKDTFDFSFSGLKTA
FT                   VINYIHNRKQRGQEINVNDVAAGFQQAVIDVLVSKVIKVTKKLPVKSVILSGGVAANRS
FT                   LRSQLQKELNYRNIPLYYPRLEYCTDNAAMIGVVAYYQYLKGDFNDLSLNAEANLKL"
FT   gene            204244..205587
FT                   /locus_tag="Hore_01990"
FT   CDS_pept        204244..205587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_01990"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_01990"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68961"
FT                   /db_xref="GOA:B8D0Z2"
FT                   /db_xref="InterPro:IPR000385"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR007549"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:B8D0Z2"
FT                   /protein_id="ACL68961.1"
FT                   /translation="MKIEGKHKYLLLKTVQEDGILPLTSVCNLSCKFCSHRYNPPGVEV
FT                   YRFGHLPMELIMELIDYIPPDGPLILGESATKIIEGDPLAHPHFRGVLTMLREKWPDKL
FT                   LKITTSGTHLSRDMIEFLKEVNPVELNISLNCSSPEERVFLMGDPQPERVFNSFFLLNE
FT                   YRIQVNGSLVAVPHIIGYKSIEKAIVFLARKQVKTIRVFMPGYTRYADVDIDFHKMYYR
FT                   LKELIEEIRARYQTPIILEPPLLNDLTSNVTGVIKGSPAYKSGIKRGDIIDRINGNLPL
FT                   SRVDAFRRLVNLKDPDLRIKRGKDYLNIKLKKCSGMKPGVVMDYDLDSNVFLKLKRIIA
FT                   ANKGKKTGVITSFLARNLMETVTTKIKEDLNYINLSVLPVKNKYFGGTIKTAGLLVNSD
FT                   IIEAVEQNNCNYDLLLVPGIIYDIFGNDLTGSNYKKLSKIIRSKIEII"
FT   gene            205787..206071
FT                   /locus_tag="Hore_02000"
FT   CDS_pept        205787..206071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_02000"
FT                   /product="Chaperonin GroES (HSP10)"
FT                   /note="PFAM: Chaperonin 10 Kd subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_02000"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68962"
FT                   /db_xref="GOA:B8D0Z3"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8D0Z3"
FT                   /protein_id="ACL68962.1"
FT                   /translation="MNIKPLNDRVAVKYLEEEEKTRSGIVLPDTAKEEKPQQGEIVAVG
FT                   KGCTPEDGDPEVKVGDLVVFDKYSGTKVTIDGEDYIILNLEDVLAVIEK"
FT   gene            206110..207753
FT                   /locus_tag="Hore_02010"
FT   CDS_pept        206110..207753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_02010"
FT                   /product="chaperonin GroEL"
FT                   /note="PFAM: TCP-1/cpn60 chaperonin family; TIGRFAM:
FT                   chaperonin GroL"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_02010"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68963"
FT                   /db_xref="GOA:B8D0Z4"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8D0Z4"
FT                   /protein_id="ACL68963.1"
FT                   /translation="MAKELKFSEDARRALERGVDTLANAVKVTLGPKGRNVVLEKSFGA
FT                   PTITNDGVSIAREIELENHYENMGAQTVKEVATKTNDVAGDGTTTATVLAQAIFKEGLK
FT                   NVAAGANPMILKRGIEKAVQKLVEEIKELSKPVEGKEAVSQVAAISAGNDEEVGKLIAE
FT                   AMEKVGQDGVISVEESKSMGTSLDVVEGMQFDRGYLSPYMVTDTDAMEASLEDPYILIT
FT                   DKKISNIQEILPLLEKVAQSGKPLLIIAEDVEGEALATLVVNKIRGTFNCVAVKAPGFG
FT                   DRRKAMLEDIAILTGGQVITEDLGLKLENADISMLGRAHKVTVTKEDTTIVEGAGDSKE
FT                   IQNRIKQIRTQIENTDSDFDREKLQERLAKLAGGVAVIKVGAATETELKEKKHRIEDAL
FT                   SATRAAVEEGLVAGGGTTLIDAIPALDELNLEGDEATGVDIVRKALEAPVRLIADNAGY
FT                   EGSVIVEKVKSEDKGIGFDAYNGEFVNMIESGIVDPAKVTRSALQNAASAAAMLLTTEC
FT                   LVADKEEDNDSNGNAGMPGGGMPGGMGGMM"
FT   gene            207995..209527
FT                   /locus_tag="Hore_02020"
FT   CDS_pept        207995..209527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_02020"
FT                   /product="GMP synthase (glutamine-hydrolyzing)"
FT                   /EC_number="6.3.5.2"
FT                   /note="PFAM: GMP synthase C terminal domain; Glutamine
FT                   amidotransferase class-I; TIGRFAM: GMP synthase
FT                   (glutamine-hydrolyzing), C-terminal domain or B subunit;
FT                   GMP synthase (glutamine-hydrolyzing), N-terminal domain or
FT                   A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_02020"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68964"
FT                   /db_xref="GOA:B8D0Z5"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022955"
FT                   /db_xref="InterPro:IPR025777"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8D0Z5"
FT                   /protein_id="ACL68964.1"
FT                   /translation="MKEDKILVLDFGGQYSQLIARRVRECNVYSIIKPYNISIDQIKDI
FT                   NPAGIIFSGGPKSVTGPEAPMIDKEVFKLNIPILGICYGMQLMTALLPGGAVEKARHGE
FT                   YGKARLHITEKDKLFEGISDSQVWMSHWDRVKKVPDGFKVTAKTDITPVAAMGNPELKF
FT                   YGVQFHPEVVHTIQGLNIIRNYLFKVCGVKGTWNMADFINEEIDRIKEEVGSSQVISGL
FT                   SGGVDSAVASTMVHRAIGDQLTCIFVDHGLLRKGEAEQVKRTFVDEFNIPLVYVDARER
FT                   FLNRLNGVKDPETKRKIIGEEFIRVFEEEARKLGDARYLVQGTLYSDVIESGSETAETI
FT                   KSHHNVGGLPDNMDFKLIEPLRNLFKDEVRKIGEVLGLPDEIVWRQPFPGPGLAIRIIG
FT                   EIDGKKLEILRKADSIIQEEIKEAGYYKEIWQSFAVLPDLKSVGVMGDTRTYGYPIILR
FT                   AVTSDDAMTADWARLPYELLEKISTRIVNEVDSVNRVVYDITSKPPATIEWE"
FT   gene            209545..209832
FT                   /locus_tag="Hore_02030"
FT   CDS_pept        209545..209832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_02030"
FT                   /product="TrpR like protein, YerC/YecD"
FT                   /note="PFAM: Trp repressor protein; TIGRFAM: TrpR-related
FT                   protein YerC/YecD"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_02030"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68965"
FT                   /db_xref="GOA:B8D0Z6"
FT                   /db_xref="InterPro:IPR000831"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013368"
FT                   /db_xref="InterPro:IPR038116"
FT                   /db_xref="UniProtKB/TrEMBL:B8D0Z6"
FT                   /protein_id="ACL68965.1"
FT                   /translation="MGKDIKDRFTEQLFDAILLLENKEECYRFFEDIATIGEIKALGQR
FT                   LEVARMLRQGATYDEITEKTGVSTATISRVKRALHYGADGYKLILDRMGE"
FT   gene            209878..211095
FT                   /locus_tag="Hore_02040"
FT   CDS_pept        209878..211095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_02040"
FT                   /product="conserved hypothetical protein TIGR00341"
FT                   /note="PFAM: Domain of unknown function (DUF389); TIGRFAM:
FT                   uncharacterized hydrophobic domain; conserved hypothetical
FT                   protein TIGR00341"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_02040"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68966"
FT                   /db_xref="GOA:B8D0Z7"
FT                   /db_xref="InterPro:IPR005240"
FT                   /db_xref="UniProtKB/TrEMBL:B8D0Z7"
FT                   /protein_id="ACL68966.1"
FT                   /translation="MQVVHATFYPGEGKKAVSILESLGVNIEDYKLIESETGDLLIVNL
FT                   RYGNTDVVIDNLRSNFNFEHSGRSLVIFTPDAVLPRERDKEEEDNSRATRESLIFFAKE
FT                   KSSITRDYLLLVVFSAIITSLGLILNNVAVIVGGMVIAPVLGPILAITIGIVLGKTRLI
FT                   WKGISAEIIAVVLAMGVGLVFGLLIPDVEVNRALSIRMMPTMADLFIAMAAGAAGAFTL
FT                   IKGELESGLVGVMVAASLLPVMCTAGIGLALGNRTMIVGPMLLLGGNYLALLLSNVLVF
FT                   YLQGLKPRIWYKLKAKNLVKQSIIIITIAVVLLSIPLSFITYYYFYVEKPVDIIKTTIK
FT                   ERLVFNWDYRIESVEIEGNLINVYLYAEGDINIQYLQNIKQEIEKELAREYNINFRIIP
FT                   VKEVQV"
FT   gene            211248..211493
FT                   /pseudo
FT                   /locus_tag="Hore_02050"
FT   gene            211497..213212
FT                   /locus_tag="Hore_02060"
FT   CDS_pept        211497..213212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_02060"
FT                   /product="putative PAS/PAC sensor protein"
FT                   /note="PFAM: Putative Fe-S cluster; 4Fe-4S binding domain;
FT                   4Fe-4S binding domain; Iron only hydrogenase large subunit,
FT                   C-terminal domain; TIGRFAM: PAS domain S-box"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_02060"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68967"
FT                   /db_xref="GOA:B8D0Z8"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR004108"
FT                   /db_xref="InterPro:IPR007202"
FT                   /db_xref="InterPro:IPR009016"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B8D0Z8"
FT                   /protein_id="ACL68967.1"
FT                   /translation="MGLVITSEAKCRDCYKCIRYCPVKAIGIKDGQAWVDEDRCILCGR
FT                   CIEACPQNAKKTEQYLDKFKNYIASGNKVVVSLAPSYLASGYFSTPWKLVGALKELGVD
FT                   VVEETAIGAEVIADEYRDLLNKKELIISSCCPTVVNLVEKYFPGLCDYLAPVISPMIAH
FT                   GRLIKQEMGENCRVVFIGPCYAKKEEALTRGEGSIDAVLTFEEIFNYLDRLNQDIPPRN
FT                   IFPDRTSNRARRFPLPGGALRTGGLNELNIKPDDIVSISGLEDCMETFRDIEKGLIKPR
FT                   FIEAMACRGGCLGGPAMGEDAGILARKQRLYNNLNRGQQSCRGANNKGIIVSWSYTPRE
FT                   IDYKVPDEEEIKRILALTGKTSPEDETNCGGCGYPSCRDKAIAVYNGLANPEMCIPYMR
FT                   EKAESLSHAVVDSTLNGIIIVDKDMIIQDFNPAANRMFNRRDIKAKGKPLSTFIDPGDY
FT                   IDVWENQEMITDNCKQYPQYELITRETIYPLPKYGVVIGIITDVTEEEKTRAEIDNMRQ
FT                   EALDRASQVIKEQMRVAQEIAGLLGESTADTKATLLELKEIIGQREAKTNGDES"
FT   gene            213196..214350
FT                   /locus_tag="Hore_02070"
FT   CDS_pept        213196..214350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_02070"
FT                   /product="Stage II sporulation E family protein"
FT                   /note="PFAM: Stage II sporulation protein E (SpoIIE)"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_02070"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68968"
FT                   /db_xref="GOA:B8D0Z9"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:B8D0Z9"
FT                   /protein_id="ACL68968.1"
FT                   /translation="MGMKVDVGVASLSKHGEEVCGDSYQVIRSRDATTVILSDGLGSGI
FT                   KASILSLLSTKIASRLLERNINVEQVFATIADTLPICQTREIAYSTLSILKITDSGYAH
FT                   LIEYDNPSLILIRNGQRVKLDKEQKIIAGKKVSEVHFKLKLGDLLLVVSDGVINAGVGG
FT                   LFHLGLGRERLVEHVTKYGLYKKDSLHVARDIIELTEACYICKPGDDSTCIALKLREPR
FT                   SVVVLTGPPTDPDLDGKVVKEFLKRNNSEKVVCGGATGNMVARELGEDIETSLTYDDPS
FT                   VPPLASIKGIDLVTEGILTLNKCLEKILQLKKGQSIDEKKDGASLLARTLFKADQIHFL
FT                   VGTAVNPAHQELMQSLQLKPRPVIVNKLIKELAELGKEIKIKRY"
FT   gene            214364..214606
FT                   /locus_tag="Hore_02080"
FT   CDS_pept        214364..214606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_02080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_02080"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68969"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR042128"
FT                   /db_xref="UniProtKB/TrEMBL:B8D100"
FT                   /protein_id="ACL68969.1"
FT                   /translation="MKEKITVEVCVGTSCHLMGSPAIIDYLKNLPDNIKDKIEIKHVSC
FT                   MNSCDRGPRVMVNDTVIYNATPERVKEAITEIIMA"
FT   gene            214625..216100
FT                   /locus_tag="Hore_02090"
FT   CDS_pept        214625..216100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_02090"
FT                   /product="hydrogenase large subunit domain protein"
FT                   /note="PFAM: Iron only hydrogenase large subunit,
FT                   C-terminal domain; 4Fe-4S binding domain; 4Fe-4S binding
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_02090"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68970"
FT                   /db_xref="InterPro:IPR004108"
FT                   /db_xref="InterPro:IPR009016"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR027631"
FT                   /db_xref="UniProtKB/TrEMBL:B8D101"
FT                   /protein_id="ACL68970.1"
FT                   /translation="MAGEVSEVTRIRRKVLTEIARLTFEDRLVEEVDYIPRRLTENGIS
FT                   NYRCCVYKERAILKERVKLALGVAPDEVDDEEKSLSEIASNVLQGQLGNSDRNIAIIEE
FT                   ACDQCSIDKIVVTNACRNCVAHHCVNSCPRGAITIVNNQAYVIREKCVECGLCVKACPY
FT                   GAILEVERPCTSACSLDAVVPGEKSTAEIDDNNCIECGSCIEACPFGAISYKSEIVRVV
FT                   QMLKSGDINTVALVAPSYIGQFGPRVDWEKLCTGLKRLGFHDVIPVALGADKVIEEESR
FT                   EFQAMTDKPMFNSCCPSFVNLIELKFPEYLSQVSTTESPMLKAAYLAKEDGELVQCVFI
FT                   GPCLAKKSEARNKGQGLIDAVLTFEEIAAMLVAKGINLAKITETGDLSEEHRSPSIPAQ
FT                   AFCEAGGVGSAISGKLNNNDNGIRFHQVDGASECLKVLNQIKAGKIKADFVEGMGCQGG
FT                   CIGGPGTLVNRRVASGLLKKLIKSRGGEKVGTK"
FT   gene            216087..216740
FT                   /locus_tag="Hore_02100"
FT   CDS_pept        216087..216740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_02100"
FT                   /product="CoA-binding domain protein"
FT                   /note="PFAM: CoA binding domain; Putative DNA-binding
FT                   protein N-terminus"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_02100"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68971"
FT                   /db_xref="GOA:B8D102"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR009718"
FT                   /db_xref="InterPro:IPR022876"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B8D102"
FT                   /protein_id="ACL68971.1"
FT                   /translation="MAQSKGRVKSQGIPVGVINRLPHYYRYLSSLMARDVERISSRELA
FT                   SKLGVTASQIRQDLSYFGCFGQPGYGYRVQELQAEIGKILGVNENMHMVLVGAGNLGMA
FT                   LMKYPNFRRRGFYIRAIFDSDINKIGQEVEGIEIKPVSELEKYLSRFNVDIGIIATPAG
FT                   AAPEIASIFMNGGVKGIWNFAPVSLNPEEGVVIENVHISESLMTLSYKVKEKDK"
FT   gene            216770..219433
FT                   /locus_tag="Hore_02110"
FT   CDS_pept        216770..219433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_02110"
FT                   /product="iron-containing alcohol dehydrogenase"
FT                   /EC_number="1.2.1.10"
FT                   /note="PFAM: Iron-containing alcohol dehydrogenase;
FT                   Aldehyde dehydrogenase family"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_02110"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68972"
FT                   /db_xref="GOA:B8D103"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR012079"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="InterPro:IPR034789"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:B8D103"
FT                   /protein_id="ACL68972.1"
FT                   /translation="MAKAVLEKSVDKATKEKKEIRKGLKIEDSINKLVERANEAARKFK
FT                   DYDQEQVDRIVKKMALAANDKHIELAKMAHRETGMGVYEDKITKNLFASEYVYNYLRDK
FT                   KTAGILNKNIEENYIEVAEPIGVVAALTPVTNPTSTTIFKALICMKTRNPVIFSFHPRA
FT                   MKCSIEAARILKEAAIKAGAPENCISWIEEPSIEATNYLMKHPEVDLILATGGSGMVKA
FT                   AYSSGKPALGVGPGNVPCYIEKTANIKQAVSDLILSKTFDNGMICASEQAVVVDKEIAA
FT                   EVKKFMQENGCYFVSKKESEKLARVAVDQERGAMNPAVVGQPARKIAKMAGIKVPDDTK
FT                   ILVAELKGVGENYPLSREKLSPILGWYVVKDYREGIKRCEEITEFGGLGHSSVLHSNDE
FT                   KVIDEFSRRLRTGRLIINSPSSQGAIGDMYNFNVPSLTLGCGSMGKNSTTDNVNVDNLI
FT                   NKKRVAMRKERMKWVKVPPRIYFEYGSLRYLSGVRGERAFIITDKTMSQLGFIDKVEEH
FT                   LSVAGVQTRVFDSVEPDPSVETVLNGCQEMNEFKPDIIIALGGGSPMDAAKGMWLFYEH
FT                   PETRFEDLKMKFNDIRKRVYKFPRLGKKATFIAVPTTSGTGSEVTAFSVITDKKRNIKY
FT                   PLADYELTPDIAIIDPELVLTVPQSVTADTGLDVLTHAIEAYVSVMASDYTDALAEKAI
FT                   KLVFEYLPRAYKNGNDREARKKMHNASCIAGMAFTNAFLGLNHSMAHILGGKFHIPHGR
FT                   ANAILLPHVIRYNAGKPSKLASFPQYDYPRAGERYAEIARILGLPASTTEEGVESLVKA
FT                   ITDLMRELNIPLSLEEAGVNHNKFEKELEDMADIAHNDQCTGTNPRMPLVNEIKEIYRQ
FT                   AYKGVSIKDKKKVRNA"
FT   gene            219652..221376
FT                   /locus_tag="Hore_02120"
FT   CDS_pept        219652..221376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_02120"
FT                   /product="biotin (acetyl-CoA carboxylase) synthetase"
FT                   /EC_number="6.3.4.15"
FT                   /note="PFAM: HI0933-like protein; FAD binding domain; FAD
FT                   dependent oxidoreductase; Pyridine nucleotide-disulphide
FT                   oxidoreductase; TIGRFAM: adenosine phosphosulphate
FT                   reductase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_02120"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68973"
FT                   /db_xref="GOA:B8D104"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:B8D104"
FT                   /protein_id="ACL68973.1"
FT                   /translation="MKKKDIEVKVMDTDLLIIGGGTAGCMAAIRAKELDPDVDVLIMEK
FT                   AHIRRSGCLASGMNAINAYLNPGETPESFVRYVRADAMGLVREDLLLGMARRLNQVVHK
FT                   VESWGLPIEKDKQGNYVPRGRWNIKINGESLKPIIADKAIESGARVLNRVTVTNLITTE
FT                   DGSVMGAMGFGIRDGVFYVVKAGATIVATGGAAGIYKPNNDGSAHHKMWYSPFNTGAGY
FT                   AIGIRAGAEMTSFEMRFIALRTKDVIAPTGTLALGFGATQVNARGERFMAKKFRHLGSE
FT                   GAPTPIRVYGPTREIKEGRGPVFMDTTHLSEEEVRDLKKSYLNMYPDIVLFWAANKIDP
FT                   GQEPLEIQGTEPYLVGGHAQAGYWITEKRETTLPGLYAAGDVAGGAPYKFVSGAWAEGE
FT                   IAAENALEYLRNNYYREDKKYVAQVIEREIMRVYAPLRRRDGVKAEEMEERLQKIMDQY
FT                   AGGVSRYYEMNEDELKLARKLLKKMRGQVKYLRAEDYHKLMLCHEVLDRLDVASVLVEH
FT                   LLYRRETRWPAYQSRVDYPDRNDREWLKFVNSRLEGNKVSIIERPYKQIVPGDRYLP"
FT   gene            221416..221739
FT                   /locus_tag="Hore_02130"
FT   CDS_pept        221416..221739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_02130"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S binding domain; TIGRFAM: adenosine
FT                   phosphosulphate reductase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_02130"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68974"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B8D105"
FT                   /protein_id="ACL68974.1"
FT                   /translation="MGIRIDKGKCTGCPGRDEPPCVKYCPGNLIVIAPETKKARIRGQR
FT                   DCWDCMVCVKSCPFGAIETRLPFQLAGFGASLKPEVAKDKIVWKLKDADGNTEIFEVLT
FT                   KKV"
FT   gene            221898..222515
FT                   /locus_tag="Hore_02140"
FT   CDS_pept        221898..222515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_02140"
FT                   /product="predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_02140"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68975"
FT                   /db_xref="GOA:B8D106"
FT                   /db_xref="InterPro:IPR023596"
FT                   /db_xref="InterPro:IPR026898"
FT                   /db_xref="UniProtKB/TrEMBL:B8D106"
FT                   /protein_id="ACL68975.1"
FT                   /translation="MWVWYFYRQDRYDPEPLSLIIRDFIWGILIVIPISIIESPFSRFL
FT                   TPDTPLLILFFSSIIFVGLVEEGGKSLVTYRLHYRNTEFDEPVDGIIYGITVGLGFAAA
FT                   ENLFYTIMFGYQVGLIRAVVTSLAHASFTGIFGYYLGQAKIKGNQGLILKGFILVSILH
FT                   GLYDFFVIGQIMGFVTTVLVVVALQIYLASLIRLTTENSPFK"
FT   gene            222657..224045
FT                   /locus_tag="Hore_02150"
FT   CDS_pept        222657..224045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_02150"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: Thi4 family; HI0933-like protein; FAD binding
FT                   domain; Pyridine nucleotide-disulphide oxidoreductase; FAD
FT                   dependent oxidoreductase; Lycopene cyclase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_02150"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68976"
FT                   /db_xref="InterPro:IPR028348"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B8D107"
FT                   /protein_id="ACL68976.1"
FT                   /translation="MASKEYDVIIVGAGPTGIFTALELINKESDLKVVILEKGNNLKDR
FT                   ECPMNVKNTNCVKCKSCSIVSGWGGAGAFSDGKLSLSPDIGGHLDEYIGKENLSELIKY
FT                   ADKLYLKFGAPDRIFGVDSDKVQDIKEKAVKANLKFIPARLRHLGTGYSKTVLQAMQDF
FT                   IAEKGVDIRFGVNVKELLVEDATIKGVKTKEGEIIYGDYVVTAPGRENAEWLTLEAERL
FT                   GIETTINPVDIGVRVECPAVITKELTDNIYESKLIYQTPTFDDKVRTFCMSPYGQVVNE
FT                   NNQGLITVNGHSHAEIKTENTNFALLVSKTFTEPFHEPITYGKNIAKLANLLGGGVLVQ
FT                   RLGDLLDGHRSTPERIARGIVEPTLKEATPGDLSLVLPYRHLKDIIEMIEVLDNLAPGL
FT                   YSRDTLLYGVEVKFYSSRLEVNDEMETRINNLYAGGDGAGITRGLMQASVSGILIARSI
FT                   LNKV"
FT   gene            224237..224911
FT                   /locus_tag="Hore_02160"
FT   CDS_pept        224237..224911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_02160"
FT                   /product="HhH-GPD family protein"
FT                   /note="PFAM: HhH-GPD superfamily base excision DNA repair
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_02160"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68977"
FT                   /db_xref="GOA:B8D108"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:B8D108"
FT                   /protein_id="ACL68977.1"
FT                   /translation="MSGCRGVFSNITWKAGLNEIYHRLYKKFGPQHWWPADSRFEVIIG
FT                   AILTQAVSWQNVEKAIENLKKHKVLYPEELLHLEEEILAKMIKPAGYYNMKARKIKAFI
FT                   NFLFEDYGGSLDEMFQEPLSKIRDKLLEVYGIGPETADSILLYAGEFPVFVIDAYTKRI
FT                   FSRIGYIEENIGYHTLQKMIMDNLPARTGIYNEYHALLVALGKEICKKNNPLCEKCPLN
FT                   RK"
FT   gene            225246..225380
FT                   /locus_tag="Hore_02170"
FT   CDS_pept        225246..225380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_02170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_02170"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68978"
FT                   /db_xref="UniProtKB/TrEMBL:B8D109"
FT                   /protein_id="ACL68978.1"
FT                   /translation="MDRLPVLQGSSFFVLNRILYVSYNTVNIIIIAKKHPAGVLFTYL"
FT   gene            complement(225492..225568)
FT                   /locus_tag="Hore_R0022"
FT   tRNA            complement(225492..225568)
FT                   /locus_tag="Hore_R0022"
FT                   /product="tRNA-Pro"
FT   gene            225743..226999
FT                   /locus_tag="Hore_02180"
FT   CDS_pept        225743..226999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_02180"
FT                   /product="histidyl-tRNA synthetase"
FT                   /EC_number="6.1.1.21"
FT                   /note="PFAM: tRNA synthetase class II core domain (G, H, P,
FT                   S and T); TIGRFAM: histidyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_02180"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68979"
FT                   /db_xref="GOA:B8D110"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR004517"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR015807"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8D110"
FT                   /protein_id="ACL68979.1"
FT                   /translation="MTENILNSPGGMRSYLDSIAFQLEEIQDRIKGVFRQWAYRPIITP
FT                   TLEYYESLTTGIGEKYKKQMYKFIDYEGNILALRPEMTAPIARTVANKIDELCLPQRLS
FT                   YRAPVFRYEEPQTGKNREIYQIGVELIGEKSPGADAEVIMLAVESLKSSGLTDFQIDIG
FT                   HAGFLNGVIEELKVTDSQGEQIKRWLNKKDMVSIRDFTSRVEIKNINKLLGIVRLRGKK
FT                   EVLQRAKRLINNDKSKKALKDLELVYEYLCDYGVDNYVNFDLTLIRGFEYYTGIVFEAF
FT                   TENLGYTICGGGRYDSLIYQYCGKEIPAIGFAIGIERVRLGLLNQGQELETPEIDVMVV
FT                   FSYQARKPALEAIKKYRKQGLNVLQIEKEEVDQEFIKKHLKTGVKKIISFCEYSSNQKI
FT                   KVIDDRGNIELLTPGGDLP"
FT   gene            226996..227667
FT                   /locus_tag="Hore_02190"
FT   CDS_pept        226996..227667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_02190"
FT                   /product="ATP phosphoribosyltransferase"
FT                   /EC_number="2.4.2.17"
FT                   /note="PFAM: ATP phosphoribosyltransferase; TIGRFAM: ATP
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_02190"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68980"
FT                   /db_xref="GOA:B8D111"
FT                   /db_xref="InterPro:IPR001348"
FT                   /db_xref="InterPro:IPR013820"
FT                   /db_xref="InterPro:IPR018198"
FT                   /db_xref="InterPro:IPR024893"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8D111"
FT                   /protein_id="ACL68980.1"
FT                   /translation="MKSVITALPKGRLMGEVIDILKQSGFISNNIDINTLSRQLVFHDK
FT                   KTRNSFLLAKPKDVPVYVEHGAADLGITGKDVLLEHGRNLYEMVDLGVGKCKLVVAVPE
FT                   SKGYKSLADIPEYSRVATSYPEIVKKFFQGKGIQVEVIKLNGSVELAPLVDLADVIVDI
FT                   SSTGTTLKKNNLIPMETIVTSSARLVVNNVSYKIKHKQISELINKINEVVKSGNTEISR
FT                   K"
FT   gene            227639..228922
FT                   /locus_tag="Hore_02200"
FT   CDS_pept        227639..228922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_02200"
FT                   /product="Histidinol dehydrogenase"
FT                   /EC_number="1.1.1.23"
FT                   /note="PFAM: Histidinol dehydrogenase; TIGRFAM: histidinol
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_02200"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68981"
FT                   /db_xref="GOA:B8D112"
FT                   /db_xref="InterPro:IPR001692"
FT                   /db_xref="InterPro:IPR012131"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR022695"
FT                   /db_xref="UniProtKB/TrEMBL:B8D112"
FT                   /protein_id="ACL68981.1"
FT                   /translation="MEILRYPENKDRIKEIAKKRADFIDEDKLKSVQEIVNRVKVRGDE
FT                   ALFEYTRKFDRVNLKKLRVSEKEIEEAYQSVDKGFLQDLKQAINNIGDYHRKQLKESWF
FT                   SHDRKGNIMGQLINPVQRVGAYVPGGRAPYPSSVIMTVIPARVAGVDEVVVVTPPDKEG
FT                   KVNSYTLVATREAGADEIYRVGGAQAVAALTYGTESIKPVEKIVGPGNIYVTLAKKMVS
FT                   GIVGIDMLAGPSEIMILADETAEPEYIAADLLSQAEHDPLAAPVFVTPDWKLVEEVISH
FT                   LENQMKDQPRRETMAKSWENQGLIIIVEDIKTGLEMVNLFGPEHFELMVEDPFKYLPDI
FT                   KNAGAIFLGKYSPEPLGDYVAGPNHVLPTGGTARFSSPLSVDDFIKKSSLIFYSREGFN
FT                   EVAGGAISLAQKEGFNGHASSVSIRLGR"
FT   gene            229060..229653
FT                   /locus_tag="Hore_02210"
FT   CDS_pept        229060..229653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_02210"
FT                   /product="Imidazoleglycerol-phosphate dehydratase"
FT                   /EC_number="4.2.1.19"
FT                   /note="PFAM: Imidazoleglycerol-phosphate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_02210"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68982"
FT                   /db_xref="GOA:B8D113"
FT                   /db_xref="InterPro:IPR000807"
FT                   /db_xref="InterPro:IPR020565"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR038494"
FT                   /db_xref="UniProtKB/TrEMBL:B8D113"
FT                   /protein_id="ACL68982.1"
FT                   /translation="MVEITRKTKETKIKLNLDLDGQGRAKINTGIGFFDHMLELWAVHG
FT                   FFDLVLSVEGDLEVDGHHTVEDTGIVLGEGLKKALGNKAGLKRYGNVIIPMDESLVLVS
FT                   LDLSGRPYYEDDLVFNRTQVGGFPVELLEEFFRALTNNAGITLHIKMLRGKNTHHLIEA
FT                   CFKGFGRALDVALTGEERLNNTPLSSKGSLGEGG"
FT   gene            229656..230279
FT                   /locus_tag="Hore_02220"
FT   CDS_pept        229656..230279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_02220"
FT                   /product="imidazole glycerol phosphate synthase, glutamine
FT                   amidotransferase subunit"
FT                   /EC_number="2.4.2.-"
FT                   /note="PFAM: CobB/CobQ-like glutamine amidotransferase
FT                   domain; Glutamine amidotransferase class-I; TIGRFAM:
FT                   imidazole glycerol phosphate synthase, glutamine
FT                   amidotransferase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_02220"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68983"
FT                   /db_xref="GOA:B8D114"
FT                   /db_xref="InterPro:IPR010139"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B8D114"
FT                   /protein_id="ACL68983.1"
FT                   /translation="MIVVIDYGIGNLGSVVKAFKYLGVPVKLTASPDEIREADGIVLPG
FT                   VGAFGHGVENLEKYNLKRVIRELIEEGKPFLGICLGMQLLFSGSEEAPGVRGLGIIKGI
FT                   VQKFDPSNVGKIPHIGWNKVNIIKEDPLFYNLNTSPYLYFVHSFFARTSEGDNIIGETC
FT                   YGKQRFVSVVRSNNAWEIQGHPEKSSRTGLKILQNFSEVVNRWK"
FT   gene            230270..230983
FT                   /locus_tag="Hore_02230"
FT   CDS_pept        230270..230983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_02230"
FT                   /product="phosphoribosylformimino-5-aminoimidazole
FT                   carboxamide ribotide isomerase"
FT                   /EC_number="5.3.1.16"
FT                   /note="PFAM: Histidine biosynthesis protein; TIGRFAM:
FT                   phosphoribosylformimino-5-aminoimidazole carboxamide
FT                   ribotide isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_02230"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68984"
FT                   /db_xref="GOA:B8D115"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR006063"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023016"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8D115"
FT                   /protein_id="ACL68984.1"
FT                   /translation="MEVIPAVDIKDGSCVRLKKGDFNKRRVYSTSPVDVALYWEKHGAS
FT                   RLHIVDLDGAKSGWPTHLKTIREIALRVNIPLQVGGGIRSLKVIKKYLDSGVDRIILGT
FT                   VALKNPELVKRALDNFGSNRIVVGVDARGGKVATEGWLKTSQVTVEDIISEMEEVGVKT
FT                   FIYTDINRDGMLKGPDIEGIKRVLKSTKARIIASGGISSRQDLINLKAIGIKAAIVGKA
FT                   LYEGNLPLEVLNQYP"
FT   gene            231019..231777
FT                   /locus_tag="Hore_02240"
FT   CDS_pept        231019..231777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_02240"
FT                   /product="imidazole glycerol phosphate synthase subunit
FT                   hisF"
FT                   /EC_number="4.1.3.-"
FT                   /note="PFAM: Histidine biosynthesis protein; TIGRFAM:
FT                   imidazoleglycerol phosphate synthase, cyclase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_02240"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68985"
FT                   /db_xref="GOA:B8D116"
FT                   /db_xref="InterPro:IPR004651"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8D116"
FT                   /protein_id="ACL68985.1"
FT                   /translation="MLTKRIIPCLDVKGGRVVKGVNFKDLRDEGDPVELARYYDREGAD
FT                   ELVFLDITASAENRGIVIDMVEKTAASVFIPFTIGGGIRTISDMKAILNAGADKVSINS
FT                   AAVKNPGLIAEGARVFGSQCIVVAIDCCRKNGNWEVYINGGRTVTGLDAIKWAQKVEEL
FT                   GAGEILLTSMDADGTKDGYDTELLAAVSTAVEIPVIASGGAGMPEHLREAIVEGQADAV
FT                   LAASIFHEKTYSVSEVKEYLAGHGIPVRIE"
FT   gene            231793..232437
FT                   /locus_tag="Hore_02250"
FT   CDS_pept        231793..232437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_02250"
FT                   /product="phosphoribosyl-AMP
FT                   cyclohydrolase;Phosphoribosyl-ATP diphosphatase"
FT                   /EC_number="3.5.4.19"
FT                   /EC_number="3.6.1.31"
FT                   /note="PFAM: Phosphoribosyl-ATP pyrophosphohydrolase;
FT                   Phosphoribosyl-AMP cyclohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_02250"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68986"
FT                   /db_xref="GOA:B8D117"
FT                   /db_xref="InterPro:IPR002496"
FT                   /db_xref="InterPro:IPR008179"
FT                   /db_xref="InterPro:IPR021130"
FT                   /db_xref="InterPro:IPR023019"
FT                   /db_xref="InterPro:IPR026660"
FT                   /db_xref="InterPro:IPR038019"
FT                   /db_xref="UniProtKB/TrEMBL:B8D117"
FT                   /protein_id="ACL68986.1"
FT                   /translation="MKVDLENLNFDDRGLIPAVLQDVESRKVLMVAYMNREALVRTLET
FT                   GKAWFYSRSRQKLWLKGETSGNYQLVKEIRIDCDSDTLLVLVKPEGPACHTGHESCFYR
FT                   NILTEKGRDQGRKHLIDLDFIKRLFELIKDRKINPTPGSYTSYLFREGIDKVCKKIGEE
FT                   AAEVIIGAKNKSKQEVIYESADLIYHLLVLMVIMDTTPGEVINELKKRHKE"
FT   gene            complement(232548..232892)
FT                   /locus_tag="Hore_02260"
FT   CDS_pept        complement(232548..232892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_02260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_02260"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68987"
FT                   /db_xref="InterPro:IPR012851"
FT                   /db_xref="UniProtKB/TrEMBL:B8D118"
FT                   /protein_id="ACL68987.1"
FT                   /translation="MNMTTYQSKTIKNSQTSTVPQVKGPEMNDRDWINDILALEKYLTD
FT                   NYNVFTREASHLELYQDLRFILDETHDCTRNIFNAMFAEGFYKLQQANPREIQQTREQF
FT                   TKYLSSQSPY"
FT   gene            complement(232969..233244)
FT                   /locus_tag="Hore_02270"
FT   CDS_pept        complement(232969..233244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_02270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_02270"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68988"
FT                   /db_xref="UniProtKB/TrEMBL:B8D119"
FT                   /protein_id="ACL68988.1"
FT                   /translation="MKGGIILQQYNNQNQISQPVMTEPPSFISNKDLLYLKDAMSWELL
FT                   AMKKCFHASQQCLNPRLKQAIEQAGMMHQRHYQTLLRHVDPNKTLP"
FT   gene            233434..233850
FT                   /locus_tag="Hore_02280"
FT   CDS_pept        233434..233850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_02280"
FT                   /product="uncharacterized conserved protein"
FT                   /note="PFAM: Domain of unknown function DUF123"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_02280"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68989"
FT                   /db_xref="InterPro:IPR002837"
FT                   /db_xref="UniProtKB/TrEMBL:B8D120"
FT                   /protein_id="ACL68989.1"
FT                   /translation="MKNLDYDSGIYLLEIFLHKPKKIEVGKKGEFTFPPGYYYYAGTAQ
FT                   KNLQARLERHKRRVKKYHWHIDYLLGAANLLSIYTWEVKREGECHLARYLIDKLNGEII
FT                   VPGFGSSDCRCKTHLVFFPQKVTKNEIPDNDFFD"
FT   gene            233978..236125
FT                   /locus_tag="Hore_02290"
FT   CDS_pept        233978..236125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_02290"
FT                   /product="ATP-dependent DNA helicase PcrA"
FT                   /EC_number="3.6.1.-"
FT                   /note="PFAM: UvrD/REP helicase; TIGRFAM: ATP-dependent DNA
FT                   helicase PcrA"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_02290"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68990"
FT                   /db_xref="GOA:B8D121"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR005751"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:B8D121"
FT                   /protein_id="ACL68990.1"
FT                   /translation="MLSDSSDILTGLNPEQKKAVEHFEGPLLILAGAGSGKTRVLTHRI
FT                   AYLIENYGVNPLQILAVTFTNKAAGEMKERVDNLLGGMAGDLWVSTFHSLCARILRKEI
FT                   GKIGYDNNFVIFDTDDQQKLISRILKELNLDPKKTRPRAILSEISRAKNELIDPRSYAN
FT                   NVGDYFQDITARIYPLYQERLKESNALDFDDLIMKTIEVFVDNPMVLEYYQERFKYILV
FT                   DEYQDVNFAQYKLVQLLANKYRNLCVVGDPDQGIYGFRGADIRNILNFEEDYPEARVIK
FT                   LEQNYRSKEKILKAAHHVIRNNTARKEKRLWTKRGKGEDLKLYVAFDDKDEASYVCRKI
FT                   KELKREKNYKFSDFAVLYRTNSQSRSVEEMMVKYAIPYQIVGGFRFYDRMEIKDILAYL
FT                   RVIYNPSDEVSLLRIINRPKRGIGQGTISKLSRYARERGISLYKAGTEAESNPYLTASF
FT                   KKRVKAFFDLLEELREKSETLSIDTLTHQVVTRTGYQRELNEEGTQQARNRLENIQELF
FT                   SVIEEFMKGNENKTLGAFLEEVSLISDVDNMEDNQNVVTLMTLHSAKGLEFPVVFIIGM
FT                   EEGLFPHANSMMDHEELEEERRLCYVGITRARDELYLTRARERMRFGQRKPYPPSRFLD
FT                   EIPPQLFEDNNDKKEEILGNIKEKESKTGEYKVGDTVVHPRWGKGQIVGVRENRGLELK
FT                   INFGKGKVKTLLAEYAPIQKA"
FT   gene            236182..238194
FT                   /locus_tag="Hore_02300"
FT   CDS_pept        236182..238194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_02300"
FT                   /product="DNA ligase, NAD-dependent"
FT                   /EC_number="6.5.1.2"
FT                   /note="PFAM: BRCA1 C Terminus (BRCT) domain; NAD-dependent
FT                   DNA ligase C4 zinc finger domain; NAD-dependent DNA ligase
FT                   OB-fold domain; NAD-dependent DNA ligase adenylation
FT                   domain; TIGRFAM: DNA ligase, NAD-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_02300"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68991"
FT                   /db_xref="GOA:B8D122"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR001679"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004149"
FT                   /db_xref="InterPro:IPR004150"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013839"
FT                   /db_xref="InterPro:IPR013840"
FT                   /db_xref="InterPro:IPR018239"
FT                   /db_xref="InterPro:IPR033136"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="InterPro:IPR041663"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8D122"
FT                   /protein_id="ACL68991.1"
FT                   /translation="MASKVEQEIRDLREKIRYHEYRYYVLDDPEISDAEFDELIQRLID
FT                   LEEKHPGLVTPDSPTQRVGGEPLDKFDKVEHRVPMLSLGNAFNEGDLTNFARRIYRLLD
FT                   TGKIDFVVEHKIDGLSAILTYQGGRLIRGATRGNGVVGEDVTANIKTIPSVPLRLKKDV
FT                   DIEVRGEVYIKKDDFSKLNERRLKKGEEPFANPRNAAAGSIRQLDPRLAAARPLSFIAY
FT                   DVVAYEGEGLQTHVGALELLRELGFKVNWYRKCDDITEVVNICKDWVDKREELPFEIDG
FT                   MVIKVNELGLREQLGATAKSPRWAIAYKFPAQQKTTVVKDIIISVGRTGALTPTAVLEP
FT                   VEVDGSTVSRATLHNEDEIRRKDVRIGDHVLVQKAGDVIPEVVKVIKSKRDGSEQIFHM
FT                   PETCPACGGEVVREEGEAVLRCVNVTGCPAQRREGILHFVSRNAMNIDGVGPALIDQLL
FT                   EKGLIEDYADLYYLKKEDLIPLERMGEKSATNAIEAIRASKDRPLFRVIFALGIRHVGL
FT                   GVARVLTEKYRSLSDLMRASGEELVAIDEIGPTIARSIIEFFKEPHNREVINKLKEAGV
FT                   RLEEKENGKEEQNLYLSGKTFVFTGKLDGFTRSEARDKVIAAGGKVTSSVSRKTDYVVV
FT                   GDSPGSKYDKARELGVTILDEDKFKEVLKAGDNNG"
FT   gene            238187..238552
FT                   /locus_tag="Hore_02310"
FT   CDS_pept        238187..238552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_02310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_02310"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68992"
FT                   /db_xref="GOA:B8D123"
FT                   /db_xref="UniProtKB/TrEMBL:B8D123"
FT                   /protein_id="ACL68992.1"
FT                   /translation="MVRLSLGISLVMVVILLATKSSHLWPGTFFFLVQLVLISLVGLLT
FT                   RYIRRKRRMLSLIPVLELFKKFFSVMFPLWIGLALIDRLNELAGRVFILIFFIGFFALS
FT                   MILLLQILTDDDLLDRF"
FT   gene            238779..239066
FT                   /locus_tag="Hore_02320"
FT   CDS_pept        238779..239066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_02320"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, C subunit"
FT                   /EC_number="6.3.5.7"
FT                   /note="PFAM: Glu-tRNAGln amidotransferase C subunit;
FT                   TIGRFAM: glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn)
FT                   amidotransferase, C subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_02320"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68993"
FT                   /db_xref="GOA:B8D124"
FT                   /db_xref="InterPro:IPR003837"
FT                   /db_xref="InterPro:IPR036113"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8D124"
FT                   /protein_id="ACL68993.1"
FT                   /translation="MIKKEEVEKIAGLAYLKLSDEERETFTRQLGDILDYVEKLNELDT
FT                   DGVVPTAYTVPMKNVLRDDKVGSSIPREEALDNAPDKKDGLFRVPSIIGE"
FT   gene            239083..240516
FT                   /locus_tag="Hore_02330"
FT   CDS_pept        239083..240516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_02330"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, A subunit"
FT                   /EC_number="3.5.1.4"
FT                   /note="PFAM: Amidase; TIGRFAM: glutamyl-tRNA(Gln) and/or
FT                   aspartyl-tRNA(Asn) amidotransferase, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_02330"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68994"
FT                   /db_xref="GOA:B8D125"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8D125"
FT                   /protein_id="ACL68994.1"
FT                   /translation="MELYDLTIHELRDLLRKEEVSPEEVLDSFYKRIDEVEDKVKAYVT
FT                   LTRDEARNSLASLKDGRLAGIPLAIKDNISTRGIKTTCSSKILNNYKPPYDATVVKRLK
FT                   EEGGITLGKTNMDEFAMGSSTENSGFYPTHNPWNLDHAPGGSSGGSAAAVAAGEAPGAL
FT                   GSDTGGSIRQPAAFCGVVGLKPTYGCVSRYGLVAFASSLDQIGPITKDVTDSALLLNVI
FT                   SGHDPMDSTSVDREKEDYTTYLKDDVKGMKIGLPEEYFSLDFNSEVKDKVMSAVKELEK
FT                   AGAIVEEVSLPNIEYALAAYYIIAPAEASSNLARYDGVRYGYRSENGDSVRSMFTNTRS
FT                   EGFGDEVKRRIMLGTYVLSSGYYDAFYLKAQKVRTLIKEDFERVFKDYDVLISPTTPTT
FT                   AFKLGEMTDPLEMYQSDVFTVPVNIAGIPAISVPCGFDSNNLPIGLQIMGPHFGEGKIL
FT                   QTAYTLEQALNMKTKRPKL"
FT   gene            240537..241985
FT                   /locus_tag="Hore_02340"
FT   CDS_pept        240537..241985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_02340"
FT                   /product="aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
FT                   subunit B"
FT                   /EC_number="6.3.5.-"
FT                   /note="PFAM: PET112 family, C terminal region; GatB domain;
FT                   PET112 family, N terminal region; TIGRFAM:
FT                   glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn)
FT                   amidotransferase, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_02340"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68995"
FT                   /db_xref="GOA:B8D126"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/TrEMBL:B8D126"
FT                   /protein_id="ACL68995.1"
FT                   /translation="MSTEYETIIGLEVHVQLSTNSKIFCDCSTEFGAEPNTHTCPVCLG
FT                   LPGTLPVLNKKAVDYAIMAGLALNCDISEYSKFDRKNYFYPDLPKAYQISQYDLPLCQN
FT                   GYIEIDTEDGVKKIGITRIHLEEDAGKLIHEGTIDESDSSLVDYNRTGVPLIEIVSEPD
FT                   MRSPSEAREYLTQLKKVMEYLGVSDCNMEEGSLRCDANVSIRPVGQEEFGTKTELKNMN
FT                   SFRAVERALEYEVERQKKVLARGDKVVQETRTWDEKLNKTISMRGKEEAHDYRYFPEPD
FT                   LVPLEVDKGWVEEIKSKLPELPRARKERFVKEYGLPEYDAGVLTDSRSLADFFEEVVKA
FT                   YDDPKTVSNWVMGEFLRLIKEEGIVIEESKITGELLARMLKLQDKGVISSKIAKTVFEE
FT                   MFKTGKDPEKIVEEKGLKQISDEGQLEGIVEKVIEENPEAVEDIRGGKGKAIGYLVGQV
FT                   MKETRGKANPQLVNKLLREKITGQ"
FT   gene            242208..242456
FT                   /locus_tag="Hore_02350"
FT   CDS_pept        242208..242456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_02350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_02350"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68996"
FT                   /db_xref="InterPro:IPR027271"
FT                   /db_xref="UniProtKB/TrEMBL:B8D127"
FT                   /protein_id="ACL68996.1"
FT                   /translation="MECSTVMAIVQENRTDSAPEVQEILTEFGCIISARIGLHRLKDCT
FT                   EEGLILLHLCGEDSKINDLHQKLEEMERVRVKEMKID"
FT   gene            complement(242521..243240)
FT                   /locus_tag="Hore_02360"
FT   CDS_pept        complement(242521..243240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_02360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_02360"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68997"
FT                   /db_xref="UniProtKB/TrEMBL:B8D128"
FT                   /protein_id="ACL68997.1"
FT                   /translation="MLKKLLNIFILLCLLGSLHHLNPAYMVYASKPENLTSPEQLCYQV
FT                   ITQQMQLDNFTVDVFLKVNFSSEQKSEFNFKYHFKKPDLTYIDTTDFVLLPTETLKSLH
FT                   PSFFQLENYHLSFVDKKGNNYQFELKPRDPRKNFIIHLWIDRKEKYIKQARISFKTPSV
FT                   NEVFYLTARYKKMDTFSMPVEVEGNLAIPTKFNSEWQIKDFKEGSFHLSLKNYKINRGI
FT                   PAPILEKMKMKKKSKTR"
FT   gene            complement(243293..244144)
FT                   /locus_tag="Hore_02370"
FT   CDS_pept        complement(243293..244144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_02370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_02370"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68998"
FT                   /db_xref="GOA:B8D129"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:B8D129"
FT                   /protein_id="ACL68998.1"
FT                   /translation="MLWPILKLELKKMFHRPRTYLGLTGAALIPITIIIIFLFRDPTPF
FT                   LAKALGRTFTLSGSVLNGYLVALTTLNQGTMNFFAPVLIVLVAGEIVAGESQEGTLRLI
FT                   LTRPVMRYKFLLAKLLTVCIYTMLIFVVMLIIGLGVSLLIFGEGSLFVVGLFLGNVGWF
FT                   NILNSGTALTRILMVYGISFLILLTVTTFSFFLSSILKNPIAAMIFPLVVVIFLRIVSA
FT                   FPFLQELKPFFFTTHMDVWINLLSPKIDWNQVFKSMSILGLHTLTFIGASLYGFHRRDI
FT                   LS"
FT   gene            complement(244126..245076)
FT                   /locus_tag="Hore_02380"
FT   CDS_pept        complement(244126..245076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_02380"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_02380"
FT                   /db_xref="EnsemblGenomes-Tr:ACL68999"
FT                   /db_xref="GOA:B8D130"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8D130"
FT                   /protein_id="ACL68999.1"
FT                   /translation="MGKIILETKNLSKKFGQRLAVNSVNLKVHKGDIFGFLGPNGAGKS
FT                   TTIRMITGLVTPTSGRILFNNTLLDGKKHLFLRRYLGSLIEIPRFYEYLTAYENLELIT
FT                   QISGIKDKSTIDKALIQVGLYSRRNDRVRTFSQGMKQRLGIAQAIMGKPKLVILDEPTN
FT                   GLDPEGINHIRRLILNLNKQKGITFMISSHILKEIESICNRVAILQEGKVLAQGRVVDL
FT                   LNTPQEILTLEVSPVLKAINLLHSHPGVIKAVQNNNHLNQVKVFTRDLKPDLLNQYLVK
FT                   NGIKVASLQKNNTSLEDFFLTLTRKKGELNCCGQY"
FT   gene            245221..245508
FT                   /locus_tag="Hore_02390"
FT   CDS_pept        245221..245508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_02390"
FT                   /product="regulatory protein ArsR"
FT                   /note="PFAM: Bacterial regulatory protein, arsR family"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_02390"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69000"
FT                   /db_xref="GOA:B8D131"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B8D131"
FT                   /protein_id="ACL69000.1"
FT                   /translation="MKDITKIRNEIEEKSRVLKALAHPTRLCIVKGLLEDSGCNVSRMQ
FT                   YCLEVPQSTLSQHLSKLKDLGIVEGKRVGKKVKYYVISDEARKVVKALFD"
FT   gene            245543..248038
FT                   /locus_tag="Hore_02400"
FT   CDS_pept        245543..248038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_02400"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /note="PFAM: Pyridine nucleotide-disulphide oxidoreductase;
FT                   Pyridine nucleotide-disulphide oxidoreductase; FAD
FT                   dependent oxidoreductase; Rhodanese-like domain; SirA-like
FT                   protein; Pyridine nucleotide-disulphide oxidoreductase,
FT                   dimerisation domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_02400"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69001"
FT                   /db_xref="GOA:B8D132"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="InterPro:IPR032836"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:B8D132"
FT                   /protein_id="ACL69001.1"
FT                   /translation="MGKKIVIVGGVAGGASTAARLRRLDEEAEIIIMEKGDHISFANCG
FT                   LPYHIGGVIKEREKLLVQTPESMEARFNIDVRVRNEVVRIDRDKKEIKVRDLNKNEIYC
FT                   ESYDFLILSPGAEPIKPPIDGVDFPNVFTLRNIPDTDNINEFISKNNPDRAVVVGGGFI
FT                   GLEMAENLQERGLKVSLVEMAPQVMGNMDYEMAAMIHNHLREQGIDLHLNDGIASVNRK
FT                   GGKTVVVLQSGREIETDLVIMAIGVRPSTKLAREAGLEIGESGGIKVNEYLQTSDRYIY
FT                   AIGDAIEVIHLVTGQSVLIPLAGPANKQGRIVANIISGKSDKYKGTQGTAVARVFNLTV
FT                   ASTGASEKLLKKAGRDYLVSYTVSKNHAGYYPGAKPMTIKLLFTPDRGVVLGAQIVGYE
FT                   GVDKRIDLLATAVRHEMTVYDLQELELAYAPPFGSAKDPVNMAGYTASNILDGLVEVVY
FT                   WDDINNLDKNTILLDVREEVETQIGSINGSVNIPLNSLRERLDELDKDKDIIVYCAMGL
FT                   RGYIGYRILKQHGFKKVKNLSGGYKLYKAVQDDKSEEINTAGYQELNLTSNPGAGRKAG
FT                   EEISREMSSNRVKLDACGLQCPGPIMQVYHKMEELKDGDILEVTASDPGFLRDVEAWCD
FT                   NTGNTLVDKEKQGDVYKAVIKKGRGFKVENNTSSEDTVATSKGKTMVVFSGELDKAIAS
FT                   FIIANGAASMGNKVTMFFTFWGLNILRKDRAVNTKKGFMEKMFGKMMPRGSKKLPLSKM
FT                   NMMGLGPRMIRKVMEGKGVDSLESLIKQARENGVNMVACQMSMDVMGIKKEELIDGVEV
FT                   GGVASFLGAADKSNMSLFI"
FT   gene            248392..249486
FT                   /locus_tag="Hore_02410"
FT   CDS_pept        248392..249486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_02410"
FT                   /product="alpha amylase"
FT                   /EC_number="3.2.1.98"
FT                   /note="PFAM: Alpha amylase, catalytic domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_02410"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69002"
FT                   /db_xref="GOA:B8D133"
FT                   /db_xref="InterPro:IPR006046"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:B8D133"
FT                   /protein_id="ACL69002.1"
FT                   /translation="MQAFYWDCESNWYRKVKEKLPELYYAGITDIWLPPPSRGLNQGGM
FT                   GYDIYDHYNLNTRFGTKRELKDLIRTAHRYGIRVIADVVMGHAIGGKKEYNPYLETETY
FT                   TKFNQPEFPKNYKHFCHNCVGCHTDNSYGEKICYYSDNGYMKDNLIKWCRWLKDSIGFD
FT                   GFRLDNCKQIRWDFIRDWKEALQTFTIGEYWDGDRGLLQRWRDYTNCNVFNFPLFYSLK
FT                   EMCNNPALFDMRCLMDNVFEGSVSFVENHDTDRFDPVIFNKILAYAFNILFTDYTCIFW
FT                   KDYYIYNLKREIDSLLEIRNRTVDRVEIEYADYDLLVARRGNYRIFINKGETTRIYNGM
FT                   RIDGANYKIAYNTRAEHYLEESMT"
FT   gene            249693..250514
FT                   /locus_tag="Hore_02420"
FT   CDS_pept        249693..250514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_02420"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter; TIGRFAM: cobalt transport
FT                   protein ATP-binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_02420"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69003"
FT                   /db_xref="GOA:B8D0T9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015856"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030947"
FT                   /db_xref="UniProtKB/TrEMBL:B8D0T9"
FT                   /protein_id="ACL69003.1"
FT                   /translation="MSLVEAKGVGYSYQEAGTDEPALKNIDLTVESGEFVAIIGSNGSG
FT                   KSTLARLLNVLLVPTEGEILIDGLKTSEKENIWEIRQKVGIVFQNPDNQLVATTVENDV
FT                   AFGLENLGVPSREIRLRVDNALKMVGMNGFQEHETHKLSGGQKQRVAIAGVIAMESDCI
FT                   VLDEPTAMLDPRGRKEVMDTVTYLNKEKGITIIHITHFMEEAALADKIYVMHQGQIYKS
FT                   GTPRDIFQDVEGLKSVNLDVPQVVELANNLRKAGMTVPRILSIDELVSCLC"
FT   gene            250508..251359
FT                   /locus_tag="Hore_02430"
FT   CDS_pept        250508..251359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_02430"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter; TIGRFAM: cobalt transport
FT                   protein ATP-binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_02430"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69004"
FT                   /db_xref="GOA:B8D0U0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015856"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030946"
FT                   /db_xref="UniProtKB/TrEMBL:B8D0U0"
FT                   /protein_id="ACL69004.1"
FT                   /translation="MLIQLKDVSHIYSGQNEKALESVNLRIQSNEFIGIVGHTGSGKST
FT                   LVQLFNGLIKPSEGKVFIEGIDIHQKKVSKREIRQKIGLVFQYPEHQLFEETIYDEVAF
FT                   GPRNLDLSEEEIKKRVIQALSLVGMDYETYKDRSPFHLSGGQQRKIAIAGVLAMMPEVL
FT                   ILDEPTAGLDPRGREQLIKLLKQLHRDYKMTVILISHRMEEISQLSNRVLVLSRGRIVM
FT                   DGKPEEVFTRVDEIRKLGLDLPQITEVLWELKNRGLRVRTDIFNVEEATREIITKMRES
FT                   QC"
FT   gene            251353..252144
FT                   /locus_tag="Hore_02440"
FT   CDS_pept        251353..252144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_02440"
FT                   /product="cobalt transport protein"
FT                   /note="PFAM: Cobalt transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_02440"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69005"
FT                   /db_xref="GOA:B8D0U1"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="InterPro:IPR024919"
FT                   /db_xref="UniProtKB/TrEMBL:B8D0U1"
FT                   /protein_id="ACL69005.1"
FT                   /translation="MLTDITIGQYIPGNTIVHNLDPRIKIIISIILITALFFIKSFTGF
FT                   LYFLLYITFIIFLAKLPVKRIIKGLKPILFLVILTLLLHVLFTRGGKVLWQWWVIRIDE
FT                   HGLFTGLFMASRILLLIAFTSLLTLTTSPLQLTDGIEYLLSPFKRIGVPANELAMMMTI
FT                   ALRFIPTLMEEAEKIMKAQKARGADFESGSIVQRARNLIPLLVPLFISAFRRADDLALA
FT                   MESRCYRGGEGRTRLHELQIQRRDIFSLIMSTIIAIFISFF"
FT   gene            252300..253040
FT                   /locus_tag="Hore_02450"
FT   CDS_pept        252300..253040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_02450"
FT                   /product="pseudouridylate synthase I"
FT                   /EC_number="4.2.1.70"
FT                   /EC_number="5.4.99.12"
FT                   /note="PFAM: tRNA pseudouridine synthase; tRNA
FT                   pseudouridine synthase; TIGRFAM: pseudouridylate synthase
FT                   I"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_02450"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69006"
FT                   /db_xref="GOA:B8D0U2"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:B8D0U2"
FT                   /protein_id="ACL69006.1"
FT                   /translation="MERNIKITVEYDGTNYSGWQIQNNTPETIQGVLSKCLFDINKSPV
FT                   KLIGASRTDAGVHARGQVANFRLKVGIPVERIPLALNSKLPPDIVCKDAEEVTEDFHAR
FT                   FDARGKRYIYRILNSEYPSPFLRNYTYFIPHNLNIDKMREAGSLLIGEHDFASFQASGG
FT                   SNKTTVRTITKLDIYRDQYQIKIEVCGNGFLYKMVRIIAGTLIEVGLGKRTVKSVGQLL
FT                   EIKDRDRAGFTAPPRGLTLIEVFY"
FT   gene            253193..253621
FT                   /locus_tag="Hore_02460"
FT   CDS_pept        253193..253621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_02460"
FT                   /product="ribosomal protein L13"
FT                   /note="PFAM: Ribosomal protein L13; TIGRFAM: ribosomal
FT                   protein L13, bacterial type"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_02460"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69007"
FT                   /db_xref="GOA:B8D0U3"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR023563"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/TrEMBL:B8D0U3"
FT                   /protein_id="ACL69007.1"
FT                   /translation="MSTYMAKPHEVERQWYVVDATDKVLGRLATKIAEILRGKHKPTFT
FT                   PHVDTGDYVIVVNADKVKLTGRKWEQKKYYRHSGYPGGLKEMSYEKLLQTKPELIIEKA
FT                   VRGMLPHNRLGRKMIKKLKVYAGPDHPHEAQKPEKLEL"
FT   gene            253641..254036
FT                   /locus_tag="Hore_02470"
FT   CDS_pept        253641..254036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_02470"
FT                   /product="ribosomal protein S9"
FT                   /note="PFAM: Ribosomal protein S9/S16"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_02470"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69008"
FT                   /db_xref="GOA:B8D0U4"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/TrEMBL:B8D0U4"
FT                   /protein_id="ACL69008.1"
FT                   /translation="MAAEVQYWGTGRRKTSTARVRLVPGSGKILINGKDVKEYFGRETL
FT                   IKDLKSPLELTNNLDSFDVLVNVNGGGLSGQAGAIRHGIARALLRVDKDYRKPLKKAGY
FT                   LTRDPRMKERKKYGLKKARKAPQFSKR"
FT   gene            254331..255158
FT                   /locus_tag="Hore_02480"
FT   CDS_pept        254331..255158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_02480"
FT                   /product="Extradiol ring-cleavage dioxygenase class III
FT                   protein subunit B"
FT                   /note="PFAM: Catalytic LigB subunit of aromatic
FT                   ring-opening dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_02480"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69009"
FT                   /db_xref="GOA:B8D0U5"
FT                   /db_xref="InterPro:IPR004183"
FT                   /db_xref="UniProtKB/TrEMBL:B8D0U5"
FT                   /protein_id="ACL69009.1"
FT                   /translation="MGVRMAALAPHPPIIIPEIGGRERDRVKKTITSMTRLAEDIKNVD
FT                   PDILITISPHGPVFSDAISIIYQEELTGDFSEFGAPEVNFKIDINLELIDRLKKNADKE
FT                   GIDVFTLNKQSLQNYSISPRLDHGVMVPLYFIQEAGVNKPVLPLTMGLLEYETLYKFGY
FT                   IINRTLDEMDLKAVIVASGDLSHRLKPGAPAGYSPVGRKFDQKLIELLEKKSYRKILKL
FT                   DKGLIEKAGECGLRPLIIMLGAIQNLELDVDIMSYEGPFGVGYAVVEFYQMEG"
FT   gene            255162..255686
FT                   /locus_tag="Hore_02490"
FT   CDS_pept        255162..255686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_02490"
FT                   /product="AMMECR1 domain protein"
FT                   /note="PFAM: AMMECR1; TIGRFAM: conserved hypothetical
FT                   protein TIGR00296"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_02490"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69010"
FT                   /db_xref="InterPro:IPR002733"
FT                   /db_xref="InterPro:IPR023473"
FT                   /db_xref="InterPro:IPR027485"
FT                   /db_xref="InterPro:IPR027623"
FT                   /db_xref="InterPro:IPR036071"
FT                   /db_xref="UniProtKB/TrEMBL:B8D0U6"
FT                   /protein_id="ACL69010.1"
FT                   /translation="MSKLSSYITGLARKTIEVYIKEGRQIKELTDLPEELKKRAGVFVS
FT                   LKKDGKLRGCIGTFLPTQDNIAQEIIKNAISAAVHDPRFGPVRVEELNKIEISVDILTE
FT                   PEKVNNRNELDPHKYGILVKKGHRTGLLLPDLEGIDSVEKQLEIARLKAGIRPDEEVEI
FT                   YRFQVKRYKER"
FT   gene            255692..256681
FT                   /locus_tag="Hore_02500"
FT   CDS_pept        255692..256681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_02500"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_02500"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69011"
FT                   /db_xref="GOA:B8D0U7"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR016431"
FT                   /db_xref="InterPro:IPR027596"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="UniProtKB/TrEMBL:B8D0U7"
FT                   /protein_id="ACL69011.1"
FT                   /translation="MEKAGFYIKMDNDKVQCLLCPHTCEIPVGEKGRCKVRVNEKGELI
FT                   LKNYGVITSMAIDPVEKKPLYHFYPGTRILSLGTYSCNFTCKHCQNWQISQEKPEVVTS
FT                   YSPKEVADLARDKNVIGVAYTYSEPSIWFEYVLKTSQVVKSNGMKNVLVTNGFINKKPL
FT                   KELIPYIDGINIDLKAYNPDFYQRICGGKLKPVLENIKYLRDKVHIEITTLLIPGLNDS
FT                   TEELEDMFQWLNSLDPDIPLHITRYFPRYRLNLPPTSIDELKEAYDLAKRYLNYVYLGN
FT                   INLDQGRDTVCPHCGQVVIERNIRVINRIKDGRCPWCGQEIKGEFRNK"
FT   gene            complement(257244..257972)
FT                   /locus_tag="Hore_02510"
FT   CDS_pept        complement(257244..257972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_02510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_02510"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69012"
FT                   /db_xref="GOA:B8D0U8"
FT                   /db_xref="UniProtKB/TrEMBL:B8D0U8"
FT                   /protein_id="ACL69012.1"
FT                   /translation="MKERPLYVHKINYKDILIIVGFWYFMAAFGYLTRGLVFPYTPVLT
FT                   SIFHFLFVISGRLIFLALVIFYLVSLYGVDFRTLGLSTKNLKKEILLGTSLIFSLLFAV
FT                   LFLVNIPLSYKSLSGSNFNPLYTFDKPEHFINSIFSVIIIYPGTIIIALSEAFLLINIF
FT                   YRTLLGKLKPFPGLIISSFAYSILLLTSGPTQIIIKFIAAFITIFLYRKTRSLITPSIF
FT                   LAGYYTFYIIYIYGWEFIKF"
FT   gene            258319..258969
FT                   /locus_tag="Hore_02520"
FT   CDS_pept        258319..258969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_02520"
FT                   /product="phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain I"
FT                   /note="PFAM: Phosphoglucomutase/phosphomannomutase,
FT                   alpha/beta/alpha domain II;
FT                   Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha
FT                   domain I"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_02520"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69013"
FT                   /db_xref="GOA:B8D144"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="UniProtKB/TrEMBL:B8D144"
FT                   /protein_id="ACL69013.1"
FT                   /translation="MGKLFGTDGVRGVANKELTGELAYKLGRAGGYYLTRDYKGGKKPV
FT                   VLIGKDTRISGDMLEAGLVAGLTSAGIDVIKLGIIPTPGVSFLTSSLDVQGGVMISASH
FT                   NPIADNGIKFFNQKGYKLTDEMEDEIENLIFNKLETIPYPTHEKIGVVDSAPEYYHKYV
FT                   DYLKETVDSDFSGLKIVVDCANGAAYKVAPEVLKKLRADVMVINLKRPKPVSS"
FT   gene            258975..259640
FT                   /locus_tag="Hore_02530"
FT   CDS_pept        258975..259640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_02530"
FT                   /product="outer membrane efflux protein"
FT                   /note="PFAM: Outer membrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_02530"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69014"
FT                   /db_xref="GOA:B8D145"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:B8D145"
FT                   /protein_id="ACL69014.1"
FT                   /translation="MKFSKRLEINIKDDIILNIPDEQKLEEINLSWEEVWNRAVASDTN
FT                   IEVIKKNIEQQEYLAEGLSGMELPTVNLYGKVFWDKEEFPSDYQIGLNLSYNFNTYNNK
FT                   SKGLEITGIENGIQSLKEELKNRRNGLKLESIDLIENQKTIKKQIGYSREAIELTRQKL
FT                   EIAEIRYKTGVATLSELLNYQIELRERKSAYITELTNYYKNLYSIKLLIGEFPEGEDM"
FT   gene            259643..261088
FT                   /locus_tag="Hore_02540"
FT   CDS_pept        259643..261088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_02540"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="PFAM: HlyD family secretion protein; TIGRFAM: RND
FT                   family efflux transporter, MFP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_02540"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69015"
FT                   /db_xref="GOA:B8D146"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:B8D146"
FT                   /protein_id="ACL69015.1"
FT                   /translation="MKKKIIILILIVAVIGSSIYMMNKKGGSKQVAGNVKLVKTVEAKP
FT                   GEIMTRVLADGNVTFENDRDIKVKVSGLVERVYIEEGDEVAEGEKIIKIDGDPLRDNLE
FT                   LARLSLKEASKNYETLVSNFKKQDKINELKLKEARQNLELARLSLNKEKESLEYKLKTL
FT                   QDKIDDAKKALDEARKEWEKQKYLFQNKAVAEKAVKNAEKAYQTAQDNYEDLKEELKYL
FT                   EQKTIPRTIELANLEVGKAENSLELLKNSLEKSNITENDLELARIKIDRAKKNIADIKE
FT                   DLNRLETLAPITGTIVSLEIREGDKVVEGTTVGKIADLESLLIEVMVDEVDVNEVAVGQ
FT                   SVTLTSDSFEDKLTGEVIKIDPVATKVGNLNKYRTQIVVSDPEGVLKPGMFVNAEIVTS
FT                   YKNNVITLPPLAVLGDEDKYVYVVEDGKAVKRPVELGLQNLTKVEVKGVKAGERVIIGP
FT                   FTVLKDLEPGTPVSDVTERKKDK"
FT   gene            261060..261860
FT                   /locus_tag="Hore_02550"
FT   CDS_pept        261060..261860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_02550"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_02550"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69016"
FT                   /db_xref="GOA:B8D147"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8D147"
FT                   /protein_id="ACL69016.1"
FT                   /translation="MLLKEKKINKGGVQDGGEIKLSIIKVSNLSKIYGEGEVAVKALKE
FT                   VSFEVDEGEFVAVMGPSGSGKSTLMNILGCLDTPTSGEYYLDGVNVSSMSEKELAKIRN
FT                   LKVGFIFQTFNLLPRFSALRNVEQPMIYKGVPRQKRLKIARKALESVGLGDRLHHKPSE
FT                   LSGGQCQRVAIARSLVNDPQIILADEPTGNLDSKSEEDILEILNGLNEKGITIVMVTHD
FT                   RVVASHAHRIVHFKDGEIIREDKTQNGINRETATRSWRDRDEIT"
FT   gene            261847..263067
FT                   /locus_tag="Hore_02560"
FT   CDS_pept        261847..263067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_02560"
FT                   /product="ABC-type antimicrobial peptide transport system,
FT                   permease component"
FT                   /note="PFAM: Predicted permease"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_02560"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69017"
FT                   /db_xref="GOA:B8D148"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:B8D148"
FT                   /protein_id="ACL69017.1"
FT                   /translation="MKLLEYIGLALYEIWHNKVRTFLTLIGVIIGIAAVIVIIFVVQGA
FT                   ERFLLAEVEKIAPSDVIYAYARWDRDTRRPMAGLTLDDIEYIKDRESDMIRAIAPRYYG
FT                   NSKIRLNGEEKDCNLIASTPSIFDIYDVSIARGRSLTRLDMEELNQVVVLSYDTAEKLF
FT                   EGVNPVGKKLNLSGLTFTVIGVLEEGEKSIIPTSVTNNTVFIPFSVFERIFDVHNRFIL
FT                   MARLKDKSLVDTGIKRVQQLLDRRHGMADNGMSKFRVSSWVSGLKEISIIKTVLIVLLS
FT                   GVASITLLVAGIGLMNIMLVIVTERTREIGLRKALGATNRDILIQFIIESIVLCIVGGI
FT                   LGVIVGYLGSEVALNIANKYINFSYSVPRWAVLLSLTFTTLVGLFFGIYPAYKAARLNP
FT                   IEALRYE"
FT   gene            263081..264334
FT                   /locus_tag="Hore_02570"
FT   CDS_pept        263081..264334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_02570"
FT                   /product="ABC-type antimicrobial peptide transport system,
FT                   permease component"
FT                   /note="PFAM: Predicted permease"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_02570"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69018"
FT                   /db_xref="GOA:B8D149"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:B8D149"
FT                   /protein_id="ACL69018.1"
FT                   /translation="MNLMETIRLALAGVGSNKLRSFLTLLGIIIGVTAVILMVSLGSGT
FT                   QKVVSGQFSNLQTRQIYIDENHNLPYHLQGRLSLRDRDYLKDSVMGVEKVVPFYQLYTG
FT                   VKYGDNEQEGWVYGIDPASQELINVNISYGRFFDQSDIDNKERVAIVGEQLLERLARTG
FT                   NMVQPQHASTPDYASAVGKYIYLSGKKFIIVGVMQESQNMMFISNQSVLLPYTTIRDHW
FT                   RRETRYVDFYLLSYGPDASEKDTLEQVKYLMDRKYGKTSTGKSKFYFQSLQENVNIMTR
FT                   VFTVFTYVLGGIASISLLVGGIGVMNIMLVTVKERTREIGVRLAIGATRQDVQRQFLAE
FT                   SVILSVGGGIVGVLMGSILSFLANMILKQVFNWWQGFIPGWVILLSFGVTTAIGVIFGF
FT                   YPAYKASRLDPIEALRYE"
FT   gene            264375..265055
FT                   /locus_tag="Hore_02580"
FT   CDS_pept        264375..265055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_02580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_02580"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69019"
FT                   /db_xref="GOA:B8D150"
FT                   /db_xref="InterPro:IPR006977"
FT                   /db_xref="UniProtKB/TrEMBL:B8D150"
FT                   /protein_id="ACL69019.1"
FT                   /translation="MSPWSKMVNIFLSPEEVFMDLKEKSDWVVPLVTILVISLLTTFIL
FT                   LPSVIIPKQVEQITNNPNLSLEQKNKSLEIIHGPVNYFITIIGSVLGMFIGVLILSGGL
FT                   MLIRVIFKGEKVPFKNVFSGAVYTSLIPALGSIITTILSYYQNSLISSFNLSLFVPELN
FT                   NKFIKMFIERITLFGVWEVILIGLMLSIFYKYSKKKAFSIAFGVYFILILFFIFLSQLL
FT                   PPGA"
FT   gene            265331..266092
FT                   /locus_tag="Hore_02590"
FT   CDS_pept        265331..266092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_02590"
FT                   /product="glutamate racemase"
FT                   /EC_number="5.1.1.3"
FT                   /note="PFAM: Asp/Glu/Hydantoin racemase; TIGRFAM: glutamate
FT                   racemase"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_02590"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69020"
FT                   /db_xref="GOA:B8D151"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004391"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="InterPro:IPR018187"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8D151"
FT                   /protein_id="ACL69020.1"
FT                   /translation="MRIGIFDSGVGGITVLKEALNLLPGEDYIYYADTANVPYGTKDKN
FT                   EVRQYIFKAVEFLINRGIEALVVACNTATSIAIKDLRETYQFPIVGMEPAVKPAVERSR
FT                   NKKVLVLATPLTIREEKFRNLVSRVKAEDIVDSLGLPGLVEYAEGFVFDENIIIPYLKD
FT                   RLSPFNLQEYGTLVLGCTHFLYFRDIFNKIIPDHIDIIDGNKGTVRHLKNLLLQSGFKT
FT                   GSEGSGEIIFYSSGKKDERRLKKYLDILKEI"
FT   gene            complement(266265..266849)
FT                   /locus_tag="Hore_02600"
FT   CDS_pept        complement(266265..266849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_02600"
FT                   /product="predicted membrane protein"
FT                   /note="PFAM: Domain of unknown function DUF; Domain of
FT                   unknown function DUF"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_02600"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69021"
FT                   /db_xref="GOA:B8D152"
FT                   /db_xref="InterPro:IPR003810"
FT                   /db_xref="InterPro:IPR022929"
FT                   /db_xref="UniProtKB/TrEMBL:B8D152"
FT                   /protein_id="ACL69021.1"
FT                   /translation="MTLLTLFFTAFGLAMDAFSVSVTSGIILNQIRFKNAIKIGFFFGF
FT                   FQAFMPLVGWFCSLKFSNYIKSYDHWVAFILLLIIGLKMIYETTTDEDNNFNPLNNKIL
FT                   LLLAIATSIDALAVGVSFACLKVAILPSVMIIGWTTFILSAPGVFIGKTGGNLLQNKAQ
FT                   IIGGLILIFIGTRILFEHLNINIVSILNFIP"
FT   gene            267043..267870
FT                   /locus_tag="Hore_02610"
FT   CDS_pept        267043..267870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_02610"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_02610"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69022"
FT                   /db_xref="UniProtKB/TrEMBL:B8D153"
FT                   /protein_id="ACL69022.1"
FT                   /translation="MIIKSLYIGRDILDNGGFALNREKITQLVKQFIKDYSSRKEIYTK
FT                   WREPIIKFSDVRDELFFKLKEIISPTHALPTDFMEDAKTVISYFIPFDKSIVNLNIDGK
FT                   YSSRGWAMAYIETNKLILDLNKYIKRELELLNYKSTIIPATHNFDKEKLISDWSHRHVA
FT                   YIAGLGTFGLNNMLITDKGCCGRIGSIITNLKVEPTKRKDIEYCLYKRKGVCKKCVKRC
FT                   VNNALKVDSFDRHKCYEMLLYNDRLHSDFGLADVCGKCCVNLPCSFTNPVKKK"
FT   gene            268153..268386
FT                   /locus_tag="Hore_02620"
FT   CDS_pept        268153..268386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_02620"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_02620"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69023"
FT                   /db_xref="InterPro:IPR018680"
FT                   /db_xref="UniProtKB/TrEMBL:B8D154"
FT                   /protein_id="ACL69023.1"
FT                   /translation="MSRIFTKKEKQRIIKEIQYFFLEEREEEIGIIAAERVFDFFTGNL
FT                   GKIFYNKGLDDARIWFSKRMEDLEIDYDLLYK"
FT   gene            268464..269117
FT                   /locus_tag="Hore_02630"
FT   CDS_pept        268464..269117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_02630"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_02630"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69024"
FT                   /db_xref="GOA:B8D155"
FT                   /db_xref="UniProtKB/TrEMBL:B8D155"
FT                   /protein_id="ACL69024.1"
FT                   /translation="MLDYNNSTTVFLWVLAFYFLPMVVGFILGKIKTISLTKISEIGYK
FT                   LGDPVTTKIHNWSRKYKLLSIKNGHWLLLFLLIFLNNLILVAFVRRIFYGIIFVIPLLL
FT                   TAWTGFGHGVLFSKPKGRAGILLIFFEFGGYLFATVIGVKIGICILISLISNNQPVISI
FT                   PWDYVLPAVVFLMIGAAIETLSIKAASKNMDLNNIDKINFEQRRAEIAKQIDDD"
FT   gene            269277..269753
FT                   /locus_tag="Hore_02640"
FT   CDS_pept        269277..269753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_02640"
FT                   /product="uncharacterized conserved protein"
FT                   /note="PFAM: Uncharacterized protein family (UPF0157)"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_02640"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69025"
FT                   /db_xref="InterPro:IPR007344"
FT                   /db_xref="UniProtKB/TrEMBL:B8D156"
FT                   /protein_id="ACL69025.1"
FT                   /translation="MEFKKIKNKILKYIGNLILSVEHVGSTSVEGLAAKPIIDIDVVIE
FT                   DMSVLPDIIKGLEKAGYEYEGNLGIEGREAFRRIKKDGLMKHHLYVCPKDGKGYLEHIA
FT                   LRDYLRENKDARREYEELKLKLARKYRNDVDTYCIKKTDFINSILSKTIYKKQD"
FT   gene            269839..270792
FT                   /locus_tag="Hore_02650"
FT   CDS_pept        269839..270792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_02650"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: Aldo/keto reductase family; TIGRFAM:
FT                   voltage-dependent potassium channel beta subunit, animal"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_02650"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69026"
FT                   /db_xref="InterPro:IPR005399"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:B8D157"
FT                   /protein_id="ACL69026.1"
FT                   /translation="MKYRKLGRAGVKVSELSLGSWLTYGNSVEKERAIKTIDKAYELGI
FT                   NSFDTANVYARGEAEKIVGRALNKYPRESYVLATKVYWPMGDGVNDRGLSKKHVFEQLH
FT                   QSLKRLNHDYVDILYCHRFDEETPLYETLRTIDDLIRQGKVLYVGVSEWTAYQIVEGLR
FT                   VQDQYLLDRLVVNQPIYNLFNRYIEKEIVPTCMENGLGLIVFSPLAQGLLTGKYRLGEP
FT                   IPENSRAADPKANRWIKEILTEENLSKVEKLIEIANELGISMPQLALAWILHQPGITSA
FT                   LIGASKPEQVEENVKAVDVSLSEDVLERIEKIMQGE"
FT   gene            270932..271507
FT                   /locus_tag="Hore_02660"
FT   CDS_pept        270932..271507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_02660"
FT                   /product="Peptidoglycan-binding LysM"
FT                   /note="PFAM: LysM domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_02660"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69027"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:B8D158"
FT                   /protein_id="ACL69027.1"
FT                   /translation="MNHGSRPPCQGILYTVKPGDTLSKIARRYNLTVRDIVSANPQISD
FT                   PDKITVGQVICIPKVASQLRECAIVLALSREATVALPEIAGGVVLVQRAGEGKYALTFA
FT                   ATGLPNPGSLGEFDTYLGSININGQEYSAVLRVSAPFEQEPTWAGTRVININPFNYPDS
FT                   TVTIFPFNLETSIRSGPILGGTIAECKR"
FT   gene            271978..273489
FT                   /locus_tag="Hore_02670"
FT   CDS_pept        271978..273489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_02670"
FT                   /product="glycoside hydrolase family 16"
FT                   /note="PFAM: Glycosyl hydrolases family 16; Fibronectin
FT                   type III domain; Carbohydrate binding module (family 6)"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_02670"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69028"
FT                   /db_xref="GOA:B8D159"
FT                   /db_xref="InterPro:IPR000757"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR005084"
FT                   /db_xref="InterPro:IPR006584"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="UniProtKB/TrEMBL:B8D159"
FT                   /protein_id="ACL69028.1"
FT                   /translation="MLRNKIVSVFLLLIISTAGVMATDDNVGQEKHQVPYDQLTLVWSD
FT                   EFNYTGFPDPDKWSYDVGGHGWGNGEKQYYTEKRKENVWVEDGRLIIMARKEDYKGNKY
FT                   TSARLVTRNKGDWLYGRIEVRAKLPRGRGTWPAIWMLPTGWIYGNWPSSGEIDIMEHVG
FT                   YDMGVVHGSVHTRSYNHRLGTHKTNTIRVEEVDKKFHVYSIEWYPGKILFFVDNIHYFT
FT                   FRNEGTGWREWPFDQPFHLILNIAVGGAWGGQKGIDDSIWPQSMEVDYVRGYDLNIEER
FT                   DKIPPGKPGNLKADSTAIYVDLSWDHSVDNFGVKEYEIYLNDRLIGKTSNTKFKVKKLD
FT                   PETKYNFKVRAVDFAGNVSEYSSVQVKTTSLPLKIIPGKVEAEEYLIMEDGIATETTTD
FT                   AGGGVNLCYIGDGDWMEYVLEVQETGNYQVDFRVAGVIKGKVELRDEKGNTLASVEVPA
FT                   TGDWQKWVTVSSDKFTLAAGVYHIKVYATIGGFNLNWFEIKKVDQ"
FT   gene            complement(273587..273703)
FT                   /locus_tag="Hore_02680"
FT   CDS_pept        complement(273587..273703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_02680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_02680"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69029"
FT                   /db_xref="UniProtKB/TrEMBL:B8D160"
FT                   /protein_id="ACL69029.1"
FT                   /translation="MSWDTNPIIVPTIYKTIKKANLLMRLTFKFNYLHLYII"
FT   gene            273811..274254
FT                   /locus_tag="Hore_02690"
FT   CDS_pept        273811..274254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_02690"
FT                   /product="iron dependent repressor"
FT                   /note="PFAM: Iron dependent repressor, N-terminal DNA
FT                   binding domain; Iron dependent repressor, metal binding and
FT                   dimerisation domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_02690"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69030"
FT                   /db_xref="GOA:B8D161"
FT                   /db_xref="InterPro:IPR001367"
FT                   /db_xref="InterPro:IPR022687"
FT                   /db_xref="InterPro:IPR022689"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036421"
FT                   /db_xref="UniProtKB/TrEMBL:B8D161"
FT                   /protein_id="ACL69030.1"
FT                   /translation="MLSPSLEDYLEEIYRFSAELGFIRITDVANKLNVSLPSVNKAVKI
FT                   LASKGYLEYIPYKNIALTEKGAKLGKYLVERNHMIQNFLEVIGSKADKEEEAEAIEHYL
FT                   SKETVHAMTMVVKFFEKNPGIQKMLTRFQRENKENSQFSQYDI"
FT   gene            complement(274273..275682)
FT                   /locus_tag="Hore_02700"
FT   CDS_pept        complement(274273..275682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_02700"
FT                   /product="Ferrous iron transport protein FeoB"
FT                   /note="PFAM: Nucleoside recognition; Ferrous iron transport
FT                   protein B; Ferrous iron transport protein B C terminus;
FT                   Nucleoside recognition"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_02700"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69031"
FT                   /db_xref="GOA:B8D1F4"
FT                   /db_xref="InterPro:IPR011640"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1F4"
FT                   /protein_id="ACL69031.1"
FT                   /translation="MELVSSSVKIKNIFKEVDNKFTSEQKKLLRDQIVKDIYSFAETIA
FT                   RKTVKVNNKKKTDLGEKIDDILTSKWLGFPIMLLMLGGVFWLTIAGANVPSALLAKGLF
FT                   WIEGRLSDFFIWIKAPEWLHGILVLGVYRTMAWVVSVMLPPMAIFFPLFTLMEDLGYLP
FT                   RVAFNLDNFFKKAGAHGKQSLTMSMGFGCNAAGVISARIIDSPREKLIAIITNNFVPCN
FT                   GRFPTLIILATIFMGTVVSNTYSSFIAAATVVGLVLFGIIITLVVSWGLSKTVLKGVPS
FT                   SFTLELPPYRKPQIGRVLVRSFLDRTLFVLGRAVIVAAPAGAIVWIFANVGLNGVSLID
FT                   HVANLLDPFAVLIGLDGFILLAFILGLPANEIVIPILVMSYLSAGTMLEPESANALRDI
FT                   LVNNGWTWVTALATMLFSLLHFPCGTTLLTIRKETQSIKWTIFTFILTTSIAIVVTFVV
FT                   VQLIELFGLIL"
FT   gene            complement(275687..276475)
FT                   /locus_tag="Hore_02710"
FT   CDS_pept        complement(275687..276475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_02710"
FT                   /product="Ferrous iron transport protein FeoB"
FT                   /note="PFAM: Ferrous iron transport protein B; GTPase of
FT                   unknown function; TIGRFAM: GTP-binding conserved
FT                   hypothetical protein; small GTP-binding protein domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_02710"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69032"
FT                   /db_xref="GOA:B8D1F5"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030389"
FT                   /db_xref="InterPro:IPR041069"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1F5"
FT                   /protein_id="ACL69032.1"
FT                   /translation="MGLTAESSGLNVLKEEFNIELDKKIPVIALAGNPNTGKSTVFNGL
FT                   TGLRQHTGNWPGKTVTRARGFFTHKDQEFMIVDLPGTYSLLASSTEERIARDFICFARP
FT                   DTTVVVADATNLERNLNLVLQVTELTSNVILCLNLMDEARRKNIKIDIKELKNNLKIPV
FT                   IPTVARDGIGLENIKEMVYKITNGDIKVNPGKVKYSPEIEEAVDRIVPVLKKNFGHISD
FT                   INLKWLALRLIEGDKTIMESIEKYVLRSKPEFNLSAKREV"
FT   gene            complement(276502..276723)
FT                   /locus_tag="Hore_02720"
FT   CDS_pept        complement(276502..276723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_02720"
FT                   /product="Ferrous iron transport protein FeoA"
FT                   /note="PFAM: FeoA domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_02720"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69033"
FT                   /db_xref="GOA:B8D1F6"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR038157"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1F6"
FT                   /protein_id="ACL69033.1"
FT                   /translation="MILTQLPIGTKGKVINLTARGNKRRRLLDLGLIPGTTVEPRRRSP
FT                   SGDPTAYLIRGTVLALRKEETDLVKVSQ"
FT   gene            276974..277678
FT                   /locus_tag="Hore_02730"
FT   CDS_pept        276974..277678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_02730"
FT                   /product="Abortive infection protein"
FT                   /note="PFAM: CAAX amino terminal protease family"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_02730"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69034"
FT                   /db_xref="GOA:B8D1F7"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1F7"
FT                   /protein_id="ACL69034.1"
FT                   /translation="MKLVSSKRELVVLICLVILLIISNIIITRGVLMTDNIPGTDVFNI
FT                   YRARIIDTLLHLVFLVFGVLLYKHSHQNNYFSNGFEEITLKNITSFIISLLIILFTNIQ
FT                   WFFVNEAQLEMLTSSSKYNLLFKNYYNILGYSLRAGVGEEIIFRLFLISLFVFIIKKIN
FT                   VKIDAVKVSVVIASLLFIFIHPLGNFLFAFLVFMVGLGFGYLFVNNGLLWCIVVHFAAD
FT                   IIGFTVGYFKVM"
FT   gene            277701..278093
FT                   /locus_tag="Hore_02740"
FT   CDS_pept        277701..278093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_02740"
FT                   /product="OsmC family protein"
FT                   /note="PFAM: OsmC-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_02740"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69035"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1F8"
FT                   /protein_id="ACL69035.1"
FT                   /translation="MKTKVVWQGGLKFIDKFDDGQEILMGSSENSEGVSPLKLLLTGVA
FT                   GCTGIDIIMILEKMRLNVEKFSIVVEGVRADEHPRRFIEIDIKYILKGDNLSEDKVERA
FT                   IELSIDKYCSASNSLNSKINYSYVIE"
FT   gene            278312..278605
FT                   /locus_tag="Hore_02750"
FT   CDS_pept        278312..278605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_02750"
FT                   /product="regulatory protein ArsR"
FT                   /note="PFAM: HTH domain; Sugar-specific transcriptional
FT                   regulator TrmB; Bacterial regulatory protein, arsR family"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_02750"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69036"
FT                   /db_xref="GOA:B8D1F9"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1F9"
FT                   /protein_id="ACL69036.1"
FT                   /translation="MNLNFDKTFKALADANRRKILFLLKESDLTAGEIASEFDISKPSI
FT                   SHHLNILKNAGLVEARREGQQIYYSLKMTVFQEVVNEFMNLFRKESGDNEKI"
FT   gene            278592..279260
FT                   /locus_tag="Hore_02760"
FT   CDS_pept        278592..279260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_02760"
FT                   /product="predicted integral membrane protein"
FT                   /note="PFAM: Protein of unknown function (DUF1648)"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_02760"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69037"
FT                   /db_xref="GOA:B8D1G0"
FT                   /db_xref="InterPro:IPR012867"
FT                   /db_xref="InterPro:IPR025962"
FT                   /db_xref="InterPro:IPR026272"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1G0"
FT                   /protein_id="ACL69037.1"
FT                   /translation="MKKYNIKRDIFAIFILLVGVGFALASYPKIPDKVPIQWGLDGNVN
FT                   SYANKFPGAFWGVFAALGIYIFFYLQLIIDPLKKNYERFKDKYWIIRDITVAIFVSLNF
FT                   MSIFWSLGYMKNNNIIILLISILIIAIGNYMPTFKKNWFLGIKTPWTLSSEEVWNKTHR
FT                   LGGKLFVLSGLIGLIEILFFDSSKIFLGSLILTGVLCLAYSFIVYKKMERKLEEGDQDD
FT                   "
FT   gene            279253..280158
FT                   /locus_tag="Hore_02770"
FT   CDS_pept        279253..280158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_02770"
FT                   /product="Abortive infection protein"
FT                   /note="PFAM: CAAX amino terminal protease family"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_02770"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69038"
FT                   /db_xref="GOA:B8D1G1"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="InterPro:IPR042150"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1G1"
FT                   /protein_id="ACL69038.1"
FT                   /translation="MTKKAGLFVGLTLSFSWLIAFLFFHFVGTGNILFYTLMSIGYMFI
FT                   PLLVTIIIQKIIYNEPVKKPMGISFKFNKWFVIAWLLPLIMAFMTFGVSLLFPQVEYSP
FT                   DMAGMFARYLDQFGPEKIEQMKQAMKVAPIHPFWMSVIQALLAGFTINALVAFGEELGW
FT                   RGFLQQEFNKLGFWPSSLLIGFIWGLWHAPLILQGHNYPQHPKFGVLMMIIWCILLSPL
FT                   FSYIRIKSGSVIAAAIFHGTINASFGLAIVLIKGGSDLIVGFTGLAGFIVLLLLNVLLF
FT                   LYDIRYAKESIINNSLYIKI"
FT   gene            280327..280875
FT                   /locus_tag="Hore_02780"
FT   CDS_pept        280327..280875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_02780"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_02780"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69039"
FT                   /db_xref="GOA:B8D1G2"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1G2"
FT                   /protein_id="ACL69039.1"
FT                   /translation="MVKERNALFKWEVAGIFWIIVVGSLLHFVYDWTDHSILAGLFAPV
FT                   NESVWEHLKMGYWSLFFFGVIEYIYFKKKNFSLNGFFLGKALGVAALEGTILVVFYTYT
FT                   AILKSEILWLDIASYIIGAIICQIVSYKIINREVSKKADVIGFSAFILFGIILMIFTFY
FT                   PPRLPIFRDGLTGRYGPTP"
FT   gene            281107..281883
FT                   /locus_tag="Hore_02790"
FT   CDS_pept        281107..281883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_02790"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_02790"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69040"
FT                   /db_xref="GOA:B8D1G3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1G3"
FT                   /protein_id="ACL69040.1"
FT                   /translation="MVTKPVISIKNLRKSFGSNEVLKGVNLEVYPGQVIGYIGPNGAGK
FT                   STTVKIMLGIIEEYEGQIEIFGEDITGQTDYKKRIGYVPEDGEIYESLTGYEYLTFLGK
FT                   IYGLDFESANKKAERLSQLFGIEESYHSPISSYSKGMKQKLLIIASLLHNPDILFLDEP
FT                   LSGLDANSVMVLKELLARLARQGKTIFYCSHIMEVVEKISNRILLINKGQIVADGSFEE
FT                   LKAKSKQGSLEGIFNQLTGFSEHQKIADEIISTLGE"
FT   gene            281890..283560
FT                   /locus_tag="Hore_02800"
FT   CDS_pept        281890..283560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_02800"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_02800"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69041"
FT                   /db_xref="GOA:B8D1G4"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1G4"
FT                   /protein_id="ACL69041.1"
FT                   /translation="MEDFKSLKILDRFKFIFEKFNIDYKVMREIVRLKLIMDQRRRHVI
FT                   FGNTGKKEGGKKKNQFKNSLIIYGFYGFMVMMVFLIPVSLFLKMSLTTGFIMFFMMSQM
FT                   LLDFSSVLLDLSDKLILLPGPLNSRTLNAAKLIHIFIYLTIISLVLVAPTLFIGTIKMG
FT                   LSFLFVFFIEVFLMLFLVIFITACLYGLILKFFDGEKLKNAINYFQIGVAIILPISYQF
FT                   VGDMFDVFGEKVVFTPDWWTYLLPPVWFAGPYELFLGGNTAPYVIGMTVLTVLVPVLGL
FT                   LLYLKLINPYFEKNLSKLNNNKSGQNNFEKTWDMVSYKITGFFCKGNQETVFFRFIRQM
FT                   LSRERRLKLSIYPVLGFAVIFPFIMLKNEIDFSAFRESLKNLSRGVGYYKLYLAIIFLP
FT                   SILPILSYSEHHRGSWIYRVLPIRDYNIIHRAKIKAVFYKYNVFVFGLLALLFGWIYGL
FT                   KILDDLLIMGLNMVLLTLVIGIFFRDDLPFTKEMGYQVDAGKKKTSIFILFLGLLLGGF
FT                   HFISAFYPYLILIYGVLLITAIIVVWRKVFSYRVPGENV"
FT   gene            283582..284790
FT                   /locus_tag="Hore_02810"
FT   CDS_pept        283582..284790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_02810"
FT                   /product="Acetyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_02810"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69042"
FT                   /db_xref="GOA:B8D1G5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR025559"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="InterPro:IPR041380"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1G5"
FT                   /protein_id="ACL69042.1"
FT                   /translation="MEKIKYRNISKDEEHKFFQFTSYSFKMEEGAGMYKKGEKLPETIG
FT                   EKKGLFKGDELVCCYQLYEVDCKTRGTWFKTGGIGDVASPPHNRRKGYVGKMLTYALEE
FT                   MKERKIRFSALWPFSYSFYRKYGWEQGTASLHIVLEPSSLKFTEDSIKGKFKQVNAEEY
FT                   SLLNNIYNTFYKGYDLGIKRDKTWWVNRVFKSGDKNRFGYIWEENGKPQGYIIYSASKG
FT                   PNGYWENRIHVREIIGIDIPSFLQLFRFIYYHDSQCREVGMMLPFDFPLLKILPEPRIK
FT                   TYEVRPGVMIRIVDIQQVLNKITYPNQVKAGFTFRVFDETAPWNNGIFRLEVSDGKGEC
FT                   SQISGDEGDFSIKINHLSSILAGFMTPAEVYSLGYLDTDNDKIIKILEKIFPPRQTFFT
FT                   GYF"
FT   gene            284878..285921
FT                   /locus_tag="Hore_02820"
FT   CDS_pept        284878..285921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_02820"
FT                   /product="N-acetyl-gamma-glutamyl-phosphate reductase"
FT                   /EC_number="1.2.1.38"
FT                   /note="PFAM: Semialdehyde dehydrogenase, NAD binding
FT                   domain; Dihydrodipicolinate reductase, N-terminus;
FT                   Semialdehyde dehydrogenase, dimerisation domain; TIGRFAM:
FT                   N-acetyl-gamma-glutamyl-phosphate reductase, common form"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_02820"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69043"
FT                   /db_xref="GOA:B8D1G6"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR000706"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR023013"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8D1G6"
FT                   /protein_id="ACL69043.1"
FT                   /translation="MIRVSIIGATGYTGIELVRLLANHPEVELSSLVSRNASNKPLSDI
FT                   YPQFIGRIDLKFSEYDCQAICQNSDIVFTALPHGISQEIVGELYNCGVKIIDLSGDFRY
FT                   KDSAIYEKWYRENHHYPHLLEKAVYGLVEINRNSIKRSSLVANPGCYPTASLLGLWPVI
FT                   SENLINLNTIIIDAKSGVSGAGKGLKRGSHFVEVDENIKGYSIGSHRHTSEIEEIIKTF
FT                   SGNQKAIVSFTPHLVPMKRGILATIYVKLKQSISERALRELYHKYYPDHGFIKVLPRDI
FT                   FPETKYVVGTNYCYIGLKYDTRTERLVIISAIDNLVKGAAGQAIQNMNVMFNLPEYMGL
FT                   KQVGVFP"
FT   gene            285991..287196
FT                   /locus_tag="Hore_02830"
FT   CDS_pept        285991..287196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_02830"
FT                   /product="N-acetylglutamate synthase;glutamate
FT                   N-acetyltransferase"
FT                   /note="PFAM: ArgJ family; TIGRFAM: glutamate
FT                   N-acetyltransferase/amino-acid acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_02830"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69044"
FT                   /db_xref="GOA:B8D1G7"
FT                   /db_xref="InterPro:IPR002813"
FT                   /db_xref="InterPro:IPR016117"
FT                   /db_xref="InterPro:IPR042195"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1G7"
FT                   /protein_id="ACL69044.1"
FT                   /translation="MSELELITGGITAPRGFLASGVSCGIKQEPRRDLALIYSKKAASV
FT                   AGVFTTNRVQAAPVILSRERVKGGTCRAIIVNSGNANACTGKRGLEDARAMTARVAEGL
FT                   RLNKSDVLIASTGVIGTYLPMDCIQRGIDKAISNLSDRGGSRAAEAILTTDTCTKEIAI
FT                   KGKLPSGSDYTIGGMAKGSGMIHPNMATMLAFITTDLAILPPLLNKALKQAVEKSFNRI
FT                   SVDGDQSTNDSVFLIANGLSGNKPIVNCGKDYESFLKDLKEVCNYLARKIVLDGEGATK
FT                   FVTVKVEGAYSEQDAVKVGREVANSNLVKTALFGSDPNWGRIVAAVGYSGIDIAPDLIE
FT                   VTINGRTLYSRGQPWISDDINLLSGREVVIEINLNQGEGSATFWTTDLSHDYIKINADY
FT                   HT"
FT   gene            287208..288080
FT                   /locus_tag="Hore_02840"
FT   CDS_pept        287208..288080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_02840"
FT                   /product="acetylglutamate kinase"
FT                   /EC_number="2.7.2.8"
FT                   /note="PFAM: Amino acid kinase family; TIGRFAM:
FT                   acetylglutamate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_02840"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69045"
FT                   /db_xref="GOA:B8D1G8"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037528"
FT                   /db_xref="InterPro:IPR041727"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8D1G8"
FT                   /protein_id="ACL69045.1"
FT                   /translation="MEELINKAQTLVEALPYIRNFYGKTFVIKYGGSTMGDKRLKEKIM
FT                   EDITLLKYVGVNPVLIHGGGPAISEAMESMDKEARFIQGLRITDSETMSLVEMVLVGKV
FT                   NKELVSIINRLGGEAVGICGKDGGLIEADKLIFEDKSIDLGHVGSVKKINPEIVLNLIK
FT                   GGYIPVISPVGSSKEGDTYNINADTVAGKLAVSLKAEKLIFLTDVDGVWSDPSNEKTRV
FT                   SSLTVNEVKSWIGEGKIKGGMVPKVEACIEAVTCGVNRTHILNGLIPHALLLEIFTDRG
FT                   IGTMILKER"
FT   gene            288086..289285
FT                   /locus_tag="Hore_02850"
FT   CDS_pept        288086..289285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_02850"
FT                   /product="acetylornithine and succinylornithine
FT                   aminotransferase"
FT                   /EC_number="2.6.1.11"
FT                   /note="PFAM: Beta-eliminating lyase; Aminotransferase
FT                   class-III; TIGRFAM: acetylornithine and succinylornithine
FT                   aminotransferases"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_02850"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69046"
FT                   /db_xref="GOA:B8D1G9"
FT                   /db_xref="InterPro:IPR004636"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1G9"
FT                   /protein_id="ACL69046.1"
FT                   /translation="MLRDEIITCDKNYFMNVFKGRFPLVVDHGEGVKVYDKNGKVYCDF
FT                   LSGIGVNALGYSCPELVEALREQVEKIIHCSNLYYIEPQAELEKWLVNHSVADRVFFSN
FT                   SGAEANEGAIKLARKYFEVRNENKYEIITAQNSFHGRTLMTLAATGQEKYHRFFQPLPQ
FT                   GFKYVPFNDLEAVYRSVGPNTAAIMVEPIQGEGGVYPATREYLEGLRKLCDEENILLIF
FT                   DEIQCGIGKTGTLFAYEYYGVEPDIFTLAKALGGGVPIGAFLAREEVANAFKPGDHGST
FT                   FGGNPLATRAAITTLKVIKERGLLNKVKKTGQYFKNLLEELKEEIDIVNEVRGVGLMLA
FT                   IELNRNKARDIVNYMFEKGFLLNAVKDNIIRFLPPLIIEKTDIKNMVGELKTVLEKNNL
FT                   "
FT   gene            289379..291154
FT                   /locus_tag="Hore_02860"
FT   CDS_pept        289379..291154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_02860"
FT                   /product="ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_02860"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69047"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1H0"
FT                   /protein_id="ACL69047.1"
FT                   /translation="MRSVLLNGQTSYIGYSQILRSNTFHKMLCEQIERAEKKKSSLLEF
FT                   FKLFLKNVDVVEVDRRYDVEALKQLLLALTDNPIETIDSSAYYSFPKLGNNKELLVKFV
FT                   EDLFDSWRKKQRFIISQDEYTSDSCEKTYKELVLVKTNEDLKNLVLRMHREILLNISDV
FT                   RLKVLRQLPTGAQVGLLADKPDFKDKARVEQAPWLYELNYVWSYIFEPPVIFYTRSNKR
FT                   RGLFKVLDKPILEKIDIEDKENWLVFPIRVCLKTIYVVVNKEYFALAAGLGNLFEPASF
FT                   EILENRKPDGIYILGIDKKYFENEEDYNGVVYKEDDGTYVGMVGDDPSIDYFGYMKKMI
FT                   LTIHNLLVIDEGRLPIHGALARIKLKNGKKANVMLIGDSGAGKSETIEALNRLEDEVSE
FT                   INILIDDMGSLDIINDEGKVVGYGTETGAFVRLDDLQPSYAYDNMDRSIFMNPNQSNAR
FT                   VIIPYSNYTEIIRPTDIDYFLYANNYEEITDESEAIKFFDNADEALEVFSKGARMAKGT
FT                   TAEKGLTTSYFANPFGAVQRREKHEKIAEKFMTTMMSFGVKVGELKTQLGRDGYEQKGP
FT                   LMAARSLLKLIASQE"
FT   gene            complement(291474..292844)
FT                   /locus_tag="Hore_02870"
FT   CDS_pept        complement(291474..292844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_02870"
FT                   /product="Ferredoxin hydrogenase"
FT                   /EC_number="1.12.7.2"
FT                   /note="PFAM: 4Fe-4S binding domain; Iron only hydrogenase
FT                   large subunit, C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_02870"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69048"
FT                   /db_xref="GOA:B8D1H1"
FT                   /db_xref="InterPro:IPR004108"
FT                   /db_xref="InterPro:IPR009016"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1H1"
FT                   /protein_id="ACL69048.1"
FT                   /translation="MIENSNYQSLRKDIFKQLCKDLYNDQIKKTINNLPYQLTKKDSHE
FT                   ELDLIKNEILLAMGLNPTAKNDTELSAELNTALNLKEVKQPVVTVNRKICDLCQKKYGP
FT                   DYCRVGCDINEKEGLLIEDGRCISCGKCIPKCPLEAVSDKVEFFPLYKYLKNDTQVYAN
FT                   VAPAIMGQFGEKVTAGHLRSAFKKIGFTDMVEVALFADIVTLREADEYNRLVQKEGDFM
FT                   ITSCCCPVWVNMVTKHYPSLNNHLTRTVSPMIASGRLIKLLFPDAITVFIGPCIAKKAE
FT                   AKHPELKGAIDFVLTFDELDLIFEALNIDPARLPEDNKEQSSRGGRVYARTGGVSQAVS
FT                   DTVKRLSPHEHVKFKANQADGVKNCKKLLDELKEGKVEATFIEGMGCEGGCVGGPKRIN
FT                   DIKEATRLVNKFGSKARSQTPIDNNNIYHIFNYLTQLIESQEQIIDEETYDNILVRK"
FT   gene            293222..294316
FT                   /locus_tag="Hore_02880"
FT   CDS_pept        293222..294316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_02880"
FT                   /product="carbamoyl-phosphate synthase, small subunit"
FT                   /EC_number="6.3.5.5"
FT                   /note="PFAM: Carbamoyl-phosphate synthase small chain,
FT                   CPSase domain; Glutamine amidotransferase class-I; TIGRFAM:
FT                   carbamoyl-phosphate synthase, small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_02880"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69049"
FT                   /db_xref="GOA:B8D1H2"
FT                   /db_xref="InterPro:IPR002474"
FT                   /db_xref="InterPro:IPR006274"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR035686"
FT                   /db_xref="InterPro:IPR036480"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1H2"
FT                   /protein_id="ACL69049.1"
FT                   /translation="MEAKLVLEDGTVFKGKGLGYEGTTWGEVVFNTSMTGYQEILTDPS
FT                   YRGQLVTLTYPLIGNYGINHNDFESYEIHAGGLIIREDCSRPNHWQSQNTLDVFLKEYK
FT                   ITGITNIDTRALTRRLRSKGSMFGVISSEILDEKELNKIIKQKIKEKRCLVEEVSVSTP
FT                   TRIPGKGPRVVVMDFGVKYNIVRYLKSLGADIFVLPYSSSAEEVLSYNPDGILLSNGPG
FT                   DPMDISEKVPEIQSLATKNIPVFGICLGHQLLGLAFGGRTYKLKFGHHGGNHPVKDLRT
FT                   GKVLITTQNHGYALEDGLPPEIEVTHINLNDGTIEGIKHKDLPVSSVQYHPEAGPGPKD
FT                   STLLFNEFINKLTGQRNVKKLVNF"
FT   gene            294465..297668
FT                   /locus_tag="Hore_02890"
FT   CDS_pept        294465..297668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_02890"
FT                   /product="carbamoyl-phosphate synthase, large subunit"
FT                   /EC_number="6.3.5.5"
FT                   /note="PFAM: Phosphoribosylglycinamide synthetase,
FT                   ATP-grasp (A) domain; MGS-like domain; RimK-like ATP-grasp
FT                   domain; ATP-grasp domain; Carbamoyl-phosphate synthetase
FT                   large chain, oligomerisation domain; Carbamoyl-phosphate
FT                   synthase L chain, N-terminal domain; Carbamoyl-phosphate
FT                   synthase L chain, N-terminal domain; Carbamoyl-phosphate
FT                   synthase L chain, ATP binding domain; Carbamoyl-phosphate
FT                   synthase L chain, ATP binding domain; ATP-grasp domain;
FT                   TIGRFAM: putative glutamate--cysteine ligase/putative amino
FT                   acid ligase; carbamoyl-phosphate synthase, large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_02890"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69050"
FT                   /db_xref="GOA:B8D1H3"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005480"
FT                   /db_xref="InterPro:IPR005483"
FT                   /db_xref="InterPro:IPR006275"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR036897"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8D1H3"
FT                   /protein_id="ACL69050.1"
FT                   /translation="MPINKKIKKVLVIGSGPIIIGQAAEFDYSGTQACKALKEEGLEVV
FT                   LVNSNPATIMTDTDIADQVYLEPLTFDYITRIIEKEKPDGLLPTLGGQTGLNLAVELAE
FT                   KGVLDKFGVTLLGTNLEAIQKAEDRNLFRELLDDIGEPFIESKIVDNLKEAVQTAQQIG
FT                   FPVIVRPAYTLGGSGGGIAENVEELKEIVTLGLKRSRINQVLIEKSLYGWKELEYEVIR
FT                   DGNDNCITICNMENIDPVGIHTGDSIVVAPSQTLSDKEYHLLRMASIKIIKALGIEGGC
FT                   NIQFALDPEGLDYYVIEVNPRVSRSSALASKATGYPIAQVSAKIALGLRLDEIKNIVTG
FT                   KTYACFEPALDYVVTKIPRWPFDKFSKGDRSLGTQMKATGEVMAIGRNFTESFLKAIES
FT                   LDIRLPDFMEDLDRESLENRVKKAYDDRMFYILQAFYNGVKPEDLYEWTGIDPFYLYKI
FT                   EEIVRLSLKISSNKDKILKGEVNLLARAKKLGLSDSMLGRLLGIPDFEVRDLRLKYGIK
FT                   PTYKMVDTCAAEFAAETPYYYSTYEEEDEVEVSDNRKVLVVGSGPIRIGQGIEFDYCSV
FT                   HAVRALQDRNVEAIIVNNNPETVSTDFDTSDKLYFEPLTTEYVLNVAEREGITDVILQF
FT                   GGQTAINLAEPLSEAGMNVLGTGLKSINLTEDRKQFNQVLTSEKIPTPPGYTVFSIEEA
FT                   LKLSHKIGYPVLVRPSYVLGGRGMEIVSNEAELKTYLTDAVKITPEHPVLIDRYIPGRE
FT                   IEVDAISDGNDVLIPGIMEHVERAGVHSGDSMAIYPARNLTTKQTRRLVNYTKKICNLF
FT                   GIKGIINIQFVLDRDGQFYVLEVNPRASRTVPILSKVTGIPMVKWSVRIMLGETLNQIT
FT                   TLKGLVPPGDLISVKVPVFSFDKLLGVDIHLNPEMKSTGEVLGTAENLEQAIYKGLKAA
FT                   DFDLPEGGKVLFSLADRDKQEALGVVCRFIEEGYQVLATRKTALYFQKRGLRVEKTEDP
FT                   VGLIKKGDIKMVVNTPTRGKEPGRIGFKLRRIAVEHNIPCFTSLDTVEMVLQALVRVGE
FT                   EEKKEVIPLSEYKKGGVLV"
FT   gene            297665..298906
FT                   /locus_tag="Hore_02900"
FT   CDS_pept        297665..298906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_02900"
FT                   /product="Argininosuccinate synthase"
FT                   /EC_number="6.3.4.5"
FT                   /note="PFAM: Arginosuccinate synthase; TIGRFAM:
FT                   argininosuccinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_02900"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69051"
FT                   /db_xref="GOA:B8D1H4"
FT                   /db_xref="InterPro:IPR001518"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018223"
FT                   /db_xref="InterPro:IPR023434"
FT                   /db_xref="InterPro:IPR024074"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1H4"
FT                   /protein_id="ACL69051.1"
FT                   /translation="MKKVNKIVLAYSGGLDTSVSIKWLQEKFNAEIIAYSANVGQDDND
FT                   WNQIKEKALKAGASKVYIDDIREEFIKNYAFNSLKANGLYEGKYPLATALSRPLIAKRM
FT                   VEVAHQEGAEAVAHGCTGKGNDQVRFDVSFKALDPDLEIIAPLREWEFKSRGEEIDYAK
FT                   KHNIPVKATKESPYSIDSNLWGLSVECGELEDPWAEPPLDAYQWTANPEEAPATPLYLT
FT                   ISFDQGEPIKLNDRYMSPVELVEKLNDIGAEYGIGRIDMVENRLVGIKSREIYETPAAT
FT                   ILLEAHQQLEDLTLDRETAHYKRLISEKYSELVYNGLWYSPLRSALEAFIEDTQKQVTG
FT                   KVKLKLYKGQCVTVGRKSPYSLYQFDLATYDENDSFDHSSAKGFIKLWGLPGQVYSQVQ
FT                   QKNKDTIYLKEFVK"
FT   gene            298903..299415
FT                   /locus_tag="Hore_02910"
FT   CDS_pept        298903..299415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_02910"
FT                   /product="Acetyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /note="PFAM: Acetyltransferase (GNAT) family"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_02910"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69052"
FT                   /db_xref="GOA:B8D1H5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1H5"
FT                   /protein_id="ACL69052.1"
FT                   /translation="MRSLSSPDNSVCIRGANTEDAGKVLILIRRAFKDYLPEPVTPGEY
FT                   ILPAFRDNIDEIVKDIVKNRVLIMEKDSLIIGSLRLVFEGSTSVYLKRFAILPGYQGQG
FT                   YGSLLLRYAEDEARNMKGCYLYLHSTLDNDKLVKFYLKNGYRCVRIDNSYPYRRGLWVK
FT                   RLNGVDQ"
FT   gene            299412..300806
FT                   /locus_tag="Hore_02920"
FT   CDS_pept        299412..300806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_02920"
FT                   /product="argininosuccinate lyase"
FT                   /EC_number="4.3.2.1"
FT                   /note="PFAM: Lyase; TIGRFAM: argininosuccinate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_02920"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69053"
FT                   /db_xref="GOA:B8D1H6"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR029419"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1H6"
FT                   /protein_id="ACL69053.1"
FT                   /translation="MMKLWGGRFSKQTHKLMEEFNSSLSFDKRLYSYDIKGSIAHVKML
FT                   SRTGVLSKSEAETIIKGLQEIKEEIDEGIISLEGRYEDIHSLVEKNLIDKVGAVGGKLH
FT                   TARSRNDQVALDTRLYLRDEIFNIQELLIIFLKTLLELGEKYKKVVMPGYTHLQRAQPV
FT                   SMGHHLLAYYFKLKRDYDRLNDNMKRVNVLPLGCGALAGTTFPIDREWVARELGFEKIA
FT                   LNSIDGVSDRDYIIEFMGIAASIMVHLSRFSAELILWSSSEFSFIELDDSFTTGSSIMP
FT                   QKKNPDVAELVRGKSGRIFGNLVQLLSLLKGLPLAYNKDMQEDKEALFDTIDNLKIILE
FT                   IFPPMLKTMKVNKDRLYRAANRGFVNATDLADYLARKGVPFREAHGMVGKAVLYALEKD
FT                   KELNQITIEEWNQLFPDYGDIFDKGLSEILDVNTSLNNRKSSGGPAPEEVERVISIERE
FT                   WIESFT"
FT   gene            300924..301502
FT                   /locus_tag="Hore_02930"
FT   CDS_pept        300924..301502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_02930"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_02930"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69054"
FT                   /db_xref="InterPro:IPR009097"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1H7"
FT                   /protein_id="ACL69054.1"
FT                   /translation="MIQPASLESEHFIVLIPRGKVYSLARGIQKFISENCRISDDVFFP
FT                   EIHITLDRIKKGYRDEVVAIVEKVINKYKKIDICVNTDQSFHFYQNNFLVMDILNEGPL
FT                   MEFALNLHRELEKRGLSTINNYHQWDLHITLLSNLFASRPIPDKLFRHIYYYISYNTNK
FT                   KQYASEADRLEVWRPEPDPENRCLASFKL"
FT   gene            complement(301513..302433)
FT                   /locus_tag="Hore_02940"
FT   CDS_pept        complement(301513..302433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_02940"
FT                   /product="Auxin Efflux Carrier"
FT                   /note="PFAM: Membrane transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_02940"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69055"
FT                   /db_xref="GOA:B8D1H8"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1H8"
FT                   /protein_id="ACL69055.1"
FT                   /translation="MGIIINQILVLFLIIFLGFVLRKKQLINEEINKGLSNILVDVTLP
FT                   ALIISSMAIEFNPDIMDNIKKIGFISIASYLTVIALVLIFTSKLSLPSKRKTVFKFLLI
FT                   FGNVGYMGYPVIDTIYPELGILYAVINNIIFNVLVWTFGIYLFIKDEKGSNIKLHNLVN
FT                   NGLIAVVIGFILFLGNIKLPLPIEGALDKVGEMTFPLSMIIIGSSLTNVRFKTIIKDYY
FT                   LYLLCLLKLIAIPLIGFLILIQFDLPQIIRDISVLLLAMPAAASGVIFAEKFEGDYKFA
FT                   SEGVFITTLFSLVTIPLFIWLTRIY"
FT   gene            302577..305210
FT                   /locus_tag="Hore_02950"
FT   CDS_pept        302577..305210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_02950"
FT                   /product="putative PAS/PAC sensor protein"
FT                   /note="PFAM: Sigma-54 interaction domain; TIGRFAM: PAS
FT                   domain S-box"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_02950"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69056"
FT                   /db_xref="GOA:B8D1H9"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004108"
FT                   /db_xref="InterPro:IPR007202"
FT                   /db_xref="InterPro:IPR009016"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030828"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1H9"
FT                   /protein_id="ACL69056.1"
FT                   /translation="MVGLIETIKDRCHECYACVRNCPVKAVRVKNRQAEVISDRCIHCG
FT                   NCVLVCSQGAKKVRDFKEIAKQFLQDNDKIVAGLAPSFPSYGNQLSLDDWVSYLKSLGF
FT                   NRVYEVAWGAEMVIKEYKKILKKATGPVISSACPVIVNLIKKYYPDLLTYLATIVSPMK
FT                   ALYRYIKKIEGNDVKVVLIGPCLAKKGEFEGYEDVVVLTFSEIAEPGQNSGDYQKIITA
FT                   SKQEVTDRRNTDTIKREPDDESRALPLAGGLIRAITGKCNIFPEGYNQVEGREKVIDLL
FT                   NSIRNGEIKPRFVDALFCEGCINGVDLYHENYFKKEKAVFNFINRAKDNNVAQAKYSET
FT                   VASRISLKVKFKEDYRELASPGEEEIWSILNQTNKFTEEDLLDCGACGYATCWDKAIAV
FT                   YQGLAEVEMCLPYLINEKRSELKEIQILNKEMDTLINFSCDGLVMVSKDGRIERVNHSY
FT                   LNMVGFKRQDLIGKRVEELEKERYIYPSVASLALKEKRNITLVENTSDKKRLLATANPV
FT                   FNENGDLEWVVVNVRNLDLINDEKDKEKEKLKKYLDNAPQLDNNPEGNTGHIIVSSDEM
FT                   KNILMTCRKIAGTDSTVLITGESGVGKEVVARYIHEQSPGRQEFVKINCAAIPESLLES
FT                   ELFGYETGAFSGAKRAGKPGLIEKADRGTLFLDEIGEMPLNMQAKLLQVLQERKLTRIG
FT                   GVKPVKIDFRLIAATNRDLRQMVRQKYFRQDLFYRLNVVPLYIPPLRKRPEDILSLIKY
FT                   FLDQYCEKYNKQIKLTRDAEELLLSYSWPGNVRELTNLIERLVVTCEESFVDRNIIIEY
FT                   IDNPEVKTPEILINKIMPLPEAVARVEKKLLSMARSKGNSTYDMAKLLGVNQSTVVRKL
FT                   HKYFKQ"
FT   gene            305730..306140
FT                   /locus_tag="Hore_02960"
FT   CDS_pept        305730..306140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_02960"
FT                   /product="NADH dehydrogenase I subunit E"
FT                   /EC_number="1.6.5.3"
FT                   /note="PFAM: Respiratory-chain NADH dehydrogenase 24 Kd
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_02960"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69057"
FT                   /db_xref="GOA:B8D1I0"
FT                   /db_xref="InterPro:IPR002023"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR041921"
FT                   /db_xref="InterPro:IPR042128"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1I0"
FT                   /protein_id="ACL69057.1"
FT                   /translation="MNRVSFLERLHNIQETYGFISEGEIRKLSQEYKMPRARIYGVIRF
FT                   YSMFYTEPVGKYIVRVCDSLSCHINDSEGIVEVVKDYLGIKNGETTEDKKFTLEVVECL
FT                   GHCGEGPVMMVNDRIYTRVSPNMALEILRDCV"
FT   gene            306160..307386
FT                   /locus_tag="Hore_02970"
FT   CDS_pept        306160..307386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_02970"
FT                   /product="NADH dehydrogenase I subunit F"
FT                   /EC_number="1.6.5.3"
FT                   /note="PFAM: Respiratory-chain NADH dehydrogenase 51 Kd
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_02970"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69058"
FT                   /db_xref="GOA:B8D1I1"
FT                   /db_xref="InterPro:IPR001949"
FT                   /db_xref="InterPro:IPR011538"
FT                   /db_xref="InterPro:IPR019575"
FT                   /db_xref="InterPro:IPR037207"
FT                   /db_xref="InterPro:IPR037225"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1I1"
FT                   /protein_id="ACL69058.1"
FT                   /translation="MTERLFLKQNEVSDFDSYKFPALKRALDMDKKDIIEELKKSGLRG
FT                   RGGAGFPTGLKWELALKEKAGEKYIICNGDEGEPGTFKDRYLLENSPLKVLEGILIGAY
FT                   TIGAHQGYIYIRGEYALPINIFRQVIKEAKKRGILGNRVMGSDYSFDLKLIKGAGAYVC
FT                   GDETSLINSIEGKRGTSRIKPPYPTRQGLFNKPTVVNNVETLAAAAEIILQGADKYGSM
FT                   GTEQSRGTKLVCLSGDICNPGVYEVEFGTMTIKELIDTFGGGVKCSSGLKFVIPGGIST
FT                   SVLKDDELDIPYTYEDIEKKGSSLGSGAVVVVSEDHYLPDLMLNVSRFFMDETCGTCFP
FT                   CREGNRRVHLLLKNKISDGRFDRDEKKLISDIGRAIHLAARCGLGQTSLNFVTSVLNKF
FT                   EDELMVGRD"
FT   gene            307388..309100
FT                   /locus_tag="Hore_02980"
FT   CDS_pept        307388..309100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_02980"
FT                   /product="NADH dehydrogenase I subunit G"
FT                   /EC_number="1.6.5.3"
FT                   /note="PFAM: Iron only hydrogenase large subunit,
FT                   C-terminal domain; 4Fe-4S binding domain; 2Fe-2S
FT                   iron-sulfur cluster binding domain; Iron hydrogenase small
FT                   subunit; TIGRFAM: hydrogenases, Fe-only"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_02980"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69059"
FT                   /db_xref="GOA:B8D1I2"
FT                   /db_xref="InterPro:IPR000283"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR003149"
FT                   /db_xref="InterPro:IPR004108"
FT                   /db_xref="InterPro:IPR009016"
FT                   /db_xref="InterPro:IPR013352"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019574"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036991"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1I2"
FT                   /protein_id="ACL69059.1"
FT                   /translation="MVKINIDGLDLEVRDGISILEAARQAHIKIPTLCYEEGLSVYGGC
FT                   RLCVVEIEGEALLKPACATEVNDGMVIKTHSPKVRDVRRTLFELIVASHNIDCQLNCLT
FT                   CSRAGSCELREIAEDIGVSNIRLATYDKGYRDDRSSYSIVREPNKCITCGRCIRKCEEV
FT                   QEVGIFTTANRGPATVVTTFKEKGMGNVECTNCGQCIHACPTGALHEVYHYEKVWEVLH
FT                   DRDKYVVVQTAPAVRVALSEAFGLKPGTIFTGQMVAGLRRLGFDRVFDTNFTADLTIME
FT                   EGTELIERLNNNGELPMFTSCSPGWIKYIEHFYPEFIDNLSTCKSPQQMFGAIAKSYYA
FT                   DKSNIPRDKIVVVSVMPCTAKKFEARRPEMEGDVDYVLTTRELARMIKEAGIDITNLNA
FT                   EEHDKLMGTSSGAADIFGATGGVMEAALRTAYELVTGEKLGQLDFKNVRGEAGIKEAEV
FT                   TLNGTQLKVAVAHGLGNVRKLMELIKSGKEYHFVELMACPGGCIGGGGQPIPTSEDIRR
FT                   KRIEALYKIDKNKKLRKSHENPYIKKLYQEFLDKHGSHKAHELLHTHYINRGV"
FT   gene            309104..309748
FT                   /locus_tag="Hore_02990"
FT   CDS_pept        309104..309748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_02990"
FT                   /product="CoA-binding domain protein"
FT                   /note="PFAM: CoA binding domain; Putative DNA-binding
FT                   protein N-terminus"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_02990"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69060"
FT                   /db_xref="GOA:B8D1I3"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR009718"
FT                   /db_xref="InterPro:IPR022876"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1I3"
FT                   /protein_id="ACL69060.1"
FT                   /translation="MNEVPQATIERLVVYYRYLKKMAERDLEDTISSKTLGDAVGTSAA
FT                   QVRKDLSYFGEFGCKGVGYDINSLKKCLERILGFNRVREIALVGAGNLGRALVNYQGFK
FT                   EMGMEIVEVFDCDIDKINNRVGRLTVRSVNEMEKIIRKRNIKTAIIAVPEEEAQGVASS
FT                   LVKAGVKAIWNFAPVALNLPSEVVIYYEDLASSLVWLIYKSGHGNLKVNVK"
FT   gene            309898..311259
FT                   /locus_tag="Hore_03000"
FT   CDS_pept        309898..311259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_03000"
FT                   /product="RNA methyltransferase, TrmA family"
FT                   /note="PFAM: tRNA (Uracil-5-)-methyltransferase; TRAM
FT                   domain; TIGRFAM: 23S rRNA (uracil-5-)-methyltransferase
FT                   RumA"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_03000"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69061"
FT                   /db_xref="GOA:B8D1I4"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030390"
FT                   /db_xref="InterPro:IPR030391"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1I4"
FT                   /protein_id="ACL69061.1"
FT                   /translation="MAANGDLIELKLDTLGHGGEAIGRYRGLVVFVPEGIPGEKVRVKI
FT                   KERKKNYARGEIKEILTPAPERKEPECEVFGLCGGCHLQQMDYSLQLLHKQKIVKDTLE
FT                   RIGGFEEVRVNEVIGADHPWIYRNKAQFPLGSDNEGRVITGFYQKGTHQVVPHRQCVIQ
FT                   HPLINRIARKTISILNNYDLTVYDEKTHTGLLRHLVVRVGICTNQALLIFVTRDKKFKE
FT                   LQEIARKLMTEIPELKGVLQNINPRRTNVIMGDKTLLIKGNDYYIDYIGSIRYAISPHS
FT                   FFQVNTLQTERLYNTVRKYAGLSGQETVVDAYCGAGSIGIYLAGEARTVYGIEVVGSAI
FT                   EDAERNAALNGINNCIFIKGKVEDKLPELVDKKKIKPDVIIFDPPRKGLDKETMATVLE
FT                   VLPPKIVYVSCNPATLARDLKEIKACYDINEVQPVDLFPQTYHVECVVKLESNV"
FT   gene            complement(311322..311513)
FT                   /locus_tag="Hore_03010"
FT   CDS_pept        complement(311322..311513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_03010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_03010"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69062"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1I5"
FT                   /protein_id="ACL69062.1"
FT                   /translation="MECTITRNKSNCTCTYDPCPRKGKCCECITYHRQRGELPGCLFPP
FT                   EVEKTYDRSIEAFIKAHQ"
FT   gene            311958..314039
FT                   /locus_tag="Hore_03020"
FT   CDS_pept        311958..314039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_03020"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: Methyl-accepting chemotaxis protein (MCP)
FT                   signaling domain; HAMP domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_03020"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69063"
FT                   /db_xref="GOA:B8D1I6"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1I6"
FT                   /protein_id="ACL69063.1"
FT                   /translation="MKLKVTMSAFIKKGGKAISNFFLKIEKGLINLLNKFKIGKRLMFF
FT                   ILLLIILVIGLNSYLSLNTFTGYVTNQQKQNMLEGLYSIDQLLENKRTELSGYARLLSQ
FT                   VPAVKELVTGEGRVDVLFDLRTNLDIVNLAIRDSEFSLVHSFMAEDPLGNKKELTSKLE
FT                   QLLFQGITVPFISRTESNIYINSIGPITGEFGIETIGSLIISDPINTTLLDQISKNTGY
FT                   IVQLYAGDELLFNNSDASEFSSIDLVDEDIITSLNKSEESGEEFYITNKNLESGSYLVG
FT                   YYPIKNFFGDNIGYLTLVSSQQGVTRLVENTQKRTVLYAVIFIIASFLIVLLITRSITV
FT                   PLKKVIEVTNSVADGDLTRMVKNKSRDQLAEMTKNFNKMVQNLRSIVKELINSSENVYN
FT                   MSQNLSANTEEVTAASQEVAAASEEIAAGTEEQAEKTEKATRILSEIKTKAQNVASSSE
FT                   EVFQTVEQAFDRSSYGLEVMGNVSENMDQILEEVQNTQSEVLTLADKIKKINTIVEAIN
FT                   YINEETSLLSLNAAIEAARAGEAGRGFAVVADEIRKLAEESNKSVQEINHIFEQINTAT
FT                   GNVVDSMEKSSKLVEEGEKSVENAEEVFGQIQEAINKSKKVAREINRYVQEQLEGTREI
FT                   SDAVEEINKISRSNAEGAKQSARTNEEQTEVIEQMAQAADELAHMADNLQRMVNQFRI"
FT   gene            314324..314605
FT                   /locus_tag="Hore_03030"
FT   CDS_pept        314324..314605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_03030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_03030"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69064"
FT                   /db_xref="GOA:B8D1I7"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1I7"
FT                   /protein_id="ACL69064.1"
FT                   /translation="MNVFLLIFFILLAIAGLIFKVDAGVFAGLGLATWQVIRLRINKTL
FT                   NLVTILITTIMGSVYFYITDNTLFLILFIFIELYNLLGHISITRREES"
FT   gene            314856..315071
FT                   /locus_tag="Hore_03040"
FT   CDS_pept        314856..315071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_03040"
FT                   /product="putative regulatory protein, FmdB family"
FT                   /note="TIGRFAM: putative regulatory protein, FmdB family"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_03040"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69065"
FT                   /db_xref="InterPro:IPR013429"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1I8"
FT                   /protein_id="ACL69065.1"
FT                   /translation="MPTYLYECENCGRFEHFQKITDDPIETCPECGGKVRRIIGSPGII
FT                   FKGSGFYVTDSRKKNNKKSSDQEKAS"
FT   gene            315073..315543
FT                   /locus_tag="Hore_03050"
FT   CDS_pept        315073..315543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_03050"
FT                   /product="uncharacterized conserved protein"
FT                   /note="PFAM: Protein of unknown function (DUF523)"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_03050"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69066"
FT                   /db_xref="InterPro:IPR007553"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1I9"
FT                   /protein_id="ACL69066.1"
FT                   /translation="MIIVSACLLGKKCRYDGKAKLNNRLVKLLKDKEIIPVCPELEGDL
FT                   PVPRPPAEIIGGNGFDILKGRARIKNREGRDVTDNFIKGVNKVITRVDLKDIRMAILKE
FT                   RSPSCGVNCIYDGSFNGKLKDGCGVFTARLLKEKIPIFSEEETGKLINQGLL"
FT   gene            315885..316604
FT                   /locus_tag="Hore_03060"
FT   CDS_pept        315885..316604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_03060"
FT                   /product="Spore cortex-lytic enzyme SleB"
FT                   /note="PFAM: Putative peptidoglycan binding domain; Cell
FT                   Wall Hydrolase; TIGRFAM: spore cortex-lytic enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_03060"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69067"
FT                   /db_xref="GOA:B8D1J0"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR011105"
FT                   /db_xref="InterPro:IPR014224"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="InterPro:IPR042047"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1J0"
FT                   /protein_id="ACL69067.1"
FT                   /translation="MKGVGRVKKKIITLLVILGITGISTVVYFTALNTNTEAARPTLYW
FT                   GTSGSNVRLVQWKLQQWGYYEGRIDGYFGPETSEAVREFQRKNGLRVDGLVGPQTWAAL
FT                   GYEARPTTYARQTAAAVSRNDDVQLLARLVHAEARGEPYRGQVAIAAVVLNRVESPSFP
FT                   NSLSGVIYQPLAFESVANGQINLPPTQENLRAARAALNGWDPTYGCLFFWNPSKPVSRW
FT                   IWSRRVVTTIGSHVFAQ"
FT   gene            316700..318031
FT                   /locus_tag="Hore_03070"
FT   CDS_pept        316700..318031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_03070"
FT                   /product="Spore germination YpeB"
FT                   /note="TIGRFAM: germination protein YpeB"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_03070"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69068"
FT                   /db_xref="GOA:B8D1J1"
FT                   /db_xref="InterPro:IPR014239"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1J1"
FT                   /protein_id="ACL69068.1"
FT                   /translation="MLIAVLVAGAIGYWGYDQYRDRQQLEIYLGNKYQQAFYELVERVE
FT                   QLQVLLGKTMVSSSPRQNILILTDVWNHATTAQEQLNRLPLSNQAAFRAAKFLNQTGDY
FT                   AHVLAQKNAEGKVLTAENRKKLVELRQQAARVSASLHDLESQVFSGDINWVELVKGTRG
FT                   KMQENKPNPMLDGFDEIRSELSKYPTLIYDGPFSDHITETKPRGLQGNEVTKTEARRKA
FT                   EKVADFVNNDGINVSRGKTVNGRIRSYNFQVKNDDGEVYSVDISRKGGHLVNMLTSRQV
FT                   AGAKIGQKEAAEKARDYLARIGYPNMEPTYSEINDNIAFISFAYKPDNIIYYTDIINVQ
FT                   VALDNGQILGVEALNYLMSHREREKQEPEISEEEVRGMVNDTLEKIENIRLAVIPEESL
FT                   KEVFTYEVRGTIGEETYLVYINAKTGVEEQILKVIKGKQGTFAL"
FT   gene            318139..319272
FT                   /locus_tag="Hore_03080"
FT   CDS_pept        318139..319272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_03080"
FT                   /product="uncharacterized conserved protein"
FT                   /note="PFAM: Domain of unknown function (DUF362); 4Fe-4S
FT                   binding domain; 4Fe-4S binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_03080"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69069"
FT                   /db_xref="InterPro:IPR007160"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1J2"
FT                   /protein_id="ACL69069.1"
FT                   /translation="MERVSVIKCDSYKGVEEKVVSAVKLLGGIEKFVKPGQKVLLKVNL
FT                   LMGKPPDKAITTHPRVVKAVGELVKQAGGQVIIGDSPGGPFTKNALRKIYRVTGMEEVA
FT                   EELGAELNYDVEQEKVEYRSGIITKSFIVGKYITGADVIINIPKLKTHGMTMYTGAVKN
FT                   LYGAIPGLLKADYHLRMPELSHFSQMLIDLAFCVKPALNIMDGIIGMEGDGPSGGTPRK
FT                   FGYILASASPLGLDVAALFLMGVRPLNKVPLIKAARERGEVADITDINLVGDKLYPLDD
FT                   VEIPQGDRVSNLLDKRLPGPLANILGYLLRPRPVFDHGRCTGCQVCFKHCPAKTIEMVA
FT                   GKPEVNLNNCIRCFCCQELCPYNAVDIKRPLLGRLIF"
FT   gene            319293..319775
FT                   /locus_tag="Hore_03090"
FT   CDS_pept        319293..319775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_03090"
FT                   /product="phosphodiesterase, MJ0936 family"
FT                   /note="PFAM: Calcineurin-like phosphoesterase; TIGRFAM:
FT                   phosphoesterase, MJ0936 family"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_03090"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69070"
FT                   /db_xref="GOA:B8D1J3"
FT                   /db_xref="InterPro:IPR000979"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR041802"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1J3"
FT                   /protein_id="ACL69070.1"
FT                   /translation="MVIGVVSDTHIPTKARSLPEELVTGLKDVDLIIHAGDVINVKTLN
FT                   EFKKIAPVKAVSGNVDLPEVKKMLPDRLNLTLENKKIGVVHGHNLRGHIMDRLGYIFPE
FT                   ADIIIFGHTHHPLNRRINGQLYFNPGSPTDKRLQPHYTYGIIELSGKNINSKIIEF"
FT   gene            319792..320148
FT                   /locus_tag="Hore_03100"
FT   CDS_pept        319792..320148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_03100"
FT                   /product="uncharacterized conserved protein"
FT                   /note="PFAM: Protein of unknown function (DUF964)"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_03100"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69071"
FT                   /db_xref="InterPro:IPR010368"
FT                   /db_xref="InterPro:IPR023378"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8D1J4"
FT                   /protein_id="ACL69071.1"
FT                   /translation="MALYDLAHQLAREIKNSDEYTRYKELKDKIMSNEATKSMLLDFQK
FT                   QQINIQSKQINGQTITDEEKEKFENIKELINLNSDIKEYLDAEYRMGVLFNDIQKILFG
FT                   GLEIGITENEKSTR"
FT   gene            complement(320209..320433)
FT                   /locus_tag="Hore_03110"
FT   CDS_pept        complement(320209..320433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_03110"
FT                   /product="nitrogen-fixing NifU domain protein"
FT                   /note="PFAM: NifU-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_03110"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69072"
FT                   /db_xref="GOA:B8D1J5"
FT                   /db_xref="InterPro:IPR001075"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1J5"
FT                   /protein_id="ACL69072.1"
FT                   /translation="MKEEVAKIIDKIRPSLQADGGDVKLVDVDDEKGIVKVKLLGACQG
FT                   CPMSTMTIKNGIERVLKEKVPGVKEVKPV"
FT   gene            complement(320563..321048)
FT                   /locus_tag="Hore_03120"
FT   CDS_pept        complement(320563..321048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_03120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_03120"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69073"
FT                   /db_xref="GOA:B8D1J6"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1J6"
FT                   /protein_id="ACL69073.1"
FT                   /translation="MFYPIFSFTKGELIFILAVFILGTIVGATLLNIYLSRRIDNLILT
FT                   NRELKIKNEEQQEQIDQLKENLKISRRHYINNVQIKLRSELNKHTQQDIIQKIKKLLSG
FT                   LPGKEIKDIDALLIRDLINDRYLVIEDEVYRLELIYLVISEELTLYIKVSTKNGENN"
FT   gene            complement(321052..321363)
FT                   /locus_tag="Hore_03130"
FT   CDS_pept        complement(321052..321363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_03130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_03130"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69074"
FT                   /db_xref="GOA:B8D1J7"
FT                   /db_xref="InterPro:IPR025689"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1J7"
FT                   /protein_id="ACL69074.1"
FT                   /translation="MNRVVPVFFIALGVVLGGSFIGSIGGVLINQPPLKTLTDIADDLK
FT                   LYAIISAIGGTFTNLRMLEGVFTQGDLSIIVQQFFILLSAFMGAQLGYWLVIVFCGGK"
FT   gene            321405..324773
FT                   /locus_tag="Hore_03140"
FT   CDS_pept        321405..324773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_03140"
FT                   /product="DNA polymerase III catalytic subunit, DnaE type"
FT                   /EC_number="2.7.7.7"
FT                   /note="PFAM: PHP domain; OB-fold nucleic acid binding
FT                   domain; Bacterial DNA polymerase III alpha subunit;
FT                   TIGRFAM: DNA-directed DNA polymerase III (polc)"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_03140"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69075"
FT                   /db_xref="GOA:B8D1J8"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004805"
FT                   /db_xref="InterPro:IPR011708"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR029460"
FT                   /db_xref="InterPro:IPR040982"
FT                   /db_xref="InterPro:IPR041931"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1J8"
FT                   /protein_id="ACL69075.1"
FT                   /translation="MTANFVHLHVHTEYSLLDGAIRLKDLVKKTKEYDMPGVAITDHGV
FT                   LYGAIDFYKLARQYGIKPIIGCEVYLTPSSFRKKDTRERYHLLLIAQNREGYHNLTKIV
FT                   SRSWLEGFYYKPRVDKDLLYQHRKGLICLSSCLQGEIPQLILKDRLQEAEQAIKEYEAI
FT                   FGRESFYLELQDHNLGDEKLVNSRLIELSNKLGTPLVVTNDSHYLNREDASLHDVLLAM
FT                   QTGKTINDENRLSFTGEEFYFKSPDEMKSLFPDIEDTYLNTVKIAEMTDIDFDFNTFYI
FT                   PDFPDAKGDKTPVEILRDKCQQGLKEKGLEDNKEARERLQYELEIIEEMGYVSYFLIVW
FT                   DFVNFARQKGIRVGPGRGSAAGSLVSYLLGITKINPLKYGLIFERFLNPERVTMPDIDI
FT                   DFDERRDEIIEYVKQRYGREKVAQIGTFGTMAARAAIRDVGRVLDIPLRKVDRIAKMVP
FT                   GRVTIKEALKMNDNLNKLYQQDSEVKRLLDYACRVEGMPRHISTHAAGVIIGPGDLSNI
FT                   IPLQTQDENIITQFHMENLEELGLLKMDFLGLRNLTIINKTLNLISKRYGREIDVDNIP
FT                   LNDDRVYKMLQEGKTPGVFQMESRLFQDLNRRLKPEKFSDLIALLALGRPGPLGSNLVE
FT                   QYIKSRHGEIEPSYLHPELEPILEETFGLILYQEQVMEIASKLAGYTMGEADLLRRGMG
FT                   KKKKELISKERERFVEGAVKNGIEKEVAHKIFDQMEYFAGYGFNKSHSTAYAMLAYQTA
FT                   YLKANYPSEFMAALLSTVMNNLDKVGQYIRECQEMGLRVLPPDVNRSGFEFETTPDGDI
FT                   SFGLKAIKNVGIKAIEAIIEERNRNGNYSSLEDFIERVDTGRVNLQVIESLIKAGVFDS
FT                   FNTYRSQMLIKYEEIYEKLGSRSRNRAQGQTSFFDLFSEDEKFYNQSIEYPEIEELPLE
FT                   ERLNQEKEYLGIYLSAHPLDPFKDKIDHFISTTSQDIKDYEGDKVTIGGVVVDFKEHIT
FT                   RTNKKMAFLTLEDWLGNIKVVVFPDLYNQLDINLEKGLKLLITGRVDDGSVISNKIISL
FT                   EQDFIEIDVTSLDSDKLKELKNLCQQYRGDCPLFINVGDTCLLSGINYWVSDGGAFLQK
FT                   AKKLVGINNVKIWSS"
FT   gene            324807..326222
FT                   /locus_tag="Hore_03150"
FT   CDS_pept        324807..326222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_03150"
FT                   /product="aspartate ammonia-lyase"
FT                   /EC_number="4.3.1.1"
FT                   /note="PFAM: Lyase; TIGRFAM: aspartate ammonia-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_03150"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69076"
FT                   /db_xref="GOA:B8D1J9"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004708"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR018951"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1J9"
FT                   /protein_id="ACL69076.1"
FT                   /translation="MLTRKERDPLGEKEVPRDAYYGIQTLRAAENFQITNLRIHPELIK
FT                   SLAYVKKAAASVNIEIGMLNEKIGKAIIQATDEVINGSLNEEFIVDALQGGAGTSINMN
FT                   MNEVLANRAIEILGGEKGDYSLVHPNNHVNMGQSTNDVYPTAIRITAIKLLRRALEELS
FT                   SMYGALTRKSGEFDHIIKMGRTQLQDAVPIRLGQEFGAYASAIKRDIRRIKETVADLKV
FT                   VNLGATAIGTGLNADHEYVNNVTRRLNELTGLDLTQADDLIDATQNADALVEVSSALKT
FT                   CAVNLSKIASDLRLLSSGPRAGLNEINLPAVPPGSSIMPGKVNPVIPEVVNQIAYQIIG
FT                   NDTTITMAAESGQLELNVMIPVLTFNLFQSIEILKNGVKTFTEKAIEGITVNEERCKEL
FT                   VDKSVSIITAINPHVGYEVASRIAKKALKTGKSVKELILEEGVLNEEELKLILNPYEMT
FT                   EPGIAGKELLEGH"
FT   gene            326254..326730
FT                   /locus_tag="Hore_03160"
FT   CDS_pept        326254..326730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_03160"
FT                   /product="putative small multi-drug export"
FT                   /note="PFAM: Putative small multi-drug export protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_03160"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69077"
FT                   /db_xref="GOA:B8D1K0"
FT                   /db_xref="InterPro:IPR009577"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1K0"
FT                   /protein_id="ACL69077.1"
FT                   /translation="MNEVFLWLDKYLSRELAVLITACLPFIELRGAIPLAISLGFSPIK
FT                   AFWLGIIGNAIPVIPLLVLLEPVRKWLRRRFRFMNKFFSWLDERTLKKSDKVDKYGALG
FT                   LILFTAVPLPTTGAWTASLAAILFKIKFRYAFPAIMVGILLAGCVVTLMSSVFL"
FT   gene            326853..327071
FT                   /locus_tag="Hore_03170"
FT   CDS_pept        326853..327071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_03170"
FT                   /product="tryptophan RNA-binding attenuator protein"
FT                   /note="PFAM: Tryptophan RNA-binding attenuator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_03170"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69078"
FT                   /db_xref="GOA:B8D1K1"
FT                   /db_xref="InterPro:IPR000824"
FT                   /db_xref="InterPro:IPR016031"
FT                   /db_xref="InterPro:IPR023558"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1K1"
FT                   /protein_id="ACL69078.1"
FT                   /translation="MDVNADFVVVKALEDGVTIIGLTRGKETKFAHTEKLDKGEVLVAQ
FT                   FTEHTSAIKIRGKAELLTKHGKFTSGN"
FT   gene            327181..327357
FT                   /locus_tag="Hore_03180"
FT   CDS_pept        327181..327357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_03180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_03180"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69079"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1K2"
FT                   /protein_id="ACL69079.1"
FT                   /translation="MWQVVHIATTEGEAKEIKDKLTAEGFLVKLESMSEGGFQIKVPEV
FT                   EAEDVHQFLNDAL"
FT   gene            327425..328303
FT                   /locus_tag="Hore_03190"
FT   CDS_pept        327425..328303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_03190"
FT                   /product="acetyl-CoA carboxylase, carboxyl transferase,
FT                   beta subunit"
FT                   /EC_number="6.4.1.2"
FT                   /note="PFAM: Carboxyl transferase domain; TIGRFAM:
FT                   acetyl-CoA carboxylase, carboxyl transferase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_03190"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69080"
FT                   /db_xref="GOA:B8D1K3"
FT                   /db_xref="InterPro:IPR000438"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="InterPro:IPR041010"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8D1K3"
FT                   /protein_id="ACL69080.1"
FT                   /translation="MLKDLFGKSRYVTVKREEHTSSKKKAPGDDRLWTKCKKCKEIIFN
FT                   KKLVENLMVCPKCGYHFRLTARDRLAITIDEGSFKEFGQDIKTVDPLEFPGYQQKIGKY
FT                   KVKTGMEEAIITGEATIEGYPVVIAVMDFHFMGGSMGSVVGEKVTRAIEKAISTRKPLV
FT                   IFSTAGGARMQEGMLSLMQMAKTSAAIKRLNKAGILYVSVMTDPTSGGVTASFASLGDI
FT                   IIAEKGALIAFAGPRVIKQTISTKLPEGFQRAEFLLDHGMVDMVLSRHEIRDELAKILK
FT                   IHQIGVVSNGG"
FT   gene            328293..329294
FT                   /locus_tag="Hore_03200"
FT   CDS_pept        328293..329294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_03200"
FT                   /product="acetyl-CoA carboxylase, carboxyl transferase,
FT                   alpha subunit"
FT                   /EC_number="6.4.1.2"
FT                   /EC_number="2.7.7.72"
FT                   /note="PFAM: Acetyl co-enzyme A carboxylase
FT                   carboxyltransferase alpha subunit; TIGRFAM: acetyl-CoA
FT                   carboxylase, carboxyl transferase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_03200"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69081"
FT                   /db_xref="GOA:B8D1K4"
FT                   /db_xref="InterPro:IPR001095"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1K4"
FT                   /protein_id="ACL69081.1"
FT                   /translation="MAGNNILDFEKPLLELKDKIEELQSFMDEKGIDLSEEINRLKTRA
FT                   KNLQREIYANLEPKQILQIARHPERPTTMDYVDYIFDEFLELHGDRRFGDDKALIGGIG
FT                   TIDNMPFTLLGHQKGKSTKENLERNFGMAHPEGYRKALRLMKQAEKFNRPVIALINTPG
FT                   AYPGVGAEERGQAEAIAVNLMEMSDLKVPIIVVVTGEGGSGGALGIGLGDKIMMLEYSY
FT                   YSVSSPEACAAILWKDANKAPEAARALNLTSADLLRLGIIDEIIKEPAGGAHKDPQQAA
FT                   LLLKQAILKTAKQLKQLSVEELLERRYHKFRKMGIYTVTSKTKNLNNVQSNS"
FT   gene            329307..330305
FT                   /locus_tag="Hore_03210"
FT   CDS_pept        329307..330305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_03210"
FT                   /product="6-phosphofructokinase"
FT                   /EC_number="2.7.1.11"
FT                   /note="PFAM: ATP-NAD kinase; Phosphofructokinase; TIGRFAM:
FT                   6-phosphofructokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_03210"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69082"
FT                   /db_xref="GOA:B8D1K5"
FT                   /db_xref="InterPro:IPR000023"
FT                   /db_xref="InterPro:IPR012003"
FT                   /db_xref="InterPro:IPR012828"
FT                   /db_xref="InterPro:IPR015912"
FT                   /db_xref="InterPro:IPR022953"
FT                   /db_xref="InterPro:IPR035966"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8D1K5"
FT                   /protein_id="ACL69082.1"
FT                   /translation="MKKIGVLTSGGDAPGMNAAIRSVVRTGIYHGLDVVGIRRGYAGLI
FT                   EGDFYLMDRGSVADIIQRGGTILLSARCEEFKTEEGRQKALKKMKEEGIEGLVVIGGDG
FT                   SFRGAEKVSKELGIPAIGIPGTIDNDLACTDFTIGFDTAMNTIIDTINKIRDTATSHER
FT                   TFVVETMGRRSGFLTLMAGLAGGAESILIPEIDFDLDDVSQKLKKGYERGKLHSIILVA
FT                   EGVGDDFSTNRDINHSKAFVIGKQIAEKTGLETRVIILGHIQRGGSPTAMDRILASRMG
FT                   SKAVELLLASESNKMVGYVNNKLVTCDISEALSKEKQVEKDVYKLANILSM"
FT   gene            330449..332203
FT                   /locus_tag="Hore_03220"
FT   CDS_pept        330449..332203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_03220"
FT                   /product="pyruvate kinase"
FT                   /EC_number="2.7.1.40"
FT                   /note="PFAM: PEP-utilising enzyme, mobile domain; Pyruvate
FT                   kinase, alpha/beta domain; Pyruvate kinase, barrel domain;
FT                   TIGRFAM: pyruvate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_03220"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69083"
FT                   /db_xref="GOA:B8D1K6"
FT                   /db_xref="InterPro:IPR001697"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="InterPro:IPR015793"
FT                   /db_xref="InterPro:IPR015795"
FT                   /db_xref="InterPro:IPR015806"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018209"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR036918"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1K6"
FT                   /protein_id="ACL69083.1"
FT                   /translation="MRKTKIVCTIGPVSESKEMLKKLAEAGMNVARLNFSHGDHEEHGN
FT                   RIDTIRKVEAELGKPIGIMLDTKGPEIRTGMLKDDKVELKKGEEIILTTEDIEGDENRV
FT                   SVSYKGLPDDLHEGATVLIDDGLIGLEVLEIKGTEIRCKIVNGGLLGSRKGVNLPGISV
FT                   NLPALTEKDESDIRFGVRKGIHFIAASFVRKAQDVIEIRKILEEEGKEDILIIAKIENQ
FT                   EGVDNIDEIIDVADGIMVARGDLGVEIPAEQVPVIQKSIIKKCNEKAKPVITATQMLDS
FT                   MIRNPRPTRAEASDVANAIFDGTDATMLSGESAAGDYPVEAVKTMARIAEETEKSLYYR
FT                   DVISNRRTYRPQTVTDAISFASCETATDLGAQAIITSTESGLTARMVSRYRPLVPIVAV
FT                   TPDERVQHALTVSWGVYPLTVKKSNSTDEMMDVSIKTAQENRLIKSGDLVVITAGAPVG
FT                   IPGTTNLIKVDVVGEPLVEGQGVGKGIVTGQVKIAHTAKEAVEKIEEGDILVTGITDKE
FT                   YLPAMKKAGAIIAEQGGLTSHPAIVGLELGIPVIVKAEKATENLVEGEIITIDGVRGLV
FT                   YPGTVHLK"
FT   gene            complement(332359..333132)
FT                   /locus_tag="Hore_03230"
FT   CDS_pept        complement(332359..333132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_03230"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="PFAM: DeoR-like helix-turn-helix domain; HTH domain;
FT                   Iron dependent repressor, N-terminal DNA binding domain;
FT                   Bacterial regulatory proteins, deoR family"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_03230"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69084"
FT                   /db_xref="GOA:B8D1K7"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1K7"
FT                   /protein_id="ACL69084.1"
FT                   /translation="MLSIARRNKILEILKEKHQITTQELEKELNVSGATVRNDLQELEK
FT                   EGLLKRIHGGAVLPKEQIFQNSYRNFHHRSKKNVQEKKAICRAASKFIDEGQTYLLDAS
FT                   STVLYLVPYLREKHRISIATNGLYTALEVKEICNINVIVLGGIAKPRSGSLEGLLGESI
FT                   LCKINADIMFTSAHGFTLKDGLTDFNVYEVELKNKMVSKSKKVIALLDHTKIGYTSTTS
FT                   FCSIDNLDVIVTDNKTPSNKIEEIRNAGIEVIVAE"
FT   gene            333934..335010
FT                   /locus_tag="Hore_03240"
FT   CDS_pept        333934..335010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_03240"
FT                   /product="Zn-dependent alcohol dehydrogenase"
FT                   /EC_number="1.1.1.-"
FT                   /note="PFAM: Zinc-binding dehydrogenase; Alcohol
FT                   dehydrogenase GroES-like domain; TIGRFAM:
FT                   2-desacetyl-2-hydroxyethyl bacteriochlorophyllide A
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_03240"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69085"
FT                   /db_xref="GOA:B8D1K8"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1K8"
FT                   /protein_id="ACL69085.1"
FT                   /translation="MVNLPEKMKALVAYAPGDYRFEEVDVPRAGEGEIVVKVEACGICA
FT                   GDIKAYHGAPSFWGGEGNPPYIKAPMIPGHEFIGEIVEKGAEVSDDFEIGDRVISEQIV
FT                   PCWECKFCRTGRYWMCQKHDVYGFQNNVNGGMAEYMKFPKEAINYKVPKDIPIEKAILI
FT                   EPYACSKHAVDRANISNEDVVVLSGAGTLGLGMVGAIKLRNPKSLVVLDLKDDRLELAK
FT                   KFGADITMNPKKENVVEKILEMTDGYGCDIYIEATGHPSSVQQGLEAIRKLGTFVEFSV
FT                   FGDLVTTDWSIISDRKELDVLGSHLGPYCYEPVIEWIANGKLPTEGVVTHKFPLEKWKE
FT                   AFEKAEKGQDSIKVVLVP"
FT   gene            335101..336105
FT                   /locus_tag="Hore_03250"
FT   CDS_pept        335101..336105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_03250"
FT                   /product="Glycerone kinase"
FT                   /EC_number="2.7.1.29"
FT                   /note="PFAM: Dak1 domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_03250"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69086"
FT                   /db_xref="GOA:B8D1K9"
FT                   /db_xref="InterPro:IPR004006"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1K9"
FT                   /protein_id="ACL69086.1"
FT                   /translation="MQKFVNDPSQVVDEMLEGFVKNHKDLVAKTDNPRVLKYVKAPIEN
FT                   KVGIVTGGGSGHKPAFIGYIGKNMVDAVAVGEIFSSPTAQAFYDAFKEADSGKGVACLF
FT                   GNYAGDKMNVKMAIEMAKEDGIDVKTVIANDDVPSAPKDEREKRRGVAGEILMWKVGGA
FT                   KAATGASLDEVISTCQKAIDNTRSIGVGLSPCTIPEVGKPNFTIEEGKMEVGIGHHGEP
FT                   GVKVSEIKPAKEVAKEMVNYVLPDLPFEKGNEVAVLVSGLGATPVLELYILYNEIEKLL
FT                   KKESIKIYKSYVGNYFTSLDMAGATLTVMKLDEELKELLDEEANCMGLKQFKG"
FT   gene            336111..336761
FT                   /locus_tag="Hore_03260"
FT   CDS_pept        336111..336761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_03260"
FT                   /product="Glycerone kinase"
FT                   /EC_number="2.7.1.29"
FT                   /note="PFAM: DAK2 domain; TIGRFAM: dihydroxyacetone kinase,
FT                   phosphoprotein-dependent, L subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_03260"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69087"
FT                   /db_xref="GOA:B8D1L0"
FT                   /db_xref="InterPro:IPR004007"
FT                   /db_xref="InterPro:IPR012737"
FT                   /db_xref="InterPro:IPR036117"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1L0"
FT                   /protein_id="ACL69087.1"
FT                   /translation="MEYFLNSSGGRIVYSIIEAIQDNKEYLSEIDGAIGDGDHGINMNK
FT                   GVTMTKEKLDEQDEVDLATALKTLGFTVVSKIGGSMGPLYGNFFLEMSKAINGREKIDK
FT                   KVFSDMLNAALEGVKALGDAKVGDKTMMDTLIPAVKTYDKAIEGGKGFKEALEEMQVAA
FT                   EKGKESTKDLVAKVGRAARLGERSRGVLDAGATSCNLILQAMANTIRDLLISE"
FT   gene            336778..337254
FT                   /locus_tag="Hore_03270"
FT   CDS_pept        336778..337254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_03270"
FT                   /product="ribose-5-phosphate isomerase"
FT                   /EC_number="5.3.1.6"
FT                   /note="PFAM: Ribose/Galactose Isomerase; TIGRFAM:
FT                   sugar-phosphate isomerases, RpiB/LacA/LacB family; ribose
FT                   5-phosphate isomerase B"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_03270"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69088"
FT                   /db_xref="GOA:B8D1L1"
FT                   /db_xref="InterPro:IPR003500"
FT                   /db_xref="InterPro:IPR004785"
FT                   /db_xref="InterPro:IPR036569"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1L1"
FT                   /protein_id="ACL69088.1"
FT                   /translation="MKVIKNKQYVIGSDNAGYPLKEIIKELLESEGLEYEDVGVDSDQD
FT                   KTIYPEIAERVVNRIKKSNYEKEGILICGTGIGMAITANKFSRIYAAVCHDVYSAERAR
FT                   LSNDTNVITMGARVIGPVLAKKIIREWLSLEFKPGRSTPKLKQIKKYENQNFVS"
FT   gene            337360..338010
FT                   /locus_tag="Hore_03280"
FT   CDS_pept        337360..338010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_03280"
FT                   /product="putative transaldolase"
FT                   /EC_number="2.2.1.2"
FT                   /note="PFAM: Transaldolase; TIGRFAM: transaldolase,
FT                   putative, TalC family"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_03280"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69089"
FT                   /db_xref="GOA:B8D1L2"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR004731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018225"
FT                   /db_xref="InterPro:IPR022999"
FT                   /db_xref="InterPro:IPR033919"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1L2"
FT                   /protein_id="ACL69089.1"
FT                   /translation="MKFFIDTANLEDIKRAASLGVIDGVTTNPTLVSKEGNVDFHTRIK
FT                   EICNVVEGPVSAEVISLNTDGMVKEARELSKLAPNVVIKIPMTMDGLKAVKILSKEGIK
FT                   TNVTLVFSANQALLAAKAGGTYVSPFMGRLDDRAHEGIKLVEEIATIFEKFNINTEIIA
FT                   ASIRSPLHVKQAALAGAHIATIPFNVIEKMSKHPLTNIGIERFLNDWKKVQQG"
FT   gene            338023..340008
FT                   /locus_tag="Hore_03290"
FT   CDS_pept        338023..340008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_03290"
FT                   /product="transketolase"
FT                   /EC_number="2.2.1.1"
FT                   /note="PFAM: Transketolase, thiamine diphosphate binding
FT                   domain; Transketolase, C-terminal domain; Transketolase,
FT                   pyrimidine binding domain; TIGRFAM: transketolase,
FT                   bacterial and yeast"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_03290"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69090"
FT                   /db_xref="GOA:B8D1L3"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005478"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033247"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1L3"
FT                   /protein_id="ACL69090.1"
FT                   /translation="MLTQIADTVRGLSADAVEKANSGHPGLPIGCADIGALLYGKVMKY
FT                   DPTQPEWPDRDRFILSAGHGSMLVYSLLHLAGFEVSLDDLKSFRQLGSKTPGHPEYGET
FT                   PGVETTTGPLGQGFANAVGMAIAERMLAQRFNTEGHTIVDHYTYTLLGDGCMMEGISSE
FT                   AASLAGHLGLGKLIAIYDDNEISIGGSTDITFTESVADRFKAYNWHVIEGVDGHDLKAL
FT                   EEAVKEAKEANDKPSLIIAKTKIAFGAPTKEGSSSAHGAPLGEEEIRGLKKNIGFPEDK
FT                   EFYIPDEVKEFFKDHTEKLKKEREEWEKAFTEWAEENPDLKEEWDKAHNLELPGDLEET
FT                   INNLEIKTPVATRKASGETLRKIADEIPYLVGGSADLAPSNKTYLDKYGEIQKDSFDGR
FT                   NFRFGVREHAMGAIVNGLSLHKGVRPFCATFLVFSDYMRPAIRMAALMKQPVIYVFTHD
FT                   SVYVGEDGPTHQPIEHVEALRVIPNLKVLRPADAEETKAAWLEAVKRTDGPTALVLTRQ
FT                   GLPHIEKEEGIVGFKRGGYIVHKEKGDRTDAVLMASGSEVSLAVEVAKLLEEKGKEVRV
FT                   VSVPERREFVNQGTEYIEEVLGKDTFRVVLEAGVGNGWYRLLGHKCHVVSLEDFGMSGP
FT                   GEEVARELGFDAEKIASDILGNYERL"
FT   gene            340166..341092
FT                   /locus_tag="Hore_03300"
FT   CDS_pept        340166..341092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_03300"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: Binding-protein-dependent transport system
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_03300"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69091"
FT                   /db_xref="GOA:B8D1L4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1L4"
FT                   /protein_id="ACL69091.1"
FT                   /translation="MKPGIENGLDLVTDSKPSLFEKFKPYLIILPAFILTIGILVPFAT
FT                   GVYWSLTNYNLMYPNYSFIGITNYIDLFTSSDFWHALKVSGLYVLFAVGVEVLLGLAIA
FT                   LLLNRDTILAKILRPMLIFPLLIAPVVGTLMWKLMMSPEYGVLNYFLSLINPALRDFPW
FT                   AASSKFALLSVVIVDVWIFTPFIALLLLAGLRSLPAPPFEAAKVDGASNWFIFKNLTMP
FT                   MLTPYLVVAVIFRLVDSIRMFDIPFAMTKGGPGDALMNLQITAFTESFTYLNLAVGCAY
FT                   MFVTWIIIYFISKKMINYWLKWRARLS"
FT   gene            341117..341983
FT                   /locus_tag="Hore_03310"
FT   CDS_pept        341117..341983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_03310"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: Binding-protein-dependent transport system
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_03310"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69092"
FT                   /db_xref="GOA:B8D1L5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1L5"
FT                   /protein_id="ACL69092.1"
FT                   /translation="MKKNRENLWKNTGANLALIIIFIFVLFPIFWVFTLAFKSRPDILT
FT                   WPPKFIFTPTFENFKNILISGTSGSSAGSTTVNFILYFKNSLIISVGSIIVSLLVGIPA
FT                   SYAIARWNFKGKEDIAFTFLTFRFAPPLMVIIPIYVIFRKLGLLNTYIGMIWVYQLITL
FT                   PMIIWILRGYFEDISNELEEACLVDGYHQWQAFFKIILPLVKPGIAASSLLAFIYAWNN
FT                   FIFAMILGGSDVQPITVASLQFMTAEAIRYGDMAAACVIAAIPALILAIYSQKHLIRGL
FT                   SLGAVKE"
FT   gene            342007..343113
FT                   /locus_tag="Hore_03320"
FT   CDS_pept        342007..343113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_03320"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter; TOBE domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_03320"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69093"
FT                   /db_xref="GOA:B8D1L6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1L6"
FT                   /protein_id="ACL69093.1"
FT                   /translation="MGSVIFENVTKMYGEKVGIKDVSLEIYEDEFLVIVGPSGAGKTTT
FT                   LKVIAGLLDITEGNLYIDGRNVNKIPPRDRNVAMTFESYALYPHYTVFENMANPLRAPH
FT                   MNFTEKEIEEKVERIAGMLEIDHLLERFPKELSGGQKQRVSLGRAMVREPSVFLLDEPL
FT                   SHVDAKVRHRMRLELNRLQKELNATTVYVTHDYVEGLSLADRIVILNEGEIIQVGTPHE
FT                   IYNDPLNEFVATHVGQPEMNIFDALVSLENGKIILTNQESNKIKFVLEGDTAELVKNHG
FT                   KNKVRVGIRPQDIKITSQEKGDFNGKVYVYEPFVTYGILTVNVRGIQLQILTEHDSQFN
FT                   IGDNIALKVNPDDLYLFDKESGMNLEHL"
FT   gene            343130..344266
FT                   /locus_tag="Hore_03330"
FT   CDS_pept        343130..344266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_03330"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: TOBE domain; ABC transporter; TOBE domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_03330"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69094"
FT                   /db_xref="GOA:B8D1L7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1L7"
FT                   /protein_id="ACL69094.1"
FT                   /translation="MAEVTLKDVRKVYKSQNEEVLAVKDLSLEIRDGEFMCFLGPSGCG
FT                   KTSTLRMIVGLEEITNGEIYIGDRIVNDLTPQERNVAMSFETYALYTHLTVKENLLFPL
FT                   KARGLNKSDQQRRLRKVVDMLEIKDILDRSPSSLSGGQQQRVSLGRALIRQPDVFLLDE
FT                   PLSHLDVSLRISTRSRIKRLHNQLSTTMIYVTHDQLEAISLADRIAVMNFAELQQVGTR
FT                   EELLDRPKNIFVADFIGEPPINFVNCKLDKNDDKFVLRFKNSHYTIELPEKLEKVIKKE
FT                   YIEDVILGIRPHDILFREKKGYVGLENGTVEIFEFLGEENHVTVNIGGESITVVTDAKD
FT                   YFKEGEKVDLYLSQDKIHLFDPETEECLTTRYKNQGLI"
FT   gene            344409..345728
FT                   /locus_tag="Hore_03340"
FT   CDS_pept        344409..345728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_03340"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: Bacterial extracellular solute-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_03340"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69095"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1L8"
FT                   /protein_id="ACL69095.1"
FT                   /translation="MVKKTFLLMLVALFLVSLTAVVGAAEFDWKRFEGETIKLLLNKHP
FT                   YTDGVLKELDKFEKMTGINVEYDILPEEQYFNKVTVTLSSGSSEYDIFMTGAYQVWQYA
FT                   PPGWMEPLDKYIEDNSLTSPDWDKNDFIPGIINSLKWNLQPGSELGTGKQWALPLGWEE
FT                   NCLVYRKDIFEKYNLKVPETLDEVIEVGKIIEEKTDLTGIVVRGTRSWATIHPGFYSGL
FT                   VASGGFDYDGNLKPQMNSEVALEFTKKWVEMIKEVGPEQWTTYTWYDVSNALGSGKAAM
FT                   MYDADTLGFWADHADERLAWAPGPGLNKKADKTNVWIWSLAMSAHSNSKEPAWYFLQWV
FT                   TGKEFLTTAAVKHDGLNPVRKSIWENPDFKERLAKFDGYYKTYKKIDEAAVQFTPQPMF
FT                   FQTTTEWAAALQKIVNGEDAEEVLNKLVEDLDKKMESIRR"
FT   gene            346043..348031
FT                   /locus_tag="Hore_03350"
FT   CDS_pept        346043..348031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_03350"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: Methyl-accepting chemotaxis protein (MCP)
FT                   signaling domain; HAMP domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_03350"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69096"
FT                   /db_xref="GOA:B8D1L9"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1L9"
FT                   /protein_id="ACL69096.1"
FT                   /translation="MINFNLRIKSRLMLIMVLLVVMAVASIGIYSYTTIKKSLKLAAHQ
FT                   DLIETIDVNRERLSKWLKELDRGIYKLTEDTMLTSMTSSTLSRVRINYHLNYLKEFDHL
FT                   LVLDNEGKVFVSSNEGDKNKKLNIKEHKIYTSIKNIKDSFKGVAVSPFTGNNSYIIAYP
FT                   IIKNDKINGLVVGLIEYEHFYNKLSDFQTSEEYEYVILNDENRVIFKKNEKVLLKPYFE
FT                   EDTRNYRVNKPFTYNYNGNTYFGLMAKLNDSNWKLVIAKNHVKVFGPPTDLRNKIIIFG
FT                   GAIIIIAITISFILGNSIGKRIKTLYKNTDRISNGDLTSTVSLNSKDELGDLADKLNQM
FT                   VFDLREIVSDIDKGSRDVTKASRDLNTGLERVTDSAEQVSKAIEQVASGADDQAANYEK
FT                   IVEIVNDMVDEINIMVKNNNITLDNVEKSLASVKEGNKWMTQLKSQMDIINEKVQAMTS
FT                   IIDKMDKTSSRIGEIVEIINNIAQQTNLLALNAAIESARAGEAGRGFSVVADEIRSLAE
FT                   ESISSAEKITNLVKETQNNTEEARRSMLAEKEAVNRGEELVEQTGEIFSTIKNVIERTH
FT                   QNARKSNEISKTLAEGAQNVEEKIESLASISQEISASSQEVAASAEEEVKLIQDMNRAA
FT                   DGLQELARKMQSMINKFELGQENQEKE"
FT   gene            348107..348406
FT                   /locus_tag="Hore_03360"
FT   CDS_pept        348107..348406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_03360"
FT                   /product="conserved hypothetical protein TIGR00106"
FT                   /note="PFAM: Domain of unknown function DUF77; TIGRFAM:
FT                   conserved hypothetical protein TIGR00106"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_03360"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69097"
FT                   /db_xref="InterPro:IPR002767"
FT                   /db_xref="InterPro:IPR029756"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1M0"
FT                   /protein_id="ACL69097.1"
FT                   /translation="MPIAEVTIVPLGTGETSLSKYVAGCHKVLADEEGIKYRLTPMGTI
FT                   IEGELDRIFSVVKKLHEVPFDKGASRVLLNLRVDDRRDREASMEQKLKSVKDKL"
FT   gene            complement(348634..348722)
FT                   /locus_tag="Hore_R0023"
FT   tRNA            complement(348634..348722)
FT                   /locus_tag="Hore_R0023"
FT                   /product="tRNA-Leu"
FT   gene            complement(348926..350116)
FT                   /locus_tag="Hore_03370"
FT   CDS_pept        complement(348926..350116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_03370"
FT                   /product="S-layer domain protein"
FT                   /note="PFAM: S-layer homology domain; S-layer homology
FT                   domain; S-layer homology domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_03370"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69098"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1M1"
FT                   /protein_id="ACL69098.1"
FT                   /translation="MRFKLTALLLLILVIPLAVTAIDEPNDITNHWAQDYILNVINRGT
FT                   MKIYPDGTFRPEQPVTRGEFAKALSRELGLLPDSITSFKDLEGYPGYTLITPLVKEKIF
FT                   KGYPDGTFRPEKPLSRAEAVVILLKSLGIMNEEQKINLSDQPSFKDVPENHWAANFLKI
FT                   GKKIGLIERDVSENFYPDEYITRAEAAKYLTIESQLKNNTAYISDIYPASRKVSVNLLN
FT                   GQRKVLDFDDKTLVGRNNRLVDMNEILKTDKVFLIYDHENKIKYMKAYGIITKNDLATE
FT                   VSNMTDGLLSPEDIKSLATGDIDVAVPKLKETLKQQMVKQGLTDEEINAIMETEWNQLE
FT                   NLSKQRVAEILAIETGLPLDITKGIISGDWNKIKTYAQIEIVQRMVREVLTSDLIS"
FT   gene            350361..350436
FT                   /locus_tag="Hore_R0024"
FT   tRNA            350361..350436
FT                   /locus_tag="Hore_R0024"
FT                   /product="tRNA-Gly"
FT   gene            350729..353161
FT                   /locus_tag="Hore_03380"
FT   CDS_pept        350729..353161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_03380"
FT                   /product="peptidase S16 lon domain protein"
FT                   /note="PFAM: Lon protease (S16) C-terminal proteolytic
FT                   domain; TIGRFAM: lon-related putative ATP-dependent
FT                   protease"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_03380"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69099"
FT                   /db_xref="GOA:B8D1M2"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041699"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1M2"
FT                   /protein_id="ACL69099.1"
FT                   /translation="MRDIKNLKPEELKNEIDPDLFSFKTTEEITPFTSGIIGQSRAVKA
FT                   MDFGLRVKQEGYNIYMAGITGTGKTTYARTLTRRESKKHPVPPDLCYVFNFEEPEKPRA
FT                   LKLPAGTGIHLKKDMDNIIEELKVEIPKIFESEEYEEQKNRIMNRYQQLSNQIMEEFEI
FT                   EVRDKGFILQQTVQGPLTVPIDEDGNPITQEDYQSLPEDKRKEIREKNQEIQNKMDAIM
FT                   KKIRGLKTEAQEELENLEKSMVLSVVKPIINHLKEEYRFCQDILDYLDDVKNDIAKNLG
FT                   MFKGDNKNKEAKKASLPFTMETGDDDFFVRYKVNLLVNNRDTEGAPVIVETNPTYYNLF
FT                   GKIEGRSQFGTVTTDFTMIKGGAIHKANGGYLILKAKDILRNPYAWETLKRTLINQRIV
FT                   VENIGEQYRTVPVLTLKPEPFDIKLKVIMIGNPMIYQLLYNHDEEFQKLFKIRAHFDVE
FT                   MEKNNENIEKFASFIASVSNREGIKHFTAGAVAEVISYSSRLAGKKDKLSTRFNQIIEI
FT                   LYEASTWAELDNSSYVEASHVIKAVEEKERRANLVEEKMQEMIEKEQILLDVTGEKVGQ
FT                   INGLSVIQTGGYSFGRPSRITARTFMGRKGVINIEREAKMSGKIHNKGVLILSGFLGGK
FT                   YARERPLTLSASLAFEQSYSGVDGDSATCAELIALLSALTGLPVKQNLAITGSLNQKGM
FT                   VQPVGGINQKIEGFYKVCEAKGLTGKQGVIIPEQNTDNLMLKEDVIATVKRGEFHIYSI
FT                   KEIDEAIELMFGLSAEEVHTKVEESLDKINEKAREFNREFKEGRKKEELAKIIIKYY"
FT   gene            353308..353907
FT                   /locus_tag="Hore_03390"
FT   CDS_pept        353308..353907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_03390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_03390"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69100"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1M3"
FT                   /protein_id="ACL69100.1"
FT                   /translation="MTSFLKALTRLSLSNVVIILVVLILMVQSVSAQKFYEINGWEFRD
FT                   TKEFIQWWLRTESDYISEILLFDSVKLGGEVMNGFYLSRPTGEVKLLRVVYTGFDKSGN
FT                   IYLKMYKKKDNLSPVDETELESMVKDLINSKQAMEDPIFSRQQFFKSITDYFEDEGLEL
FT                   TIDPSKTIIIDILETIPFLKLEADSKTSILNTRVTK"
FT   gene            353925..354746
FT                   /locus_tag="Hore_03400"
FT   CDS_pept        353925..354746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_03400"
FT                   /product="Ku family containing protein"
FT                   /note="PFAM: Ku70/Ku80 beta-barrel domain; TIGRFAM: Ku
FT                   protein, prokaryotic"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_03400"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69101"
FT                   /db_xref="GOA:B8D1M4"
FT                   /db_xref="InterPro:IPR006164"
FT                   /db_xref="InterPro:IPR009187"
FT                   /db_xref="InterPro:IPR016194"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1M4"
FT                   /protein_id="ACL69101.1"
FT                   /translation="MRTIWKGAISFGLVNIPIKLVTATTKKNIRFRFLHKECKTPVSTK
FT                   RFCPTCKKEVEYGDLVKGYEYEDNKFVVLKDEDFDNIPVKSTKTIDIVDFVKLEDIDPV
FT                   YYIKTYYLNPAEGGEKPYLLLKKAMDDTGKVAISKITIRKKESLAVIRVMDDVLALETM
FT                   FFADEVRPASELGLNNIEEKIKIGKKEEELAVEIVNNLTTEFKPEKYTNEYREELMNII
FT                   RQKIEGKEVETPDVVPEERKIVDLMEKLKKSVEATEEGEGKKKKKTKKKTG"
FT   gene            complement(354672..355613)
FT                   /locus_tag="Hore_03410"
FT   CDS_pept        complement(354672..355613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_03410"
FT                   /product="DNA polymerase LigD polymerase domain protein"
FT                   /note="PFAM: Eukaryotic and archaeal DNA primase small
FT                   subunit; TIGRFAM: DNA polymerase LigD, polymerase domain;
FT                   DNA ligase D"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_03410"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69102"
FT                   /db_xref="GOA:B8D1M5"
FT                   /db_xref="InterPro:IPR002755"
FT                   /db_xref="InterPro:IPR014145"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1M5"
FT                   /protein_id="ACL69102.1"
FT                   /translation="MKLTIGKHDVQLTNLDKVLWPELGYTKGDLINYYINMYPYLKEYL
FT                   LNRPLSMKSYPDGINGKSFYQKDCPDYAPHWLSTYGIFSGHRKDIINWVTINKLSDLVW
FT                   VANRASIELHTWFSTTTNLDKPDFAVFDLDPGSKSSMKDVVDIALTIKNILDEFNVRSF
FT                   VKTSGKRGLHVYIPVKTRYTYKEIRSFLQNVAEMVIKLKPEQATVEWRKNKRQGKVYID
FT                   YRQNGKSKTLPAPYSLRPTSKATVSTPLKWSEITPDLNPDNYNIKNIETRIKQKGNIWE
FT                   TLLKIRQELPGLFLGLLLFLSFSLFGGLNTFL"
FT   gene            complement(355638..356495)
FT                   /locus_tag="Hore_03420"
FT   CDS_pept        complement(355638..356495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_03420"
FT                   /product="ATP dependent DNA ligase"
FT                   /note="PFAM: ATP dependent DNA ligase domain; TIGRFAM: DNA
FT                   polymerase LigD, ligase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_03420"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69103"
FT                   /db_xref="GOA:B8D1M6"
FT                   /db_xref="InterPro:IPR012309"
FT                   /db_xref="InterPro:IPR012310"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014146"
FT                   /db_xref="InterPro:IPR016059"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1M6"
FT                   /protein_id="ACL69103.1"
FT                   /translation="MLLFEIEKPFNSPDYIFELKWDGYRALAFINDNNLLLQSRNQKNL
FT                   TPYFSELKSITSLFKGTNAVLDGEICYLNRDGKPVFEKLQGRIWQKKSNIKYPVTYITW
FT                   DILGLNNNDLTRTPLLERKKILQNYIQESNRLKRSKYIKEKGKELYEMAEEEGLEGIVA
FT                   KKVNSPYEFKRSKYWYKIKIWQYTTAVIVGFTRDKEALLVGKYLKDNNKISFMGRVKIA
FT                   LNEAEKKALFRFLPTLKVKKPPFKVRHKQGISWVKPAIQCKVKYTEITSNNTFRHGFVV
FT                   KLKI"
FT   gene            complement(357182..357643)
FT                   /locus_tag="Hore_03430"
FT   CDS_pept        complement(357182..357643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_03430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_03430"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69104"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1M7"
FT                   /protein_id="ACL69104.1"
FT                   /translation="MNILKDKSRNHKGGMCMNQLNQIENNLRQLRQNINSMINQINHQI
FT                   SSSEQLIRNLRNQPGQTSGQNQYQPQQNYGEQYQGQYTTQPQQYGFNSTQNQSGTSYEA
FT                   GQPDRQGSTNPISGLSENSPTMQQRTGVNQYGAQYTSGKDKNEEKSNRS"
FT   gene            357767..358573
FT                   /locus_tag="Hore_03440"
FT   CDS_pept        357767..358573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_03440"
FT                   /product="periplasmic serine protease (ClpP class)"
FT                   /note="PFAM: Protein of unknown function DUF114"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_03440"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69105"
FT                   /db_xref="GOA:B8D1M8"
FT                   /db_xref="InterPro:IPR002825"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1M8"
FT                   /protein_id="ACL69105.1"
FT                   /translation="MDFFAIIWLIFIIMTFIPVIKQKRIEKVRVRLIRKIEDKTNSKLI
FT                   ALIHRQEALSFLGIPFRRFINIEDSEDILRAIRMTSDDKKIVIVIHTPGGLVLAAEQIA
FT                   HAIKKHPSKVTVIVPHYAMSGGTLLALAADEIVMDENAVLGPVDPQIGNYPAPSIVKVV
FT                   EEKSVDEIDDKTLILGDVAQKAIVQIKDLVKKLLEGKMDEEKVNRVADVLTEGYWTHDY
FT                   PITVEKLKGLGINVRTDLFKEIYQLMELYPQAGHRRPSVQYINSIQ"
FT   gene            358867..358942
FT                   /locus_tag="Hore_R0025"
FT   tRNA            358867..358942
FT                   /locus_tag="Hore_R0025"
FT                   /product="tRNA-Thr"
FT   gene            complement(359557..360426)
FT                   /locus_tag="Hore_03450"
FT   CDS_pept        complement(359557..360426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_03450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_03450"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69106"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1M9"
FT                   /protein_id="ACL69106.1"
FT                   /translation="MTNTPVNINDLNIKKLGNSLEISVFPVKFKNYKVKKIKNKEYIIG
FT                   KGMQLKDEDLINAFEGKNPMNNFKLLLSLINLVKKSLPDKNKNEWDPDKIKKAIPLKNI
FT                   KEWINKYGLPYIGKIDFAKTNHTRKKINNMLTFGVNINDFRSKIAGLYSFYKLWFAIKT
FT                   KDKKIINKFKANYSIPGKNIEETLTYYIDNSFDNNFKIKPAFDKDDKTFKLQIYTHNNQ
FT                   LNAALFQLYNLMTLDDISTDENGNSQFQHLKECNYCKNIFWAKDSKGKYCSPRCRKNAW
FT                   YHKNKNTK"
FT   gene            360763..361119
FT                   /locus_tag="Hore_03460"
FT   CDS_pept        360763..361119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_03460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_03460"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69107"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1N0"
FT                   /protein_id="ACL69107.1"
FT                   /translation="MKKEKARQWQNEPLLLDAKDLQRILRINKNHIYRLFKQASFPSIQ
FT                   IGKRYVIEKNNFREWLNQQSRKNEFISSYKTLTPDEQKLYEKAFWEAVKFLKDREAEQH
FT                   DRREKVAKLFSETG"
FT   gene            361073..363520
FT                   /locus_tag="Hore_03470"
FT   CDS_pept        361073..363520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_03470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_03470"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69108"
FT                   /db_xref="GOA:B8D1N1"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR025048"
FT                   /db_xref="InterPro:IPR034154"
FT                   /db_xref="InterPro:IPR036977"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1N1"
FT                   /protein_id="ACL69108.1"
FT                   /translation="MTEEKKLQNFLAKLDKVKKKGPDQWQARCPAHEDKVESLSVSRGD
FT                   NKINFHCHAGCSGKDILRAMGLNWSDIYFDDEPGKKKKSKVVKEYIYRDENGRPLHKTL
FT                   RTANKDFLQKRYENGKWKWGLKGVRTVLYKLEEVKEAINNNDVVYLVEGEKDADNLHKI
FT                   GLTGTCNPLGAGKWKPGYTETLKGARVVILPDNDKPGKKHARNIAKELHGKAKLVKILE
FT                   LPGLDKKEDVSDWLDKGGTKEKLLQLVKDCPEWKPGINNWPDPLPFNNFDVKPIPVNIL
FT                   PNWLSDFAINLAEFTQTPIDMSIMLIISALGTALANKGVVQIRKGYTEPLNIWTCTVLP
FT                   AGNRKSPVFKKIMKPILDYEERKREEIEPERRHALKEKSILEDQLKQKEKIAGNAKDQA
FT                   KRKQIMQEIFNLDDEIQEMEIPTLPRLVASDVTTEKLAKLMEDNNGRIAILSPEGDIFK
FT                   LMAGRYSKNGAANFDNYKKAWTGGEPIRDDRMARKGTYVKNPALTQGLTVQPVILEDLK
FT                   EKKAFKGEGILGRFLYAIPESPVGSRKVGNEVPELSDIAVMRYQKGLSALLHTRPAGEN
FT                   KNGEWEPHIIKLSPEALEVRYEFERDIEKELGPEGKLHNIADWGSKLVGNITRVAGLLH
FT                   IAGQTDAQKGQATRDIWNKPIGPETMKKAVKLGYSLIEHALKVYDLLDTDPEIELARYV
FT                   LKRIMRGKEMEKAEELPKDKDTLDKSILMELCKGKKEIKRPDDLKEPLKLLAELNYITI
FT                   VERETEGRGRNPSPLIKLNPKVHSINSIKKDTEYNKSNKSNKSNITPEIKKDENGVIIE
FT                   GMI"
FT   gene            363522..364040
FT                   /locus_tag="Hore_03480"
FT   CDS_pept        363522..364040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_03480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_03480"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69109"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1N2"
FT                   /protein_id="ACL69109.1"
FT                   /translation="MTGYEIINESEKIGYKLELRPGPKIGLSLKPGYNPDPQEAERLIN
FT                   KLKANKENVIEYLQLDDKAAFNKYIEELREQNRYDPRPDLSEDSELWQTVLKEAEKQDK
FT                   QVYSNLHGCRCGGARLKTEKGQLKLIPAIGPDQFWKNKEEWDQDRKEFLLPYASDIKEI
FT                   FIKVQRKCC"
FT   gene            364178..364714
FT                   /locus_tag="Hore_03490"
FT   CDS_pept        364178..364714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_03490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_03490"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69110"
FT                   /db_xref="GOA:B8D1N3"
FT                   /db_xref="InterPro:IPR006166"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1N3"
FT                   /protein_id="ACL69110.1"
FT                   /translation="MQALPYRYTKTELKELLKSLTVIIDTREQKNQHITDYLDDKGIPY
FT                   KTKKLNFGDYSFYLPEQPELGIQRPMYFNNEIVIERKRSLNELSNNFTHDRAQFENELI
FT                   RASNSKFILLVENVKGYQNIIKHNYRTDYKPKSYIATLHAYRARYNLEIIFIDPAYSGN
FT                   FIYYTFYYWLREYLK"
FT   gene            364810..365514
FT                   /locus_tag="Hore_03500"
FT   CDS_pept        364810..365514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_03500"
FT                   /product="peptidase S14 ClpP"
FT                   /note="PFAM: Clp protease"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_03500"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69111"
FT                   /db_xref="GOA:B8D1N4"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1N4"
FT                   /protein_id="ACL69111.1"
FT                   /translation="MSKNTLFKVFNESDNNAAEIYLHGPIRNPLPDEDEEDVITLKEVR
FT                   NKLNKITADKIIVHLNSTGGDLFQSVAIHNLFKDHKAEIIMINDGIAASGGSIILMAGD
FT                   KIKFYPNSIMMIHAAHTITYGDAKYHREVARKLDKIDKSLKENYSQRFTGAEKELEKLI
FT                   QEETWLTAKEAKEKGFCDEIISDNTEESRAENKSNNLFMNMKTNSNIKGKLMKKYGSRN
FT                   NKSLLNKLGGNK"
FT   gene            365579..366241
FT                   /locus_tag="Hore_03510"
FT   CDS_pept        365579..366241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_03510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_03510"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69112"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1N5"
FT                   /protein_id="ACL69112.1"
FT                   /translation="MTELKLLENRKEKLQSEVDGWKEYEDKVKVLLPFEEIQKLEKEIE
FT                   LLKLKERIVNKEIEKERAIRGQSKELDSIFIRLQKEIEVKKEKIRDTREIGKSIRITYH
FT                   NKSIEEDPRKDIKKELARQSKYQKIVELLGQHIELIQKLNVNVSNIINNVTDYNKGYVI
FT                   DRLVSPSRDKKERLRELKKSYEQKIARGRGLKNELQRVEKELEETRAELIARKELAV"
FT   gene            366424..366741
FT                   /locus_tag="Hore_03520"
FT   CDS_pept        366424..366741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_03520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_03520"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69113"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1N6"
FT                   /protein_id="ACL69113.1"
FT                   /translation="MTANKREQIKRDLLDQLDEETAQKRHFRDLVDDYLQLWDIKNMLI
FT                   KDIKERGVVVEYNHGGGQSGFKKNDSINELKKVHYQMIKILKTLSIESSPKEKEVEIPE
FT                   M"
FT   gene            366755..366976
FT                   /locus_tag="Hore_03530"
FT   CDS_pept        366755..366976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_03530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_03530"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69114"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1N7"
FT                   /protein_id="ACL69114.1"
FT                   /translation="MKRRITKETIKPEEVGKFKNALYEVKTITPLVENPIKRTYILTQA
FT                   ELTQMLKEYETYGEFLISIKVIGGNGIA"
FT   gene            366963..367250
FT                   /locus_tag="Hore_03540"
FT   CDS_pept        366963..367250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_03540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_03540"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69115"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1N8"
FT                   /protein_id="ACL69115.1"
FT                   /translation="MVLPETAENLPYWKSEEPEVLINKALQIKYYGEAGALQLTMRGKD
FT                   NQGNSYNKKGVNLRKHILQKHPELLRTLAEIFTDWYDELPEDKKAKALEG"
FT   gene            367309..367656
FT                   /locus_tag="Hore_03550"
FT   CDS_pept        367309..367656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_03550"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_03550"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69116"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1N9"
FT                   /protein_id="ACL69116.1"
FT                   /translation="MVDDFFNYVKDELHYYYRPTELAAIKKRIHILIDEVYFNDPDNDI
FT                   IFDFTKSKDELYQLNREKAEELARLFDRSPARLILKGKDREIIRENLKRECLLDGIVII
FT                   QSLKEIIRGED"
FT   gene            367659..368384
FT                   /locus_tag="Hore_03560"
FT   CDS_pept        367659..368384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_03560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_03560"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69117"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1P0"
FT                   /protein_id="ACL69117.1"
FT                   /translation="MIDKNIKDITLQDIVNLNIYDDVNFDEYINVIRKEKPGAKDELLK
FT                   LLDRGNQVIKKSFIEEELQKLKKEHNQINPDFNLVTTDYFKGQIESLMVLASRTVEPGP
FT                   EEVQSKKNGWYFRGYITLGELKELPSIYPYFKKAYSEYNRDEWELELNVVGGIIQGYPA
FT                   VDEETINSWRDEGVLMELWGFDKGNKMTSLTDIMVNSLLKLKKQAQKIREKGKPDNLHE
FT                   ARILKLDNEGKKLFSHIFY"
FT   gene            368407..368844
FT                   /locus_tag="Hore_03570"
FT   CDS_pept        368407..368844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_03570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_03570"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69118"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1P1"
FT                   /protein_id="ACL69118.1"
FT                   /translation="MKTDVTTELLKLYFTGELSNIIKRLKAKNKRQLSDDIYCTLYGID
FT                   YSIIKPGKVNTHSDPTGNRAAKIADLYYERLVEIERYQEIMKEVEDFLKELNRSDRIII
FT                   QSLVLDQPLTNVAKETGIYYEKARRRAHQLINIARNKLTPP"
FT   gene            complement(369215..369424)
FT                   /locus_tag="Hore_03580"
FT   CDS_pept        complement(369215..369424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_03580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_03580"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69119"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1P2"
FT                   /protein_id="ACL69119.1"
FT                   /translation="MTIKDEIKAKIISKGWTIKDVAAELEKRYNSSYSPENLSNKLRRG
FT                   TIKYQEVKDIADIIGYKIEWIKKQ"
FT   gene            369620..369799
FT                   /locus_tag="Hore_03590"
FT   CDS_pept        369620..369799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_03590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_03590"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69120"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1P3"
FT                   /protein_id="ACL69120.1"
FT                   /translation="MIIKVKQEEVKSVDPDYKGQQFYHEGEKIKLLDGREGIFKGVERR
FT                   NYPDDDLIIVKLED"
FT   gene            369832..370002
FT                   /locus_tag="Hore_03600"
FT   CDS_pept        369832..370002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_03600"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_03600"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69121"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1P4"
FT                   /protein_id="ACL69121.1"
FT                   /translation="MDVKESTKKQIEQYLFDIAKTAIMMERTDKPEIRAFQRESIEFRV
FT                   DKIMERLKLLT"
FT   gene            370062..370382
FT                   /locus_tag="Hore_03610"
FT   CDS_pept        370062..370382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_03610"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_03610"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69122"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1P5"
FT                   /protein_id="ACL69122.1"
FT                   /translation="MLNSTKQHIVDVLVNDEEYQRVTSQIEEVLPHKLAADGVDDENMN
FT                   LLIKLENLIMEVAYLKGYADGLEESTIKKVKEEPGKYLSINEVYNLTDEMGITGQIEKP
FT                   AR"
FT   gene            370625..371800
FT                   /locus_tag="Hore_03620"
FT   CDS_pept        370625..371800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_03620"
FT                   /product="phage integrase family protein"
FT                   /note="PFAM: Phage integrase family"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_03620"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69123"
FT                   /db_xref="GOA:B8D1P6"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1P6"
FT                   /protein_id="ACL69123.1"
FT                   /translation="MARGAGEGTIVKRKDGLWQGAVTIGTDPQTGKQKRKYFYGKTKKE
FT                   VAKKMTELKMKLFNGTYSEPSEMKLIDWLHRWIEGRKSTLAYSTYRNYKVMINNHLADD
FT                   IGETKLKDLKARQVQELLNDKLEKGKVYGEGGLSPRTVKYIYSTLHTALEQAVKENMIP
FT                   RNICKAVEVPKKQEEKKLHTWNKKQVNIFLKAARDYKYFILHYLALNTGMRRGELLGLQ
FT                   WKDIDMEKKRIEVKRQLARTDEGLIFKKVKTKSGNRTIPITDNVVRELKRHQIKQGEKR
FT                   LALGEAYNKKADLVASNGIGNPIDPRNLVRDFKDIIEETGLPEIRYHDLRHTFATLFLE
FT                   AKGPIKTLQQILGHSSITVTIDTYSHVTEEMLIEAERKMETMFKVIGNDKE"
FT   gene            complement(372269..372964)
FT                   /locus_tag="Hore_03630"
FT   CDS_pept        complement(372269..372964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_03630"
FT                   /product="transcription activator effector binding"
FT                   /note="PFAM: Bacterial transcription activator, effector
FT                   binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_03630"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69124"
FT                   /db_xref="InterPro:IPR010499"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="InterPro:IPR029441"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1P7"
FT                   /protein_id="ACL69124.1"
FT                   /translation="MEILIAKVKEMNQDLQELKNKKEIIEQFIFTLENNNHRNLCKALE
FT                   ILQRKYTAIKNGMKQVEKKSREGEGELKRLTDSEVRIVELKPVWVASYRAEAESPEPRA
FT                   WEVIFKWAKKYNLLQLPGTRFFGFDNPSPTPDKAVYGYEFWVTIPHKNFNIPEEMKIRK
FT                   FSGGLYAVTNTNFREFDVGERWKQLYKWVKESEFSYREGICLEEHITLTGYNLDINTVQ
FT                   LDLYEPIKP"
FT   gene            373977..374819
FT                   /locus_tag="Hore_03640"
FT   CDS_pept        373977..374819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_03640"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_03640"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69125"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1P8"
FT                   /protein_id="ACL69125.1"
FT                   /translation="MLLKEILDIRGLTNYKIKLVRHNVNREYIKKIMNNGNFNLYQSVH
FT                   KTNIFKGYDYIITFTNLERTKASLYGVYKVKGVEKIQELPEEICFIKEPESWDKGPFYK
FT                   YRIEEVNLLSDLKKRLVIDWGAATRSWHQKKLNKEVIEIFPVGFVKTFPGYQNVILSFK
FT                   ELSRIVNNPDSNREWKSALSSVYGVYLILDITDGKQYVGSAYGEEGIWGRWKCYVKTKH
FT                   GNNKLLIDLLKSDPDRYKHFQFSILDILPITSMKEEVINLESITKEKLGSNVFGLNAN"
FT   gene            complement(375133..375264)
FT                   /locus_tag="Hore_03650"
FT   CDS_pept        complement(375133..375264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_03650"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_03650"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69126"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1P9"
FT                   /protein_id="ACL69126.1"
FT                   /translation="MDKKCVSTGAPTKLPKKEIIPIKTPKAADKNINSFIYEPKLIK"
FT   gene            375760..377253
FT                   /locus_tag="Hore_03660"
FT   CDS_pept        375760..377253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_03660"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_03660"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69127"
FT                   /db_xref="GOA:B8D1Q0"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1Q0"
FT                   /protein_id="ACL69127.1"
FT                   /translation="MNPFQLKKGDTDAFFGVLFDGMPKIITGVVVLTPLLGADTVFKQL
FT                   LPSIGLAIVLAGLFFWWLGEQTKKRTGNKDIVALPGGINAGRFFVWLFAIMIPVYKATN
FT                   DAKLALFVGIGANIISSILSIIMAFVGKKIANIIPAEALFGGLTGGALAWLTLSTFNDM
FT                   FKTPEMSIISMVSIFIILSVYLGKVKLKISPALLSVGVGVVLGLVLNVVTAGALKDSLS
FT                   NFGIYLPGGVIFSGGYFSYLMKGLIEAVKYLPIIIVFSFGETISNIQGLEQARGLGDDY
FT                   DIRQSLIGVNIVSLISGFFGNPFCIGIWWGYPSWKEVKAGTGYQILHGLAYLLLSVTGI
FT                   VAIVTSLIPVGAVLPILIFIGLASTQSAFANYDARYYGIMALAMAIPIAELTKAPDFIA
FT                   KGAMLISLVWGSVLVYIAKNEWKKVSFSFLVGALLSLLGLMHTPNFIINFKLTESGAFN
FT                   GINFTMDAWKPAIAYLIIAAITYFFAKKGNISYEEEVQS"
FT   gene            377424..380498
FT                   /locus_tag="Hore_03670"
FT   CDS_pept        377424..380498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_03670"
FT                   /product="glycoside hydrolase family 31"
FT                   /note="PFAM: Glycosyl hydrolases family 31"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_03670"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69128"
FT                   /db_xref="GOA:B8D1Q1"
FT                   /db_xref="InterPro:IPR000322"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR033403"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1Q1"
FT                   /protein_id="ACL69128.1"
FT                   /translation="MHLDNYNVVFNILEGEVLHIQIQDKNNKSPFLRVTGGEKVLKSID
FT                   YHQVDSREIIPVSERYNLEINKDRESFKIFDKTRQKIVLESYDSFFRKVDEKQKGLSLS
FT                   IKENELFTGLGQDVEGKLYIEDIERRCWNEWNGYDYLGSNSVPFYLSNQGYGLYLDTTY
FT                   PSRFVFGKGEIQPKPIAHEVMAETPFDWEEKACVNAEDQLTILGWEEEQLDFYILLGDM
FT                   AEIEQKYYQLTGKPSLLPKWSLGYIQCKNRYKSEEEILHIARKMREKGIPCDVIVIDWL
FT                   WFKEFGDLYWDGENYSEKMAETIKKLKDMGIKILLAVHPFVDYSSKNYKELSEKGCLSK
FT                   VPEGGRPYFDHTNPATKEAMWKFYQKLYDEGVAGWWTDMGEPESDLPGTQGYAGKREVY
FT                   HNVYTLLWSKNIMEAQRENTGSRNFCLARTNALGIQNYNTAYWTGDIFATWEIYRRNIK
FT                   ALQTVSVSGQPYVCTDIGGFHTDERFTPELYVRWLQWGVFAGLFRVHGVKPENEPWSLG
FT                   ESNEKIIKKIIEFRYRFIPYIYEKMYQMQQNGEAFIRPLIYDYPQDEKAIEREYQYLFG
FT                   DILVCPVVEPDVREIDVYLPAGKWYDFYKGTMYYGGETYKAYAPIDRIPLYVKDGSIIL
FT                   TTEPEEDVKDIYDKYQLLIYGEGSTTEYIYEDDGTSYGYEDGSYNLIKLEKKDNQLTVS
FT                   TLQHKYKEENTNRELEIVYYKNNKKYTRTVDYTIGETINISLQEGKESNIQVVNVEMDV
FT                   DVTHSEYNGDFYANLSIKNNLNEPQNLRIRIEKPDHYYVKAQIDLPESLDFSSNVKVEE
FT                   SAEYLYRKIQVEDTYTSVFPFKPFKDKMPQQEKIEVAIEDQRTGKVLDKKIITLGNGYL
FT                   KNWRYAVSKYEEIDKDDLNFAPALDSNPWGYIYLYKYLNMQENGINPVDFIEIIQKIGY
FT                   GYARVNILSPENKKAYLRIRADEGSTFYLNGEKIHENSRYTIEEDILIELEKGVNLLEA
FT                   NVQWKSPRPFTGREFGLSAQVLTLDKEIDETVKSF"
FT   gene            380553..382118
FT                   /pseudo
FT                   /locus_tag="Hore_03680"
FT   gene            382436..383383
FT                   /locus_tag="Hore_03690"
FT   CDS_pept        382436..383383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_03690"
FT                   /product="Bile acid:sodium symporter"
FT                   /note="PFAM: Sodium Bile acid symporter family"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_03690"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69129"
FT                   /db_xref="GOA:B8D1Q2"
FT                   /db_xref="InterPro:IPR002657"
FT                   /db_xref="InterPro:IPR004706"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1Q2"
FT                   /protein_id="ACL69129.1"
FT                   /translation="MIKKVTNFIKDNLPYLILLMMVSGLYYGYFNDVQYLKSFITPVLI
FT                   LMIYPMMININVGEVFTNLSNPKPIILSLLINFIFSPFVAYLLGKIFLGSFHQLLTGLI
FT                   IISLIPTSGMTAPWTGLAKGNIKSSLTMISVNLLISILIIPVYVKVFIGEMIAINMMFI
FT                   IKSLLKVVVVPLLLGDLTRRFIIEKYGMEKYKEVKPELGGVSALGVIIIVFVAMALKSK
FT                   TILGDLKLVIVSIIPLLIFYTLILIISNKIGQKLPNNGNKIAFVYSTVMRNLTLALGLT
FT                   INTFGGLAVFIIALAYVVQVPIGAFYMNYLKTVK"
FT   gene            complement(383519..384520)
FT                   /locus_tag="Hore_03700"
FT   CDS_pept        complement(383519..384520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_03700"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_03700"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69130"
FT                   /db_xref="GOA:B8D1Q3"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1Q3"
FT                   /protein_id="ACL69130.1"
FT                   /translation="MFKKIINLIKKDLINGLRNNMVIYMLLFPLVLALGMSFFIPSVTE
FT                   VEVTIAVDSGVDQWVINRLEDYGKVELYDSPEAVKERVKRLDDISGIIKDEDEYVVLIE
FT                   GNEPEETVDMARAVMNMVLSDEQPADFKYKSLNKETSMMQEVMGSILMLTAILVSGLVI
FT                   GMNIIDEKETGVINALTVSPLKLRDFIISHTTVALISGIIISVLSLLILVGTSINYIQV
FT                   ILGTICTMGIGIAWGFLIGGIADNLMSGIAVIKGTMLFLIGIPIGSIFVPANFRWILYP
FT                   FPNYWAFQVYRNILNGGKQWVSFSSSAWITLAFGLILLLALSPMLKKRLNLK"
FT   gene            complement(384523..385569)
FT                   /locus_tag="Hore_03710"
FT   CDS_pept        complement(384523..385569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_03710"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; TIGRFAM: ATP synthase
FT                   subunit 6 (eukaryotes),also subunit A (prokaryotes)"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_03710"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69131"
FT                   /db_xref="GOA:B8D1Q4"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1Q4"
FT                   /protein_id="ACL69131.1"
FT                   /translation="MIKRLTNLFQQDLKVAVRNYFHLVIIILALLMVVVVNFIIPAEVK
FT                   LTPGEIFLDNTPGKQVQKYLMSEGLDKNRFVNNREELFKRIEADSNTLGVILEGTVDNA
FT                   TFTVIGQGHESRESVNLLKAALASILDHMKGTVDRTNHRVERLHPQSKKVPFNKQMIPI
FT                   FIFTEVIMLGFLLVAVMVFQEKKEGGVRAYRVSPGGTLEYILSKVGTNLLLALLFAVIL
FT                   IVLTLGLEVNFISLLITIILANIFMTLIGLTISVFFKNLEEFIFVGILFLSIFALPMVS
FT                   YLTPSFAPPFITWIPSYPVLFGLREILFPTGRAGFISSLNWMLVVENLIVLAISYLAVH
FT                   RKLMREDK"
FT   gene            complement(385569..386423)
FT                   /locus_tag="Hore_03720"
FT   CDS_pept        complement(385569..386423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_03720"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_03720"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69132"
FT                   /db_xref="GOA:B8D1Q5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1Q5"
FT                   /protein_id="ACL69132.1"
FT                   /translation="MIEVKNLYHDYTGRGEYAVYNVSFTMEKGEIFGFLGPSGAGKSTV
FT                   QNIMTGLLRLQQGKINYNGKSINKIKNEFFNKIGVSFEHPNLYTKLTGYENLKYYAGLF
FT                   SVPTEDPMKLLNMVGLGDSASKKAADYSKGMKQRLVFARSLLNNPKILFLDEPLSGLEP
FT                   STASIIKDIIIDMKKRRTIIFLTTHNMFVAEELCDTVAFINEGKIVASDSPRNLKLKYG
FT                   EKSVKVEYRENGKVNSEVLFIENDKDKDRLNKLINTKKIETIHSQEATLEQIFIKLTGR
FT                   GLS"
FT   gene            complement(386416..387063)
FT                   /locus_tag="Hore_03730"
FT   CDS_pept        complement(386416..387063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_03730"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: Bacterial regulatory proteins, tetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_03730"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69133"
FT                   /db_xref="GOA:B8D1Q6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1Q6"
FT                   /protein_id="ACL69133.1"
FT                   /translation="MPLKTYYNLPEEKQKRIIKAAIAEFASNGYQKGSIQSIADRAGIS
FT                   KGSMYQYFTNKKELFLYIFDIAIDKKINGVKNIISRYRKLTIYELLEKAFEDSIKYARE
FT                   YPSLYQIYTRAIKGAPREIINSLDFKIKTEGLSFYLKLLTEARENGQVRDDINLELATF
FT                   VVFTLCKYFGEYLGQKIPRSSEKEIKHNVRDFLKVLKEGLLPQEHEEVCKND"
FT   gene            387304..387969
FT                   /locus_tag="Hore_03740"
FT   CDS_pept        387304..387969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_03740"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: Bacterial regulatory proteins, tetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_03740"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69134"
FT                   /db_xref="GOA:B8D1Q7"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1Q7"
FT                   /protein_id="ACL69134.1"
FT                   /translation="MPRETFFNLSEEKRNRIINIAVEEFARYDYNSASLSRVVEKAGIA
FT                   KGSMYQYFKNKKELYLYLVELASEKKFNYISDNIDFDTGKKDFFQLLKEMHLVGLKFDL
FT                   THLHYSNLILNAMRETSKKIGNLADRLIRSSDNYMKDFIKKAREKGQIRDDVDLDLISF
FT                   IVNRVSIYLSEYLGMKYDFSYEEVIKEGKIRIPVSEEELEKILDEMVKVLQTGLEGRK"
FT   gene            388247..388633
FT                   /locus_tag="Hore_03750"
FT   CDS_pept        388247..388633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_03750"
FT                   /product="putative cytochrome c-type biogenesis protein
FT                   CcmE"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_03750"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69135"
FT                   /db_xref="GOA:B8D1Q8"
FT                   /db_xref="InterPro:IPR004329"
FT                   /db_xref="InterPro:IPR036127"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1Q8"
FT                   /protein_id="ACL69135.1"
FT                   /translation="MKTKTKVIILTLIIVLVVSYTTYISFNNSATYYYTISEARGLEGI
FT                   RQHLRIKGNLIKDSVKWSPDLSELKFTLTDGQHNLKMIYSGVVPDNFKHSREVIVEGKF
FT                   IENDVFRVTKLMLQCPSKYEKGEE"
FT   gene            388633..390612
FT                   /locus_tag="Hore_03760"
FT   CDS_pept        388633..390612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_03760"
FT                   /product="cytochrome c assembly protein"
FT                   /note="PFAM: Cytochrome C assembly protein; TIGRFAM: c-type
FT                   cytochrome biogenesis protein CcmF"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_03760"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69136"
FT                   /db_xref="GOA:B8D1Q9"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="InterPro:IPR003567"
FT                   /db_xref="InterPro:IPR032523"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1Q9"
FT                   /protein_id="ACL69136.1"
FT                   /translation="MISTGDLSILLASIFTVISIITAVICFWKEEKAGLFIRVSRLSNF
FT                   LSIIMVTVAVVILLKALIRSNFNYEYVVRYTSRDLPLIYKISALWAGQSGSLLLWLFFM
FT                   SLTGLIVQLNKHFGKENYDIAVTGIINVIRLFFMAVLTGPASPFKISAPAPYFGQGLNP
FT                   MLQNIYMAIHPLFLFAAYSGFIVPFSLATVGVWQRDKKYLWLERSRLWVLFSWGLLTAG
FT                   IITGGKWAYTELGWGGYWAWDPVENASLFPWLIATALLHNLILRKRAGGVKLLNFILIS
FT                   LSFVLTIFGTFLTRSGLLDSVHAFSNGKIGYYFLFILIVLVLLVIYLIITRYNYFKKTN
FT                   LNIKLFSVEGVLILTGIFLMFIFGGVLLGTLFPVITEVFVERRIILNKVFYNQFTVPFW
FT                   LLIVFLMGLCPLIKGGKWKAKEFVLPLLAGVVMFIGIIIKYNHGLAAFSFAICIFASGS
FT                   IIQNFIIDILKLRYKNDKSLLASIIKLFILHKRKPGSYIIHIGIILIVIGITGSSLLGN
FT                   GKLQVLRPGEEMVLKNYRFEYQGLTRKVFYTKTRVIAKLQVYRGKRRLGDITSEKIFYP
FT                   GHDQPDTEIGLMSKINEDIYFNLAGWDGDQARIEVNIYPLVSLIWTGALVICIGVVVLV
FT                   LPVRQEIDYQQGTKSGRGCPGWKY"
FT   gene            390600..391238
FT                   /locus_tag="Hore_03770"
FT   CDS_pept        390600..391238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_03770"
FT                   /product="heme exporter protein CcmA"
FT                   /note="PFAM: ABC transporter; TIGRFAM: heme ABC exporter,
FT                   ATP-binding protein CcmA"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_03770"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69137"
FT                   /db_xref="GOA:B8D1R0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005895"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1R0"
FT                   /protein_id="ACL69137.1"
FT                   /translation="MEVLRVKQLTKKIGYRTILSNINLEVSSGELVVLIGPNGAGKTTF
FT                   LRILAGLTNKTSGEILIDNKPCKIGDSRIGYLGHQTMLYNLMTVYENLETFGRLYGCFN
FT                   DEKVEGLLKKVNLYFNKYERVANLSRGMKQRLALARLLLPQPDLILYDEPFTGLDREGQ
FT                   KLLIDILKKQQNDGKLQVLVTHKSAFLTGINYRKYRLERGELVEGGDNI"
FT   gene            391235..391909
FT                   /locus_tag="Hore_03780"
FT   CDS_pept        391235..391909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_03780"
FT                   /product="cytochrome c-type biogenesis protein CcmB"
FT                   /note="PFAM: CcmB protein; TIGRFAM: heme exporter protein
FT                   CcmB"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_03780"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69138"
FT                   /db_xref="GOA:B8D1R1"
FT                   /db_xref="InterPro:IPR003544"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1R1"
FT                   /protein_id="ACL69138.1"
FT                   /translation="MNSYFKNLWILYLKDLKCEFRSIDNMASTIVFGLMVTFIISLSLQ
FT                   NLDMESINIFPSLLWVVVLFTVTLGVNRSFDFEKENKAHEALIMAVGDWSCIFFAKVIS
FT                   NLTLLFVVEAIIIPLYIIFNDIRFDFNYGFFLLTLILGSCGLSLIGTLLNSIILQIRGS
FT                   KLLLPVLLFPLSIPLFIAVTECTKASLIAGYIPVRWVNFLILFDLIHFLIPLFIFDYIM
FT                   EN"
FT   gene            391924..392601
FT                   /locus_tag="Hore_03790"
FT   CDS_pept        391924..392601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_03790"
FT                   /product="cytochrome c assembly protein"
FT                   /note="PFAM: Cytochrome C assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_03790"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69139"
FT                   /db_xref="GOA:B8D1R2"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="InterPro:IPR003557"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1R2"
FT                   /protein_id="ACL69139.1"
FT                   /translation="MKDKVNSILLIILIFTMLTNLYLIFYYAPLEKVMGVVQKIFYFHV
FT                   ASAWIGFLALAVVFASNILYLRCGRKKWSQLSLASAEIGVVFISIVLITGPLWAKPVWN
FT                   TWWTWDPRLTTTLILWFMYVAYLILHGGREKNEKRERLAAVYGIIAFINVPLVFFSIRW
FT                   WRTIHPVVISTSGISITGEMLFTLLFSLATFTLLYVYLLKTRCRGIKLAYKIDLLKERI
FT                   GGY"
FT   gene            392770..393462
FT                   /locus_tag="Hore_03800"
FT   CDS_pept        392770..393462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_03800"
FT                   /product="Twin arginine targeting translocation protein ,
FT                   TatC subunit"
FT                   /note="PFAM: Sec-independent protein translocase protein
FT                   (TatC); TIGRFAM: Twin arginine targeting (Tat) protein
FT                   translocase TatC"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_03800"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69140"
FT                   /db_xref="GOA:B8D1R3"
FT                   /db_xref="InterPro:IPR002033"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1R3"
FT                   /protein_id="ACL69140.1"
FT                   /translation="MAEVEMSFVEHLEELRKRILISISLVLIFSIASYFFVPDIIKFLT
FT                   KPVGTRLVYLAPTEAFFTQLKVAFFSGLLLAFPFIIYQIWRFISPAFTENRQKFISWLV
FT                   PLSCLFFAGGLIFGYFVVVRFGLKFLMRFATDSLNPMFSLGKFISFVTGVMIPFGLIFQ
FT                   MPIIIIPLVKLNLIDHKFLKKQRKYVLLIIFILAAILTPPDVISQVMMALPLILLYEVS
FT                   IIWARIIE"
FT   gene            393740..394489
FT                   /locus_tag="Hore_03810"
FT   CDS_pept        393740..394489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_03810"
FT                   /product="split soret cytochrome c precursor"
FT                   /note="TIGRFAM: Tat (twin-arginine translocation) pathway
FT                   signal sequence"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_03810"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69141"
FT                   /db_xref="GOA:B8D1R4"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR010181"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1R4"
FT                   /protein_id="ACL69141.1"
FT                   /translation="MEEKNNKISRKQFLTTVGGLAAGAVLAGSGLSLLDSEVKAEKLPE
FT                   YPWTKYFAKKLNVETVRKKATQYYHEGNHCAEASFRALVEELGAPFSNVPSQVLWFGAG
FT                   GGAGWATLCGAVNGGSAAISLVYGRSKITMALVNELFGWYSETPLPLNSEVNSVAGTPL
FT                   CHSSVSNWCEASGLKADSKKRSKRCGLLTGDTTAKAAELLNAQLAGKFVATYTIPKEAQ
FT                   ECMNCHVAGDLKDTRGKMDCLDCHEGH"
FT   gene            394508..394690
FT                   /locus_tag="Hore_03820"
FT   CDS_pept        394508..394690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_03820"
FT                   /product="twin-arginine translocation protein, TatA
FT                   subunit"
FT                   /note="PFAM: mttA/Hcf106 family; TIGRFAM: twin
FT                   arginine-targeting protein translocase, TatA/E family"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_03820"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69142"
FT                   /db_xref="GOA:B8D1R5"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1R5"
FT                   /protein_id="ACL69142.1"
FT                   /translation="MFGMGPVELILVLFIALIIFGPGKIPEIGEAIGKGISKFKSAAKE
FT                   AEETVNIKSDDKEEK"
FT   gene            394963..395669
FT                   /pseudo
FT                   /locus_tag="Hore_03830"
FT   gene            complement(395691..396104)
FT                   /locus_tag="Hore_03840"
FT   CDS_pept        complement(395691..396104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_03840"
FT                   /product="hydrogenase maturation protease"
FT                   /note="PFAM: Hydrogenase maturation protease; TIGRFAM:
FT                   hydrogenase maturation peptidase superfamily; hydrogenase
FT                   maturation protease"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_03840"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69143"
FT                   /db_xref="GOA:B8D1R6"
FT                   /db_xref="InterPro:IPR000671"
FT                   /db_xref="InterPro:IPR023430"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1R6"
FT                   /protein_id="ACL69143.1"
FT                   /translation="MGDDGVGIHLIKELESKKIPPDVSLIDAGTAPINYLKEISLSKEV
FT                   IAIDAIYGGKSPGTIYRLCLDDLKKSTNPDLHGFSLFDVIKMGQSMTGYPHKITIYGIE
FT                   PERITLGTKLSKSVQKAVMKVKKIIEEKLSPHI"
FT   gene            396228..397232
FT                   /locus_tag="Hore_03850"
FT   CDS_pept        396228..397232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_03850"
FT                   /product="hydrogenase (NiFe) small subunit HydA"
FT                   /EC_number="1.12.99.6"
FT                   /note="PFAM: NADH ubiquinone oxidoreductase, 20 Kd subunit;
FT                   TIGRFAM: hydrogenase (NiFe) small subunit (hydA)"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_03850"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69144"
FT                   /db_xref="GOA:B8D1R7"
FT                   /db_xref="InterPro:IPR001821"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="InterPro:IPR027394"
FT                   /db_xref="InterPro:IPR037024"
FT                   /db_xref="InterPro:IPR037148"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1R7"
FT                   /protein_id="ACL69144.1"
FT                   /translation="MKKKDYVNLCRSLKTEGSHQLSREILRVVRDFRSNNGKKLPVIWI
FT                   ETNDSGDNNISFMNTTYPYLDQVFEDIIDLYYSNTFMAAQGEDAYQILKKVALREKREF
FT                   TLVVEGAIPLKANGRYNITFITDEGPVTAVELVRWLGELAKYAVAVGTCASFGGASAAS
FT                   PNITGSVALGDVLDRQIINVSGCPINPDWFVGTLAHLQMYGLPDLDRLGRPELFYQFTV
FT                   HRHCQRRSYFDDGNFAEELGDIECMFSQGCVGPRTGADCPYRLWDNHVSYPIKVNTPCI
FT                   GCTNEDFPDGSSPFFVPLPLKRQEDEEVTPGRDGDKINGFKDSKDTCGDDTDG"
FT   gene            397225..398637
FT                   /locus_tag="Hore_03860"
FT   CDS_pept        397225..398637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_03860"
FT                   /product="nickel-dependent hydrogenase large subunit"
FT                   /EC_number="1.12.99.6"
FT                   /note="PFAM: Nickel-dependent hydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_03860"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69145"
FT                   /db_xref="GOA:B8D1R8"
FT                   /db_xref="InterPro:IPR001501"
FT                   /db_xref="InterPro:IPR018194"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1R8"
FT                   /protein_id="ACL69145.1"
FT                   /translation="MVKKITFSPVTRLSGLLSVEIVVDRGKIVNARTRGTMFRGYEWIM
FT                   RGRKVTDAVYMTQRICGICSLAHGAVGSYLLDELYGNIISENAQYLRNIMFAADFLQNH
FT                   IRHFYFFGLPDFVKMPEKPPFLGQDLNDLRLNREDNRRLVDNYYKAVKAAQESHQLLAL
FT                   FGGKIPNQHSFVHGGVTVAPTADKINQAKALIESIQQFVQGCMIPDTELISRAYRDYFQ
FT                   IGVTPLRLISFGLFPFGPQNDDYLWPPGVIINNEFELPQVEFIEEQVPYSYYEANDEGE
FT                   NVFNQYPEPAPFKPEAYSYIKTVLYKGQHFETGPYARGVIRGDYRGRASTMDRIVARSL
FT                   EALKLAGFIREWLTRLEPGPPPLNQNEEPVKDRAVATTGAMRGALLHSAIIEGEEVKSY
FT                   NVITPTTWNFSPRDKNGNPGPVERALIGTEIPGGAMLETIVGRIIRSFDPCISCGTHVY
FT                   SIDGKLQKKIEF"
FT   gene            398661..399008
FT                   /locus_tag="Hore_03870"
FT   CDS_pept        398661..399008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_03870"
FT                   /product="hydrogenase nickel insertion protein HypA"
FT                   /note="PFAM: Hydrogenase expression/synthesis hypA family;
FT                   TIGRFAM: hydrogenase nickel insertion protein HypA"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_03870"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69146"
FT                   /db_xref="GOA:B8D1R9"
FT                   /db_xref="InterPro:IPR000688"
FT                   /db_xref="InterPro:IPR020538"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1R9"
FT                   /protein_id="ACL69146.1"
FT                   /translation="MSVMGEIFSIINSNVAKYRLKRVTKVVVRVGEMTCLNDEALDFAF
FT                   QVFAEDTVAEGAELIINKEKARARCHHCGHIFEITYTDKLCPHCQSYSDNIVNGYELYL
FT                   DKVEGEIDEND"
FT   gene            398995..399642
FT                   /locus_tag="Hore_03880"
FT   CDS_pept        398995..399642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_03880"
FT                   /product="hydrogenase accessory protein HypB"
FT                   /note="PFAM: CobW/HypB/UreG, nucleotide-binding domain;
FT                   TIGRFAM: hydrogenase accessory protein HypB"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_03880"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69147"
FT                   /db_xref="GOA:B8D1S0"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR004392"
FT                   /db_xref="InterPro:IPR012202"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1S0"
FT                   /protein_id="ACL69147.1"
FT                   /translation="MKTIKINKKILSKNEEKATEIRAYLNEKKVRMLNLVGSPGAGKTT
FT                   ILEKIIEKFDNTRKIVVIEGDLYTTRDAERLKKYEIQVVQINTMGACHLEAGMVWQALK
FT                   EVNLEEIDFLIIENVGNLVCTASYDLGENIRATVLSVPEGNDKLLKYPVIFQRADLIII
FT                   NKIDLLPYTDFSLEEIEKDLKQINKNAPVFKLSGKTGAGLDKLCFFLEENLT"
FT   gene            399639..401894
FT                   /locus_tag="Hore_03890"
FT   CDS_pept        399639..401894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_03890"
FT                   /product="(NiFe) hydrogenase maturation protein HypF"
FT                   /note="PFAM: yrdC domain; Acylphosphatase; HypF finger;
FT                   HypF finger; TIGRFAM: [NiFe] hydrogenase maturation protein
FT                   HypF"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_03890"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69148"
FT                   /db_xref="GOA:B8D1S1"
FT                   /db_xref="InterPro:IPR001792"
FT                   /db_xref="InterPro:IPR004421"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR011125"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR017968"
FT                   /db_xref="InterPro:IPR036046"
FT                   /db_xref="InterPro:IPR041440"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1S1"
FT                   /protein_id="ACL69148.1"
FT                   /translation="MKKRRLQLEIEGIVQGVGFRPFIYRLARENNLNGWVLNTSGGVLV
FT                   EVEGNQKTLEMFIRQIDEESPPLAQITTIKSREVSVREDSSFVIKDSRKTYYTQVQLPP
FT                   DIAICNDCLHDIMDPTNRRYRYPFTSCVNCGPRFKIIKSLPYDRPRTTMKKFKMCPECN
FT                   TEYNNPLDRRFHAQPNACPLCGPQLWLKKMSGEKCLTRDPIGLTIDLLKKGNIIAIKGI
FT                   GGFHLMCDATESDVIANLRTRKRRPDKPLALMMNKLTTVRKYCNVGSMEEEILTGIRRP
FT                   IVLLDKKGEKLPRNIAPGIRYYGVMLPYTPLHYLLFDKGIEVLIATSGNVSGNPLEYQN
FT                   GGVFENLKGIADYVLGHNREIYVPVDDSVVRVVGGKKRVIRRARGYVPQPLMVGGLDNG
FT                   LALGGDQKNTFCFARNKYAFISQYLGDLGNIDNYNNFKLMIDHFKELYKIKPDFVVHDL
FT                   HPDYQTTYYASFYGDKIGVQHHHAHIASCMAENNIDEKVIGLAFDGTGLGNDGNIWGGE
FT                   FLICDFKDFKRGGHLNYMKMPGGDMAIKEPWRLAVSYLNRLRYDKADIINLLRIDEVEA
FT                   DIILKMLNKGFNCPETSSMGRLFDTVAALIGLRKRITYQAQAALELESIADNNTEEIYH
FT                   VSIEEKGQKYVVNTDPMMGGIISDHKKGVKRSIISSKFHNTVIAFTLEMCRLIRHKYGI
FT                   NSVALSGGVFQNKLLLEMLCAGLKEQNFKVYSQAKIPCNDSGLSLGQLAIASNRRKD"
FT   gene            401901..402116
FT                   /locus_tag="Hore_03900"
FT   CDS_pept        401901..402116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_03900"
FT                   /product="hydrogenase assembly chaperone hypC/hupF"
FT                   /note="PFAM: HupF/HypC family; TIGRFAM: hydrogenase
FT                   assembly chaperone HypC/HupF"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_03900"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69149"
FT                   /db_xref="InterPro:IPR001109"
FT                   /db_xref="InterPro:IPR019812"
FT                   /db_xref="InterPro:IPR037254"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1S2"
FT                   /protein_id="ACL69149.1"
FT                   /translation="MCIGVPVKIIKKRESLALAELNGVKKEINIDLVPEVKPGDYVLLH
FT                   AGCAIQVVNKKEAIRTLKLLKELSQG"
FT   gene            402139..403236
FT                   /locus_tag="Hore_03910"
FT   CDS_pept        402139..403236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_03910"
FT                   /product="hydrogenase formation HypD protein"
FT                   /note="PFAM: Hydrogenase formation hypA family; TIGRFAM:
FT                   hydrogenase expression/formation protein HypD"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_03910"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69150"
FT                   /db_xref="GOA:B8D1S3"
FT                   /db_xref="InterPro:IPR002780"
FT                   /db_xref="InterPro:IPR042243"
FT                   /db_xref="InterPro:IPR042244"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1S3"
FT                   /protein_id="ACL69150.1"
FT                   /translation="MKCVDELSDRKIISGIVSKIKAIKLSGKVKIMEVCGTHTMSIFKN
FT                   GIKSLLPDSIELISGPGCPVCVTPDIYIDKALALAKKENVIITTFADLLRVPGSSGTLQ
FT                   EMRVNRKNITTVYSPLEAVKIAYNNPGQEVIFLAIGFETTIPAIALSIIKANQLGLNNF
FT                   SILQSLKIMPPVLQELVLDKDLDVDGFILPGHVSTISGLQPFEFLARDYHVPGVVAGFE
FT                   PGDIILSIYTLCKMLKDNDIRVKNLYPRLVRLEGNKKAQELIKEIFTPVDSYWRGLGTI
FT                   TGSGLKLRKVYHRYSAEKKFQFGDTQYRPGKGCICGEILKGKQKPTDCRLFGIKCTPMK
FT                   PEGPCMVSREGTCAAYYRYRGKVNL"
FT   gene            403241..404245
FT                   /locus_tag="Hore_03920"
FT   CDS_pept        403241..404245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_03920"
FT                   /product="hydrogenase expression/formation protein HypE"
FT                   /note="PFAM: AIR synthase related protein, C-terminal
FT                   domain; AIR synthase related protein, N-terminal domain;
FT                   TIGRFAM: hydrogenase expression/formation protein HypE"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_03920"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69151"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR011854"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1S4"
FT                   /protein_id="ACL69151.1"
FT                   /translation="MNTISLAHGNGGKMMEDLIDNLFLKYLNNDIINKKDDASPVPEIK
FT                   GVPVISTDTFVVDPIFFPGGNIGKLSICGTVNDLAVTGAIPLYLTVGFILEEGLPIKHL
FT                   EKIIISMAEVSREANVKIVAGDTKVVERGKGDKIFINTTGVGMIGDKLKLSDENIKLGD
FT                   KVIINGSIAEHGLAILMERNQMDFSTSIKSDCCTLSDLIVTLLSETNGIKFMRDPTRGG
FT                   MATVLNEIATRYNVGIEIEEEKVPLGDEIKSLCKILGLDPLYLANEGKVLIIADREKSE
FT                   KIVDIMRRHPYGRNSSIIGTIVDNNDQQVYLKTRIGGKRIITKLMHDMLPRIC"
FT   gene            404460..404933
FT                   /locus_tag="Hore_03930"
FT   CDS_pept        404460..404933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_03930"
FT                   /product="Rubrerythrin"
FT                   /note="PFAM: Rubrerythrin"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_03930"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69152"
FT                   /db_xref="GOA:B8D1S5"
FT                   /db_xref="InterPro:IPR003251"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1S5"
FT                   /protein_id="ACL69152.1"
FT                   /translation="MFTSRLKGIEALEMAKNIEKDGFEFYQEQADRVDDDLKKLFLKLA
FT                   NDEKDHYKRFEELKHDHKKKTGEEDDYVYEPEVSAYLRVLVESTIFPEKAIKSFNNLDS
FT                   ILNFAIQAEKDSILFYQELLKYNKGRTAEVLTRLIKEEKTHLLDLTKYKADLK"
FT   gene            404935..405195
FT                   /locus_tag="Hore_03940"
FT   CDS_pept        404935..405195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_03940"
FT                   /product="Excinuclease ABC C subunit domain protein"
FT                   /note="PFAM: GIY-YIG catalytic domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_03940"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69153"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1S6"
FT                   /protein_id="ACL69153.1"
FT                   /translation="MHYVYIVECSDGSFYTGYTTDVERRVKEHNRGIGAKYTRGRRPVK
FT                   LRYQECYSTKSEAMRREYELKQLTRFRKEELINKKVTRTDK"
FT   gene            405278..406216
FT                   /locus_tag="Hore_03950"
FT   CDS_pept        405278..406216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_03950"
FT                   /product="aldo/keto reductase"
FT                   /EC_number="1.1.1.-"
FT                   /note="PFAM: Aldo/keto reductase family"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_03950"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69154"
FT                   /db_xref="GOA:B8D1S7"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1S7"
FT                   /protein_id="ACL69154.1"
FT                   /translation="MLKKRKLGTTGLEVSEIGFGCWQLGNTKDWRGATGEDAIRLVHKA
FT                   IEMGCNFFDTAPNYAGGKSEELLGKALKGKRDKVIISSKFGHTPDGQTSFDPSLLKKSV
FT                   EESLGRLETDYLDILLLHSPPVEVIKGSQGHYQIMEELKKEGKIRFYGASVDTGQQMLD
FT                   VINNSNSSVIEILFNLFHQEPRRVFPRAGEEGVGLIVKVPLDSGWLTGKYNADSTFTGI
FT                   RERWSREVIKRRASLVEMVKDIKDDNTSMVHEALKYILAYPQVSTVIPGVRTEEHLIEN
FT                   FKASERKLSDDRLRKYEDLYNKYIEGNELPW"
FT   gene            complement(406333..407016)
FT                   /locus_tag="Hore_03960"
FT   CDS_pept        complement(406333..407016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_03960"
FT                   /product="Catalase"
FT                   /EC_number="1.11.1.6"
FT                   /note="PFAM: Manganese containing catalase; Rubrerythrin"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_03960"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69155"
FT                   /db_xref="GOA:B8D1S8"
FT                   /db_xref="InterPro:IPR007760"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR039377"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1S8"
FT                   /protein_id="ACL69155.1"
FT                   /translation="MLHEVKVDKPNPAYAAMLQEQLGGANGELKAGLQYFSQSFRIQDP
FT                   EIKDLFLDIAAEEFSHAEMVAQTINMLNGHEVSNTNDNIGQIESQVLSGLAPMLANGSG
FT                   TPFTGNYVNVTGDITADILSDIAAEQRAKVVYEYLYRQIDDQGVRETIDFLLNREEAHN
FT                   ALFRQALNKVQKNKRSSNDDFGVTEDSRLYFDLSTPGKYFDNPFPTPPSFQEPSQKKEP
FT                   QGQPV"
FT   gene            407226..407813
FT                   /locus_tag="Hore_03970"
FT   CDS_pept        407226..407813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_03970"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="PFAM: Sigma-70 region 2; Sigma-70, region 4;
FT                   Sigma-70, region 4; TIGRFAM: RNA polymerase sigma factor,
FT                   sigma-70 family"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_03970"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69156"
FT                   /db_xref="GOA:B8D1S9"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1S9"
FT                   /protein_id="ACL69156.1"
FT                   /translation="MDGTSDEKIINMILAGEKELFARLVEKYQRKVYNTTYRMLGNSED
FT                   ASDLTQEAFIKTFRNLKRFRGKASFSTWLFTITTNLCRDELRKRQRRSASPHFPDGQHF
FT                   MSEDIENIKDNSKVPEDLYMGRETMASIQRAINKLPADQKEVIVLRDIQGFSYKEISEI
FT                   IGVPMGTVKSRLSRARKSLQKHLKNIEGRGLK"
FT   gene            407810..408982
FT                   /locus_tag="Hore_03980"
FT   CDS_pept        407810..408982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_03980"
FT                   /product="putative transmembrane anti-sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_03980"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69157"
FT                   /db_xref="GOA:B8D1T0"
FT                   /db_xref="InterPro:IPR025645"
FT                   /db_xref="InterPro:IPR027383"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1T0"
FT                   /protein_id="ACL69157.1"
FT                   /translation="MNHQKLKDLLPLYVDNGLNDEEKNLVEKHLKECEECRNELKHYRQ
FT                   NFNILSSTEGVEPPQDIVESVMEGLNNLDYNIDKEQEQNTWSDKLLNLFRLKVRIPVGA
FT                   VAVVVAIILSIALFSPGIYNSYQNYSLSREEMEMGQEAAPEQDLKMARDRTMNRTNLNQ
FT                   SSPNTNQEAGLDRKIIQNASLEIETDDFAEVSKVVTGLVTSYEGYIASSTNWVTASGQK
FT                   KVSFTLRIPENHFHMVLEQIKNMGRVKYSSLGSRDVTEEFIDVEARLDNLKEQEIRYRK
FT                   LLDRADKVEDILKIERELERVRSTIESLEGRIEYLQNRVSFSTINVVFMEPESIMNSNR
FT                   GIIGALRQALRAMVESFYNLIIKLGAWLPYMLPLVAGYFIYRRHKLKNKE"
FT   gene            409245..409724
FT                   /locus_tag="Hore_03990"
FT   CDS_pept        409245..409724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_03990"
FT                   /product="Flavodoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_03990"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69158"
FT                   /db_xref="InterPro:IPR026816"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1T1"
FT                   /protein_id="ACL69158.1"
FT                   /translation="MKKLILYASKHGTTEKASALLAEKLTGEVERVNVQKKFPDLRGYD
FT                   YIIIGGSIHAGQIQKEIKKLCEDNLNILLDKKIGLFLCCGLEDRVDDQMKTGFGSKLYE
FT                   HARVRGYFGYEFNFDKMNFLERLVVKVLAKVKESKSSIYEENIEDFANKINESLT"
FT   gene            409749..410132
FT                   /locus_tag="Hore_04000"
FT   CDS_pept        409749..410132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_04000"
FT                   /product="FMN-binding domain protein"
FT                   /note="PFAM: FMN-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_04000"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69159"
FT                   /db_xref="GOA:B8D1T2"
FT                   /db_xref="InterPro:IPR007329"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1T2"
FT                   /protein_id="ACL69159.1"
FT                   /translation="MSKKIITAGLILFIMLAIVFGFNSYKKIDRVRSMDINDINLGNVR
FT                   DGIYTGSYDAGLVSARVRVAVKNHRITRIEIMEHNNGRGEPAENIVKKILKKQSLKVDA
FT                   ISGATISSKVICKAIEIGLEKGQ"
FT   gene            410301..411971
FT                   /locus_tag="Hore_04010"
FT   CDS_pept        410301..411971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_04010"
FT                   /product="diguanylate cyclase"
FT                   /note="PFAM: GGDEF domain; TIGRFAM: diguanylate cyclase
FT                   (GGDEF) domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_04010"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69160"
FT                   /db_xref="GOA:B8D1T3"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1T3"
FT                   /protein_id="ACL69160.1"
FT                   /translation="MKFKKGYLCTYLTIFVVVTGFMFLINIQTTRLLSNDKIYKIVNYS
FT                   LDGSSDDLHYRLLEEGQRLFKFKTIIPESKLPATLDGNYKIIIHRLAGQWYRVYINDVL
FT                   IGSLGDIKKGYSNIWNAFGVYDLDQDLLQERNELVIEVYGLYEVGLLGYPVMITDNVTA
FT                   NRLSNWFIILIRNIKLVAIGVLLTAFIILILLIKMSKKIKREYVYYALGAFTIIFMVLD
FT                   YQVMYRLPVPPILFKKFIISGIYLASFFISIGLYKQFKVQLNLVLGLMVLGSAGYLIIF
FT                   PGNMVDFKKSYSLLNLLISLNVLGWFYAGALNFKKSLYARVFSICSFVLFVLASCDIYH
FT                   ILMNRGFVISMSIIGVAVFSIGIVFLIIIDYIIMQGQVVYEKKKSRFFYEKSIRDSMTG
FT                   IYNHHYIVSTLSRMKEPFSLVVLDLDNFKNINDTYGHLAGDEVIKNVAINLQNSIRKYD
FT                   YVGRYGGDEFVIILMNCSLDELKMMAKKIKRAVEEPVYKYKGNKIRVTASMGIYNATEK
FT                   EEGEQVIYRADQALYAAKKSGRSGIKMWTKSEFSDERGE"
FT   gene            412184..413491
FT                   /locus_tag="Hore_04020"
FT   CDS_pept        412184..413491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_04020"
FT                   /product="Exodeoxyribonuclease I subunit D"
FT                   /EC_number="3.1.11.1"
FT                   /note="PFAM: Calcineurin-like phosphoesterase; TIGRFAM:
FT                   exonuclease SbcD"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_04020"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69161"
FT                   /db_xref="GOA:B8D1T4"
FT                   /db_xref="InterPro:IPR004593"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR041796"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1T4"
FT                   /protein_id="ACL69161.1"
FT                   /translation="MDCIQNQYKFIVHELITVVIKRGRGPLRILHTADWHLGKHLEGWS
FT                   RYEEQKEFVEEIIEIADDNKVDMVLICGDIFDTTNPPAEAEQLFFQAMDYLSKGGERVI
FT                   CLISGNHDSPNRLMAPGPLASRQGIFIMDEPRGDRYKLDDDRVLNRGQGYIELEINGEG
FT                   VVLTALPYPSESRLNQVFSWTGDDRAVQESYSRRVGQIFSHLEQYYRENTINIAMSHLF
FT                   VAGGQTTRSERPIQVGGSLTVLPEHLPEKSQYTALGHLHRYQIASSARRAYYSGSPLQY
FT                   SLSEKDHKKCVNLVELHPGEEARIEQVELTTKKPIEVWEAEGVEEAIKMVEANKDRSVW
FT                   AYLYINVDKTLLQSEIKKIKEIKKDILCINPITPEEKYEWETIKMPDEDLDIMELFKEY
FT                   YRKTKKVEPDDDIIRMFSSIVNDTREKGEHDETAAS"
FT   gene            413472..416798
FT                   /locus_tag="Hore_04030"
FT   CDS_pept        413472..416798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_04030"
FT                   /product="Exodeoxyribonuclease I subunit C"
FT                   /EC_number="3.1.11.1"
FT                   /note="PFAM: RecF/RecN/SMC N terminal domain; TIGRFAM:
FT                   exonuclease SbcC"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_04030"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69162"
FT                   /db_xref="GOA:B8D1T5"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038729"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1T5"
FT                   /protein_id="ACL69162.1"
FT                   /translation="MRPLLLKISGLNSFVQEEIINFKKLTEKGLFGIFGPTGSGKSSIL
FT                   DAITIALYGKIARDTKEFINKETGELYVYFEFAMGSNQKTYCIDRKLKTSDNNGYTTSR
FT                   VRLAIKENGKVEEVYEKVREVEDKVEKIIGLNHEDFMRTVVLPQGQFSEFLTLQGKKRR
FT                   DMLERILNLEEFGERLMEKLRLRKNIKESQLKSVETILTSYEDVSEKSLEDILNKLENL
FT                   KKEIGYKKKRLQEKRNEYEKYKEVWTRQKQLLKYQEKLDTLEERSERISNLKNKMEQAK
FT                   KALNLKKDINRLERYHQERKETNQKVENLEKMIVDLREKRDRYNREYEESLRAKEKELP
FT                   DLTKKKLEIKDAIKLYEQNKGIKKEVTGKAEKLKQMVQDKNSLEEYLKRGQEKSRVIKQ
FT                   QIKDLEDIIEKQVINSDYRKTIMAGLNLERDYKQVQKDIKVINQGIKRLEREIWSLDEK
FT                   RKDKSGELKRIESGILYQYEKIIGDKEKAERELNGQKEKLEDDINKKRKQLEDLEKEIE
FT                   DYKIRNLAGILAGKLTEGSPCPVCGSTEHPRVAEKIDKAGLQKLLNTRKEIDSKLTELE
FT                   ERLNKYNSGMSILNKELTRLRQEKEEVILSFDNVLSELEEYDGVLTTGPGELRRKRDRV
FT                   KNELTKYTTQLETKQKDLADRKDKMKELKSLNSTLKQEYFKLIGELGIDDIADELENIN
FT                   KKDKERENYQKRLTQLRQQYEKINNRIENYRVSFNETEREITIFEHKIQTLKDKYQENR
FT                   KEIENKVGDRDPLHYLKEVESREEELKKRVDKYKKALEDTTDLLNNKERLMERLKQNRA
FT                   TLIKEISDTEQYLKEKMDEYKFESFDDVRKYLSWENQIRAWEEEITEFEDLKKEVESNI
FT                   TRLKMELNGQSISQERWTKIKADRESLEENLSRLQEELGSCKQTIEELKRKLELKRKNQ
FT                   EKKEELEHDLAVIKDINDLIRGKSFVEFVAMKQLRYIALEASSRLMEITNNRYKLELDN
FT                   QGEFVICDNYNGGVRRDCKTLSGGETFLTSLSLALSLSSHIQLKGNSNMEFFFLDEGFG
FT                   TLDVNLLDIVMNSLERLHNEHLTVGIISHVEELKNRVPVKLMVEPAEPGLHGSRVRIEY
FT                   T"
FT   gene            417181..418439
FT                   /pseudo
FT                   /locus_tag="Hore_04040"
FT   gene            418561..418986
FT                   /locus_tag="Hore_04050"
FT   CDS_pept        418561..418986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_04050"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: MarR family; Iron dependent repressor,
FT                   N-terminal DNA binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_04050"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69163"
FT                   /db_xref="GOA:B8D1T6"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR022689"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1T6"
FT                   /protein_id="ACL69163.1"
FT                   /translation="MGTQDSLIEVIEKLSAMMGEFEDRALNSDELADLTVKQLHYLDVI
FT                   KKYKKPTFTDLAEEMGVTKPTVTLAVNKLINQGYVKKVQSAEDRRVYHLLLTEMGERVV
FT                   DVHDKAHRDFARQFMKCLNDEELNQLVTIFKKVVKCE"
FT   gene            419106..419984
FT                   /locus_tag="Hore_04060"
FT   CDS_pept        419106..419984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_04060"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /note="PFAM: Cation efflux family; TIGRFAM: cation
FT                   diffusion facilitator family transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_04060"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69164"
FT                   /db_xref="GOA:B8D1T7"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR027470"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1T7"
FT                   /protein_id="ACL69164.1"
FT                   /translation="MMEEERYRETRKVSFISIVINIILSVAKIFIGISFASKALLADGV
FT                   HSVSDIASTVVVLISIKFSQNPADERHPYGHGKAEQIGTALLGLMLLITGLTLIKDTAG
FT                   NMITGEITVPGQITLWIALISIISKEALYQYTVKIGKKINSKGLVADAHHHRSDALSSV
FT                   AALAGIAGARLGYPFLDPLAGLIVALLIIKISIEIIKEAVHELMDGIPDEDKIVKIRKI
FT                   AENVSGVKDIGDIKIRSYGPHLIVDLTVAVDKNLKVIEGHQVAANIKNELLNSDSNVED
FT                   VLVHVDPWQEG"
FT   gene            420277..420981
FT                   /locus_tag="Hore_04070"
FT   CDS_pept        420277..420981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_04070"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: UTRA domain; HTH domain; Bacterial regulatory
FT                   proteins, gntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_04070"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69165"
FT                   /db_xref="GOA:B8D1T8"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1T8"
FT                   /protein_id="ACL69165.1"
FT                   /translation="MGKPVLPTYKTIAAEITNRIHEGEYKSGSYLPSENQLAREFEVTR
FT                   TTIRKALNILKERGTIESHQGKGYRVKLLHWEQSLLTFYSFGRDIAWKVQNPETRLLSY
FT                   NKIRGLKNINEFINTELWEITRLRFMNEIPLILETSYIPVKVMPEFKEEDLKQNSLYNL
FT                   LKENGVHIVKAKEYLEPVLPSLEDQKLLNIKQNTPLFQTLRYTYDSNEKLLEVRESLIR
FT                   GDHFRFSVEMTL"
FT   gene            420996..421595
FT                   /locus_tag="Hore_04080"
FT   CDS_pept        420996..421595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_04080"
FT                   /product="Chromate transporter"
FT                   /note="PFAM: Chromate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_04080"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69166"
FT                   /db_xref="GOA:B8D1T9"
FT                   /db_xref="InterPro:IPR003370"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1T9"
FT                   /protein_id="ACL69166.1"
FT                   /translation="MKKSLKNLVKLFFVFLKIGLFTFGGGFAMIPLMEKEIVRKHGWIE
FT                   KEKFIDAISITQSVPGAVAINLATFFGYNLAGIPGAIVAATGTALPSFVIVLIIAMGFS
FT                   KFNNNQVVKNMFKGIRPAVVGLIIYAGLDLARHIDWSKFLLCTFLMTVVAIIIFNINPV
FT                   SLILTAIVTGLLVYQRNTGRDDQEEAEATSFKIQES"
FT   gene            421645..422169
FT                   /locus_tag="Hore_04090"
FT   CDS_pept        421645..422169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_04090"
FT                   /product="Chromate transporter"
FT                   /note="PFAM: Chromate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_04090"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69167"
FT                   /db_xref="GOA:B8D1U0"
FT                   /db_xref="InterPro:IPR003370"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1U0"
FT                   /protein_id="ACL69167.1"
FT                   /translation="MYETLMALYYSFFKIGLFGFGGGYAMISLIQEELACNNWLNLDEF
FT                   LDIIAIAQMTPGPVSINSGTFVGYKISTATGSLIATLAVITPSFFMILLVARFFEKIKN
FT                   SQYISYILRYLRPTVIGLIIAAALKIGKNSVGDVASVLIVLSVILIMAKTKIHPVIVIM
FT                   LAGITGVIIYQ"
FT   gene            422377..422778
FT                   /locus_tag="Hore_04100"
FT   CDS_pept        422377..422778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_04100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_04100"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69168"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1U1"
FT                   /protein_id="ACL69168.1"
FT                   /translation="MGLLSIFNSLKNKIACFIGDNDCRNQDKIHLNLDGLSIYMERCFE
FT                   YDKPHEVSVFVPRAELRKRITRGDEVEEIEILLNSITVVHSPQRPSDEGGGPPPAPPEI
FT                   PGKSIKLKEFKGIKGKEINYYNKKTNAHR"
FT   gene            complement(422970..423842)
FT                   /locus_tag="Hore_04110"
FT   CDS_pept        complement(422970..423842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_04110"
FT                   /product="Pyridoxal kinase"
FT                   /EC_number="2.7.1.35"
FT                   /note="PFAM: Phosphomethylpyrimidine kinase; TIGRFAM:
FT                   pyridoxal kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_04110"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69169"
FT                   /db_xref="GOA:B8D1U2"
FT                   /db_xref="InterPro:IPR004625"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1U2"
FT                   /protein_id="ACL69169.1"
FT                   /translation="MQLPVPRVAAIHDLSGFGRASLTVIIPILSTLGIQVCPVPTAILS
FT                   THTGGFKDYKYIDLTEHLEDYINHWDKLNIKFDGIYSGFLGSPDQISIVSNFIEKFQGD
FT                   NQLIVIDPVMGDNGQTYGPMNGRMIQEMKGLICQADVITPNMTEAAFLLDENYPETISE
FT                   EKIKTYLVDLSQKGPRIVIITSVPFEGIKGKTSVVAYNRDDGRFWKVDCDYVPTHFPGT
FT                   GDAFTSVVVGSMLQGDSLPLALDRAVQFVSTAIRTTYGYNYANREGVMLERVLENLKAP
FT                   ALSHSYEIF"
FT   gene            424109..425044
FT                   /locus_tag="Hore_04120"
FT   CDS_pept        424109..425044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_04120"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_04120"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69170"
FT                   /db_xref="GOA:B8D1U3"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR040084"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1U3"
FT                   /protein_id="ACL69170.1"
FT                   /translation="MEIFGPIPSRRLGKSLGINIIPPKVCSYSCVYCQVGRTKKMCINP
FT                   VEVDDKEEIKENVRQKLDLLEQRGERVDYLTFIADGEPTLASNLAEIIKSVRDFNINTA
FT                   IITNSSTIDRPGVKESLKMVDWVSLKCDAYTEEVWHKINRPHGGLEPGKIKNGMIEFSR
FT                   DYSGKMVTETMLVKGINDSEEELKSIASFLNEIKPDVSYISIPTRPPAEEYAVSPTPES
FT                   INRAYNIFKSQGLTPELLIGYEGSGFASTGNIKEDILSITSVHPLKQEAIVALLKKADA
FT                   SWNEVNSLIEEGRITVVEYNGSKFYVRTIK"
FT   gene            425261..427855
FT                   /locus_tag="Hore_04130"
FT   CDS_pept        425261..427855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_04130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_04130"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69171"
FT                   /db_xref="GOA:B8D1U4"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1U4"
FT                   /protein_id="ACL69171.1"
FT                   /translation="MNFTYLDYHEDLFSKIISNDLPRIYVFDNTNNMLKAREYYKKPLL
FT                   QRGSIFITISDLKEKLFPTDRLILKEEKLAVIFYELLTEREKKELQISDYFDAIEFASE
FT                   FFNFFNELNEYGVKNIDNLRKWQEKKYNLFKTIRKRYRKRLEELNYTDRTLAFNFNNFC
FT                   SHFMEGYNELVFVNIVNFTPKEKRLLKLLQETGKEINLVLQLSPDDFDEESLRLKSVTL
FT                   PEELSSEIELYYTGERLTQMVNLISKMEAENGNITILDADYNNTCYHRLISPDKIDIDR
FT                   DLSFTETKIYRFLEVIYNLLKNADSTDGFLRVELNDLLEACYLQEFRDYFSINENAVKV
FT                   LQELAREEYAYFYPGFIKRYISLKRFGEVLEEIEKLRQIENINQLCNYLENLNLYFLND
FT                   REISNNITQYFDALLELNSLEEMGIVSSWDHYFKDKARGLFRMALNYLRYKKVKPVIDN
FT                   QNKGNKLDSLFSAPHLSRDILIVLNASRGVIPSEAGNDFILTDRQRAELGLETINNLRL
FT                   REKYYFYRHILNSQKTIIFSLKNLESNLTTSSFVDELRLKYGLDLKEAEITSRQLPAVI
FT                   RRIFPAKPAALGMVSSVSRKEDKLVIETDDFPGNQMSLSYYRYTTLIDCYYKFYLEKLV
FT                   RLAEDRVVVDREMSPLLFGNFVHEVFAEVLNRQGRNLNVSKEVVEEVIVDKLNSYRLQI
FT                   NNYYLPYYRKVLLPTVRDSVISFFRGLKRRVKGEIVDIKIEWQPEKSKDRVIFNHDFTD
FT                   VFLNGRVDLIIETSDTRFIIDFKTGQGKEDQLDFYSLLLAPDYGSEKKVAKELYNVMKA
FT                   SFKAGAPGTEEEFAREISEEIKNFFEGGEYTTIYKSRCKDCNWMDICRVVIE"
FT   gene            427852..430962
FT                   /locus_tag="Hore_04140"
FT   CDS_pept        427852..430962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_04140"
FT                   /product="UvrD/REP helicase"
FT                   /note="PFAM: UvrD/REP helicase; TIGRFAM: putative
FT                   glutamate--cysteine ligase/putative amino acid ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_04140"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69172"
FT                   /db_xref="GOA:B8D1U5"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1U5"
FT                   /protein_id="ACL69172.1"
FT                   /translation="MIKVLKASAGTGKTYRLSLEYVNSLLRGQSFDEIVVMTFTRKATA
FT                   EIRERIFEHIEDLLEHGMESKVYNSLKEIYHDISFNRDNLQKKYKAMLINKDKLHIYTI
FT                   DSFINRVFKQAIAPYLGVYKYEIVEDDKNTEIVEKVFKEILDNPDDFALMEKFLSDNPE
FT                   RKIKEYINLIKSMLNNRWKFLLIDHKPRKKRETGQLTPLLDECLNILESAARDKGKDFS
FT                   KDYFKKSFQGQMSQYLELETHEARKEFIIKNKDSFFKESFWNGNNLRGKAMAPFKEHLE
FT                   VKYREFLEKMAGYIYNEEMIPYEEEVFKFYSRIFEIYDRIKFKEKTFTHTDISNYTYKY
FT                   LREEALDLLDGKKVSDYFYELLGSEVTTLFIDEFQDTSILQWKILKPLIDRCRNVIAVG
FT                   DEKQSIYGWRGGEKELFSRLDKILDGESESLKVCYRSEKEIIKFINRFFTGLEIDWEYN
FT                   EVKHLPEKQEGFIEILLGGDSLKNRTNSKKFNNMSEEKQRQIIELNEKVTVNLKRKIVE
FT                   RIKNISDLSGVGILARSNDDLSDIATELDKKGIPYILESKDSLINHEAVKPLYFLLGYL
FT                   TYNDYLELIKFLRSDLVGLDNQGLKYLLRNRDRVEKFMRGRGVKLSNALLQKALSEIRR
FT                   LKALNYRELTNTLIQKSGLMDLFGDNSGALKNIYHFFKLMRQFSCLKDFMDYIEENKNS
FT                   DELKQVGVKEENAVKLMTIHKSKGLSFETEFFYWCPGKRKGGRSNRMEIYVRFDDNFEE
FT                   LEDYLLTHSRYTRYFEYLGFNFNKEQEEKELIEEINNVYVALTRPEKNLYLYIEGPRIF
FT                   EVDKPGQEWKGKKYSFYEKAILKGAGVNSLCDLIEGRRLGHFNSEEKDRGEENILLPDL
FT                   EPYFQPGDLPEELLDSFNDNKDLNMNLKMEIDRIEGLAIHYYLEHIQYNSQEERDYARK
FT                   MVLARYGNILGPVKTDEIFERVESFIKNNPGYFEDRWKVFTEYEIKDGNQVYRIDRLLV
FT                   DEGGKEIKIIDYKSGETREKTQLEKYKDLLEEKTGGEYSISVEFVEV"
FT   gene            complement(431108..432628)
FT                   /locus_tag="Hore_04150"
FT   CDS_pept        complement(431108..432628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_04150"
FT                   /product="Carboxypeptidase Taq"
FT                   /EC_number="3.4.17.19"
FT                   /note="PFAM: Carboxypeptidase Taq (M32) metallopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_04150"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69173"
FT                   /db_xref="GOA:B8D1U6"
FT                   /db_xref="InterPro:IPR001333"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1U6"
FT                   /protein_id="ACL69173.1"
FT                   /translation="MFNIKQSNTEKSFLEFVQKIKAYDSAQSLLYWDMVTGMPEKGVSK
FT                   RASIISLLSTEVFKMSTSDKMKEYLDNFSRQEVNKDLDPVMKGIVRECKKNYDRFKKIP
FT                   EDKYRDFVRLKSEAESIWKKAKQNDDFNLFRPYLEKIVDYLNEFIDIWGYEGNKYNTLL
FT                   DHYEPGVTVEKLDDIFTDLKASIVPLLKRVKDAQDKPDDSFLKEYYDPATQEKLCELLL
FT                   EEIGYDFKAGRLDESEHPFTIGINSGDVRVTTHYYPHNLTSALFSSLHEGGHAIYDQNI
FT                   DPELDETPLHDGASMGIHESQSRFWENIIGRSYNFWKSYYGKVRKLFPEQLNDISLDEF
FT                   YRAINKVEPSMIRVEADELTYNLHIMVRYEIEKALINRELEVAELPEVWNQKMKEYLGI
FT                   EPENDKEGVLQDVHWSNALFGYFPSYALGNIYAAQFYNTIKKEINNYDELISKGHFQPI
FT                   KEWLGDKIHKYGKLLTPTEIIKKVTGEEINSRYLIKYLENKYSKIYKL"
FT   gene            433564..436767
FT                   /locus_tag="Hore_04160"
FT   CDS_pept        433564..436767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_04160"
FT                   /product="beta-1,3-glucanase"
FT                   /EC_number="3.2.1.39"
FT                   /note="PFAM: Fibronectin type III domain; Glycosyl
FT                   hydrolase family 81; Fibronectin type III domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_04160"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69174"
FT                   /db_xref="GOA:B8D1U7"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR005200"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="InterPro:IPR040720"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1U7"
FT                   /protein_id="ACL69174.1"
FT                   /translation="MSKNKLLLFMMLMVLLLFTYTVSGAVPNEGVVSVGAGSYVDVFPS
FT                   GIDQSNPDNTDIQENIYITSNMEGRPIPTNDWWSSLVWEGVSDDGHYVQAAHPFLIKLE
FT                   ARGMRLFAPKTEDFWVIDNAYGATMAVGNSQDFVLGNSLSTTMEAYLHDFSDWFVTASM
FT                   EGGSASMKLTYGHGSPYVYAIYESGNPTLTFDTPPTIWYDNSYTKVIGFSIEGRNYAAF
FT                   APEGSTWSGIGTTTITCNLPGGSNYFSVAALPPGEPDTLLPLFEQYAYNHIINTEVVWE
FT                   YVESSSEVITSYNYTVTQYEGSETGTLFALYPHQWRNLQQGNLQNYSYTTARGEMKLAQ
FT                   GTSFTTSMKFPGVLSALPPLETQTDLDRLYSYVDSARNEPFTSTDTYYVGKRLGKLATI
FT                   IPIAEQVNHTTAASEFRNELRTRLENWFNATNDDGSAYVRDIFYYNNNWKTLIGFDASF
FT                   GSANQLNDHHFHYGYFIKGAAEIARTDRTWASESQYGEMVNLLIRDIACPDRNDPMFPF
FT                   LRNFDIYAGHSWASGHARFADGNNNESSSEAMNAWTALILWGEYTNSPEIKELGIYLYT
FT                   TEMHAIYEYWFNIYNENYPDTFSKPMTAMVWGCKQDYATWFSAAPEAIQGIVLLPIQAG
FT                   SLYLGHDPNYCQLYFDFLVDQRGSSDFAQWDAIFYAYEALFDPDQALQDFFTYENQLLN
FT                   STSGPTAATEEGNTVANTYHWIKNLQRLGRVDHSVVATNHALYAVFQQTDGTRTYVAYN
FT                   PTDNGKTVNFSDGGNLYVAPHSYGVSTDSPVINPPSSPVLNSAIAGDAQVTLDWNSVSG
FT                   ATGYKVYYGTASGEYNNVQTVSDITSYTVTGLTNDTTYYFVITATNSAGESGYSNELSA
FT                   TPQPELNNPPVEPNLNSATAGDGEVSLSWDSVSGVTGYNLHYGTSSGSYSVTIDVGNST
FT                   SYTVTGLNNNTTYYFAVTAYNDNGESGYSNELSATPQAESSDDHGAEYVSPTEALFWVD
FT                   DGGDPSTQDYGWVIVYIGPDPSTSLHEKPGYHMSYNSSLDRWEYTKADMHDNDGNPWEY
FT                   QFNFNDQELSEEYLYYHQP"
FT   gene            437298..440012
FT                   /locus_tag="Hore_04170"
FT   CDS_pept        437298..440012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_04170"
FT                   /product="Cellobiose phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_04170"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69175"
FT                   /db_xref="GOA:B8D1U8"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR010383"
FT                   /db_xref="InterPro:IPR033432"
FT                   /db_xref="InterPro:IPR037018"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1U8"
FT                   /protein_id="ACL69175.1"
FT                   /translation="MGWEFNNNKGTFSLKGADDNSYLYFPLTNESGIMSSITPTLNGDI
FT                   KTDQNSFLMQPVSVEDLHNNRSNRNFWLKIDGYGPWSVTGNSARQISMKYTGDKKIETA
FT                   DVEAGFLWHKVIRKNRKLNIKAEITNFVPVNEDQVELMKVTIVNTGQETIKFTPTAAIP
FT                   VYGRSADNLRDHRHVTSLLHRITTNSNGVIVTPTLSFDERGHQPNNTSYGVFGRCSDSS
FT                   DPVGFCPVLEDFIGEGGTLDWPRSIVEGNVDFVKPGFKYEGYESIGAIKFGDKELKAGE
FT                   SISYIIVMVIDHNGKDMKKYIDKYCSEKDFDRELNENKKYWQSTIEQLTFYTGDETFDN
FT                   WMKWVTLQPVLRRIYGCSFLPYHDYGRGGRGWRDLWQDCLALLLMDDKNVRYLLYNNFA
FT                   GVRIDGSNATIIGNKPGEFIADRNNITRLWIDHGAWPLQTTSLYINMSGDIKFLMEKQS
FT                   YFKDRIVSFAREIDNRWHQGMGNKLKTEEGQVYHGSILEHILLQNLTVFFNVGEHNNIR
FT                   LEDADWNDGLDMASEKGESVAFTAFYAGNLFEIVNLLETLRDKENVTEVKLLEEIKVLL
FT                   DTLYNPVDYNDVTAKNEVLNKYFASCKYNISGNQVTIKIDQLIKDIKRKANWLQEHLRE
FT                   NEYIGDNKGHKWFNGYYDNKGQRVEGRFEKETRMTLTGQVFTTMFGIATGEQVKNIISA
FT                   ADYYLYDDGVGGYRLNTDFKDKDIQLGRCFGFAYGHKENGAMFSHMSVMYANALYRRNF
FT                   VKEGFKVWHSIYNHCLDFDRSRIYPGIPEYISQRGRGMYSYLTGSASWLLLTFATEVFG
FT                   VKGYYGDLRLEPKLLKEQFDEEGKATIGIKFAGKRLTITYVNPQLLDYDSYKIDKVMVN
FT                   DEIIDYYEDKQVTIKREDIEERDEVIDITVRLA"
FT   gene            440197..442053
FT                   /locus_tag="Hore_04180"
FT   CDS_pept        440197..442053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_04180"
FT                   /product="beta-N-acetylhexosaminidase"
FT                   /EC_number="3.2.1.52"
FT                   /note="PFAM: Glycosyl hydrolase family 3 C terminal domain;
FT                   Glycosyl hydrolase family 3 N terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_04180"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69176"
FT                   /db_xref="GOA:B8D1U9"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR019800"
FT                   /db_xref="InterPro:IPR036881"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1U9"
FT                   /protein_id="ACL69176.1"
FT                   /translation="MKRLAGFSLLYMVLLICFIGGTVFASTELVENEEFKIIPDYMNPF
FT                   LSIEEKVDKLLSVMTLEEKIGQMTQAERRYITPDEVYQYKIGSILSGGGSTPFSNTPEA
FT                   WANMYDRFQKWAMKTRLKIPIIYGVDAVHGHNNLRGATIFPHNIGLGATRDPELVEKVG
FT                   RITAKEVSATGPDWNFGPCVAVARDERWGRTYESFGEHPELQKLLAGAYVRGLQGPEAE
FT                   MDGEYVVACAKHYVGDGGTEWGSGDGGYLIDRGDVTVDEKTLREIHLPGYIEAIEEGVG
FT                   TIMVSFNSYQGVKMHAHKYLITDVLKGELGFDGFVVSDWNGINEISGYSYYEKVVKSVN
FT                   AGIDMFMVPDSWKKFIYNLKQAVENGDVSEERINDAVRRILTVKFKAGLFEKPFTDRSH
FT                   ISLIGSEEHREVAREAVRKSLVLLKNENVLPLDKDSKIYVGGSNAEDIGSQCGGWTITW
FT                   QGRSGDITEGTTVLEGIEAAIAGRGQVVNDLNQADVAVIVVGEDPYAEGRGDNGRLELK
FT                   QEDISLLEKVTGAGKPVVVVMISGRPLIISDYIDDWDAFVMAWLPGTEGQGIADVLFGD
FT                   YNFTGRLPVSWPEDVSQLPINYGDDDYDPLFEYGTGLKMDLE"
FT   gene            442073..443410
FT                   /locus_tag="Hore_04190"
FT   CDS_pept        442073..443410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_04190"
FT                   /product="glycoside hydrolase family 30"
FT                   /note="PFAM: O-Glycosyl hydrolase family 30"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_04190"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69177"
FT                   /db_xref="GOA:B8D1V0"
FT                   /db_xref="InterPro:IPR001139"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR033452"
FT                   /db_xref="InterPro:IPR033453"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1V0"
FT                   /protein_id="ACL69177.1"
FT                   /translation="MNSISVILTARDTGDRLSLKGEKVFKSGIGRQDIDLELYPDTRYQ
FT                   KIIGFGGAFTEAAAYTLSKISSDKRLKIIESYFDRDKGLGYNMGRVHINSCDFALENYT
FT                   YVEDGDRELKTFDISRERQWVIPLIRDAIKARGGEIKLLASPWSPPAWMKSNENMNYGG
FT                   KLLPEYRDVWAKYYTKYIKAFQEEGLNIWGITVQNEPAAVQTWDSCTYTAEEERDFVKN
FT                   HLGPVMHEEGLGDINILIWDHNRDIIVDRVKPILDDLEAAKYVWGTAFHWYVSEDFDNV
FT                   GQVHEMYPDKHLLFTEGCQEGGCQIGEWFTGERYGRNIIGDLNNWTEGYLDWNMVLNEE
FT                   GGPNHVGNYCDAPVIVDTNTEEIYYNSSYYYIGHFSKYIRPGAVRIGVSCTNDNLKATS
FT                   FLNSDGSIILIVMNETDNPTDFAVSLDNKVADLTLPAHAIATYIIT"
FT   gene            443671..444696
FT                   /locus_tag="Hore_04200"
FT   CDS_pept        443671..444696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_04200"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: Periplasmic binding proteins and sugar binding
FT                   domain of the LacI family; Bacterial regulatory proteins,
FT                   lacI family"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_04200"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69178"
FT                   /db_xref="GOA:B8D1V1"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1V1"
FT                   /protein_id="ACL69178.1"
FT                   /translation="MATIKDIAKIAGVSTATVSRVINNYPDVSEKTKKKILKIMKENNY
FT                   RPNSVARSLSTSKSNIIGIFFTDHFNTGIHHPFFREVIYGLEKIFDEKGYDILYFTNRK
FT                   WGENFSYVEKCHDRQVDGVVLMGVPKTDSNIPKLLDSDIPTVFVDLDIVGKKASYVISD
FT                   NYRGAEMAVNYLHSLGHTRIGMIMGISSTKVTNDRLLGYQTAIKNLGLVYNSQWILDGR
FT                   YTEEGGYQAMSKYLEMDERPTAIFCQSDSMAIGAMQAIHEAGMSVPEDFSLIGFDDIEV
FT                   SRYVNPALTTIKQDKIGLGRAAGELLINIVENENESQAPVILPVELVKRDSCGRPNLDM
FT                   V"
FT   gene            445222..446067
FT                   /locus_tag="Hore_04210"
FT   CDS_pept        445222..446067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_04210"
FT                   /product="glycoside hydrolase family 16"
FT                   /note="PFAM: Glycosyl hydrolases family 16"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_04210"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69179"
FT                   /db_xref="GOA:B8D1V2"
FT                   /db_xref="InterPro:IPR000757"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1V2"
FT                   /protein_id="ACL69179.1"
FT                   /translation="MFLFCLVLLLVVVLSGCSDLFGTVPEDMNKDINEDTNGWTLVWSE
FT                   EFDQDEIDLSTWNFEIGNGHAEGIPGWGNNELEYYTAGDNAEIIDGKLVITARKENRRD
FT                   EYGTYNYTSSRMTTEGKYEVEYGKIEVRAKLPEGQGIWPAIWMLGNDIGEVGWPACGEI
FT                   DIMELLGHQPSIVYGTVHMPGTSKGSSYSLSSGKFSDAFHVFAIEWDKDKIEWYVDGQL
FT                   YHVFNKNEIPDSSWVFDHPFFLILNIAVGGNWPGYPDETTIFPQTMEVDYIRVYENIKP
FT                   "
FT   gene            446205..448079
FT                   /locus_tag="Hore_04220"
FT   CDS_pept        446205..448079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_04220"
FT                   /product="Autotransporter beta-domain protein"
FT                   /note="PFAM: Autotransporter beta-domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_04220"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69180"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1V3"
FT                   /protein_id="ACL69180.1"
FT                   /translation="MKKFPVLLSLVLVLLLALPAFAVTNVEFSGNANFNFWEFYEVDGK
FT                   ANYSMNGIPGAVFGIGDYKQSTSDNKDDNRERLEMGLNLNMNVKVDNIVNIDANFVGLH
FT                   EEMNMDYNGTDETYSQDQTTPKDNAVLRLGDLTITATPEFGEIIITNNFNYNFNNKVLA
FT                   AQFRDNWGDMSPYGEGILIKKDIAGISTQSFLYKTEINSNDREQVDFWNPNLEVQQMVY
FT                   GVDLKKNISLGKVGALLVRTHDERADEAGSYFGKDLDNTHIALTGELYPNNMVKINGEF
FT                   ITAIYGDDVDTIYNTVPYGWIPEPQEFDLSAPGAKEDTNVIEVGATITPIAGLQLTGTY
FT                   KDVGEDYIAVQGNSHARQSWFGDESFGPDQRFDYVDGCGYEKGFKLDGSYMLPVNLAPQ
FT                   ITGMFTQYEETRSALNDAADNSVTIARVETNVSGALWKADTSYRWRNNKAATENNGILF
FT                   NEFNVNGSYTVLDDGITKVGLTGEVNYYTGSDEEVEDNKNFANEIRVRAGVNGSYKLNN
FT                   RVDLTASYDFGIAREDSDLLTGSAMQNLFKAGLSYKVSQNTTFTIGYQFDAYQLNDIND
FT                   PDDDFVTAMSKREAHHIWYDGAESWQPRNPDYEGYTTHSVKASYNITF"
FT   gene            448226..450055
FT                   /locus_tag="Hore_04230"
FT   CDS_pept        448226..450055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_04230"
FT                   /product="Cna B domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_04230"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69181"
FT                   /db_xref="GOA:B8D1V4"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="InterPro:IPR015567"
FT                   /db_xref="InterPro:IPR041443"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1V4"
FT                   /protein_id="ACL69181.1"
FT                   /translation="MKKLSILAILLVGLLVLAGCSKDANDVNSAVKHTLTVTVTDEATQ
FT                   AAIEGATVTVDEASKTTDANGVAQFELTDGTYDITVTAEGYESKSGSVTIDGKDSTLDV
FT                   TLTAGTGGSTDFVLITSNSGEETDIYVDWDYDNNIGNIAADAWGSGTTITQDSSYNNTP
FT                   CWELTTGDGWGTVLAFMGDIYNVDQIAEFPVDLTADSVISFSVATTGDYDELRVKVVGE
FT                   ENEKEIAIDSFDNTSTDWQTVQVTTDQFSEVVPANVTQIAIIAFGGTAGTSKVYVTDYT
FT                   ISNAEVVIPKPQPETYTLTVTVTDDSQVAIEGATVTVNGTSKTTDASGVATFDLPDGTY
FT                   TVNVSADGYANGSGSVTIDGADKSVDVSLTSLEVTSTLTVNVKNAVSGAVIEGAAVTVD
FT                   GTEIVTDANGVAQFDLVDGDYTINVSANGYNTVSQDVTIAGADKTVDISLTTDAPSLFN
FT                   SSFTVFNEAPITALQASYEVSTTEITEGDSSIKVTYPGDNWGGIYVEISTPVDLSSYDG
FT                   GNLVFDIKLPTTIKDIGVKLEGPKGTGVQVQLANYTGTDAGNGWMTYTIPLSDLGIDLT
FT                   QVAVGFGLWNPTDGTALDAWAGGDVYIDNVRFE"
FT   gene            450354..454226
FT                   /locus_tag="Hore_04240"
FT   CDS_pept        450354..454226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_04240"
FT                   /product="Glucan endo-1,3-beta-D-glucosidase"
FT                   /EC_number="3.2.1.39"
FT                   /note="PFAM: Carbohydrate binding domain; Glycosyl
FT                   hydrolases family 16; Carbohydrate binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_04240"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69182"
FT                   /db_xref="GOA:B8D1V5"
FT                   /db_xref="InterPro:IPR000757"
FT                   /db_xref="InterPro:IPR003305"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1V5"
FT                   /protein_id="ACL69182.1"
FT                   /translation="MKIRQNKVWLVATLGLIMLLVLAGCKSGVSEGTSSLLVNVQDGNS
FT                   QTEIKVLDDSGEVASKTGKTAKFELSNGVYKVEVGNKIFDVYLTGDTTLDVILGEDENL
FT                   IGSGFFNEPLSNKKIAGDGYVDTEGNWVAYLNTGGGGRATVKNGRVIYQVTNAGSQPYS
FT                   VQLIQAPVKIEKGAKYKVSFDAKAADGKTIAIKVGAIADRAWEAYAQQNIKLTGNWESY
FT                   EFEFTMMAETNEMARFEFWFIDTGIYELDNIKLVKVEENAISTEGTKTEADEDLVEDWE
FT                   LVWSDEFDEIREDVWTFEVGNGHKQGIPGWGNNELQYYTDGDNAHIKDGKLVITAKEEE
FT                   ISDSHGSYNYTSTRMITKGKFSMKYGRVEVRAKMPEGKGIWPAIWMLGTDIDENPWPAC
FT                   GEIDIAEVIGNTPNIVHGTIHGPISTYTGISAGYILPDGKKFSDDFHIFALEWDEDELE
FT                   FYVDDVLYHVVNKDEVGGQEWVYDKPLFFILNVAVGGNLPGYPDGTTEFPQTMEVDYIR
FT                   VYEDKDPASIDGEERWDSEYELKWREMKEKEESSKEKKNADLTINRVVNGAFDSEIVND
FT                   VEAHRDNWYVLIEEGGEVNSFGVENGEFIMDIANPGSKASNVQFAQCLKLEPGSIYKVS
FT                   FDARAEDARDINVKMLHPTKHTVYGEETIGLNPTMESYSLEVEFPGNVSEVVNLSFELG
FT                   ALSDQSKATRVYLDNVKIEKIRGVNYTEYGNCLLDNGELLFGNPDYHAISYSGYRKNVR
FT                   RESTVPTVEQIKDDMKILEAMGVKLLRTYNTNEFSQSEKILKAISELKEEDPDFEMYVM
FT                   LGAWISCEGAYTDSVNHNVEDEDKNKGEIDKAIELAAKYPQIVKAIAVGNEAMVRWQAH
FT                   YVPAEVILKWVNYLREARENGDIPGETLITSSDNFAAWGGEGSYRSKTLKDLVKAVDFV
FT                   SLHTYPFHDTHYVSKFWKTPEENKDLSDKEKIDNAMKRAFERAKNQYQLVKEYVRSIDP
FT                   EKPIHIGETGWASVSTDLYGSGGSRAADEYKQKQYYDQIREWSDACNISVFFFEGFDEP
FT                   WKGSNNPGHSEKHFGLFTVDGKAKYVLWDLVDKGIFDGLTRDGNPVKKTYNGDESALME
FT                   DVLTPPLAQNHTAGAAVTEDTYVVLDTKKNTETNSYLAIPAIVNPWEGTCGMGLTDDGI
FT                   VEITTGTGNWWGCGLEIREGVNLSNFANGHLHFDIKGDTSSSFNIGFQTGVYGSSERPQ
FT                   TNNYVTFGPGRSYQLTRNWKSYSIPVSELMKGADLTDVTSLLYLMGDANFDGRKIYVKN
FT                   VYYTQD"
FT   gene            454473..455486
FT                   /locus_tag="Hore_04250"
FT   CDS_pept        454473..455486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_04250"
FT                   /product="transcriptional regulator, LacI family"
FT                   /EC_number="5.1.1.1"
FT                   /note="PFAM: Periplasmic binding proteins and sugar binding
FT                   domain of the LacI family; Bacterial regulatory proteins,
FT                   lacI family"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_04250"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69183"
FT                   /db_xref="GOA:B8D1V6"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1V6"
FT                   /protein_id="ACL69183.1"
FT                   /translation="MVTIKDIARIAGVSTATVSRVINNYPQVNEKTKKKVLEVMKENNY
FT                   RPNSVARSLSTSRSYTIGIFFTDHFDTGLRHPFFREVIYGLEKIFGQKGYDILYFTKRN
FT                   WDDKCSYVDKCRDRHVDGVVLMGVSREDTNLPQLLDSGIPTVFIDVDIIGKRASYVTLN
FT                   NTDGAKMAVNYLYSLGHTKIGMIMGISSTKIAHDRFLGYQMALKDLSLSYNPDWVLNGL
FT                   FSEEGGYRAMNKFLKMIDRPTAIFCQSDTMAIGAMKAIKEAKMNVPGDFSIIGFDDIEI
FT                   SKYVKPALTTIRQDKVKLGRAAGKLLLNIINNDLDGYKPVILPVKLIKRKSCAKLR"
FT   gene            455631..458870
FT                   /locus_tag="Hore_04260"
FT   CDS_pept        455631..458870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_04260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_04260"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69184"
FT                   /db_xref="GOA:B8D1V7"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1V7"
FT                   /protein_id="ACL69184.1"
FT                   /translation="MKISNNGSFVISNYQQQKTFASFLPGIAGEMGVPVWAFYVNRGQG
FT                   IAGFGIKDKDHAIMEFNPSNKAYQVTPLKGFRTFIKFINSNNIYEPFTGSSEKVKTKMI
FT                   IEPHALVIKEVNKELGLEVKVKYFILPGETFGALVRRVYIKNISENPFELEVLDGLPEI
FT                   IPEGISHLALKEVSQTMSAWCRVYNLEHKMPFFRLRATADDTPEVRKMESGHFYLSYHS
FT                   NENGINLLKPLVDPEVIFDQDKSFIKPVNFYHSSLLNYQGRQLLENRYPSAMAAAVCVL
FT                   KPGEEEVINSFYGHTGNQNNLNSIKERVLKPGYIDSKERENIALHNYYLDKILTVSNYS
FT                   EFDQYCRQTFLDNILRGGFPHQIGGHVYHLFSRKHGDLERDYNFFQLEPNYYSQGNGNY
FT                   RDVNQNRRCDNFFNPEVQETNIKLFANLIQPDGYNPLVIKGLVFKLNKEDRADILKLVS
FT                   NKKNILEKKLNEEFTPGNLANFIINHHIELSVPVDEFINRLMEKAESRISAEHGEGFWV
FT                   DHWTYLLDLIENYLAVYPEKSGELLVNDNTYTYYDNFVRVQPRDKKYVLSDLGPRQFGA
FT                   VVADEEKQKEIKEREFNQDQVRTGYGRGDILYTNLLVKLLTIVTNKISSLDPEGTGVEM
FT                   EANKPGWYDALNGLPGIFGSSTPETMELYRLVNYLLDKIKDVQSSGKHLSIELPEEIYE
FT                   FINGLKQELETWQREKDDFLYWDKTAELKEKYRDKVFKGFSGKLINMQIEEIINFLEMS
FT                   QEKLLTAIEKAYNPDTGLYNTYYYYLPEEYDRTGEYSPEGYPCIRVKSFKQHVLPPFLE
FT                   GQVRAMKIMGDKEKALQLHRSVCQSELYDKKLKMFRLNGDLSEMPDDIGRARAFSPGWL
FT                   ENGSIWLHMEYKYLLELIKGGLYDEFYQAMKDALIPFLDPVMYGRSILENSSFIMSSLN
FT                   PDTENHGRGYIARLSGSTAEFIHIWSLLAFGPQPFVYRNGILSFNPEPILDSDMFTREE
FT                   KEISFQLTKSRKMTITIPENSFAFRLMGHTLAIYHNPGRKRTFGDNRARVKKFVLSING
FT                   EEVLVQGNELKEEYAEKLRNNEVDRLDMYLE"
FT   gene            458982..460238
FT                   /locus_tag="Hore_04270"
FT   CDS_pept        458982..460238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_04270"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: Bacterial extracellular solute-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_04270"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69185"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1V8"
FT                   /protein_id="ACL69185.1"
FT                   /translation="MKKFAVIAVVALLVVSMFSLSIAAKTKIKVACFPDQDSGFEAILD
FT                   QFHAEHPDIEVELVVNGFADHHNTLLTQIAAGAEVPDVAMIEIGYIANFVSKGGFVNLL
FT                   EEPYNAGQFKENIVPYKWAQGSTDDGRLIAFPTDIAPGTIYYRRDKLAELGYEIEDMKT
FT                   LEDWIEAGSQFAKDLDGDGVNDRWLLADATDIFFMIAKSGEELYFNEDGECIVDSPRFI
FT                   KAFKAAKMVRDMGLDARIGAWTNEWYSTFKDGTVLMQPSGAWLGGHIRNWIAPDTAGKW
FT                   GVTNLPDGMYCNWGGSFAAIPEKAEHKEEAWEFIKFIATRKDTQIAQFKASNIFPAWMP
FT                   AFDDPVFQEEMEFYGGQKARLLWLEAAKKIPNVVTNKYDVIAEEIVTAALTDVLNNDAD
FT                   PVEALREAKRMIERRMRRR"
FT   gene            460290..461198
FT                   /locus_tag="Hore_04280"
FT   CDS_pept        460290..461198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_04280"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: Binding-protein-dependent transport system
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_04280"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69186"
FT                   /db_xref="GOA:B8D1V9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1V9"
FT                   /protein_id="ACL69186.1"
FT                   /translation="MRLSKKVAPYVFISPFYILFFIFGAFPILYSFFLSFHIWDGISPK
FT                   EFVGLENYLFVLTDPWFWQSVWNTLVIFVLTTIPQHVIALFLAFILNSKLVKFKALFRS
FT                   SYFLPYITSSVAVAMIFGMLYGEHYGILNAILKYVANFPPIGALFESIGLNLPVRWLGE
FT                   AAWIKPSIALLVTWQFTGWNLIIYYAGLKNIPHNLYEAARVDGANMRQIFFKITLPMLR
FT                   PVIFFGITLSIIGNLQLFEQPFILTGGTGGTGRAGLTTALYLYRTGFNWNMFGTGSAMA
FT                   YILCIFIIILSLINMKIFQKR"
FT   gene            461211..462104
FT                   /locus_tag="Hore_04290"
FT   CDS_pept        461211..462104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_04290"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: Binding-protein-dependent transport system
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_04290"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69187"
FT                   /db_xref="GOA:B8D1W0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1W0"
FT                   /protein_id="ACL69187.1"
FT                   /translation="MELQLNKKENITKENVTIDKKQKDWVKVLKKALLYFILIFGVLIT
FT                   FFPFYYMIVLATRSVEEIFNFPPPLWFGNAAQENIQILLDKLPFFQNIFNSIIVATLAT
FT                   LLVLFFCSLGGYGFAKYNFRGKEKLFFLMLASMMIPPLLSIIPWFIMMKAFGWINSFKP
FT                   LIIPGAANAFGIFLMRQFMEEIPDEIIDAARIDGAGEFEIYYKIALPLSKPGMATLGIL
FT                   TFLGSWNNFMGPLLVLQEKTKYTIPVALSKLNGNFETPWGATMMGTALGVFPIVLAFVL
FT                   ASKYFISGLTTGATKG"
FT   gene            462110..462217
FT                   /locus_tag="Hore_04300"
FT   CDS_pept        462110..462217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_04300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_04300"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69188"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1W1"
FT                   /protein_id="ACL69188.1"
FT                   /translation="MVGQVGRNNGFVIKVGKKGGPGGGLPIQVSSLKGG"
FT   gene            462221..464290
FT                   /locus_tag="Hore_04310"
FT   CDS_pept        462221..464290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_04310"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: Methyl-accepting chemotaxis protein (MCP)
FT                   signaling domain; HAMP domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_04310"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69189"
FT                   /db_xref="GOA:B8D1W2"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1W2"
FT                   /protein_id="ACL69189.1"
FT                   /translation="MFSFLKIITKPFLYLVRLVKSLDRFVIKILGRLKIGKRIMLFILL
FT                   MIITIVGISSYQIYNSYLNTLENNEREKLQQDLRVISNQLEQRKIEVSSIAGSLAKMPL
FT                   ARKIIYDMEYDKTYWEYIMGQLQVDGIEIRDFDFESVARVGNVGVDFEKNNELKQKIVD
FT                   LILSGVDVTFFTHNDKYIQVNAVSSVIDEFRIPGLGGIMVSKFLGSEFIKLLPFNDEYG
FT                   VQLYYNQKLIDSNQIGSNFNDVALITSDIENTFNSGSDSYLICKREINGEIYSVGYLPI
FT                   KNFFGKPIGYIVLIQSRAGVVGKINDMFRQIIINSLVIIGISSLFVLLITQSITHPLNK
FT                   VIGGARQVSQGDLRVTIEADSKDQFLVLSDNFNQMVANLKNVVSSLLYSSDNVYKMSQN
FT                   LSASVQEVSATSEEVAATSEKIALGAEEQATKTKETEKLLDNIKKGAEDVSESSAKIVE
FT                   VVDNVQKQSIDGLDVIKKARNHMGKTLEELDLTNEVIDNLRDSIDQINTIIEAINYINE
FT                   ETTLLSFNAAIEAARAGEAGRGFAIVAEEIRSLANRSNESLDNIISIFRQIKDAMQQVE
FT                   DAMDKSRNNIKSSDQNVVDVYKALEEMQNVVEEAKNVSIEIAKQARSQLKGTEDIDKVV
FT                   GEITDIAEDNLSGSRQAAQMNLEQSKVIEEVAEAADDLADMAESLQNMIKKFKL"
FT   gene            465251..466630
FT                   /locus_tag="Hore_04320"
FT   CDS_pept        465251..466630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_04320"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_04320"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69190"
FT                   /db_xref="GOA:B8D1W3"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1W3"
FT                   /protein_id="ACL69190.1"
FT                   /translation="MSQTFITDKMKENLDKYIIFNEDVVDIIFRYPDRVLVYNHDTSGL
FT                   SRFMGFGLDILYDDSLDILLNNPDKLLGEYKPEFITKYIEYYYFKNWICFSDTPKTEYK
FT                   IRFLGSKDYYIPGHLAIELTDKCNLACKHCYRDSTKKGKLMDTQKLFSLIDMLTEKGLI
FT                   IVELTGGEITLHPDFCEIVDYLAQKLDIIALLTNGYEYNQEIIECILRNKDKVMVNVSL
FT                   DSYDQEFHDNFRGKKGAWERAYNLVKTLASNEVPTRIAMAITPENLFHIEKTILLAKEL
FT                   GIKNFAWDQVSQFGRGSSIDWSKVTPEEYFEYEKQSKYLFKKYYDMLTLIPAKITRQMK
FT                   VEGLNCGAGWRTFALDPDGNLRLCVNSELDLFKIGNVFEEGMSIFKKELLQEFAKVSMP
FT                   RYRTCKNCNYFSFCDSCTLKGLIGAKNNKNCVWDGKKLARKVRTRQTINISCLSKKTIS
FT                   K"
FT   gene            466662..467672
FT                   /locus_tag="Hore_04330"
FT   CDS_pept        466662..467672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_04330"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_04330"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69191"
FT                   /db_xref="GOA:B8D1W4"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1W4"
FT                   /protein_id="ACL69191.1"
FT                   /translation="MIKESLSTVTLNVTSKCNYNCSYCASCNKEDLLELKDIKMIIDNT
FT                   VKLKTQYLILSGGEPTLRNDYQDIIDYANKNGLITVLFSNGSQIDNVAADYIKENINIV
FT                   RFTLDSTKEEKYDKIKGRGTFANLIKTIDMFNDKKIPVNLNIPVNYDNIEEIEDIILFS
FT                   IDKGIQTLRFAPIIPSADKHIYKTLLTSIFENIIKYEPFFAFPDFKPVGSRDTFINAVS
FT                   NIDCPGGIISININSNGEVTVCSFFDEVTEGNLKEEDLFDIWFNNYEKNLNQKCKVIDV
FT                   DIGELLSEVLTDKMWGYSAVRKAISFWYTEIAGKEKMCYRGFPFWQLYFSRKPGE"
FT   gene            467674..468381
FT                   /locus_tag="Hore_04340"
FT   CDS_pept        467674..468381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_04340"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_04340"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69192"
FT                   /db_xref="GOA:B8D1W5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1W5"
FT                   /protein_id="ACL69192.1"
FT                   /translation="MANIIEIKNLKKIINNKLILKGVSLNIPQGSIFGLIGPNGAGKTT
FT                   LIRHLLGLYKPTEGQILIMSNSERHIKNKIGFMLHATGLYPVLTCYQNLDLYATIYNLN
FT                   NSEKKINNILKTVGLLNRKNDRVAELSKGMKQKLVLARALLHEPEILILDEPTVGLEIE
FT                   MKVWFRNFIKTFVDDKLRTVIISSHELSELEKICTHVAIIRDGMIVKQYRKNELPTDVS
FT                   LEDLYLKSGGEMS"
FT   gene            468378..469064
FT                   /locus_tag="Hore_04350"
FT   CDS_pept        468378..469064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_04350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_04350"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69193"
FT                   /db_xref="GOA:B8D1W6"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1W6"
FT                   /protein_id="ACL69193.1"
FT                   /translation="MSILTKEFRLLYGNKVFLLCFLFFTLIYSAIGYGARYVYEEVVND
FT                   LNVVYYFIFVYSMSLTLLMLQVYPASNDIREQAYGGVENILATGYPLSKLILHKMLPIF
FT                   SALYLPSSIMVVIIIIWSKLYLAGLVALLCILPVINAGLSLIYTCTVLLSPIPGMVMNQ
FT                   ISFYAVAGIFLLSYGPVLIYRTTGYVVGIKVSILLSFVFSLLVGFRAYRKFKKTDKETI
FT                   IIRGDY"
FT   gene            469064..469723
FT                   /locus_tag="Hore_04360"
FT   CDS_pept        469064..469723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_04360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_04360"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69194"
FT                   /db_xref="GOA:B8D1W7"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1W7"
FT                   /protein_id="ACL69194.1"
FT                   /translation="MILEITNYLTRYEKYEPVNQHIDKRLVNTFSIILPIVLFIILKKL
FT                   NLVLSFNAILLYLYVNIFVRVNTLALRVISKKYGGIYENLLATGMGRKHLIIIETLIYI
FT                   KQNWVKIILFNSSITLGYYLINLKLMSVYNLLVFLLIANIISIILHLIVGAITVINGMV
FT                   NNSLAQLITLIGWGSGLVLFLSKHIIIKITVPLVVICLLGGYSVINILIKEDYEVI"
FT   gene            470161..471018
FT                   /locus_tag="Hore_04370"
FT   CDS_pept        470161..471018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_04370"
FT                   /product="degV family protein"
FT                   /note="PFAM: Uncharacterized protein, DegV family COG1307;
FT                   TIGRFAM: degV family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_04370"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69195"
FT                   /db_xref="GOA:B8D1W8"
FT                   /db_xref="InterPro:IPR003797"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1W8"
FT                   /protein_id="ACL69195.1"
FT                   /translation="MSTKIIVDSACDLPDEILDKYEIEVLPFNIHIDNQCYKDGIDIEV
FT                   EELYAAMKEGKVPKTSQVSPEDFKRAFSRNAEAGNDCIYISFSAKLSGANQTGQLVAKE
FT                   IRDKYKDVNIDIVDSKAGSVATGIIAYKAALLLEKGVSREKVIEKIKYWADHIEHIFML
FT                   DDLKPLVRGGRISKTKFFVGNILNIKPILCVKNGKIELLKKVRGTGRAISKMINYVKEK
FT                   SYDLTEQLIGIAHADDLVQAEVLKEKIEELGGKIFCVEKIGSVLGVHLGIGGIGVFFLN
FT                   EAEA"
FT   gene            471290..471508
FT                   /locus_tag="Hore_04380"
FT   CDS_pept        471290..471508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_04380"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: Bacterial regulatory proteins, tetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_04380"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69196"
FT                   /db_xref="GOA:B8D1W9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1W9"
FT                   /protein_id="ACL69196.1"
FT                   /translation="MPKIIKDIEERIFNAALKLFAERGYNKVNMKMVAKEAGIAVGTLY
FT                   NYFPNKLGLFLSVLETNFKKPLKSLTN"
FT   gene            471508..471849
FT                   /locus_tag="Hore_04390"
FT   CDS_pept        471508..471849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_04390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_04390"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69197"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1X0"
FT                   /protein_id="ACL69197.1"
FT                   /translation="MENPDNTIYDLIEILYDESSKLKEMGKEIIRTNILGKQENETIEN
FT                   IKNRLVKMLEEFLMQLKKERKLKISKSREKRLIHLLLLSIIDFSKEFPCEREENISFIN
FT                   EIFWSLAGQ"
FT   gene            471931..472512
FT                   /locus_tag="Hore_04400"
FT   CDS_pept        471931..472512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_04400"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_04400"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69198"
FT                   /db_xref="GOA:B8D1X1"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1X1"
FT                   /protein_id="ACL69198.1"
FT                   /translation="MKHKLAKCISYFTVVPVFAFFTLLLLYYQNLITTRYWLLVGVLFL
FT                   TVLPLLAYLFKFFIPSIRNEGREGERRLAFYFGLGSYIIGTFFVSFSPSPVVIKVLFFT
FT                   YLVSALVLTFINMFLNFRASGHACGVAGPVTILISFLGSSVWMFLLLIPVTFWSRLTLN
FT                   RHSLKELISGALVGSCSTIFVIFFYLFLRG"
FT   gene            472591..473943
FT                   /locus_tag="Hore_04410"
FT   CDS_pept        472591..473943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_04410"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_04410"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69199"
FT                   /db_xref="GOA:B8D1X2"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017200"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1X2"
FT                   /protein_id="ACL69199.1"
FT                   /translation="MGIDFSFAKKFAVEKALKQAMKYVEKDPEKNFLKILDLGEKLVRR
FT                   DNHKRGIKIFRENYKKNPVIKEYVRKLNHIAPSYKYGLLMNFFVNAGLLGIPYQYEMAE
FT                   KLGVKVPWTILIDPTSACNLSCEGCWAGKYEKGNSLDFDTIDRIINEAKELGIYFIVLS
FT                   GGEPTVYPHLFDIFEKHQDVGFMMYTNGTLIDDDFADRLLETGNVTPVISLEGFRESTD
FT                   RRRGEGTYDKIMSAMDRLHERGIIFGASVTVTRNNVDELFGDEFIDLMIEKGVIYMWSF
FT                   HYVPIGRNPNLDLMLTPGQRARLADRVNHLRNTKPLFVADFWNDGTYTQGCIAGGKRYF
FT                   HINSKGEVEPCAFVHFAIDNIKDKPLKQVLQNPLFKSYQKRQPFNENLMCPCPIIDNPQ
FT                   ALRDIVEESGAYPTHEGADSILKGDLAKRLDEISSRWQEVSKPINEKRIKG"
FT   gene            474284..475588
FT                   /locus_tag="Hore_04420"
FT   CDS_pept        474284..475588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_04420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_04420"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69200"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1X3"
FT                   /protein_id="ACL69200.1"
FT                   /translation="MSTRRLTKNDKAWNQIFSEYNILQKIREEEFYKIESKLINKYRQS
FT                   RLMTKFDHTANLPAVFKHNNLRILPISRSSYIIGKFSNYKKVVYQGIDSPEAVRFPSYI
FT                   KSIDYNNLFSESSVLHCAYLCGMIDELIGEKTYPTVSGRMTTDNFSFRVKSIENKTYYN
FT                   LSVNKSQVEIDGGYESKNYLVIIEAKNTEVEDFIIRQLYYPYRVWQNKLNKEVIPVFLT
FT                   YSNNTFSFFVYRFEDIKNYNSLKLVKQKHYIINPRKITLDDVKYVFEKTEVIDEPEVPF
FT                   PQADKFTRIIDLLTILMNTEMSKDDITENYQFDVRQTDYYTNAAIYLGLVKKIKDGKLI
FT                   KYTLTGKARRIMILPYKEKNMALTACILEHEVFNRCFKVYLNHGKLPSIESIVEIMLDS
FT                   YIYNVSSMRTYKRRAQTVRKWLEWIINLTQKKIKS"
FT   gene            complement(475626..476546)
FT                   /locus_tag="Hore_04430"
FT   CDS_pept        complement(475626..476546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_04430"
FT                   /product="DNA adenine methylase"
FT                   /EC_number="2.1.1.72"
FT                   /note="PFAM: D12 class N6 adenine-specific DNA
FT                   methyltransferase; TIGRFAM: DNA adenine methylase (dam)"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_04430"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69201"
FT                   /db_xref="GOA:B8D1X4"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR012263"
FT                   /db_xref="InterPro:IPR012327"
FT                   /db_xref="InterPro:IPR023095"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1X4"
FT                   /protein_id="ACL69201.1"
FT                   /translation="MNLPCEANTTRKTTKYAKPFVKWAGGKRQLIPDLFNSLPDNIERY
FT                   FEPFVGAGALFFELANNNVISGRKSIIVDLNDDLINAYKVIKNSVESLINELKKHEKNN
FT                   NEIYYYKVRGLWTRKARELGLSRKELWSVNELNNIQKAARFIYLNKTCYNGLYRLNNKG
FT                   QFNVPYGNYKNPRICDEDNLRTVSQLLQNVTIIKNDFEIIKDKYRFTPADFVYFDPPYV
FT                   PLSDTSNFTSYTKNGFTKEDQERLYELFNYIDMQGGKCMLSNSNSPLIKKLYSKFNIKE
FT                   VKAIRAINCIGNKRGAIKELIITNY"
FT   gene            477040..478527
FT                   /locus_tag="Hore_04440"
FT   CDS_pept        477040..478527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_04440"
FT                   /product="type I restriction-modification system, M
FT                   subunit"
FT                   /note="PFAM: N-6 DNA Methylase; TIGRFAM: type I restriction
FT                   system adenine methylase (hsdM)"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_04440"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69202"
FT                   /db_xref="GOA:B8D1X5"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR022749"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038333"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1X5"
FT                   /protein_id="ACL69202.1"
FT                   /translation="MSQETLTLDKLESHLWESANILRGSIDSSDYKNYIFGMLFLKRIS
FT                   DVFDEECEKMKAEGKEAFIDDPDFHDFFVPKRARWEHISKVTQDIGSHINKAFEVLEEH
FT                   NKMLEGVLAPIDFNDKERLPDHVLEELIQHFSKYSLKNRDLEDPDILGRAYEYLIRQFA
FT                   DDAGKKGGEFYTPRQVVKLLVEILDPRPGMSVYDPCCGSGGMLIYSAEHLIEEGNDISE
FT                   ISLYGQERNLNTWAICKMNMLLHGLYDAKIAKGDTMRDPQFLDNGKLDQFDRVIANPMW
FT                   NQSSWSKKYLQETEPFGRFSYGFPPKNSADWVWIQHMLASANKKGKIGVVLDNGVLFRG
FT                   RSEGKIRKKVLKHDLIEAVIALPSNLFYNTSSPGCILILNKDKTVERKNKVIFIYAEED
FT                   YKEGSNQNYLREKDIEKILNAYKNFEDIERYCRVVDMEEIERNDYNLNVPRYVDTTEPE
FT                   EPIDVQEVIDNLNKLEEERKEIEEEMNGYLRELGYDD"
FT   gene            478520..479788
FT                   /locus_tag="Hore_04450"
FT   CDS_pept        478520..479788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_04450"
FT                   /product="restriction modification system DNA specificity
FT                   domain protein"
FT                   /note="PFAM: Type I restriction modification DNA
FT                   specificity domain; Type I restriction modification DNA
FT                   specificity domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_04450"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69203"
FT                   /db_xref="GOA:B8D1X6"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1X6"
FT                   /protein_id="ACL69203.1"
FT                   /translation="MIKDGYKEVRIGPKKYHIPKEWEFRNFGLISKYIKAGGTPKADKK
FT                   EYYGGEILFVKIEDMTKNGKYIYNTKSTITEDGLKNSSAWIVPKKSLLLSMYGSYGKVS
FT                   INKVELATNQAILGIIPSEEVNLDYLYYFSLGCLKPYFKSLVKATTQANLTKQIVNNTP
FT                   VLSPPLPEQKKIAAILSTVDKAIEKTDEIIEKSKELKKGLMQQLLTKGIGHSEFKEVRI
FT                   GTKKIKIPVVWTLIKFGEVFKKRNEKANVEKEYKYVGLEHLGTGEINLLGYDRNGNNKS
FT                   SKRLFKSGDILYGKLRPYLKKAAITDFDGICSTDIIPIYATKKSVNNYLIYLVHSKMFV
FT                   DFAVSTMEGTNLPRTSWRVIKNLIIPLPPLQEQKKIASILSSVDEKIQKEQEYREKLEE
FT                   LKKGLMQKLLTGEVRVKVEDEEV"
FT   gene            479792..482824
FT                   /locus_tag="Hore_04460"
FT   CDS_pept        479792..482824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_04460"
FT                   /product="type I site-specific deoxyribonuclease, HsdR
FT                   family"
FT                   /note="PFAM: Type III restriction enzyme, res subunit; Type
FT                   I restriction enzyme R protein N terminus (HSDR_N);
FT                   TIGRFAM: type I site-specific deoxyribonuclease, HsdR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_04460"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69204"
FT                   /db_xref="GOA:B8D1X7"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR004473"
FT                   /db_xref="InterPro:IPR007409"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR021810"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040980"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1X7"
FT                   /protein_id="ACL69204.1"
FT                   /translation="MTKNWDEYHRVEKRALNLFERLGYKVFDINKTMERPARNSEHEVL
FT                   LLDNLKKGIKRINPWISENNLNKAVNMIRPARIKATNLLEANEIIYERLVKHVSVLQDL
FT                   GQGKKNQTVKYIDFEDPDNNEFLVMNQYKVKGRENIIPDIVVFINGIPIGVIECKVDTI
FT                   DEPEEKAIEQLRRYQNIREYDLEEGAEQLFYTNQVLVAAWKDSASASTIGAPARQFKAW
FT                   KDPYPSTIDNITKLVGEEPTMQDILLYSMFKKERLLDLIQNFIVFEREGNGIVKKLARY
FT                   QQYRAVCKAVERIKNARKLTERSGTVWHTQGSGKSLTMLFLALKLRRMKELENPTLLIV
FT                   TDRRDLDEQITGTFKKCGFPNPIRAKSVKDLKEKLRLDAGKTIMTTVQKFQERDNDKYP
FT                   VLSEDTNIFVMVDEAHRTQYKDLAANMRRALPNACYLGFTGTPIDKKARSTIRTFGTYI
FT                   DTYTIEESVEDGATLPIFYEARLADLRVEGRDLDKLFDRIFKDYTDEEKQKIKEKHATE
FT                   KDIAEASSRIEKICLDIIEHYESKIYPFKAQIVTVSREAAAKYKETLDNLNGPESAVII
FT                   SGDRTDKGLIKKYITTGDERKELIKRFKDYHDSLKFLIVCDMLLTGFDAPVEQVMYLDK
FT                   PLKEYNLLQAIARVNRRYDNKNFGLVVDYYGVFDHLKEALEIFNKKDIENAVTPVKDEK
FT                   PRLERNYRGVMRLFDGVNMDNLDQCILAFKEEDQRIKFKNAFKAFARSMDIIMPDPIAD
FT                   PYREDLKKLGKIYKAVRNHYRDKNLNIKGVGDKVKKLIDKHIMATDIKILSEPVSILDE
FT                   EKFEETINEIRNKETRASEMEHAIRNEISIKIDENPAYYQSLKERLEELIERRKQGMLD
FT                   FAEQIEEMKEIINDIRNVRSKAERLGLNEKEFALYELLVDELEPYYTEEVADPPVKYNA
FT                   GKQSRTDIKINEKVKNLAQSLINELEDMAVFEWYKKEIVLKNMRRKIKLSLAGYKEFRN
FT                   KLDSLTTKIIKLARNILMMML"
FT   gene            482836..483561
FT                   /locus_tag="Hore_04470"
FT   CDS_pept        482836..483561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_04470"
FT                   /product="predicted metal-dependent hydrolase"
FT                   /note="PFAM: Protein of unknown function DUF45"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_04470"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69205"
FT                   /db_xref="GOA:B8D1X8"
FT                   /db_xref="InterPro:IPR002725"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1X8"
FT                   /protein_id="ACL69205.1"
FT                   /translation="MQQVRIGNTVIKYNIVRTNRKTVGLIVDPEDGVIVRSPERLSDDR
FT                   IRKLLKKKARWLMEKLRLINEFKPKPASYEFLSGEKLPYLGRKYRLKVTKDDGIKSVKV
FT                   RLYQGKFEINVSSSIKREEKRDKIRKALIKWYKEHAKDKINERVRIYQNRIGVKPNNII
FT                   VKEQKKRWGSCSSKGNININWRIIMAPMSVVDYIVVHELVHLIHPDHSVNFWELVETVI
FT                   TDYREKQKWLRINGRALDF"
FT   gene            complement(483550..484425)
FT                   /locus_tag="Hore_04480"
FT   CDS_pept        complement(483550..484425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_04480"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase core domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_04480"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69206"
FT                   /db_xref="GOA:B8D1X9"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1X9"
FT                   /protein_id="ACL69206.1"
FT                   /translation="MYPGQDITAGLKRKPGKRELTNKKLKLKIAEIYWQTRGRYGSPRI
FT                   HKQLKKEGYHYNIKRIERLMRVMGLKAIQKRKFKRTTNSDNNLPLKNNLLKRNFSVTQP
FT                   DKVWVSDITYIPTKEGWLYLSVVIDLYSRRVVGWSMDNHMTKRLVIDALEMAVLNRNPS
FT                   RGLIFHSDRGSQYASHDFQKTLWKYGIISSMSRKGDCWDNAVAESFFATLKTELIFHNK
FT                   FVSLFNSNIFSKVNHYYLAKFIFFHFHLQYLLSTTEWKYPIVTFIISYKLNGKLSLAGF
FT                   YFKNKNILKI"
FT   gene            complement(484569..484784)
FT                   /locus_tag="Hore_04490"
FT   CDS_pept        complement(484569..484784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_04490"
FT                   /product="transposase IS3/IS911"
FT                   /note="PFAM: Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_04490"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69207"
FT                   /db_xref="GOA:B8D1Y0"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1Y0"
FT                   /protein_id="ACL69207.1"
FT                   /translation="MGRKKYSEEFKREAVELSFSSDKSCKVIAKELGIIYHNLIRRRRE
FT                   YKNKGDLAFPGNGKKSYPLNRKKFKG"
FT   gene            484897..485727
FT                   /locus_tag="Hore_04500"
FT   CDS_pept        484897..485727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_04500"
FT                   /product="nuclease (SNase domain protein)"
FT                   /note="PFAM: OB-fold nucleic acid binding domain;
FT                   Staphylococcal nuclease homologue"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_04500"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69208"
FT                   /db_xref="GOA:B8D1Y1"
FT                   /db_xref="InterPro:IPR002071"
FT                   /db_xref="InterPro:IPR016071"
FT                   /db_xref="InterPro:IPR035437"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1Y1"
FT                   /protein_id="ACL69208.1"
FT                   /translation="MLKKTTSIITALISLLFLLMAGNVIKKHYIQIPGINHDQKLEKVY
FT                   VTRVYDGDTFRTADGENVRLIGVDTPEINHEEGTAEYYGREALAYARKHLEGKYVYLEY
FT                   DQDRRDKYGRLLAYVFLTDGIFFNASLLEEGYAHLITVPPNIKYLSLFKKTVKKARGEG
FT                   AGIWSRLKVKEASLPVIGWEEAENYIGKEVIVRGQIVDTYNSGQALFLNFDREYWRTFR
FT                   VVIFSEDLNKFGFNPEEYFDNKCIKVMGKVKEYEGKPEIIVDSPEEIMVIKNCL"
FT   gene            486034..486417
FT                   /locus_tag="Hore_04510"
FT   CDS_pept        486034..486417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_04510"
FT                   /product="regulatory protein GntR HTH"
FT                   /note="PFAM: Bacterial regulatory proteins, gntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_04510"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69209"
FT                   /db_xref="GOA:B8D1Y2"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1Y2"
FT                   /protein_id="ACL69209.1"
FT                   /translation="MELKNDSNIPIYIQIANMIEDQILERTLEEDEKVYSTNELSVLLH
FT                   VNPATARKGLNLLVNEGILYKKRGVGMFVKKGAVEIIKSKRKTSFFNEYIPEIIREAKK
FT                   LEIGKDELIDMIKSCEGGGVDDE"
FT   gene            486407..487300
FT                   /locus_tag="Hore_04520"
FT   CDS_pept        486407..487300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_04520"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_04520"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69210"
FT                   /db_xref="GOA:B8D1Y3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1Y3"
FT                   /protein_id="ACL69210.1"
FT                   /translation="MMSNWILNGVTKKFEDTTAINNISLEIEENKIYGLIGRNGAGKTT
FT                   LLKLLANQLQPTEGIIQKGNVSIRGNDELTRSICLARDSINIKGVAAFTVDKILKFASY
FT                   IYPNWDNDYCEELINKFDLNPDKKYIKLSKGMHTVVGIVIGLASRASLTMFDEPYIGLD
FT                   PVFRELFYELLIADYEQYKRTIIISSHLINEFENLFERVLIIDRGRVLLNEELEEIRKK
FT                   ARLISGEKSVVEEILKGKNILYKQVIGKLANYTVLDDFTEKELYEYKNRNIKWSSLDLQ
FT                   RLFVNLSKGGHISEQQ"
FT   gene            487287..487982
FT                   /locus_tag="Hore_04530"
FT   CDS_pept        487287..487982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_04530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_04530"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69211"
FT                   /db_xref="GOA:B8D1Y4"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1Y4"
FT                   /protein_id="ACL69211.1"
FT                   /translation="MSNNKNIKKALFEVEKTALFIVLMILTINLTINGLVVVFDASTPT
FT                   VYFKSQLFFSIFISGFVYLIIYGINNIITSLPFLVSLNCPRKVVAKNIIFTGLKRSFIF
FT                   TLLILFIKVIVFGRVITDSYAVSAFGMDLTSNTPGDIFVIALLLYVALNFINSLITLIS
FT                   LLGVRYGWQYALSVIFFAFGTLFIFFKSIVLLVIFGWQLNMFILLMIILITLFYLLNYR
FT                   LIKNFEYKY"
FT   gene            487996..488436
FT                   /locus_tag="Hore_04540"
FT   CDS_pept        487996..488436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_04540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_04540"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69212"
FT                   /db_xref="GOA:B8D1Y5"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1Y5"
FT                   /protein_id="ACL69212.1"
FT                   /translation="MPKRIYKYFIFIMSLVFFVLSIYYFQMNVYEIGLKPYNNLKSDRM
FT                   TGIEEFLLHVDKASKVILLHNAKIGGGYVEFKITGEDGRIIDKYRLSSNKLINRVYNLN
FT                   KGIYQCTIERDVKNSRENFRFYYDKRLIRHEYLKRDYTTSNR"
FT   gene            488477..489553
FT                   /locus_tag="Hore_04550"
FT   CDS_pept        488477..489553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_04550"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_04550"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69213"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1Y6"
FT                   /protein_id="ACL69213.1"
FT                   /translation="MKKFFIILLMFVIVVISLLVFQNERMASRLKPPLDEPYLTDIEVS
FT                   RVREIYRVQTTLGNQVWPGFGDLHIPVLLYNDRYYFIFTEGKPSLLWKPVSRNNDQEIT
FT                   YYRNLVKNPQAFAVKIGDQWAGSFGTLKKANKSYYLGIRSQLPPVLKNLFPYQLATLSD
FT                   DFYVAAIIHEMFHAFQAEQFPGKFRKAGYVYNVINKYPYHDESIIQLWNKEGEMLARAL
FT                   ESSDKKEIVACLSQFIKIREKRRQKLTPELIELEKRIEWLEGLAKYAEMKAYELAAGQG
FT                   RGTGMINYKKGLPYWQQEIGRLKKLGEVSMGDDFRFYLSGMAQARLLDKLKLDWKKEVM
FT                   KNDVFLEDIIINYLSKLN"
FT   gene            489572..489940
FT                   /locus_tag="Hore_04560"
FT   CDS_pept        489572..489940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_04560"
FT                   /product="histidine triad (HIT) protein"
FT                   /note="PFAM: HIT domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_04560"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69214"
FT                   /db_xref="GOA:B8D1Y7"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR019808"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1Y7"
FT                   /protein_id="ACL69214.1"
FT                   /translation="MNCPFCAISHKDYIAENEYAFAIYDKYPVNKGHALIIPKRHVASY
FT                   FDITERERQAIFKLVDRCKTLLDEKFNPDGYNIGINVGKYAGQTVMHLHVHLIPRYKGD
FT                   IDDPTGGVRGVIPEKRVY"
FT   gene            490264..491271
FT                   /locus_tag="Hore_04570"
FT   CDS_pept        490264..491271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_04570"
FT                   /product="transcriptional regulator, LacI family"
FT                   /EC_number="5.1.1.1"
FT                   /note="PFAM: Periplasmic binding proteins and sugar binding
FT                   domain of the LacI family; Bacterial regulatory proteins,
FT                   lacI family"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_04570"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69215"
FT                   /db_xref="GOA:B8D1Y8"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1Y8"
FT                   /protein_id="ACL69215.1"
FT                   /translation="MPVTIKDIAKKANVSVTTVSRVLNNKPDVSEKTKSKILKIINELG
FT                   YNPNGVARGLVLNRTHTIGLIIPDIRNPFFPEVARGIEDKAKEYGYSVIYCNTDNKKEE
FT                   EKKAVELLLNKRVDGIILSLSMNNRDELDRIKKQGCPIVQIDRKVPDANYPTVTIDNLI
FT                   SAYNATKHLINLGHKYIAHITGNLDTKTGQDRLNGYKKAMHERGIHISQEWIIEGDYSK
FT                   ESGYKNMKRILNLKNRPTGIFIANDLMAIGAYKAVFESKLNIPEDISIIGHDDIELASL
FT                   VNPELTTMAQPKYEMGKHAARLLIQEIEGSDQDNNQNILLNTELVVRGSTGGVG"
FT   gene            491274..492194
FT                   /locus_tag="Hore_04580"
FT   CDS_pept        491274..492194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_04580"
FT                   /product="Ribokinase"
FT                   /EC_number="2.7.1.15"
FT                   /note="PFAM: pfkB family carbohydrate kinase; TIGRFAM:
FT                   ribokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_04580"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69216"
FT                   /db_xref="GOA:B8D1Y9"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011877"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1Y9"
FT                   /protein_id="ACL69216.1"
FT                   /translation="MTKEILVIGSLNMDLIVQTEKYPRKGETVPGENFKQVPGGKGANQ
FT                   ALTAGKLGGQVRFIGSCGKDEYGTTLLNNLKNGGVIVDDILRVEKNTGIAMITIEKEGS
FT                   NRIIYVKGANEYVTPDVVMKMEDRFKKASILLIQMEIPLESVIKAVELAKKYQMKVILD
FT                   PSPVQGLPEKIFPLIDYILPNEIELDELVKNGCQIEEEKAKHLLKLGTNNVIVTKGKNG
FT                   VSHYYEDKVATYESYHVKAVDTTAAGDAFAGSLAYGLSQGWSLEKTIKFSNLVAANSVT
FT                   KLGAQSSLPTYQEVMKFAKHIKKNI"
FT   gene            492211..493095
FT                   /locus_tag="Hore_04590"
FT   CDS_pept        492211..493095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_04590"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: Binding-protein-dependent transport system
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_04590"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69217"
FT                   /db_xref="GOA:B8D1Z0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1Z0"
FT                   /protein_id="ACL69217.1"
FT                   /translation="MYESRTVGQKKLEQLKLLLPALIPVILFSLIPLLRGIYLGFTDYV
FT                   LGSDVSFNGFENYKYMLTDTYFWQSFKIGFVWTIAVTAGQILLGLGLAMLLNGDVLFRS
FT                   WARVLILIPWAMPPVIRGIMWKFMYHPDTGAINYFLMKLNIIDQPIDFLFSFDYVIPAV
FT                   IIVGIWGGLPQAAITLLAGLQSISDDYYEAACLDGANGWHTFRYITLPLLSPVMTAITI
FT                   LRFIWNFNSFGLVYVLTQGGPAGMTRIPTLLAYEEGFRYGNVGYAAALGNVMVLVVAVL
FT                   MFMYLKRRMSKEV"
FT   gene            493113..493946
FT                   /locus_tag="Hore_04600"
FT   CDS_pept        493113..493946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_04600"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: Binding-protein-dependent transport system
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_04600"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69218"
FT                   /db_xref="GOA:B8D1Z1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1Z1"
FT                   /protein_id="ACL69218.1"
FT                   /translation="MNLNIIKKIGKNLILLCYLIFLAFPLFWMVSISLKPTSEIRSLVP
FT                   KLWPENITFQHYINAFTEQRIIESIFNSAKVGILATIGVILISIPAAYALGRYKTKVNK
FT                   GVIAWVMVSQLFPAILVMIPLFVVLMNIGLIDSHIGLTILYVVWTLPFVLMMLKGYVQG
FT                   IPIELEEAAAVDGATRSQILFKVVMPLLLPGIAATSIFAFISAWNEFFFALVLLKSPEL
FT                   LTLPVKLARFTGMEGIVRLGPLAAASFVATIPALILFGFLQKWLVSGLTSGAVKY"
FT   gene            493986..495281
FT                   /locus_tag="Hore_04610"
FT   CDS_pept        493986..495281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_04610"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: Bacterial extracellular solute-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_04610"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69219"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1Z2"
FT                   /protein_id="ACL69219.1"
FT                   /translation="MKKLLLLLMVVSLLAGVAATGLVMAKEPIEIKFVSLAWQKQSIEA
FT                   NKEIVAEWNRTHPDVQVKYIQGTWGSIHDYMITAFETGSVPDVFHYESAAIVGFAQKGY
FT                   LAELNSLMSEDLKNDILDEAWKTTQLENGKIYGVPFLWESQITLYNKALFKEAGITPPT
FT                   IDNPWTWEDLREAAKKLTKDTDNDGEIDQWGVGLGLKSPAKKMLRLSVGFGGKFFKKEN
FT                   GEYHVEVGEAEKKLLKQFYAMLYEDKTAPLSGIGQSGSSMIPGFLAGKYAMVPSVGVWA
FT                   RQQVVVNAPENFEWGVIPPIKAKTQAQGVGTQTLSIPSASKYKKEAMEFIEFFLNTRNM
FT                   ARLAKGDWMLPTRKSTMNLPMFQTDENGWKVAMNSAKCLEAGPWQNIPGFPEWKNRVGN
FT                   PVIQLYLKDKISLEDAAKRLEREGNRILQRYK"
FT   gene            495300..496289
FT                   /locus_tag="Hore_04620"
FT   CDS_pept        495300..496289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_04620"
FT                   /product="ADP-ribosylation/Crystallin J1"
FT                   /note="PFAM: ADP-ribosylglycohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_04620"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69220"
FT                   /db_xref="InterPro:IPR005502"
FT                   /db_xref="InterPro:IPR036705"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1Z3"
FT                   /protein_id="ACL69220.1"
FT                   /translation="MTVKKDKALGALVGLAVGDALGQPTEGKTCNEIKEKWGRITDFLD
FT                   DTPAVSDDTEYALFNARLLLDYGEHLDTDKITDAWVKEIASQHGGFKGAGFSEMATIEN
FT                   LRNGLRPPDSGKHIHSWSDGLAMRVAPFGIVAAGDPELAARLARMDGEVSHAGEGIYAG
FT                   MLVAATISLAMTEKDKEIIFNTSLNMIPSDSWTYRAVCRGINIGQKYSNIWEVLEPLYK
FT                   ETVFDCYPWADLAPEALGLTYGILTVADFNFVDSVVGGVNIGRDTDTNAAIAGAIAGAY
FT                   NGIDVIPQKWQGVIKPSEGRCIHTVEGMVIDDIALKLSELGDKWGAAL"
FT   gene            496286..497329
FT                   /locus_tag="Hore_04630"
FT   CDS_pept        496286..497329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_04630"
FT                   /product="ADP-ribosylation/Crystallin J1"
FT                   /note="PFAM: ADP-ribosylglycohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_04630"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69221"
FT                   /db_xref="InterPro:IPR005502"
FT                   /db_xref="InterPro:IPR036705"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1Z4"
FT                   /protein_id="ACL69221.1"
FT                   /translation="MKLIEKNAKGIMMGLAIGDAVGWPAMFQRSHLLPGWTRRLRREIE
FT                   DEAEKYNIIRPSVPFSLNRPPQKFEISPGDDTEWVSFTAKMIIESEGKCDRGFVINKWK
FT                   NLMENKDMVKGSMSVMGALTNIERGKYPPVSGHDNPHFFDDAACVRSIPFGIAFAGKPE
FT                   LAAEKTVVDAEVTNSEDGLWAARAMAAATAVVAAGGSCDEVLNEALSLLPRKSWIRRKV
FT                   TEALSLVRRRSIFAAIPLLADRVTGSIYSYGTAAPETLALTLAIYSKSKEDYIKGIMAA
FT                   NCIARTADSVPALVGALSTGLAGGENIPDSWLNSINKLRGICIPSLKDTDYIEIINDLI
FT                   EIVKSMD"
FT   gene            497368..498699
FT                   /locus_tag="Hore_04640"
FT   CDS_pept        497368..498699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_04640"
FT                   /product="ADP-ribosylation/Crystallin J1"
FT                   /note="PFAM: ADP-ribosylglycohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_04640"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69222"
FT                   /db_xref="InterPro:IPR005502"
FT                   /db_xref="InterPro:IPR036705"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1Z5"
FT                   /protein_id="ACL69222.1"
FT                   /translation="MKITWIKPEDKIEYELEQSRQEGKDISTIQNKWKILKEEISDTKL
FT                   LRQKALNLLDEIDSLPYETDLYKEEPVRLIEIKEKSKQLDYSNRLSLDEEELFDKILGG
FT                   WLGRTAGCLLGKPVEKITRYGIREILESIDSWPLNDYFTACGVPDELLTKYPWNRHGGK
FT                   ESLKENIVCMPEDDDLNYTMLNLHIAETYGFDFTVDNIAEAWLHSLPVMTVFTAERVAY
FT                   FNCLNLINPAEVATHHNPYREWIGAQIRADLWGWMAAGNPVKAAELAYRDGSFTHVKNG
FT                   VYGEMFVAATIAASFLTDNPLDAVKMGLAVIPQKSRLARAIRFAINLPRKTEDWGEAVD
FT                   ILYKKYGHYHWVHTINNAALLTAAIVYGKGNYEKTICLAVMGGWDTDCNGATVGSILGT
FT                   LLGAKRLPDKWIKPLNNRIRSSLKGFDNVRIDELAKRTFNLVDQ"
FT   gene            498728..499708
FT                   /locus_tag="Hore_04650"
FT   CDS_pept        498728..499708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_04650"
FT                   /product="ADP-ribosylation/Crystallin J1"
FT                   /note="PFAM: ADP-ribosylglycohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_04650"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69223"
FT                   /db_xref="InterPro:IPR005502"
FT                   /db_xref="InterPro:IPR036705"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1Z6"
FT                   /protein_id="ACL69223.1"
FT                   /translation="MFNINEFKKDDDLKFDRALGAMIGLAIGDSFGDASRTEKNHKRFG
FT                   ITMDFDEGASWSTDDTEFALLTAHTLIEVQGNLTIESVKESWQKYVIPQDELYRGGSSE
FT                   IEAAVNIKRGINPPESGRFNAYNISDGAAMRVTPIGIVCAGDPEKAARMAEVDACISHW
FT                   RDGIWGAQAVAAAIAMAMVGASVDEIISAAYKVIPEDSWFKYAFKKALRIVESSNSIEE
FT                   AWTPLHTELWSTYKAAVPEAISQAFALFKLSEGDFRKGVIYAGNFGRDADTIGAIVGAL
FT                   NGALNGAEEIPERWKEKTRYPTGTCLAFTEGMDVVKISKKLAELI"
FT   gene            499731..500810
FT                   /locus_tag="Hore_04660"
FT   CDS_pept        499731..500810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_04660"
FT                   /product="(Citrate (pro-3S)-lyase) ligase"
FT                   /EC_number="6.2.1.22"
FT                   /note="PFAM: Acetyltransferase (GNAT) family;
FT                   Cytidylyltransferase; Citrate lyase ligase C-terminal
FT                   domain; TIGRFAM: cytidyltransferase-related domain;
FT                   [citrate (pro-3S)-lyase] ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_04660"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69224"
FT                   /db_xref="GOA:B8D1Z7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR005216"
FT                   /db_xref="InterPro:IPR013166"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1Z7"
FT                   /protein_id="ACL69224.1"
FT                   /translation="MSIWNLRKEILYPPVDDMTEVATFLNGLNLELEERLDCILVLRIN
FT                   NRVVGTGGLDGNILKCVGVDPEFQNQGLLNTIVSELKHILYRKGYNSLFVYTPEHQVVR
FT                   YKNLGFVEIESVGDYPVLMEDSMEGFNGFIRSLKKKTQRINLDLKKIEVASLVMNCNPF
FT                   TKGHLYLIEKAARERDIVFIFLLTEDRSLFPANIRYELVKKGTKHLDNVIVFRGGDYIL
FT                   SYTTFPDYFIGSQRGEEKARRYAELDARIFARHIAPALNINHRYVGSEPYSSITAIYNQ
FT                   VLKKVLPLYGISLCEVKRKNYKGQPISASRVRRYLGEGNYKKVRDLVPEVTYKFLQSPG
FT                   AQKIVDYLQNKFRGDKNGN"
FT   gene            500800..501084
FT                   /locus_tag="Hore_04670"
FT   CDS_pept        500800..501084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_04670"
FT                   /product="Citrate (pro-3S)-lyase, beta subunit"
FT                   /note="PFAM: Citrate lyase, gamma subunit; TIGRFAM: citrate
FT                   lyase acyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_04670"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69225"
FT                   /db_xref="GOA:B8D1Z8"
FT                   /db_xref="InterPro:IPR006495"
FT                   /db_xref="InterPro:IPR023439"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8D1Z8"
FT                   /protein_id="ACL69225.1"
FT                   /translation="MEIKRTASAGTMESSDIMITVKPSNNGIKIELKSDVEKQFGNQVK
FT                   KIIKNTIEGMGVKNVYIRAQDRGALDYAIKARTRTALERASKGAEEIEK"
FT   gene            501074..501958
FT                   /locus_tag="Hore_04680"
FT   CDS_pept        501074..501958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_04680"
FT                   /product="Citrate (pro-3S)-lyase, beta subunit"
FT                   /note="PFAM: HpcH/HpaI aldolase/citrate lyase family;
FT                   TIGRFAM: citrate lyase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_04680"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69226"
FT                   /db_xref="GOA:B8D1Z9"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR011206"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:B8D1Z9"
FT                   /protein_id="ACL69226.1"
FT                   /translation="MKNKLRRSMLYIPANNPGMIQDAFIYGADAILFDLEDSITLTEKD
FT                   AARYLLCNALQELDFGQAEIVVRINPLNTEYGRNDLEVIVPAKPDAIRVPKVETGEQIK
FT                   KIDSLLGKLERKAGITRGSIEIMAMIETARGVLNAREIAKASPRITALNLGAEDLTADL
FT                   GVRRSDEGIELLYARSQIIYAAAENGIDIIDTVYSDVENITGLKEEAIMSKRLGFTGKS
FT                   VIHPKQIEIVNSVFTPSTEEIKEAEKIVKRALEAEKRGFGVVTVDGKMVDIPVIERAKK
FT                   LLDRVESIRRASN"
FT   gene            501955..503448
FT                   /locus_tag="Hore_04690"
FT   CDS_pept        501955..503448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_04690"
FT                   /product="citrate lyase, alpha subunit"
FT                   /EC_number="2.8.3.10"
FT                   /note="PFAM: Citrate lyase, alpha subunit (CitF); TIGRFAM:
FT                   citrate lyase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_04690"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69227"
FT                   /db_xref="GOA:B8D200"
FT                   /db_xref="InterPro:IPR006472"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:B8D200"
FT                   /protein_id="ACL69227.1"
FT                   /translation="MRENTIPERVGSFKNLRSYSYIKPERKSKIIGSLEEAVNKVNLRD
FT                   GMTVSFHHHFRDGDLILNQVMDIIADKGVKNLTLAATSLRKNHDEIIKHIKSGVIKKIY
FT                   TSGLRGKLGEEICRGLMDEPVVIYSHGGRAGAIESGNLKIDVAFIATPAADRWGNANGV
FT                   EGTSNCGSLGYTMVDAKYAEKVVVITDNLIEFPPEHISISQENVDCVVEVDKVGNSDRI
FT                   ETGSLRKVSRPKDLYIAKNVARVISNIKYFQNGFSLQTGSGGISLAVTDFIQELMQERD
FT                   IKGSFILGGITGAHTDLLKKGLFKKIFDTQTFDLQAVKSLRENRNHMEIDASLYASAFN
FT                   KGSLVNNLDFVVLSALEVDTDFNVNVLTGSDGFFRGASGGHCDTAYGSKVTIVVAPSVR
FT                   GRIPTIRDKVTNIVTPGKTVDVVVTERGICVNPEREDILKDLKNVKDIELIDIHELKDK
FT                   VESLTGKPEPPLYDEKITGLIQYRDGTIIDVVRKISDRY"
FT   gene            503470..504873
FT                   /locus_tag="Hore_04700"
FT   CDS_pept        503470..504873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_04700"
FT                   /product="Triphosphoribosyl-dephospho-CoA synthase"
FT                   /EC_number="2.4.2.52"
FT                   /note="PFAM: Apo-citrate lyase phosphoribosyl-dephospho-CoA
FT                   transferase; ATP:dephospho-CoA triphosphoribosyl
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_04700"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69228"
FT                   /db_xref="GOA:B8D201"
FT                   /db_xref="InterPro:IPR002736"
FT                   /db_xref="InterPro:IPR005551"
FT                   /db_xref="UniProtKB/TrEMBL:B8D201"
FT                   /protein_id="ACL69228.1"
FT                   /translation="MEELLKGREDRVRQRNNFIKSFKYKDPVSFVSLTVNIPGRNKLTQ
FT                   FARDLFIEALNSLRLHLFIKGITNCQKKIIKNKAGWTGFVAVPIEPEKLKKICISIEKN
FT                   HFIGRLFDLDVFDIKNRYYSRKDCGLSDRRCFLCDRPAKECIRVGRHDYREIEFKLSKL
FT                   EKYFYKMKLKREDNFTKVIGNLAFEAIMKELMVTPKPGLVDAQSSGSHKDMNFDLMVKS
FT                   AESLKPFFSKFAMLGIKLGRHSKNPLTRLKEVGLEAEEKMFSVTNGINTHKGVIFSLGL
FT                   LTAATGYFYKKIIFSDYDLAENLCHIVSDWVSGISEKELKKNQNEGNTHGQVVYNEYGF
FT                   KGARGEAEDGFPNIINVGIPAYRRAIKSNLSEELAVLSVLINLMAHVNDTNILYRSGLD
FT                   TLNEVKSLSREIIFSGGVGTPEGWERYKKLINFVEKKKVSPGGSADLLILTIFLNELEE
FT                   KKSLIFTTS"
FT   gene            505224..505937
FT                   /locus_tag="Hore_04710"
FT   CDS_pept        505224..505937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_04710"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: Transcriptional regulatory protein, C
FT                   terminal; Response regulator receiver domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_04710"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69229"
FT                   /db_xref="GOA:B8D202"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B8D202"
FT                   /protein_id="ACL69229.1"
FT                   /translation="MADGSRILVVDDEQEIRELLKSYLEREGYVVDTVKDGKTALFRVS
FT                   NQDYNLVILDIMLPDTDGVEVCRTIREITNIPIIMLTARDSEVDKVLGLRIGADDYITK
FT                   PFLPGELIARVKAQLRRFFVLGSEGDARSRKMVKFGDLKIDFDGYRVYKRNKEVQLTST
FT                   EFKILLLLAREPGKVFTKKQIFNKVWGDDYLEADNNVMVHIRRLRTKIEDDPKNPEFIE
FT                   TVWGIGYRFAGDEND"
FT   gene            505930..506925
FT                   /locus_tag="Hore_04720"
FT   CDS_pept        505930..506925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_04720"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: His Kinase A (phosphoacceptor) domain;
FT                   Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_04720"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69230"
FT                   /db_xref="GOA:B8D203"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B8D203"
FT                   /protein_id="ACL69230.1"
FT                   /translation="MTEKRFLAMTGLVLILALFLLDSNHVTRQIILILTVVIWLFFILK
FT                   SRHEERIVDIVNEQLSDVLNGNLNRRILVDSKGKYSDFVVRVNELIDKLQDEAIKNKQY
FT                   EASFKRVMSNISHDIRTPLTSILGYAEALKDGLAEDDEEREKYREIMVMKARRLKKLVD
FT                   KLFFLARLEAGEEELDFKVYDLAEVTRECIIDFLPRINKEDLELKTEIPEQECLIYADH
FT                   LALERMIDNLISNSINYGKEGGIIGVKLFRQEQKYVLQVWDKGPGITEDKLPHIFNRLY
FT                   VGDKSVERQISGSGLGLAITRRLIEKHNGRITVDSKPYEKTIFSLHFPAI"
FT   gene            507081..508001
FT                   /locus_tag="Hore_04730"
FT   CDS_pept        507081..508001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_04730"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_04730"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69231"
FT                   /db_xref="GOA:B8D204"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8D204"
FT                   /protein_id="ACL69231.1"
FT                   /translation="METIIETKNLSKHFGTEKAVDRINITVKKGDIYGFLGRNGAGKTT
FT                   TIRMLLGLIKPTGGQIKIFGQNLYTNRSRILKRIGSTIEFSGFYSNLSAVDNLRINAAL
FT                   IGVQKKEAIAEALEIVGLYDERNKKVGSFSLGMKQRLGIARAILHDPELLILDEPTNGL
FT                   DPVGIKEIRKLIKTLAEQKNITIFMSSHILSEVQQLATTIGIIHEGRLMEEINFSELRK
FT                   RNRKYLELKVSDDAKTAMLMEREFDITDYEIYPERVVRVYSCLELAGKINTCLVKNGIE
FT                   VSRIRLSEDNLEDYFVKITGGEVID"
FT   gene            508042..508728
FT                   /locus_tag="Hore_04740"
FT   CDS_pept        508042..508728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_04740"
FT                   /product="bacitracin ABC transporter, permease protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_04740"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69232"
FT                   /db_xref="GOA:B8D205"
FT                   /db_xref="UniProtKB/TrEMBL:B8D205"
FT                   /protein_id="ACL69232.1"
FT                   /translation="MFIIGLLGGAVSPVLTFFMLLSYRQQSPDRVVALEEFFDQTYLFI
FT                   AVLVGTMLFALITTYLYNREYEEDTLKNLLTIPVGRGQLIISKMVILLGWVEVIMVFAY
FT                   LMVIALAVAGSFSEITLKVMLAGLGKYLLTGLYLYMLTPVIILITLVFKSYVPPLAFSI
FT                   AASLGTLIVMQSKYISLYPWSIPIVLTKKFDGLEYSIETSLLILIGVFVTGILASIVYF
FT                   VKTDIN"
FT   gene            508849..509241
FT                   /locus_tag="Hore_04750"
FT   CDS_pept        508849..509241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_04750"
FT                   /product="Dinitrogenase iron-molybdenum cofactor
FT                   biosynthesis protein"
FT                   /note="PFAM: Dinitrogenase iron-molybdenum cofactor"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_04750"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69233"
FT                   /db_xref="InterPro:IPR003731"
FT                   /db_xref="InterPro:IPR036105"
FT                   /db_xref="UniProtKB/TrEMBL:B8D206"
FT                   /protein_id="ACL69233.1"
FT                   /translation="MSLTIACATDDGVNFINRHFGDADYYYIYNLTPEGATFIKKVENT
FT                   TGEEEGHADPEKARSIVKILKENENVQVGVSRKFGPNIKRVKKHFVPVLVQASEIEEGL
FT                   KELQSNYDYIMDLWQKGEGREHLVLK"
FT   gene            509266..509715
FT                   /locus_tag="Hore_04760"
FT   CDS_pept        509266..509715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_04760"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S binding domain; 4Fe-4S binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_04760"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69234"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B8D207"
FT                   /protein_id="ACL69234.1"
FT                   /translation="MLFGRGQGPGSGGGRGAGRGSGRGSKNGGRGMGRGSGYGLGPGGN
FT                   CVCPECGHKVPHQRGVPCYEMKCPNCGGQMVHEGLDVSGSPDRNNENMVNTPVIDENKC
FT                   IGCGNCVVACPFKAIKIENGVAKIMSDKCRNCRKCVRVCPKSAIK"
FT   gene            complement(509880..511154)
FT                   /locus_tag="Hore_04770"
FT   CDS_pept        complement(509880..511154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_04770"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_04770"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69235"
FT                   /db_xref="GOA:B8D208"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B8D208"
FT                   /protein_id="ACL69235.1"
FT                   /translation="MSLLIFLLCISLVFTHQATAQETISGTWKGAINVKGQTLDITIHI
FT                   KPDNNGGYLATIDIPAQGVKNYALKNVKYNHPDLYMELPANITGFFNGKVSGARIKGKY
FT                   TQGSARGTFYLNKKTTDESETRSKDNDTGTEPISLKTETGTIYGTLQLPHSNKKSPVIL
FT                   IIAGSGITDRNGNSPGATNNCLKMLSQDLARAGFASVRYDKRGTGQSKGAINSPSDIRF
FT                   EHFINDATGWVKKLKKDKRFTGVTVLGLSQGSLVGMIAARRAEADAFISLAGAGRSIDK
FT                   VLKYQLISLNDDLYQEALDILDKLKQGQTVSQVNQKLYSIFHPLNQPFLISYIKYDPAE
FT                   EIAKLDIPVLLIHGTNDIQVKKEEANILKKAYPEAKLVLIEGMNHVLKKAPEDPRQNYM
FT                   TYNNPDLPLADNLVESIVKFLEKVY"
FT   gene            complement(511212..512963)
FT                   /locus_tag="Hore_04780"
FT   CDS_pept        complement(511212..512963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_04780"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_04780"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69236"
FT                   /db_xref="GOA:B8D209"
FT                   /db_xref="InterPro:IPR025291"
FT                   /db_xref="UniProtKB/TrEMBL:B8D209"
FT                   /protein_id="ACL69236.1"
FT                   /translation="MKKLKLFRHVLTSLTRSIKRFPLPTLFTTITTILMIILANEYLYD
FT                   FDKNTVRLFSRLVMTSSLGFPLFLCINLLFRRWQGLKAGTRNLIRFTGAVALILYFFFL
FT                   SKGTETVTTSRFLAFNLALYLLFLVIPYFYKRENFELYVVKLFIRVLVTIIYSVILYLG
FT                   LSAIFLTINALLDIPVSHRFYLNTWLITAGIFAPVFFLGGVPEQGQKINPDDYPTFFEI
FT                   LLLYIVMPLITIYTGILYIYFIKILITAQWPRGLVAHLVLWYSALSTVVMFFIHPLLYK
FT                   KWVKQFIKWFPVTNIPLLIMMFVSIGKRINAYGVTENRYYVVLLGLWILGIMVYYILSS
FT                   KKRNIILPLSLAIIMVLAVIGPWSSFSISRYSQNKRFAAILSRYRMIRDNRIIKTDKVI
FT                   SENDQKEINSIISYFKNNHDLDDLNYLPEGFTTDNMEELFGFSYSGNYYESYKYFSHKT
FT                   YENREPIRVSGYDYLFHLKSKDLKLHESDSDITVKYNKEDYHLLINHRGQEVYHKPLLP
FT                   LFSRLHKVVKEKGEENLKPNDYTLIQENGKVKVKVIIAHISGSAHKSDPDKINIYSTDL
FT                   YLLLKVK"
FT   gene            513258..513692
FT                   /locus_tag="Hore_04790"
FT   CDS_pept        513258..513692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_04790"
FT                   /product="OsmC family protein"
FT                   /note="PFAM: OsmC-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_04790"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69237"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:B8D210"
FT                   /protein_id="ACL69237.1"
FT                   /translation="MPNLKFSVTSKSENPTKTVVEARDFKIVIDEPENLGGTNDGPNPV
FT                   EYVLAALSGCLNVVGHLVAKEMGFELKGIEFELEGDLDPAKFSGQDTDTRAGYQEIRVN
FT                   IKPDTNADEDTLSKWLEAVETRCPVSDNLANATPVKISLG"
FT   gene            514109..516085
FT                   /locus_tag="Hore_04800"
FT   CDS_pept        514109..516085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_04800"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: Methyl-accepting chemotaxis protein (MCP)
FT                   signaling domain; HAMP domain; Cache domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_04800"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69238"
FT                   /db_xref="GOA:B8D211"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:B8D211"
FT                   /protein_id="ACL69238.1"
FT                   /translation="MLKSIKGKMMLLIGVVILVLVVTNSWFSFNQSRDVLSNSLFMMAE
FT                   DSAQKQAEVITKWVNNVVQQLKLLTKTESIRSMDWERQAPILKRAAEQNEGVVSFYVIN
FT                   KQGIYRNEFGSGDVSDREYYKKVRQTRDLVISKPMIDRSTGLETVAIVYPIFDEANNMI
FT                   GVLGVDLELSYLHELVEDMRLNGYGYGWIISDDMTTIAHPEEKFLGNQDIFNGDKDLKM
FT                   IATKMAAGKKGSDTYTLNGVEKGLAYAPIEITNWSVALCVNLDDILAPVNVVRRTSIWI
FT                   GIIAIIIGLALSYFMAGYFANPVTEVTSFARTIAEGDLTVRKSGSYINRDDEIGTLAQA
FT                   FNQMLAYFREMIGTVQESSQQVAASSEELSAASDQVGESAEQVGKAIQDVASGAEEQAA
FT                   QLNETSSNVEEMIQQIRYVSKDADRMESAAKDVMKNIEEGSESVERSIGEVNNVRTDTT
FT                   EVAGIIQSLGKTSEEIEDIIEIISNIANQTNLLALNAAIEAARAGEAGRGFSVVADEIR
FT                   DLAEETTTSTERISDLIRRIQQNVSAAVDRMDKNIDTVEGSVAAIEENGQVFNEIKEVT
FT                   KNLIELINQVSYNTRELAKNSDEVSSAIQEVAAVSQEAAGNAEEVAASSEEQLAATDEI
FT                   VSGARELARVADELARAVDIFKI"
FT   gene            516663..517934
FT                   /locus_tag="Hore_04810"
FT   CDS_pept        516663..517934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_04810"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: Sugar (and other) transporter; Major
FT                   Facilitator Superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_04810"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69239"
FT                   /db_xref="GOA:B8D212"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B8D212"
FT                   /protein_id="ACL69239.1"
FT                   /translation="MSVFLFVDQNAMNPIINDLVAEYGVGEDKIGIIGSAFIILGAVVS
FT                   LIFGYLADKKSRKMLLAFVVLVGEIPCFLTGFEYFTRTYEQLLILRILTGLGIGGIFPL
FT                   TFSLIGDYFPAGQRGIINAMVTTAWGVGQILGQTLAGFLSGPYGWRLPFIIAAVPNFVL
FT                   VPLFVLVAREPKRGAQEEELSEVIEQGLEYREKIKFSDLKEIFKNKTNILGFLQGIPGS
FT                   LPWGLIPFFIVPFYELHKGFSRGMATILSLFLGIGATVGGIFGGWMGDKIYKKSPRMLP
FT                   VFNAVFILLGVIPGFFLMGLNYGSDPGWNELILPLIFSFCTGVVVSLPAPNIKSILINV
FT                   NPPEHRGTVFSIHNLTDSLGRGVGPLIGGFLVVSQGYQWTMYFAVFAWIPCGLIYLWMY
FT                   RTIDNDLDTLRGYLKRKREKIIGM"
FT   gene            518050..519348
FT                   /locus_tag="Hore_04820"
FT   CDS_pept        518050..519348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_04820"
FT                   /product="Beta-glucosidase"
FT                   /EC_number="3.2.1.21"
FT                   /note="PFAM: Glycosyl hydrolase family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_04820"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69240"
FT                   /db_xref="GOA:B8D213"
FT                   /db_xref="InterPro:IPR001360"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018120"
FT                   /db_xref="UniProtKB/TrEMBL:B8D213"
FT                   /protein_id="ACL69240.1"
FT                   /translation="MSLKLPQDLLLGAATSALQIEGGDKNNNWYQWCEEGHIKDGSHCL
FT                   NANDHWNRYREDIELIKKLGLETYRMGLEWSRIEHQPGKFSKEGIEHYRDEITLLLENG
FT                   VVPLVTLHHFSHPLWLVNKGGWGNKKVVDYFKRYTEYVVENLGDLVSDWITINEPNVFL
FT                   YNGYVEGIWPPGKNNIFSMFRAMKNMIKAHIVSYKTIHQVRSKHNFEGETRVGVANHVR
FT                   LFDPAGNKKIHGIPARLLDYFFHRLVMEGMARGKFMFPIGTGGHPLGEGRYYDFIGINY
FT                   YTRDIIKFTLNPASLFARMEVKEGADTSDLGWEIYPVGLKRVCRKYYEEYQAPVFITEN
FT                   GICDKGDTKRGHFIYDHLKEVVKLINEGIPVERYYYWTLIDNFEWIEGESARFGLIHND
FT                   FKTQKRSIRISGYFYGKICKTKEITPEMERIYL"
FT   gene            complement(519345..520751)
FT                   /locus_tag="Hore_04830"
FT   CDS_pept        complement(519345..520751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_04830"
FT                   /product="MATE efflux family protein"
FT                   /note="PFAM: MatE; MviN-like protein; MatE; TIGRFAM:
FT                   putative efflux protein, MATE family"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_04830"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69241"
FT                   /db_xref="GOA:B8D214"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:B8D214"
FT                   /protein_id="ACL69241.1"
FT                   /translation="MDTYKEKRDLIIKGNIVKAILALAGPIMLNNLIQTIYNLTDTYWV
FT                   GQLGGTEVAAITLIWPIVFFLLALGFGINIAGTSLISQYTGADDKENATRVSGQIVSFS
FT                   LYFSIIIGIIGLFVAEPIIKMMGGEGRLLELASNYLKIIFAGMPAIFLFLAFTSIKQGQ
FT                   GDTVTPMKYSAISVALNMVLDPIFIFGLDLGVRGAALATIFSRSVFAIYAIYTLFYRKT
FT                   GIQLHLKHLILKPNLLKKIIKIGLPSSLGQSSAALGFIFLNAFIISFGKSTLAAFGIGN
FT                   RINSVILMPAMGIGNALATIVGQNLGADQIKRARQAVKTSAVLTTVLLTSGGIILYPFV
FT                   PTIIRAFNTEPAIVSQGTFYLRLISLSLPLMGFFQIFVGTFQGSGHTLMAMFIMTGRLW
FT                   ALRIPLIILFKKYTDWGSSSVWYAMVLSNAIISLVGFIMYLTGKWQKKVIKKKPPLTGS
FT                   EVDQNLDIDN"
FT   gene            521261..522520
FT                   /locus_tag="Hore_04840"
FT   CDS_pept        521261..522520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_04840"
FT                   /product="peptidase M23B"
FT                   /note="PFAM: LysM domain; Peptidase family M23; LysM
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_04840"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69242"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:B8D215"
FT                   /protein_id="ACL69242.1"
FT                   /translation="MKRIFVILFILVVILTVPTVNYLQGEHESDNGESIVAGNSSQIGH
FT                   SENTPVSDSSTLKDTGTGIDKVNNSNHIINNNSDSNIDSRNNNNNKVNSSNKASSGLNE
FT                   NNFSAGSDGIRDDNDDDNDSFVNNGKVNEGVNTDGKVNKSSTDLKVEITGVGGPDNLQP
FT                   GKNNNDDRVLVGEARPRIELPLMDRIKKHRVRKGDTLWTIARKYDIDIDTLIGGNDITN
FT                   MNRIKPGDVLNILPVKGILYKISPGESLWEISRKFDVSMDRIAEANNIQNPDLVQIGTL
FT                   LILPGAKPEFSYQDRLNSKLIKPVHARISSYYGMRWGRMHEGIDYAVPTGTRIRAASHG
FT                   KVVYSGWARGYGLTIIIEHRKGFRTLYAHNSKLLARSGEWVNRGEVIALSGNTGRSTGP
FT                   HLHFEVQVNGRPVNPLNYLK"
FT   gene            522998..525478
FT                   /locus_tag="Hore_04850"
FT   CDS_pept        522998..525478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_04850"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /note="PFAM: Heavy-metal-associated domain; E1-E2 ATPase;
FT                   haloacid dehalogenase-like hydrolase;
FT                   Heavy-metal-associated domain; TIGRFAM: ATPase, P-type
FT                   (transporting), HAD superfamily, subfamily IC; heavy metal
FT                   translocating P-type ATPase; copper-(or
FT                   silver)-translocating P-type ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_04850"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69243"
FT                   /db_xref="GOA:B8D216"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR006122"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B8D216"
FT                   /protein_id="ACL69243.1"
FT                   /translation="MAEEKTKKSTLEIEGMSCASCALNVEKALEKAEGVKMARVNFASE
FT                   KAYLEYDPEMVDEEKLAEVVRATGYDVKDEKERVTLDIGGMTCAGCAATVEKALKGTEG
FT                   VYEANVNIATEKGTVEYDPSILTKNDLKKVVANSGYEVIGFEGDNREVEQDDDLRKVEE
FT                   ARWKMWGTWAFTIPIIAWMIPEMFFGITWPGQTIFNLGMILLAVPPLFIFGRKTFRTAY
FT                   RAVSHGGANMDVLIAMGTGAAFITGPAVFFTPIANYAGVAAMIMAFHLTGKYIEENAKG
FT                   RASQAIKKLLELGAKKATILEDGEEKEVPVEEVKPGDLMLVRPGEKIPTDGEIIEGRTT
FT                   IDESMATGESMPVERKKGDEVIGATVNQNGLIKVKATRVGKDTFLSQVIKMVEEAQGTK
FT                   VPIQEFADRITGIFVPAVLITATLTFILWLIFPGFFREIGFWAQDYLPWVNPELETFTL
FT                   AIFATIAVLVIACPCALGLATPTALMVGSGMGAENGVLIRNGEAIQTMKDVHTIVFDKT
FT                   GTITKGQPEVTDIITAQNYSHRKLLKLAAGVEAGSEHPLAIAILNKAREENVKPPEIKG
FT                   FESITGKGVKGRIDGENVLVGSRRLMEENDVDLSGFIRDLNRLEEEAKTAIIVAREKEV
FT                   IGIVAIADALKEDSIKAIRELKESGLKTAMITGDNERTARAIARKVGIDYVVAGVLPDG
FT                   KVEEIRKLQRKSGVIAMVGDGINDAPALTQANVGIAIGTGTDIAIESSDITLVRGDLSA
FT                   VVTAVKLSRATFRKIRQNLFWAFIYNTIAIPVAIAGLLHPVIAEIAMATSSITVVTNAN
FT                   LLRRVNIKPDYMKN"
FT   gene            525669..528281
FT                   /locus_tag="Hore_04860"
FT   CDS_pept        525669..528281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_04860"
FT                   /product="DNA polymerase I"
FT                   /EC_number="2.7.7.7"
FT                   /note="PFAM: 5'-3' exonuclease, C-terminal SAM fold; DNA
FT                   polymerase family A; 5'-3' exonuclease, N-terminal
FT                   resolvase-like domain; TIGRFAM: DNA polymerase I"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_04860"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69244"
FT                   /db_xref="GOA:B8D217"
FT                   /db_xref="InterPro:IPR001098"
FT                   /db_xref="InterPro:IPR002298"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR018320"
FT                   /db_xref="InterPro:IPR019760"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="InterPro:IPR020046"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B8D217"
FT                   /protein_id="ACL69244.1"
FT                   /translation="MKKKLYLLDGQSLAHRAFYALPLLSTSRGEYTNAVFGFTRMLLKL
FT                   LDEEKPDLIAVAFDKKAPTFRHKEYKEYKAHRKKMPEELKPQLSLIKEVLKSFSIPIIE
FT                   IEGFEADDIIGTMARKGEEEGFEVVIVTGDRDALQLVTEDVSVMYTKRGISDIVRYDLN
FT                   KVRERYELEPQQLIDMKGLMGDSSDNIPGVPGIGEKTAIKLLKEFSSLEEILDNIDKVS
FT                   GKKRKENLQKYADQARLSKRLGEIKVDVPLDVELDECHLGKFHKKNIRELFERLEFASL
FT                   LNRFKEKTSISIDDISVKELDRKGLENICDKARNLGKLGLTLRLNNYTTPVRAHASQGI
FT                   ISLGEGNLYIFTDINEAISILKPILTDISVKKYILNSKECTVFLKKHDIELEGLVFDPL
FT                   LAYYLLKPSGKLPGLRDLLDQELSLSLPEDIKEDNLYLVFMDNIFKLAEGMVPKLEDME
FT                   LIELFNDIEIPLITVLAELEYNGIKVDAEYLESLSRKWEEELNGLESKIHELAGEKFNI
FT                   NSPKQLGGILFEKLGLPVIKKTKTGYSTGAKVLEKLEDKHPIIPLISEYRQLMKLKSTY
FT                   VDALPPMINPDTGRLHTSFNQMVTATGRLSSTEPNLQNIPVRTDEGREIRRAFITENED
FT                   WVLLAADYSQIELRVLAHISDDEGLKAAFNTGQDIHTQTASEVFEVEPDEVTPNMRRHA
FT                   KVINFGIAYGMSPYGLARDLGISRQEASDYINKYFERFTGVKDYMERVVTEAKTKGYVT
FT                   TIFNRRRYIPEINSRNYHRRSFAERTAINTPIQGTAADIMKLAMIKVYNRLKENGSPAR
FT                   ILLQVHDELILEVPREDLTEMARIVKSEMEKAVDMKVPLVVNLESGPNWLNKEELDIE"
FT   gene            528296..529120
FT                   /locus_tag="Hore_04870"
FT   CDS_pept        528296..529120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_04870"
FT                   /product="formamidopyrimidine-DNA glycosylase"
FT                   /EC_number="3.2.2.23"
FT                   /note="PFAM: Formamidopyrimidine-DNA glycosylase H2TH
FT                   domain; Formamidopyrimidine-DNA glycosylase N-terminal
FT                   domain; TIGRFAM: formamidopyrimidine-DNA glycosylase (fpg)"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_04870"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69245"
FT                   /db_xref="GOA:B8D218"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR015887"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/TrEMBL:B8D218"
FT                   /protein_id="ACL69245.1"
FT                   /translation="MPELPEVETVVRGLKELIKGVKINKVIIRETKLLVYPDPDTFIDL
FT                   VEGSRVIDVLRRGKYILIKLDNNRFLVFHLKMTGQLVVYERNNKYDKHTHFVFELEDGR
FT                   DLRFNNMRKFGRVYLVTKGEFDKAGSLADLGPEPLSDEFTVDEFADIIKRRKGNIKGLL
FT                   LNQKFIAGLGNIYADEALFEAGISPERKADSLDDSEIERLYHAIRKVLKMGIKYGGTSM
FT                   KDYVNARGRIGEFQNKLKVYRKTGEECVNCGHEIQKKVIRGRSSHYCPGCQK"
FT   gene            529184..529843
FT                   /locus_tag="Hore_04880"
FT   CDS_pept        529184..529843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_04880"
FT                   /product="Sporulation protein YtaF"
FT                   /note="PFAM: Domain of unknown function DUF; TIGRFAM:
FT                   putative sporulation protein YtaF"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_04880"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69246"
FT                   /db_xref="GOA:B8D219"
FT                   /db_xref="InterPro:IPR003810"
FT                   /db_xref="InterPro:IPR014205"
FT                   /db_xref="UniProtKB/TrEMBL:B8D219"
FT                   /protein_id="ACL69246.1"
FT                   /translation="MEFWTVCILAIAISVDGFSVGLTYGLRKIKFDLIPLLINSVISAL
FT                   AVYITGTLGNSLAGLIEQEMAETLGGIMLIIVGGWLVYSNIIDYNRNNSSPKKLIHKDS
FT                   EGAQLVWSLNLKPLGIIINILREPVKADFDNSGSINQFEALMLGLALALDAVGAGLGAG
FT                   LAGFFKPYISLIIGVMTLLFSGVGFYLGSLLDGMLPGKLEVMPGLVIMFLGFLRFF"
FT   gene            529858..530811
FT                   /locus_tag="Hore_04890"
FT   CDS_pept        529858..530811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_04890"
FT                   /product="Dephospho-CoA kinase"
FT                   /EC_number="2.7.1.24"
FT                   /note="PFAM: Dephospho-CoA kinase; MGS-like domain;
FT                   TIGRFAM: methylglyoxal synthase; dephospho-CoA kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_04890"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69247"
FT                   /db_xref="GOA:B8D220"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="InterPro:IPR004363"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR018148"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:B8D220"
FT                   /protein_id="ACL69247.1"
FT                   /translation="MIIGLTGGIASGKSTVSNILKELGACIIDADRIAHKILKKGQPGW
FT                   RGVVGYFGTDIIDDKGEIDRKKLGKLVFNKPEERKKLEKITHPIIISQIKDEIVSLKNK
FT                   CNLIILDAPLLFEANLDRLVDRVWVVYVDRDIQLRRLQERDGLSREEAILRIETQMPLK
FT                   EKARLADIVIDNNGSIKKLKKQVIKHWRELKMKRIALIAHDEKKDDIIEFARKHYDLLK
FT                   KCKLIATGTTGKMIIDKVGLEVERMLSGPLGGDQMIGSRVAQEKLDGVIFLRDPLTAQP
FT                   HEPDITALLRVCDVHNVPLATNLATADLILHKLLEE"
FT   gene            531514..533319
FT                   /locus_tag="Hore_04900"
FT   CDS_pept        531514..533319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_04900"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: Bacterial extracellular solute-binding
FT                   proteins, family 5 Middle"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_04900"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69248"
FT                   /db_xref="GOA:B8D221"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:B8D221"
FT                   /protein_id="ACL69248.1"
FT                   /translation="MSKRVGVLLLTLLLVFSVFGVVDAVNNPDTYVHVTIGDQSTLDPH
FT                   YSYDTGSSELIYQVYETLIDYKGSSVTEFKPLLSTKVPSVENGLIKDGGKTYIFPIRQG
FT                   VKFSNGNPLTPEDVEYSFERALILDRAYGPIWMFYEPLFGLGSLSDLTKKVVGVEDPKK
FT                   LTPEQSAKVYAEIDKKIEVDGNNVVFHLENPYPPFLNILAKGASWASILDKEWSIEQGA
FT                   WDGSPETIAKYHDPVKEDDPLFNKMMGTGPFILVEWVNGDHVIFKRNDNYWREPANFKT
FT                   VIIKNVDEPTTRILMLKRGDADSISLDYQYFNQIEGVEGIKITRGIPVLQNMTMLFNWD
FT                   INSKGNEYIGSGKLDGNGIPPDFFTDVHVRRAFSYCFNYEAFIEQVRDGQSMKLRGPIV
FT                   SPLLGYDENSPVYKLDLEKAEEEFKKAWDGKVWEKGFELTITYNAGNMARKTAADIFKT
FT                   YIEQINPKFKVNTQVVQWSTFLDQSHRGLLPLQIGGWLADFPDPHNFVQPFIHSQGYYA
FT                   GKRGENYQKWAVEVGIDDLIEKGITTQDKEEREKIYKKLQQMSHDYAIDVWIDQPLSAR
FT                   IERSWVKGWYPNSMRPGQDFYILDK"
FT   gene            533547..534578
FT                   /locus_tag="Hore_04910"
FT   CDS_pept        533547..534578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_04910"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: Binding-protein-dependent transport system
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_04910"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69249"
FT                   /db_xref="GOA:B8D222"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B8D222"
FT                   /protein_id="ACL69249.1"
FT                   /translation="MTSYIIRRLLILPIILLGVTLLIFSMIMCLSPYQRVANYVTDPTQ
FT                   LKGGDIDLLVKKYGLDDPWYQQYGRWLNNLIHGDLGWSEAAGAPVTQAIKERFPATVEL
FT                   AILAVIPVVMGGIWLGVFSAVHHNDIWDHITRVFAIIGWSFPTFVFGLYILMFFYGVLG
FT                   WTPPGRLSSWAMELANTSEFVRYTGLNILDGILNGNLAFVWDAVRHLIAPVLTLAVVWW
FT                   AYILRITRSSMLETLRKDYIRTARAKGVKENVVIQKHARRNALIPVVTVAGPMVLGLLG
FT                   GIVTVETVFGYRGLGLLAYETATRLDHTGILGVAMYFGLLLILINLAVDVSYAIIDPRI
FT                   RLE"
FT   gene            534585..535463
FT                   /locus_tag="Hore_04920"
FT   CDS_pept        534585..535463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_04920"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: Binding-protein-dependent transport system
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_04920"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69250"
FT                   /db_xref="GOA:B8D223"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B8D223"
FT                   /protein_id="ACL69250.1"
FT                   /translation="MTWQELFKRLLKNKLSLFGLIIIVFFALIAIFAPFIAPPADPDDP
FT                   YAIPRSGWIMEPTPPDEDNIFGTTEGSYDIFYGMIWGTRTAFRIGFIVVGISTIIGVII
FT                   GTISAYYGGWVDEIVMRITDIFMSIPFLVSALVLTAILGKGLDNVMIALIVFGWMGTAR
FT                   LMRSQVLEIKAEEFVQAASALGAGDLRIIFRHVLLNCIFPVVIQASMRMGSMVITAATL
FT                   SFLGVGAPPGYADWGQMISFARNWIIGAQGNALSYWYTLVIPGTAITLFCLSWNLIGDA
FT                   FRDILDPKLQN"
FT   gene            535485..536492
FT                   /locus_tag="Hore_04930"
FT   CDS_pept        535485..536492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_04930"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="PFAM: ABC transporter; Oligopeptide/dipeptide
FT                   transporter, C-terminal region; TIGRFAM:
FT                   oligopeptide/dipeptide ABC transporter, ATP-binding
FT                   protein, C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_04930"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69251"
FT                   /db_xref="GOA:B8D224"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8D224"
FT                   /protein_id="ACL69251.1"
FT                   /translation="MAREKLIDVNNLKTYFYTEQGVSKAVDGVDFEIYPGETLGLVGES
FT                   GCGKSVTSLSIMGLIPNPPGKIVDGEILFNGKDLTKLSYEELRQIRGNDISMIFQEPMT
FT                   SLNPVFTVGDQISEAILIHEDVTKEEAMDRAVEMLRKVGIPLPEQRVNEYPHQLSGGMR
FT                   QRVMIAMALACNPKLLIADEPTTALDVTIQAQILDLINELKEKYQMSIMMITHDLGVIA
FT                   EISDRVAVMYAGKIVEYTDVKTLFEDPKHPYTWGLINSIPKMNEEVERLVTIPGIVPSP
FT                   YDLPTGCSYNTRCPLADEKCRSEEPVMEEIAEGHKVRCWHYERVAELKQKIETA"
FT   gene            536516..537496
FT                   /locus_tag="Hore_04940"
FT   CDS_pept        536516..537496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_04940"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="PFAM: Oligopeptide/dipeptide transporter, C-terminal
FT                   region; ABC transporter; TIGRFAM: oligopeptide/dipeptide
FT                   ABC transporter, ATP-binding protein, C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_04940"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69252"
FT                   /db_xref="GOA:B8D225"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8D225"
FT                   /protein_id="ACL69252.1"
FT                   /translation="MAEADNVLLKVRNLKKYFPVKAGVFKKTVGYVKAVDDISFDIKEG
FT                   ETLGLVGESGCGKSTTGRTILRLLEATSGRVEFEGKDVLSLDRKELREMRKEMQIIFQD
FT                   PYASLNPRMKVADIVGEPLDIHNLATDKNEKYEKVKELLSNVGLNEEQMNRYPHEFSGG
FT                   QRQRIGVARALAVNPRLIIADEPVSALDVSIQAQVINLLQDLQEQYGLTYLFIAHDLSV
FT                   VKHISDRVAVMYLGKIVELANKKDIYDNPLHPYTQSLLSAIPIPDPNYDKKRIVLKGDV
FT                   PSPVDPPSGCRFHPRCPKAMDICSQVEPEFKDYGNGHFAACHLLD"
FT   gene            537596..538321
FT                   /locus_tag="Hore_04950"
FT   CDS_pept        537596..538321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_04950"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_04950"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69253"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="UniProtKB/TrEMBL:B8D226"
FT                   /protein_id="ACL69253.1"
FT                   /translation="MSNFDWKTKKEKILENARRDPFLKIEELAKKANTTPRYVRTILSE
FT                   ANLSLMELREQYARKMEDKNTKISEKLLLGQLLNVAFSSKVKPLSKDELLFNNPQDLDN
FT                   LSGDLNREYFYQSYLHLLKETPWSVSTIIFNNEAFEEKFLKGKEDLFANDLYTKICRCL
FT                   ESSKIQVSDIIIDVEISNAQLAATLKLPPLSPVFRVKQILKDNDDEIALFLAYFNSKQV
FT                   TLSFSYNRGLIIDRKNLAG"
FT   gene            538428..539108
FT                   /locus_tag="Hore_04960"
FT   CDS_pept        538428..539108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_04960"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_04960"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69254"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="UniProtKB/TrEMBL:B8D227"
FT                   /protein_id="ACL69254.1"
FT                   /translation="MPVDELTKKEQIINFAQSDPFLKISDIAEYVQTTPRYVRTILSEA
FT                   NISLMKLREKYARNMEKRLENTNYQELQAKVTLREEYSYNNLNSGKIMVESEDESRFPE
FT                   IKRIKEGDELIKIYQVQYVDETPYCLHELVTFMEKDINRERVKNLDSIYDLLGRKGINR
FT                   LQFMNNVITLEKPGKTLKNIFEDEVDLIVSKRTVLLNKIPIGIEKVYLRGDLTKVEFPG
FT                   EIVV"
FT   gene            539625..540926
FT                   /locus_tag="Hore_04970"
FT   CDS_pept        539625..540926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_04970"
FT                   /product="Xanthine/uracil/vitamin C permease"
FT                   /note="PFAM: Permease family"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_04970"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69255"
FT                   /db_xref="GOA:B8D228"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR026033"
FT                   /db_xref="UniProtKB/TrEMBL:B8D228"
FT                   /protein_id="ACL69255.1"
FT                   /translation="MLEKMFKLKENNTSVSTEVTAGITTFMTMAYIIFVNPSILHNGAG
FT                   MPFDGVFIATIAGIILGTLCMAFLTNYPFALASGMGLNAFFAFVVVKGMGVSWQVALGL
FT                   IFLEGIIFIVLSVLPVRKMIVNSIPMGLKTAISAGIGLFIAFIGLQNAGIVVDDPNTLV
FT                   TIGNIFTGPALVALVGIIVTGILHSRGVKGSLLIGIIVATVFGLLNGVTTPPEDIIAMP
FT                   RMAEWSQVLFKLDIAGALNFGMIAVLLTFLFVDMFDTAGTLVGVSQQAGYLDEDGNLPK
FT                   ASRALLADAIGTTGGAIFGTSTVTTYVESASGVAEGGRTGLTGVVVSILFFLCLFFKPL
FT                   VAIVPGAATASALIIVGTMMMSNITKLDWGDFTEVLPAFITMIAMPLTYSIANGIALGF
FT                   ITYPLIKLFTGKEKEVHWLVYVLGVIFIAYYVWV"
FT   gene            complement(541234..542208)
FT                   /locus_tag="Hore_04980"
FT   CDS_pept        complement(541234..542208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_04980"
FT                   /product="uncharacterized conserved protein"
FT                   /note="PFAM: Protein of unknown function (DUF1722); Protein
FT                   of unknown function (DUF523)"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_04980"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69256"
FT                   /db_xref="InterPro:IPR007553"
FT                   /db_xref="InterPro:IPR013560"
FT                   /db_xref="InterPro:IPR017087"
FT                   /db_xref="UniProtKB/TrEMBL:B8D229"
FT                   /protein_id="ACL69256.1"
FT                   /translation="MLDNQFPKPNVVVSKCLGFEACNYNGHQFNNKFISMLKQFVNFIP
FT                   VCPETAIGLPSPRQSLRLIADGDEVRLVQPAEDRDLTGDMLSFSHDFLNSLNDVEGFIL
FT                   KERSPSCGLKDIKIYHKEINNVTGKKTSGLFAGAVLATFPDTAIESEGRLTNLRIREHF
FT                   LTRLFTLARFRETKKQQTMGGLVNFQTINKFLFMAYNQKEMRILGKIAANNEKLPVSEV
FT                   FKKYEKHLNKLLSRPPRYNSNINVLMHGLGYFSDELTTEEKAFFLDTLQKFRNKKVPLS
FT                   VPQNIIRSWAIKYKDDYLLKQTYFAPFPEELIARTDSGTPKNF"
FT   gene            complement(542198..543598)
FT                   /locus_tag="Hore_04990"
FT   CDS_pept        complement(542198..543598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_04990"
FT                   /product="Deoxyribodipyrimidine photo-lyase"
FT                   /EC_number="4.1.99.3"
FT                   /note="PFAM: DNA photolyase; FAD binding domain of DNA
FT                   photolyase; TIGRFAM: photolyase PhrII"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_04990"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69257"
FT                   /db_xref="GOA:B8D230"
FT                   /db_xref="InterPro:IPR006050"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR032673"
FT                   /db_xref="InterPro:IPR036134"
FT                   /db_xref="InterPro:IPR036155"
FT                   /db_xref="UniProtKB/TrEMBL:B8D230"
FT                   /protein_id="ACL69257.1"
FT                   /translation="MIHNSRIKPLNKKNINPRGEYILYWMQASQRTEYNHALEYAIIEA
FT                   NKSNKPLLVYFGIDTSFPEANRRHYQFMLEGLQEVKKSLYNRGIKMIIESVPPDKDILK
FT                   FAEYASLLVVDRGYLKIERTWRNNVSQQIDCPLIQVESNVIVPVEVASSKEEYAAYTIR
FT                   KKLYRKLPEFLHPLHTRTIRVSSLDLKLSFINYKDIPLDNVTLCLDRLKVDNTVPEVNL
FT                   YRGGTTRALALYNDFLHNKIKDYHEYRNDPVKNWISNMSPYLHFGQVSPLHLIIKGNNY
FT                   CKKHEIDKGFKEFFEELVIRRELSFNFVYYNPDYDSIKSLPDWAKKTLKEHENDTREFS
FT                   YSLQELEDAKTHDPYWNAAQKELLLTGKIHGYMRMYWGKKILEWTSSPDLAYKYALYLN
FT                   NKYALDGRDPNGFAGVAWCFGKHDRPWPGCNIFGKVRYMSSGGLKRKFKIDLYLKRIHN
FT                   LEEASHVG"
FT   gene            complement(543749..544492)
FT                   /locus_tag="Hore_05000"
FT   CDS_pept        complement(543749..544492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_05000"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_05000"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69258"
FT                   /db_xref="InterPro:IPR023875"
FT                   /db_xref="InterPro:IPR025404"
FT                   /db_xref="UniProtKB/TrEMBL:B8D231"
FT                   /protein_id="ACL69258.1"
FT                   /translation="MVIYLYDGSFEGLMTAINHALENNIEPDRIVRKNSYNNSLFSKPV
FT                   YIKTDQELSLKLSTELKIRLGQRALKEIYYSFLSEKPNVEKNIYHYIKLGLVKGKDIHN
FT                   VLTDEWVLEVKKMARKVSRESHRMLGLIRFRNLPEDIYYAPIKPDFNILTILAPHFARR
FT                   LPSQKWVIHDKKRELAAIYNKTEWLIGDLSSDLKIQPDNEELAFQKMWQEYFKSVAIPN
FT                   RKNKKLQRQFMPKKYREYLIENPES"
FT   gene            complement(544592..545839)
FT                   /locus_tag="Hore_05010"
FT   CDS_pept        complement(544592..545839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_05010"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_05010"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69259"
FT                   /db_xref="GOA:B8D232"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023874"
FT                   /db_xref="UniProtKB/TrEMBL:B8D232"
FT                   /protein_id="ACL69259.1"
FT                   /translation="MEILQKIKILSAAARYDVSCSSSGSRRRNSPDGMGNTASGGICHS
FT                   WSDDGRCISLLKILFTNYCIYDCAYCINRISNDIPRASFTPEEVARITVNFYKRNYIEG
FT                   LFLSSAVHKNPDYTMERLVKTARLLRKDYKFNGYIHLKAIPGADLQLINEAGHYADRLS
FT                   VNIELPTRKTLKKLAPQKKVENIVTPMKFIGKNIKTNKYERKKFRNAPSFVPAGQSTQL
FT                   IVGASPEPDYTILKLSENLYKKYYLKRVYYSAYIPVAKHPRLPALKKPPLLREHRLYQA
FT                   DWLIRFYGFTSRELLTPEKPNLDTRFDPKVNWALNHFYLFPVEINTAPYETLLRVPGIG
FT                   LKSARRIVKARKEAHLNYFNLSKLGVVLKRARFFITCKGKYYGGIPFEKDLIMDRLSGN
FT                   DLSSTSVQLSLFTSGP"
FT   gene            546069..546653
FT                   /locus_tag="Hore_05020"
FT   CDS_pept        546069..546653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_05020"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: Bacterial regulatory proteins, tetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_05020"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69260"
FT                   /db_xref="GOA:B8D233"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041490"
FT                   /db_xref="UniProtKB/TrEMBL:B8D233"
FT                   /protein_id="ACL69260.1"
FT                   /translation="MKGQEALTTRDEILKAARNLFAERGFHEASMSSIAKEAGVGKGTL
FT                   YWYFDSKQELFKELIKTGGKIIEDKIHKWVKEETSPEEFIKMFIETGLKHLSNNKRIIR
FT                   ALFSSDELGREFKRELFETRYRIINSLEMVIQQGINEGKFREVSTRHAAAAIIGIINGM
FT                   TPALLCDTEDDIEELLGFSFDFIMKGLGKGD"
FT   gene            546660..548075
FT                   /locus_tag="Hore_05030"
FT   CDS_pept        546660..548075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_05030"
FT                   /product="outer membrane efflux protein"
FT                   /note="PFAM: Outer membrane efflux protein; Outer membrane
FT                   efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_05030"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69261"
FT                   /db_xref="GOA:B8D234"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:B8D234"
FT                   /protein_id="ACL69261.1"
FT                   /translation="MFLNKRYIYFIVILMMFSILVPLDKIYAEEVLTLTEVLQAGLKEN
FT                   PDIKNTRLDLENARLDLSISWRNLLPEVNLQSAYTRLGEPPQVPGFQYQRVETGIPGEY
FT                   PDSDIVYLYPEMIEGPQDNYTTTITLNQPLFMGGRLLLGIDQARKGVELARSVLEQKKE
FT                   DTLYQLINTYYNTLLLSDRLQVEEEGLDLIREQKEVIRAGIEAGTILKTDLLQVEIEEN
FT                   KAWQRLQKVKNQYKLALKQLYVMSGLDKSVLKEQEVILKKPQFKPEVNINDLSSLIKLA
FT                   KENRPDLKMLSINEEMIKNNITMEKRSNWPSFMVSGNYSWQGEELKFEDPEWTVTISGS
FT                   LPLFQGGKSGKRLKKINNEFDKIREKKQYVSEMVEVEVTNVFNKINELEENVVIQDQNL
FT                   NKAQENLRLVNSRYKVGMVTNLDVMNARLLYRQSKLGLLQAEFNYKLAMYELLYKTGRL
FT                   GEFVEEVVNNETK"
FT   gene            548062..549591
FT                   /locus_tag="Hore_05040"
FT   CDS_pept        548062..549591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_05040"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="PFAM: HlyD family secretion protein;
FT                   Biotin-requiring enzyme; TIGRFAM: RND family efflux
FT                   transporter, MFP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_05040"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69262"
FT                   /db_xref="GOA:B8D235"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:B8D235"
FT                   /protein_id="ACL69262.1"
FT                   /translation="MKPNKPVIVTLMFLMLVTLLSGQVFGETQIPVSVIEPGVKSIRVE
FT                   ESVTGVIKPYQVVNLSTKTGGIVDEILVEVGQRVEAGEPLLKLEQEELKAQVKQARAQL
FT                   AMARASFKKIKDGASPEDVEKVRGAYNQALASYNGARKALNIIKDMYEDKTSQEQQLTA
FT                   ARTKLDTASKKLELAREQLKQTEVSYEQAEKSYKRMEYLYEEGVITESEFDKVKTQYEN
FT                   AKSALKSAELGLEQAKVNYEGALKGYNLVKEIYENPRSLEQQLLNAETQYEVAKANLQI
FT                   AKANLDQVLMGAEEEDLQSARAQVEQAEVALELANIRLRDSVLESPFPGLIAAVNINEG
FT                   EMAPPGNPVIKVVNLDKVYAEIEVSASTVTSLETGDLVRVEILPLANMSMTGKIETIAP
FT                   DVDPRSRAYPVKVVIPNSKNMIKGGMYCRVYLTLKESNRGVVVPVDSVLDLEEKPYIFV
FT                   VNNGKAEKRFIETGLINDTEVQVIDGLNPDERVVVKGQYKLTDGAPVKVVN"
FT   gene            549593..552628
FT                   /locus_tag="Hore_05050"
FT   CDS_pept        549593..552628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_05050"
FT                   /product="acriflavin resistance protein"
FT                   /note="PFAM: AcrB/AcrD/AcrF family; TIGRFAM: heavy metal
FT                   efflux pump (cobalt-zinc-cadmium); The (Largely
FT                   Gram-negative Bacterial) Hydrophobe/Amphiphile Efflux-1
FT                   (HAE1) Family; ATP synthase subunit 6 (eukaryotes),also
FT                   subunit A (prokaryotes)"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_05050"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69263"
FT                   /db_xref="GOA:B8D236"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:B8D236"
FT                   /protein_id="ACL69263.1"
FT                   /translation="MKLPDLAIKRPVTTTMIVLLAVLLGFISLTRVNLDLFPDMSFPIA
FT                   AVITEYEGAGPHEVENMVTKPLEQALASVTNIKTVSSTSGKNQSTVLVEFDWGTDMDKA
FT                   TMNMREKIDLMEDYLPDEASNPLIFKFDPSLMPVMELGVSGEMDLASLKKYIDDNIAPR
FT                   LERLQGVASVELIGGKERIILVSLDRDKMKNYNVAFTSVVNSLLMENINLSGGSVRRGN
FT                   RELLVRTTGKFKSLDDIKNILIPTSSGSVPLKDIATVKDTFKKVDSKARMNKEPGVVLL
FT                   IQKQTDANTVKVSSRIKKELASLKEETNGSLTIIPIMDQADYIERSIGNVGLNAIIGGI
FT                   LAVLILFYFLRNFSSTLIIATAIPVSVITTFLLIYFGGLTLNMMTLGGLALGIGMLVDN
FT                   AIVVLENIFRYHQAGLGKVKAASRGSTEVGMAITASTLTTIIVFLPIVYVEGIASQLFK
FT                   ELALTVTFSLLASLAVALTLIPMLSSKIIASANNKEVSRFEKFLEKTRDKYRDMLRWCL
FT                   GNKKKVVLGLVIVFVASLTLIPLIGAEFIPEMDQGQFTITAELPLGTSLDITDKVSARI
FT                   EEEVLKIPEVKTILASIGTSGQMITSPSPETTSIYVQLKDLSRRERSTSEVMEELREKL
FT                   VYPGVDIKIEALDYMAAGMGNKPISIMVKGDDLNQLERLVKQIKEQMKTVPGVREIEDS
FT                   ITRGRPELHINVDRVLAARYGLRVSQVATAVKTAVDGRTVTRYEVGGEEFDIRVKLKDD
FT                   ELTTPEELEDLLITSSAGFKVPLKDIASLDIEKGPVEILRDDQVRYASITASLFGVDLG
FT                   TTMERIQKKISNNVRLPDGYEIEYGGQFKEMMSSFDSLAFAFILAVVLVYMVLAAQFES
FT                   FLYPLVIMFTVPMSIIGVVLGLFITRNHISVPAIIGVIMLAGIVVNNAIVLVDYINTLR
FT                   KRGHSLKEAILEAGPVRLRPVLMTASTTILGLLPLALGIGEGTEVQEPMAVVVIGGLAV
FT                   STILTLFIVPVLYSVFTVEKEA"
FT   gene            552786..553028
FT                   /locus_tag="Hore_05060"
FT   CDS_pept        552786..553028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_05060"
FT                   /product="FeoA family protein"
FT                   /note="PFAM: FeoA domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_05060"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69264"
FT                   /db_xref="GOA:B8D237"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR038157"
FT                   /db_xref="UniProtKB/TrEMBL:B8D237"
FT                   /protein_id="ACL69264.1"
FT                   /translation="MSTKKVSLNKLKQGETGTVVRLIGGHSFKSKLDALGIREGKKITK
FT                   IGGMIMKGPVTVKVGNTRIAIGNGMADKIIVEIPE"
FT   gene            553067..554890
FT                   /locus_tag="Hore_05070"
FT   CDS_pept        553067..554890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_05070"
FT                   /product="Ferrous iron transporter protein FeoB"
FT                   /note="PFAM: GTPase of unknown function; Ferrous iron
FT                   transport protein B C terminus; Nucleoside recognition;
FT                   Nucleoside recognition; TIGRFAM: GTP-binding conserved
FT                   hypothetical protein; small GTP-binding protein domain;
FT                   ferrous iron transporter FeoB"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_05070"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69265"
FT                   /db_xref="GOA:B8D238"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR011640"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030389"
FT                   /db_xref="UniProtKB/TrEMBL:B8D238"
FT                   /protein_id="ACL69265.1"
FT                   /translation="MNVLLVGNPNVGKSIIFSRLTGTRVTSSNYPNTTVEFTEGYIKWQ
FT                   EKMVKIIDVPGTYSLKPNNRAEEVAVDMLEKGDLIINVVDATNLERNLNLTLQLLERDI
FT                   PVIVALNLFEEARHKGITIDVDKLQKLLGVPVIPTEAIKGNGIRDLIKYFDYREVSQRT
FT                   PLTKGERWKEIGRIVEQVQQIHHRHHTWLDWFDELSIRPLSGIPIAFIILSVLFFIIRF
FT                   IGEGLITYVTEPFFEIIYKPVVIYIGNLLNEGSFLYNILIGQTINGQIDFEQSFGLLTT
FT                   ALFIPLGAVLPYIVSFYLVLGLLEDSGYLPRLAVLTDNVMHRVGLHGFSVIPMVLAFGC
FT                   NVPAALAIRSLESRREKFITATLMSIAIPCMSQNAMIVSLLGRYGNRYIFTVFGMLFIV
FT                   WMMVGLILNKITPGFSTDLLLEIPPLRMPGPATTLKKLWMRFISFLREAVPYVLLGVFL
FT                   VNILYFSRGFEIITGLFGGLFNTIFGVPDEAVIALLLGFLRKDLAVGMLIPLGLSVKQL
FT                   VIASTVLVIYFPCAATFFVLIRELGIIDMLKSSMIMIFTTLVVGGFLNLFYHNGGISIT
FT                   GWSLILITFFLIYRYLPQSGGNNIKEDSFKG"
FT   gene            554906..555904
FT                   /locus_tag="Hore_05080"
FT   CDS_pept        554906..555904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_05080"
FT                   /product="lipoate-protein ligase"
FT                   /note="PFAM: Biotin/lipoate A/B protein ligase family;
FT                   TIGRFAM: lipoyltransferase and lipoate-protein ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_05080"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69266"
FT                   /db_xref="GOA:B8D239"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004562"
FT                   /db_xref="InterPro:IPR019491"
FT                   /db_xref="UniProtKB/TrEMBL:B8D239"
FT                   /protein_id="ACL69266.1"
FT                   /translation="MEFKPEIIYSQSFNPWYNLALEEYLLNGVSDNEVILYLWQNDNTV
FT                   VVGRNQNAWKECRCKLLEEEGGKLARRLSGGGAVYHDLGNLNFTFLMKDSLYDLKHQLN
FT                   VILNAVKMAGIEAEFSGRNDLVVQGKKFSGNAFYKAKGSSYHHGTILVNSDFSKLMRYL
FT                   QVSSDKIRSKGVDSVRARVINLKEVNPDINIEKMKKLMEESFIKAYGDNIETSPEEINP
FT                   EKLPELDKLYQKYSSWEWRYGRTPEFDIKLVNRFDWGGIELNLALKNGVITESTIYSDA
FT                   MESDLIRKIASSLKGVPFRFGDINNRLTGLKEEEGKNIIDDLLTWLKNKIS"
FT   gene            complement(555977..556432)
FT                   /locus_tag="Hore_05090"
FT   CDS_pept        complement(555977..556432)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_05090"
FT                   /product="Rubrerythrin"
FT                   /note="PFAM: Rubrerythrin"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_05090"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69267"
FT                   /db_xref="GOA:B8D240"
FT                   /db_xref="InterPro:IPR003251"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:B8D240"
FT                   /protein_id="ACL69267.1"
FT                   /translation="MNSNFEPQQVFNPPLEITLELISRAVAGETTDRRFYRYLLNAAPN
FT                   EKERAIISGIREDELRHYELFRQIYRDITGRNPVPLGDDEFEEPENYLAGIEEAKLGEI
FT                   ETAAKYRQIYYGLRTREHRDKLFEIITDELRHADLYDYLYTRNFLNF"
FT   gene            556532..557035
FT                   /locus_tag="Hore_05100"
FT   CDS_pept        556532..557035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_05100"
FT                   /product="3-deoxy-D-manno-octulosonate 8-phosphate
FT                   phosphatase, YrbI family"
FT                   /EC_number="3.1.3.45"
FT                   /note="PFAM: haloacid dehalogenase-like hydrolase; haloacid
FT                   dehalogenase-like hydrolase; TIGRFAM:
FT                   3-deoxy-D-manno-octulosonate 8-phosphate phosphatase, YrbI
FT                   family; HAD-superfamily hydrolase, subfamily IIIA"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_05100"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69268"
FT                   /db_xref="GOA:B8D241"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR010023"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B8D241"
FT                   /protein_id="ACL69268.1"
FT                   /translation="MDKTIVEKAARINLIITDVDGVLTDGRIVLGNNGEEFKFFHVQDG
FT                   QGIKRAQKAGLKVAIITGRISKAVDRRAKELNIGEVYQGVNDKLIIYKKLCNKYNLKNE
FT                   EVAYIGDDIADLDVLKEVGFACSVKNGVSAVKEMVDYVTDREGGRGAVREVIDLILEAR
FT                   SNPV"
FT   gene            complement(557074..558234)
FT                   /locus_tag="Hore_05110"
FT   CDS_pept        complement(557074..558234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_05110"
FT                   /product="DNA methylase N-4/N-6 domain protein"
FT                   /note="PFAM: DNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_05110"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69269"
FT                   /db_xref="GOA:B8D242"
FT                   /db_xref="InterPro:IPR001091"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR017985"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B8D242"
FT                   /protein_id="ACL69269.1"
FT                   /translation="MNDSSTCNDNNINNYKIIRLKHKSNLHSSEIKAIDYINKFFNQDN
FT                   FYIEVNPGSVKIYLKKLDMKKLGRLIKEINDTSPFLLKIYRTIKNIKSYVIENNKRVYV
FT                   DYNREKKVKNRKKKERNRQKYFYARNHNFNVINQPLPEKYINKIICGDSEQILKEIPDN
FT                   SIDLILTSPPYNFGLDYKDSRDGYYWKSYFSKLFSIFKECIRILKYGGRIIINVQPLFS
FT                   DYIPTHHLISNFFIKNKMIWKGEILWEKNNYNCKYTAWGSWKSPSSPYLKYTWEFLEIF
FT                   AKGSLKKKGDKKNIDITGEEFKEWVSARWSIAPVRNMKKYQHPAVFPEELVYRVLKLFS
FT                   YKGDVILDPFNGTGTTTAVAHRLKRNYLGIDISPDYCNTARGRLNP"
FT   gene            complement(558227..559681)
FT                   /locus_tag="Hore_05120"
FT   CDS_pept        complement(558227..559681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_05120"
FT                   /product="amino acid permease-associated region"
FT                   /note="PFAM: Amino acid permease"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_05120"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69270"
FT                   /db_xref="GOA:B8D243"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:B8D243"
FT                   /protein_id="ACL69270.1"
FT                   /translation="MPENKHGLTSSRLTLLALGTVVGGSFFLGSAIAIKNAGPSIIISY
FT                   LLGGALVYVILYSLSEMTTSDPTAGSFRNYCENMYGPMAGFVVGWLYWTGLVLAMSSEA
FT                   IAVSAFLKKWFPQVSLPALGAVTIIAVTIINLLGVEKLSTLESGLAVVKLLAIVGFIVL
FT                   ALFLVAGLLPGRSPIGAGELLNEPLFPRGLAGIAGSMLIVIFTYARFEIIGLASSETIN
FT                   PHKTIPRAITYTVAGLVGLYTLAIIFLLPLIPTARLSEEVSPLVAALTRSGLGWAGDVI
FT                   NIVLITAILSTMLAATFGIARMLRSLADEGHAPGFLRDKGDIPYRGIIFSGLSMLTALV
FT                   LGFILPRRIYLFLVSSGGFAFLFVYLVILATHYKFRKIYGCPDEGKCRVPAYPYTTITS
FT                   SIGLLLIILSMPLIPGQGSGLYAGLILVSVYTGIYIIKEPEKARQFFTGINLNLSHKNV
FT                   LTEFSDEIIPEDKLNGKEDSGGKNNE"
FT   gene            560037..561044
FT                   /locus_tag="Hore_05130"
FT   CDS_pept        560037..561044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_05130"
FT                   /product="uncharacterized membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_05130"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69271"
FT                   /db_xref="GOA:B8D244"
FT                   /db_xref="InterPro:IPR038728"
FT                   /db_xref="UniProtKB/TrEMBL:B8D244"
FT                   /protein_id="ACL69271.1"
FT                   /translation="MVGAGFASGQEVLQFFGFYGLGGFGGLVLTIMLFVIYGYIILSLG
FT                   REYRARSHLEVIRYAGGRWLSKVIDGVITFFLFGALTAMVAGSGAIFLEQFGIPSLWGN
FT                   IAMIGASILTTLFGIGGVISAISFVVPLLLTGVFLATIASVIGALPVNIADLHQALPGR
FT                   APVPHWALSSVVYASYNIVLAVAVLAPLGSRVNDKRKLKYGAIFGGVGLGLGAMFILLA
FT                   ILLNIPRVLEYEIPMIYVAGNFAPWFQLVYSGILLAEIYTTAVGNLYGFVARLTDPEGK
FT                   KYRTYIILTGVAAFITSQLGFSNLVRYLYPAVGYAGLLLLGGLTLGMYRRVRNR"
FT   gene            complement(561302..562078)
FT                   /locus_tag="Hore_05140"
FT   CDS_pept        complement(561302..562078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_05140"
FT                   /product="SCP-like extracellular"
FT                   /note="PFAM: SCP-like extracellular protein; Bacterial SH3
FT                   domain; TIGRFAM: uncharacterized protein, YkwD family"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_05140"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69272"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="InterPro:IPR014044"
FT                   /db_xref="InterPro:IPR014258"
FT                   /db_xref="InterPro:IPR035940"
FT                   /db_xref="UniProtKB/TrEMBL:B8D245"
FT                   /protein_id="ACL69272.1"
FT                   /translation="MRKLKILIPLILAVLLVSCANESPTQESSIFQIGEVEYCRVTDDN
FT                   VNVKAGAGNTFPNIATLNKGDIVKVMGEMGNWYVVRLDNNQVGCINTTDATPVVRDGGE
FT                   PEKQRRIVEPEPAPEAKDDVAPAKSLTSMEQRMVNLINQERRKNNLKPLEVHMKLTEVA
FT                   RIKSQDMVDNNYFSHYSPTYGSPFDMMDRFGIEYLHAAENIAANRSVDDAHESLMRSSG
FT                   HRRNILNPNFTHVGVGIKPSDKYGYIFTQMFISRPQ"
FT   gene            complement(562259..562657)
FT                   /locus_tag="Hore_05150"
FT   CDS_pept        complement(562259..562657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_05150"
FT                   /product="uncharacterized conserved protein"
FT                   /note="PFAM: Protein of unknown function (DUF1284)"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_05150"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69273"
FT                   /db_xref="InterPro:IPR009702"
FT                   /db_xref="UniProtKB/TrEMBL:B8D246"
FT                   /protein_id="ACL69273.1"
FT                   /translation="MVQLRGHHLLCVQFFQGLGYSKEFIQKMYELLKKIEEPSTRILLT
FT                   TSCDYLCQACPWHNEYTCTISSPSEELKLVERDKAVLSYFGFEEHQLITAGLYKKRVDL
FT                   LLPKLDLKKICGNCRWFEICNSKRGQVD"
FT   gene            complement(562680..563234)
FT                   /locus_tag="Hore_05160"
FT   CDS_pept        complement(562680..563234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_05160"
FT                   /product="BioY protein"
FT                   /note="PFAM: BioY family"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_05160"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69274"
FT                   /db_xref="GOA:B8D247"
FT                   /db_xref="InterPro:IPR003784"
FT                   /db_xref="UniProtKB/TrEMBL:B8D247"
FT                   /protein_id="ACL69274.1"
FT                   /translation="MSGYKLSIHDLTRIAFFAALTGILAYISFPLPFSPVPVSGQTLGV
FT                   MLAGLLLGSYRGFLSQIAYILLGVIGLPVFAGGSSGIGSLFGPSGGYIWGFLFGAYIIG
FT                   RLFESFNNSNYIVKFFFLVTGGIVVVYLFGITQLIIVTKMSLTEAIVSGMLPFLPGDLF
FT                   KIFIVTLISQKGLISAFRTNR"
FT   gene            563664..565625
FT                   /locus_tag="Hore_05170"
FT   CDS_pept        563664..565625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_05170"
FT                   /product="peptidase S8 and S53 subtilisin kexin sedolisin"
FT                   /note="PFAM: Subtilase family"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_05170"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69275"
FT                   /db_xref="GOA:B8D248"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:B8D248"
FT                   /protein_id="ACL69275.1"
FT                   /translation="MDSKKYKVLLTAFIVIGILLFLPACSPEPDTGYKYYDIYGWVTEY
FT                   NSGDPIKDAFVYIAGQTAYTDETGYYHISNIPEGVHTWRVSADGYQGYSETIEVSSDLK
FT                   VSIKLFPIGDGNVSGKVTVNNNTGYQRVDVSTASTSNNGSAVIFNKSSDGIQYKENEIL
FT                   VKYKNEVSTLSTNSLENNNGVQIMGTRELPDGKVKHYRIPEDKTVSEMVDYYNNLPEVE
FT                   WAQPNYIYHISAIPDDEYYIYEQRGHIITNLEAAWDVEKGDNSVTVAVVDSGIIPDHPD
FT                   LAGNLVPGHDFVDDDNDPTDKTPESNSGSHGTHVAGIIGAVTNNGTGVAGVNWDVNILP
FT                   VRVMGTDGSGFTDVIADGIRYAVNNNVDIINLSLGVDPSRLENGSDPYMDDAINYAVNN
FT                   GVIVIAAAGNGGSDSIGDSYVDYPANMDSTIAVGAVDFNKDIASFSNYGQNLDLVAPGV
FT                   GIYSTWGYYDGYNYETISDYYNMSGTSMATPYVSGIAALLLANGVPSYEVRNRLTSTAV
FT                   DLGGTGWDQYYGYGLVDAYGALLGKKLSKPYVMAAEFDETTNTVYPRSEIVQVNDDGTY
FT                   SLQNVTPGEWYIIAYRDVDDNGYIDAGDYYGETSNTYSINTDTSLKDINVNMYYVTGYN
FT                   TSTSLKINGIAEIEEVNN"
FT   gene            565689..566462
FT                   /locus_tag="Hore_05180"
FT   CDS_pept        565689..566462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_05180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_05180"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69276"
FT                   /db_xref="InterPro:IPR012854"
FT                   /db_xref="InterPro:IPR020481"
FT                   /db_xref="InterPro:IPR036582"
FT                   /db_xref="InterPro:IPR038144"
FT                   /db_xref="UniProtKB/TrEMBL:B8D249"
FT                   /protein_id="ACL69276.1"
FT                   /translation="MKKRFINILVLSLVLVVLAGGTALADINIDGDNVEFDISPDRLTE
FT                   DSLVPLDQFKDMVPMEIVEMDNGDRLIYFEGDYFIIEIGKVEVETNRGVRYLDTEPIYI
FT                   NGHTLVPVEFITDFLGIDIEDFGDLQPLPPVKIGNSLKARLIVGKQVYSRNQSIRVYIL
FT                   LENEGKHREVLQFTSGKKYDVYVKDKFDRIVQKWSDNKMFAQIMQELVLEPEESVLYEL
FT                   KLKFRGLSEGTYYLQGVIESKDNKVYTDETRIILK"
FT   gene            566905..568269
FT                   /locus_tag="Hore_05190"
FT   CDS_pept        566905..568269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_05190"
FT                   /product="MATE efflux family protein"
FT                   /note="PFAM: MatE; MatE; TIGRFAM: putative efflux protein,
FT                   MATE family"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_05190"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69277"
FT                   /db_xref="GOA:B8D250"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:B8D250"
FT                   /protein_id="ACL69277.1"
FT                   /translation="MEHKKRDKFSYITEGPILGSLVKLALPIMLSQLMQTLYNPVDTIW
FT                   VGRVGANAVAAISISFPVVMLMVALGAGLTIAGTALIAQHKGAGNQQEINKILGQLFSF
FT                   IGSFSVIIAIVGYLLSRKMVVWMGADPSIVNDAAQYLKIIFSGIPFMFGFFIFSSTLRG
FT                   IGDTLTPAVMMFSSVILNMVLDPLFIFGIWIFPELGVGGAALATILSRGIVAIWALFML
FT                   LGGNKGLKLIKVNMIPDFSIIKKIIKIGIPSSVEQSMISLGQLFMTKLVASFGTMTLAA
FT                   YGIVNRVVSLPVILAFGVAAAATTMVGQNVGAEKKERAEKTALVSNLTIFISLTVIGFL
FT                   MMVKPALVISVFNKAPEVLKYGSDYLNIIALTFGFTGIMIVSNGIFKGAGRTVPPMVIS
FT                   IISQWGFRLWLGFYLSRDLGLEQAGLWWAIAIANIGGAVIGVTWLKLTDWSTGRY"
FT   gene            568377..569012
FT                   /locus_tag="Hore_05200"
FT   CDS_pept        568377..569012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_05200"
FT                   /product="tRNA (guanine-N(7)-)-methyltransferase"
FT                   /EC_number="2.1.1.33"
FT                   /note="PFAM: Putative methyltransferase; TIGRFAM: tRNA
FT                   (guanine-N(7)-)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_05200"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69278"
FT                   /db_xref="GOA:B8D251"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B8D251"
FT                   /protein_id="ACL69278.1"
FT                   /translation="MRNKPHLEEKFKKHPLVIYKLEDKVNWVNFFGNNHPIHLEIGTGR
FT                   SDFILKLARENHDINFIGMDKVKEALNYPVSKAKEEGLPNIGFIYGDARNLREYFDDDR
FT                   VSRIYLNFSDPWTKRKHIKRRLTHKDFLELYKKILIEGGEIHLKTDDYNFFKFSLESLS
FT                   QNGFLLRNITFDLHHSKFAEDNIMTGYEKRWLSEGKGIFRLEGVFKTE"
FT   gene            complement(569142..569765)
FT                   /locus_tag="Hore_05210"
FT   CDS_pept        complement(569142..569765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_05210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_05210"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69279"
FT                   /db_xref="InterPro:IPR025510"
FT                   /db_xref="UniProtKB/TrEMBL:B8D252"
FT                   /protein_id="ACL69279.1"
FT                   /translation="MDFPFFRNQSYIRVLHASPGAPAVDVYADNIKIASNLSYRNLTSY
FT                   IRVRPGQYNVIVYPAGSRRNPVYRERIYVPPGSISTVAATGQVGENFDLLVIPDTNSRP
FT                   RQDTTYLRVVHLSPNAPAVNARIDNRILARNISYQDITRYVPLDPGTYTLSIFNAQTNQ
FT                   RVVRNRNLVLQPGFYYTSYILGLVDGNVPLEVITVIDRIYELVV"
FT   gene            complement(569891..571396)
FT                   /locus_tag="Hore_05220"
FT   CDS_pept        complement(569891..571396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_05220"
FT                   /product="diguanylate cyclase"
FT                   /note="PFAM: GGDEF domain; TIGRFAM: diguanylate cyclase
FT                   (GGDEF) domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_05220"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69280"
FT                   /db_xref="GOA:B8D253"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:B8D253"
FT                   /protein_id="ACL69280.1"
FT                   /translation="MNNVIEKHKYYIIIAVFLIIIFLSYNSYQNTTNIIKSKYITHQTL
FT                   IEKSIINSINNTNYAYQIAEKLLNDKMEKLSRQLISKYRDNPDVLTWDLEKIKQTHKYV
FT                   NIYIIDNNLKIIHTTYKKDLGLDFNKYPLFSKVLRKRLEGDNFIVDRMDISIKSGQLKK
FT                   YSYMPTPDHKYLIELSINLKEIFPQIDSINLISLTERLKSEYPTIEEINFYRITQQGNI
FT                   VTESITLSESLLHTDIPDKIKSLVKKCASTSQVVSSKIKSNSQNRYYSVRFIPCLTQNP
FT                   EDPYWWDSSVIGIKYNNEFMLEELNHYKHVFIINMTIITIVFVLFVLVIEYLLKETKYM
FT                   AYHDHLTKLPNRALFERYFNKLKNNTINLNKMAVLFLDLDDFKNVNDTLGHAIGDKLLI
FT                   QVAKRLKKNLKPSDTLSRLGGDEFTLLLTSIRTREDVIKFASDLSEDFKKPFILDGNKL
FT                   TIHPSIGISIYPDNGKNLDSLLKQADNAMYQAKKQKLDFILWR"
FT   gene            complement(571562..571792)
FT                   /locus_tag="Hore_05230"
FT   CDS_pept        complement(571562..571792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_05230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_05230"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69281"
FT                   /db_xref="UniProtKB/TrEMBL:B8D254"
FT                   /protein_id="ACL69281.1"
FT                   /translation="MENTSLDFRPEITPKKINKLKETAGELKTGEHISIILERTDAHQA
FT                   KNILKILEENNIDYQTKGGHEDEFFITGKKQ"
FT   gene            complement(571868..572278)
FT                   /locus_tag="Hore_05240"
FT   CDS_pept        complement(571868..572278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_05240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_05240"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69282"
FT                   /db_xref="GOA:B8D255"
FT                   /db_xref="InterPro:IPR010540"
FT                   /db_xref="UniProtKB/TrEMBL:B8D255"
FT                   /protein_id="ACL69282.1"
FT                   /translation="MTYIYRFIIYGLSGWCLEIVWTGLGSFLRGDINLRGWTYLWMFPI
FT                   YGMALLMEPVHNQIRNWPAIIRGGVYTLIIFTIEYSSGWFLENIIGTCPWDYSKSRYSI
FT                   KGFIRLDYAPAWFIAGLLFEKLHDTLTRIHYA"
FT   gene            572493..573347
FT                   /locus_tag="Hore_05250"
FT   CDS_pept        572493..573347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_05250"
FT                   /product="degV family protein"
FT                   /note="PFAM: Uncharacterized protein, DegV family COG1307;
FT                   TIGRFAM: degV family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_05250"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69283"
FT                   /db_xref="GOA:B8D256"
FT                   /db_xref="InterPro:IPR003797"
FT                   /db_xref="UniProtKB/TrEMBL:B8D256"
FT                   /protein_id="ACL69283.1"
FT                   /translation="MKEKIALVTDSTCDLPQQTLDNSIISCLPLKIIYGDKEYRDRLDI
FT                   KPGEIYDKIEDKIPTTSMPGPDDIQKELLKLKDRGFTHVLAIHISSGLSSTYEISNMVG
FT                   KQIEGLTVEVIDSKLISMGLGRLVLYAKELIEARKFDFNEIVNKVRAKINDVELYFVVK
FT                   TLKYLIHGGRIGKVKGTIGELLNLKPIISMDSEGEYYTFKKVRSRKRSLGQLFKIVREK
FT                   IKEGICYVDVMHANAEQEARELLDKLKKLENVKDTYFGEISPAMVVHSGPGLIGVCVTR
FT                   ATD"
FT   gene            complement(573312..573845)
FT                   /locus_tag="Hore_05260"
FT   CDS_pept        complement(573312..573845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_05260"
FT                   /product="small-conductance mechanosensitive channel"
FT                   /note="PFAM: Mechanosensitive ion channel"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_05260"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69284"
FT                   /db_xref="GOA:B8D257"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:B8D257"
FT                   /protein_id="ACL69284.1"
FT                   /translation="MKDIFMLLSIDFVKIYFYKLVTITFVVLFTNIIVFIIENFFNKIM
FT                   KKEKLTPVYLPVIINLIKFILWILSIGIVLIILGFKELAITLGGVVAVFGFVSAQTLSS
FT                   ILRDLIAGVFLILDDDFNTGYRVRVNKVEGEVLTINIRKTKIKDSHNNIHIIPNRKVDN
FT                   NYILISSPGNTNPD"
FT   gene            574015..574803
FT                   /locus_tag="Hore_05270"
FT   CDS_pept        574015..574803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_05270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_05270"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69285"
FT                   /db_xref="InterPro:IPR021328"
FT                   /db_xref="UniProtKB/TrEMBL:B8D258"
FT                   /protein_id="ACL69285.1"
FT                   /translation="MKSDDIFQERINLIFWLRIFKEHALFIKKGLTYDEDELIARAHDF
FT                   YNLFDKLQNRARRIMGTPPGHNSELIEESINAVGELLEFKKTLLRLIVQCESTFNLYPL
FT                   LITHTVREADEFLEIVSEYQGQKKQISLPRDLLGDVTFWLRGMKEHTAFLHHLIDPSER
FT                   ILLDKLRDYNQRFNYLFVRALDLESMLKSEPDNFPAVSNFILELILNLKDLNQFQDRVK
FT                   TLLADCKLLSITGPLFANHLIRETEYFENLINQMKAYFKL"
FT   gene            575020..576705
FT                   /locus_tag="Hore_05280"
FT   CDS_pept        575020..576705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_05280"
FT                   /product="pyruvate ferredoxin oxidoreductase, alpha
FT                   subunit"
FT                   /EC_number="1.2.7.1"
FT                   /note="PFAM: Pyruvate flavodoxin/ferredoxin oxidoreductase,
FT                   thiamine diP-binding domain; Pyruvate ferredoxin/flavodoxin
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_05280"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69286"
FT                   /db_xref="GOA:B8D259"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="InterPro:IPR022367"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033412"
FT                   /db_xref="UniProtKB/TrEMBL:B8D259"
FT                   /protein_id="ACL69286.1"
FT                   /translation="MNLNLLIGGEAGQGLNTVSRILGKTLFRSGFFVYSSKDYMSRIRG
FT                   GHNFIRIRFGNEEILGPAERIDILVALNSETIKRHYNYLNDEGIIISGKKVDVYGKYLT
FT                   IDARQLAKDVNLKALNMVYIGAVLRVLGLETKVCEGVIEDFFDNENIIKANIKLLRRGY
FT                   EESQQLFKVNISKPARDKLFINGNQAIGLGAVMAGVKFYSAYPMSPSTGIMSYIAAKQK
FT                   ELGIVVEQAEDEIAAINMALGASFGGIRAMTGTSGGGFSLMAETVGLAGITETPVVIAE
FT                   VQRPGPATGLPTRTEQGDLLFAINVSQGEFPLMVISPRCQEDAFYQSFRAFNLADKYQI
FT                   PVILLSDQYLADSSRTVNDFNLDSLKIKRYLVSPAETDKNEGYRRYKLTDDGISPRAYP
FT                   GQNDEELVVVDSDEHNEWGHIIEDAETRKAMVEKRMRKETKLKETDLLEPLYTGEEEID
FT                   YLIIGWGSTYGPIREALSLFRKDGIKVGFLSFSDVWPLPQKSLRRWASQDIEMVAVENN
FT                   ATAQFARLIRSETGISIDHKILKYDGRPFNAREIYRCFMKEVVK"
FT   gene            576705..577559
FT                   /locus_tag="Hore_05290"
FT   CDS_pept        576705..577559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_05290"
FT                   /product="pyruvate ferredoxin oxidoreductase, beta subunit"
FT                   /EC_number="1.2.7.1"
FT                   /note="PFAM: Thiamine pyrophosphate enzyme, C-terminal TPP
FT                   binding domain; TIGRFAM: 2-oxoacid:acceptor oxidoreductase,
FT                   beta subunit, pyruvate/2-ketoisovalerate family"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_05290"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69287"
FT                   /db_xref="GOA:B8D260"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR011896"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR032686"
FT                   /db_xref="UniProtKB/TrEMBL:B8D260"
FT                   /protein_id="ACL69287.1"
FT                   /translation="MIDNSRFYETKETAWCPGCGNFALRKSLVKALNELKLKPHQVVMF
FT                   TGIGQAAKMPHYINVNTFNGLHGRSLPPAIGMRVANHTLTVIVESGDGCSYGEGGNHFI
FT                   HNIRRNPDIIHLVHDNQIYGLTKGQASPTTGMGMKTRVQTDGVKSEPLNPLSMALGMGV
FT                   GFVARGFVGEGDHLKELIKSAFDYKGYALIDILQPCVSFNKINTFKWYRERVYKLDENY
FT                   DETDLELAFKKAREWEDRIPIGIIYRAEKVTFRERYGYLEDSPLVNEVGKPSEMSFLLD
FT                   DFR"
FT   gene            577650..578135
FT                   /pseudo
FT                   /locus_tag="Hore_05300"
FT   gene            578185..578568
FT                   /locus_tag="Hore_05310"
FT   CDS_pept        578185..578568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_05310"
FT                   /product="desulfoferrodoxin"
FT                   /EC_number="1.15.1.1"
FT                   /note="PFAM: Desulfoferrodoxin; Desulfoferrodoxin,
FT                   N-terminal domain; TIGRFAM: desulfoferrodoxin FeS4
FT                   iron-binding domain; desulfoferrodoxin; desulfoferrodoxin
FT                   ferrous iron-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_05310"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69288"
FT                   /db_xref="GOA:B8D261"
FT                   /db_xref="InterPro:IPR002742"
FT                   /db_xref="InterPro:IPR004462"
FT                   /db_xref="InterPro:IPR004793"
FT                   /db_xref="InterPro:IPR036073"
FT                   /db_xref="InterPro:IPR038094"
FT                   /db_xref="UniProtKB/TrEMBL:B8D261"
FT                   /protein_id="ACL69288.1"
FT                   /translation="MTKLREVYKCEICGNVVEVVHEGAPALVCCGEDMKKLSPKTTDTG
FT                   NEKHVPVVEEKVNGVLIKVGDVEHPMEEKHYIKFIEVMTDDKVLRAELKPGQKPQAEFN
FT                   VPLKNIKAVREYCTVHDLWENNL"
FT   gene            578634..579446
FT                   /locus_tag="Hore_05320"
FT   CDS_pept        578634..579446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_05320"
FT                   /product="Phytoene dehydrogenase N terminal region"
FT                   /note="PFAM: FAD binding domain; FAD binding domain; FAD
FT                   dependent oxidoreductase; Flavin containing amine
FT                   oxidoreductase; Pyridine nucleotide-disulphide
FT                   oxidoreductase; HI0933-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_05320"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69289"
FT                   /db_xref="GOA:B8D262"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B8D262"
FT                   /protein_id="ACL69289.1"
FT                   /translation="MAKVGIIGAGPGGLAAALLLANRGFEVEVFEKENKIGGRNSYIKE
FT                   EGYTFDIGPTFFMMPFILERIFQETGRNLNDYVDLKLLEPYYQLVFKDGKRFYPSRNRD
FT                   RVKDSIAKISPDDASGFDLYMKDNKKKMDRTLPALQRGYHKFYHLLSKEVLNLLPVLRP
FT                   WESLWDNLNKYFSDDRVKLGFTFQSKYLGMSPYNCPSLFSILPYTEYKWGVYHVMGGLH
FT                   KLTKAMADVTRELGGKIKLNKEVAEIDIVNKKPMVCILKMGIIKSSTR"
FT   gene            579449..580165
FT                   /locus_tag="Hore_05325"
FT   CDS_pept        579449..580165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_05325"
FT                   /product="Phytoene dehydrogenase C terminal region"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_05325"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69290"
FT                   /db_xref="UniProtKB/TrEMBL:B8D263"
FT                   /protein_id="ACL69290.1"
FT                   /translation="MNADFAWGLQNLIPDQKRQKYNNQKLEGKKYSCSTFMLYLGLDKK
FT                   YDHLLHNNVFISGDYKNNFMEIEESKVLSRDPSFYVQNASVTDPSLAPDGHSALYVLVP
FT                   VPNLRSNIDWSRKTGSFRNTVIKLLEDRAGLTDIKDHIKYEKMITPLDWKEELHVGFGA
FT                   TFNLAHNLNQMLYFRPHNKFEEFDNMWLVGGGTNPGSGLPTIYESGRITANIMCNKYKL
FT                   NYKEVNIQHNTYSLQG"
FT   gene            580750..581523
FT                   /locus_tag="Hore_05330"
FT   CDS_pept        580750..581523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_05330"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: Acetyltransferase (GNAT) family"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_05330"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69291"
FT                   /db_xref="GOA:B8D264"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B8D264"
FT                   /protein_id="ACL69291.1"
FT                   /translation="MNGISLEEWQKTIGIWEKDGNILGVVNSEGEGEGEIFFQLAEIDI
FT                   PEMILEEMFDFAEENTGGNRGNKRYIQMRIPAGDSKREAIAIKRGYRKANWEEWVSEIP
FT                   VSRKVDITLPEGFSIVDGSNLTDFEKGRAHARAFEYINKPIYKNRAIEAYKLLRQTPDY
FT                   RFDLDLYIISDTGDVVSFTTIWYDSVNKIGILEPVGTVPEYRRRGLASSVIGECIRRIE
FT                   KEGAEKTYVWTNKEFYLSIGFEQKYKMNVWEKEIV"
FT   gene            581639..582367
FT                   /locus_tag="Hore_05340"
FT   CDS_pept        581639..582367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_05340"
FT                   /product="predicted membrane protein"
FT                   /note="PFAM: Protein of unknown function (DUF421)"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_05340"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69292"
FT                   /db_xref="GOA:B8D265"
FT                   /db_xref="InterPro:IPR007353"
FT                   /db_xref="InterPro:IPR023090"
FT                   /db_xref="UniProtKB/TrEMBL:B8D265"
FT                   /protein_id="ACL69292.1"
FT                   /translation="MPFWESQQSLNVFQWIARTGVTFVWLFLMTKIMGQREVGRLTLFD
FT                   FIIAITIGTVAASSLSNSRTSLLSSLINVGFLAVLDIVLAIIALKNAKVRRIVQGEPMV
FT                   LIQNGKLLEDSMRKSRMNLDDLLMGLRQKKISNLSDVEFAILEPNGKISVIPRSQSRAV
FT                   RPKDLKINTGYEGLPVIVIEDGNILEDNLKENNLDKNWLKNQLKQQGIDNVEEVLVGML
FT                   DTQGRLYISKKGQKNEDIVH"
FT   gene            582398..582688
FT                   /locus_tag="Hore_05350"
FT   CDS_pept        582398..582688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_05350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_05350"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69293"
FT                   /db_xref="UniProtKB/TrEMBL:B8D266"
FT                   /protein_id="ACL69293.1"
FT                   /translation="MKTKNYLKKHVKRKDLYIYLMNNLEEFAEEYLENWQDRYQAKDNR
FT                   PKKEKVKEDLLNYHNPAREYERIEQALNRKLTDEEIDVIYRAFNEEVLKKV"
FT   gene            complement(583298..585481)
FT                   /locus_tag="Hore_05360"
FT   CDS_pept        complement(583298..585481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_05360"
FT                   /product="predicted exporters of the RND superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_05360"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69294"
FT                   /db_xref="GOA:B8D267"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:B8D267"
FT                   /protein_id="ACL69294.1"
FT                   /translation="MDNYVRLINNNKRVFTIIFIMLNILSLIGLFKLKINPDFDIFMLR
FT                   DSHYKKVLDDMNQTFNTTEQTIILIETENKEINPDTIHKFRSFQKHLEKINSISYINGP
FT                   APRSISFGNFTLDLEKPINELGLKFLKEHFKGMGKLSTVTRKNGKLYGIFTIFPGENFS
FT                   SNDLKNIESYLQKNGLNYYLTGDMYMQHKIIDYIYMILLFLPPTALLLILTVFRTQMGT
FT                   LKATFLSILPAGIAALWTMGIIGWIGKPVSVITVLAPIFTIVIGSADGLHFVSHVQDTR
FT                   AEGKDKIKSIVETLKMVGIPMIITTVTSMAGFLALLVMNTDAIHDLALFASLGIFLAGV
FT                   ATWYILPLILTGNVRLKKHSHKRSFLASRIRRLWGVPSIIILFFLITISIIGGQYLSTE
FT                   FNQLLIYRNFTDVYKSFDKIMEVNEGSIPVYLYVKTENDPLSPINGKRMIELGSKLTQS
FT                   DCVTKTVSVYDAYSLIYSAIQGLSSPQYPENKNKVAFVNNLITAESNNPTSHLINRDNN
FT                   ATRMLVFPANLKNKILDRINKIVTDYDKKYPDLTIEVTGVQYLMRELSNSMISNQTQSI
FT                   LLAFSLIFILLYISIRKIKPSVISLLPIAFTTLIIFGFMGLSGISLNLFTATIFSITIG
FT                   VGIDYAVHFTSVWMTFRKRGYTAKEATNKSYKYTARPIIANAFGLAIGLSALTLSPLRI
FT                   HLYVSVLMWVAMISGVFLSLSFLPTILKSLGNN"
FT   gene            complement(585501..586118)
FT                   /locus_tag="Hore_05370"
FT   CDS_pept        complement(585501..586118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_05370"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: Bacterial regulatory proteins, tetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_05370"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69295"
FT                   /db_xref="GOA:B8D268"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:B8D268"
FT                   /protein_id="ACL69295.1"
FT                   /translation="MSKSEETKKKILKSAIELVADKGYASTSTREIAKNAGVSEATIFK
FT                   YYKNKDQLLKKIVSKTINDFFKYSLNKSLPEVFEANKNKSIDYLLQELLTERFQFFKEN
FT                   SKAIQVIFQETMVNKEVREFFKNKVWTKMDELETSIIIKGKKQGLIRNIDNYFIKKALF
FT                   GMIFYTVFFEEVLELDNKNKYNSEEQARAILDIIFKGIKNDK"
FT   gene            complement(586305..586607)
FT                   /locus_tag="Hore_05380"
FT   CDS_pept        complement(586305..586607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_05380"
FT                   /product="Coat F domain protein"
FT                   /note="PFAM: Coat F domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_05380"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69296"
FT                   /db_xref="InterPro:IPR012851"
FT                   /db_xref="UniProtKB/TrEMBL:B8D269"
FT                   /protein_id="ACL69296.1"
FT                   /translation="MSFLGNQVKERTDISDEVIASNMLSSAKAAANAYLNAALISPTPE
FT                   LRAMCEESLQQILAGHSQLSKLVIDQGWESPYDSPEKQLLDMLDKSKLVVETNEK"
FT   gene            complement(586610..586741)
FT                   /locus_tag="Hore_05390"
FT   CDS_pept        complement(586610..586741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_05390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_05390"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69297"
FT                   /db_xref="UniProtKB/TrEMBL:B8D270"
FT                   /protein_id="ACL69297.1"
FT                   /translation="MKNIVSDEGLKKQVESSIMAAEGRVKGIQQFITENKVTGKEVE"
FT   gene            587030..587233
FT                   /locus_tag="Hore_05400"
FT   CDS_pept        587030..587233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_05400"
FT                   /product="putative cold-shock DNA-binding domain protein"
FT                   /note="PFAM: 'Cold-shock' DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_05400"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69298"
FT                   /db_xref="GOA:B8D271"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:B8D271"
FT                   /protein_id="ACL69298.1"
FT                   /translation="MVYTGKVKWFDAKKGYGFIEREDGDDVFVHFSAIQADGFKSLEDG
FT                   EEVEFEIIEGDRGPQAANVVTL"
FT   gene            complement(587398..589026)
FT                   /locus_tag="Hore_05410"
FT   CDS_pept        complement(587398..589026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_05410"
FT                   /product="Sodium:solute symporter"
FT                   /note="PFAM: Sodium:solute symporter family; TIGRFAM: SSS
FT                   sodium solute transporter superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_05410"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69299"
FT                   /db_xref="GOA:B8D272"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:B8D272"
FT                   /protein_id="ACL69299.1"
FT                   /translation="MEWYYLIPLVYLFLLLVVGFVIAKRQETRSDFYVASNKMDGSVLF
FT                   ATVMSTVVGANTYMGFSGLIYNGGLHFMWMLSGAGLAYFILFFISGKIRKIATKYEVFT
FT                   LPDLVELRYSNPVALLTTFFSLIGLVGGIGGGLLGLGVILNSLLGIPTTTAIIVTSIIT
FT                   IIYTCLGGLWGVSLTDWIQSIIMIAGVAVCIVFGITSVTPGQSFVNGAFEIVNVLKQQL
FT                   GTELVSPFAGLTFFMALAWTITFMPLNTISQTQIQRVYAAKNVKTIRGVSLLMIIFVAM
FT                   VLTFGLAFIGILGRVALPGLKNAEAVFPQMSMKVINPALGILIVTGIMGAAMSTVDSNL
FT                   LGSAMHVTRDLYERYMRYKNKSVDEKRILFISRVTIVIIGVISTIAALFTPSIMSLLLI
FT                   TMKIFAGATFAPVLIGLYWKRANAFGALLGEILGGMAVVINIIHPVVNLDPVIFGIIMA
FT                   VLGTITGSLFTKENTEKGSIFSFANDISSKGWLAVIAIALLYFGWVISMNNYAMWPYFI
FT                   ITTVVLLVLSVVFLIYSFITERTGN"
FT   gene            complement(589055..590143)
FT                   /pseudo
FT                   /locus_tag="Hore_05420"
FT   gene            complement(590310..590939)
FT                   /locus_tag="Hore_05430"
FT   CDS_pept        complement(590310..590939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_05430"
FT                   /product="predicted membrane protein"
FT                   /note="PFAM: Protein of unknown function (DUF421)"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_05430"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69300"
FT                   /db_xref="GOA:B8D273"
FT                   /db_xref="InterPro:IPR007353"
FT                   /db_xref="InterPro:IPR023090"
FT                   /db_xref="UniProtKB/TrEMBL:B8D273"
FT                   /protein_id="ACL69300.1"
FT                   /translation="MTFFDFVTGITIGTIGGAFVTTQIEGFYILLSPVILAILVVLTGY
FT                   LTLKSTPARKLIEGEPLVIIQNGKIYEKNMKKLRYNLDDLMMQLREQGVFDLSEVEFAI
FT                   LETDGKLSVLKKSQYQPVKPRDLNINTRYVGLSSEIIRDGQIVEQNLKQNNLTHEWLYN
FT                   ELAKQNIKNIRNIVLATLSTDGNLYIDVKNDNHSYIQEIEDDDSMI"
FT   gene            591733..593355
FT                   /locus_tag="Hore_05440"
FT   CDS_pept        591733..593355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_05440"
FT                   /product="methionyl-tRNA synthetase"
FT                   /EC_number="6.1.1.10"
FT                   /note="PFAM: tRNA synthetases class I (M); tRNA synthetases
FT                   class I (I, L, M and V); TIGRFAM: methionyl-tRNA
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_05440"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69301"
FT                   /db_xref="GOA:B8D274"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023458"
FT                   /db_xref="InterPro:IPR029038"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="InterPro:IPR041872"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8D274"
FT                   /protein_id="ACL69301.1"
FT                   /translation="MNVFIGGAWPYANGSLHLGHIASLLPGDILARYFRLKGEKVLYVS
FT                   GSDCHGTPIALRAKREGESPRIIAERYHQEFKKTFTKLGFSYDNYTKTDNPFHHQVVQS
FT                   IIKKLFEKGYIYKKQTKQLYCSKCQQFLPDRYVEGICPVCGKVVRGDQCDYCSSLIEPT
FT                   DLEEKRCKICGSSPVIKNTEHFYLALSEFSDELKRLLDNNRGWRDNAIKLSTRYIEEGL
FT                   QDRAITRDLNWGVSIPFEGYEEKRIYVWIDAVLGYLSASKEWSRHTGEPWQNFWSEDTK
FT                   TYYVHGKDNIPFHTLILPALLRGAGIKQIPEKIVSSEYLTIEGKKLSTSRNWAVWLPDM
FT                   LKNYQPDSIRYFLIINGPEKKDSNFSWEEFIHSHNGELLGAYGNFVNRTLVFIEKYYNG
FT                   LIPDGKLNEKIKEKIETLYHRVGNKIEKTNLKNALEVIFNFVREANKYFDSEEPWITVK
FT                   EDKGTCKDTIYTCVQIIANLTNLLSPFLPFSSKKVRGFLNIDKPDWKYIEVLPATKLEK
FT                   VEILFPRINKNLIKEEREKLGVN"
FT   gene            complement(593402..594292)
FT                   /locus_tag="Hore_05450"
FT   CDS_pept        complement(593402..594292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_05450"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate binding domain; Bacterial
FT                   regulatory helix-turn-helix protein, lysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_05450"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69302"
FT                   /db_xref="GOA:B8D275"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B8D275"
FT                   /protein_id="ACL69302.1"
FT                   /translation="MNLRQLKIFVMVCKTKNMSKAAKKLYMSQPAISQTISELEEDLNI
FT                   KLFDRIKKRLKLTYAGKILLRNSKRILNLVDETENIIKDIVNMNQGKLRIGASMTIGTY
FT                   LLPQIIEGFLNKYNKIHLPFTIDNTKVIEDMILDNKLDLALVEGPIYCKDILVEHFFDD
FT                   QLYLMCSSKHSWSHKRKINSEELKGEDFIIREKGSGTRETIENIMRKHSIKYHVTHVFN
FT                   NIEAIKRAIISNLGVSILPEICVKEELKKGLLVKVDIQGIEFKRKFSIIYHKDKYRSQL
FT                   FNNFVNHIYTNICKS"
FT   gene            594412..595392
FT                   /locus_tag="Hore_05460"
FT   CDS_pept        594412..595392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_05460"
FT                   /product="conserved hypothetical integral membrane protein
FT                   TIGR00698"
FT                   /note="PFAM: Conserved hypothetical protein 698; TIGRFAM:
FT                   conserved hypothetical integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_05460"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69303"
FT                   /db_xref="GOA:B8D276"
FT                   /db_xref="InterPro:IPR018383"
FT                   /db_xref="UniProtKB/TrEMBL:B8D276"
FT                   /protein_id="ACL69303.1"
FT                   /translation="MKAFKEKIPGILLAVFVGITGRLVGNFVPNIGGVTIAIILGFLAG
FT                   NIFRLDSNYAKGIKFVEKKILSLAIMLMGLKLQMDVLAELGISSIVIIIIMVTLTVFVG
FT                   SLIGRLCGLSNSFSILLGIGNGICGSSAIAAAAPIVSNNEEEIGLSVSVVNLLGTFGIF
FT                   ILPVITGLLKLNETTSGLMIGSTLQATGQVVAAGFSISDLTGEVATIVKMARILMLGPV
FT                   VLLLSFLFGKKDNSLDNNVSIPPFIIGFFIFSIIGTLQILPVGVVQSLKYTGKLLLTVA
FT                   MAGIGLRIRISSLINQGPKALLVGLLIFVVQLVSITGLIYFFLLK"
FT   gene            595469..596728
FT                   /locus_tag="Hore_05470"
FT   CDS_pept        595469..596728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_05470"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: Major Facilitator Superfamily; Sugar (and
FT                   other) transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_05470"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69304"
FT                   /db_xref="GOA:B8D277"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B8D277"
FT                   /protein_id="ACL69304.1"
FT                   /translation="MTQEGGELTLENPFKVYRGLNRNIYIIFIGQVINSMGAFVFPFLT
FT                   MFLTQKIGMSPAEAGSYVTVAALANVPGMFLGAKLADSFGRKRLYLISSTLMALMLIPP
FT                   AFLGTSKVVIYFLIMMSLFAGAVNPAFNAMVTDLTRGEERKKAFSLLYLGWNMGFAIGP
FT                   MIAGFLFNHYLPLLFLGDAATAFIAIVLIGIYVPETKGMIEETPDEELPENERAEEGSI
FT                   FRVLLKRPGIILVSFILLFFRLVYAQSSFALPIQMNEIFGQQGPAYYGINYSFNAIVVV
FT                   AFTVLVTSVTVKLKPLANIIIAGLLLAVGFGMIYYIDILPLFFLSTFVWTIGEILEATN
FT                   VNVYIASHAPVSHRARFNSIFMFISGAGYAFAPKLGGLFLEYYSIREIWLASFFVMVIA
FT                   SSALLLFYLGQERVKRLTCK"
FT   gene            complement(596826..598409)
FT                   /locus_tag="Hore_05480"
FT   CDS_pept        complement(596826..598409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_05480"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="PFAM: DbpA RNA binding domain; Helicase conserved
FT                   C-terminal domain; DEAD/DEAH box helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_05480"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69305"
FT                   /db_xref="GOA:B8D278"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005580"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8D278"
FT                   /protein_id="ACL69305.1"
FT                   /translation="MKKVKFSELNISKEILKAVEDMGFEETTPIQTKAIPPILNGKDII
FT                   GQAQTGTGKTAAFGIPLLEKIDTRNKKPQAIILCPTRELAIQVAEELKRLAKYKRSLYT
FT                   LPVYGGQSIKRQIKALKKGVQVIIGTPGRVMDHMRRGTLNLSHINFVVLDEADVMLDMG
FT                   FIDDIKTILKDIPNDRQTLFFSATIPETILDLSKRYQKKSQFIKIAHEKLTVPGIEQYY
FT                   YEVRRSDKLKVLTRLIDLYSPGLSLIFCNTRKMVEELNIQLQARGYLSDALHGGFNQNQ
FT                   RDRVMDKFRNGIIEILVATDVAARGIDVNGVEAVFNYDVPQDTDYYVHRIGRTGRAGKT
FT                   GKAFTFVVGKDIYKLRDIQKYTKTRIIKQDIPTLTDIEQAKLENLINDLTDYIDREHLK
FT                   KYIKIIENLLDDDYTAIEIAAALFKKYMENESSEGEINNNKLNDTGAEPGMVRLFINIG
FT                   KKHNITPGHIVGAIAGETSLSGRLIGAIDLYDNFTFVEVPEESSREVLKIMKNNYIKGK
FT                   KINIEPAKPR"
FT   gene            complement(598545..598751)
FT                   /locus_tag="Hore_05490"
FT   CDS_pept        complement(598545..598751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_05490"
FT                   /product="putative cold-shock DNA-binding domain protein"
FT                   /note="PFAM: 'Cold-shock' DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_05490"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69306"
FT                   /db_xref="GOA:B8D279"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:B8D279"
FT                   /protein_id="ACL69306.1"
FT                   /translation="MIIYNGKVKWFSDKKGFGFIEREAGDDVFVHFSAIQKEGFKSLDE
FT                   GQEVEFEVVQGDRGPQAANVVTL"
FT   gene            599086..600315
FT                   /locus_tag="Hore_05500"
FT   CDS_pept        599086..600315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_05500"
FT                   /product="putative transcriptional regulator, MerR family"
FT                   /note="PFAM: MerR family regulatory protein; Trm112p-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_05500"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69307"
FT                   /db_xref="GOA:B8D280"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B8D280"
FT                   /protein_id="ACL69307.1"
FT                   /translation="MKISEFSRKYNVSKDTIRYYMDLNLITPCKQGGHYFFDNKCESQL
FT                   KEILKLKEMNFTLQEIKKIFNYRRLGKLTAYQQNNYYKSIYKRKIKEINKEIKRLKRAE
FT                   EMLRDEVFILKKKDFSKKSIGIDLATLSLFSCPDCNSELLLSAEKVEENQIIEGILQCV
FT                   CGQSLMIKDGVLYSDTCYKHIKDQVAEDHIESYIKNTDPDFIDKSYQTLDWMERQIEFE
FT                   NLSGKVVLEPGSGYGHFLRQIYRELPDDTIYICVDNNPLVNLYLKQYLEMAGERSKVIF
FT                   ITADLPKLPLKENIIDVFIDFTGTSCFSFENKGFLPELLNCYLNAEAMLLATFIIYRKF
FT                   GPNNIVGQPFRQNFIYNNVKNGLLKLNFKIEKEVKTETQTIKKNPGKYESFAQPGDKIY
FT                   AYQVMAKRWS"
FT   gene            600417..601757
FT                   /locus_tag="Hore_05510"
FT   CDS_pept        600417..601757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_05510"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: Major Facilitator Superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_05510"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69308"
FT                   /db_xref="GOA:B8D281"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B8D281"
FT                   /protein_id="ACL69308.1"
FT                   /translation="MNTQTKTLSKEIEGYQENKNIFLYSAGKLISLLGSAIYTFAVGLY
FT                   LLKITGSGLTFATNIVLYTLPMLFINPFAGVVADRINKKIVVVGSDFLNGLFLVVVYVL
FT                   AGRIGLSVSLLYISTFIMTVMATFFNIAIESAKPDLVREEKLVKINSLARVIESLSYVI
FT                   GPITGGVIYALFDMKVFILLNGLSFFLAAFLEFFIDYHFNKVEDNELERDKTRPEPGSD
FT                   NKLWFKLKEGYQYILSRQHLLALIYIFVALNFLFNFAIIVPLPYLLNTTWSVDPVIYGV
FT                   VQGGLPVGMIIGALLVKRIMEKVSYSKLLKRISYLAGLWVLMFSLPPVVFPCIPGQYFV
FT                   LIYYTTLMLVGGLVVSWVDIPANVLLQKIVPGKLLGRVISVKLSIVKVIVPIALLLSGY
FT                   IVNLLSPLILFLSGSVLFTMFNLWFFTSPSGQKFINVTNENLMGENE"
FT   gene            complement(601873..602799)
FT                   /locus_tag="Hore_05520"
FT   CDS_pept        complement(601873..602799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_05520"
FT                   /product="phosphoesterase PA-phosphatase related"
FT                   /note="PFAM: PAP2 superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_05520"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69309"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:B8D282"
FT                   /protein_id="ACL69309.1"
FT                   /translation="MTGGKHGYKNILGKWSKLPYAGEKQLPVPEEPLAGSWPTFFLKRD
FT                   HRGRFLDPDGNLIDLKIRFPGRSIDFTGKQLAIVKKTLDNITKEKIKIARYWGTGPPTK
FT                   QWTPVIDKLIDVYNISATRAGRILGAVQGGLNDARVVAWHLKFAWEIPRPNQLDQKLAT
FT                   VICTPKHPSYPSGHAVVAGCAQIMLTYFFPPKSERLQELAEECAVSRLYDGVHFPVDNE
FT                   EGLRLGRQIGRLIVRKLKRQRNSEQKRIDIRFTDNKKVKLPPPPYKQPLPFLGETKCNS
FT                   LILNKAEGSYSLLLWLIIASLLTRDIK"
FT   gene            complement(603276..603364)
FT                   /locus_tag="Hore_R0026"
FT   tRNA            complement(603276..603364)
FT                   /locus_tag="Hore_R0026"
FT                   /product="tRNA-Leu"
FT   gene            603492..604250
FT                   /locus_tag="Hore_05530"
FT   CDS_pept        603492..604250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_05530"
FT                   /product="cell envelope-related transcriptional attenuator"
FT                   /note="PFAM: Cell envelope-related transcriptional
FT                   attenuator domain; TIGRFAM: cell envelope-related function
FT                   transcriptional attenuator common domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_05530"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69310"
FT                   /db_xref="GOA:B8D283"
FT                   /db_xref="InterPro:IPR004474"
FT                   /db_xref="UniProtKB/TrEMBL:B8D283"
FT                   /protein_id="ACL69310.1"
FT                   /translation="MKKRLLIWVGLVTGIFLIGIGLYFHYSQPDVVPGLADINNRVKKS
FT                   NILLMGLDDKNSVEKGKVEVDSIVLARLAPEKRTLKFTSIPVEGEIYKGHETVEEIIGE
FT                   VEKLTGETINYYLTVSYDAFINMVDSIGGIQIKVDKAIDIPALDLYLKKGLNRLTGQEA
FT                   LNYSRWFNYNTKSEIERLKRQQQVIKSLVHKILKPETLLKLPELFTNTLKSFDRVETNI
FT                   DISIINKGIDFLKNRNDIIIKFDVFDKNIK"
FT   gene            604437..604512
FT                   /locus_tag="Hore_R0027"
FT   tRNA            604437..604512
FT                   /locus_tag="Hore_R0027"
FT                   /product="tRNA-Val"
FT   gene            604520..604597
FT                   /locus_tag="Hore_R0028"
FT   tRNA            604520..604597
FT                   /locus_tag="Hore_R0028"
FT                   /product="tRNA-Asp"
FT   gene            604602..604677
FT                   /locus_tag="Hore_R0029"
FT   tRNA            604602..604677
FT                   /locus_tag="Hore_R0029"
FT                   /product="tRNA-Phe"
FT   gene            604685..604758
FT                   /locus_tag="Hore_R0030"
FT   tRNA            604685..604758
FT                   /locus_tag="Hore_R0030"
FT                   /product="tRNA-Gly"
FT   gene            604763..604837
FT                   /locus_tag="Hore_R0031"
FT   tRNA            604763..604837
FT                   /locus_tag="Hore_R0031"
FT                   /product="tRNA-Cys"
FT   gene            604845..604933
FT                   /locus_tag="Hore_R0032"
FT   tRNA            604845..604933
FT                   /locus_tag="Hore_R0032"
FT                   /product="tRNA-Leu"
FT   gene            604966..605042
FT                   /locus_tag="Hore_R0033"
FT   tRNA            604966..605042
FT                   /locus_tag="Hore_R0033"
FT                   /product="tRNA-Val"
FT   gene            complement(605076..605336)
FT                   /locus_tag="Hore_05540"
FT   CDS_pept        complement(605076..605336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_05540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_05540"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69311"
FT                   /db_xref="UniProtKB/TrEMBL:B8D284"
FT                   /protein_id="ACL69311.1"
FT                   /translation="MNHIIFVYNYGRGDIVVNYNDIYDDKILKKVAESCPEFSSAYDSP
FT                   FASAGSLVASQDGLGDRICNECTHWNQGTCSIFQKHKDKYQ"
FT   gene            605369..606217
FT                   /locus_tag="Hore_05550"
FT   CDS_pept        605369..606217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_05550"
FT                   /product="Sporulation protein YtxC"
FT                   /note="PFAM: YtxC-like family; TIGRFAM: putative
FT                   sporulation protein YtxC"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_05550"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69312"
FT                   /db_xref="InterPro:IPR014199"
FT                   /db_xref="UniProtKB/TrEMBL:B8D285"
FT                   /protein_id="ACL69312.1"
FT                   /translation="MGIIISTLDCTNEIKTKLQDLNHSGVDFMIAENRSKDYTLFQIDF
FT                   DKSSSVGNLRYLADIIADVVVNELEKKFINRIIKHKYQQFSPDERARIEKLAFKHLNKR
FT                   EDKNNKSLNKIVRKKEIVAQIINYLNKNSDLNVEGFVRFRLKNYLDDLKLAVERAVDEF
FT                   VIEKEYNEFIELLRYFVEIQEPRIGLVNVLQETDGSFQIMDSNENIIKNEYLEGYLVDM
FT                   FDGEVEYEDLLVSALINIAPEKILLHFDDAEVEKTVKSIFGERVSICQGCYLCQPRCKK
FT                   E"
FT   gene            606317..606922
FT                   /locus_tag="Hore_05560"
FT   CDS_pept        606317..606922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_05560"
FT                   /product="uncharacterized protein conserved in bacteria"
FT                   /note="PFAM: Protein of unknown function (DUF445); Protein
FT                   of unknown function (DUF445)"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_05560"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69313"
FT                   /db_xref="GOA:B8D286"
FT                   /db_xref="InterPro:IPR007383"
FT                   /db_xref="UniProtKB/TrEMBL:B8D286"
FT                   /protein_id="ACL69313.1"
FT                   /translation="MISGFIILPVVGALIGWITNYLAVKMLFRPYNPVKIPFIPVTIQG
FT                   VLPRRKMELAESVARAIEEELLPKEYLLSRVNELQLEEDVLDILRRLINEKVDDKLPGF
FT                   IPDSFKQVMKNYISEFIEEEMKENLDRLVNDFHDTVVNKTNFGRLVQEKIESFPLTRLE
FT                   DIVLKISSRELKHIELFGGVLGFIVGLGQALLLLFFNF"
FT   gene            607023..607199
FT                   /locus_tag="Hore_05570"
FT   CDS_pept        607023..607199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_05570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_05570"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69314"
FT                   /db_xref="UniProtKB/TrEMBL:B8D287"
FT                   /protein_id="ACL69314.1"
FT                   /translation="MSPAESTPGETYLKTTSELAGGTLLKPVFLPGKNRYFSKRVMDYH
FT                   NQLGWNRGPSPSL"
FT   gene            607292..609232
FT                   /locus_tag="Hore_05580"
FT   CDS_pept        607292..609232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_05580"
FT                   /product="Threonyl-tRNA synthetase"
FT                   /EC_number="6.1.1.3"
FT                   /note="PFAM: TGS domain; Anticodon binding domain; Threonyl
FT                   and Alanyl tRNA synthetase second additional domain; tRNA
FT                   synthetase class II core domain (G, H, P, S and T);
FT                   TIGRFAM: threonyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_05580"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69315"
FT                   /db_xref="GOA:B8D288"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002320"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR033728"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/TrEMBL:B8D288"
FT                   /protein_id="ACL69315.1"
FT                   /translation="MEKIKVTLPDGSVREYDPGVTIEEVAYSIGKGLGRAAVAGNVDDK
FT                   LVDLDTTLVNDARISIVTIDSEEGLDIYRHTTAHILAQAVKRLYKNVKLGIGPTIENGF
FT                   YYDFDVEESFSPSDLEKIEKEMEKIIKEDLPIKKEMVSRDEALKLMKEKGEIYKVELIE
FT                   ELEDDYVSLYHQGEFIDLCRGPHLPSTGKVKAFKLLNAAGAYWRGDENNKMLQRIYGTA
FT                   FQKKKQLEEHLKMLEEAKKRDHNKLGRELDLFMTEESIGQGLPLLKPKGAKVVQILQRF
FT                   VEDEEEKRGYQLTKTPYMAKSDLYKISGHWDHYKEDMFILGDEEKDDEVLALRPMTCPF
FT                   QFMIYNSKLRSYRDLPLRYSETSTLFRNEASGEMHGLIRVRQFTISEGHIICTPEQLEE
FT                   EFRGVVNLINYMMETLGIEDDIWYRFSKWDPDNREKYIDNPTAWEESQDKMKNILDKLN
FT                   IDYVEAEGEAAFYGPKLDIQFRNVHGKEDTIITVQIDFALPERFDMTYIDKDNKKKRPY
FT                   VIHRTSVGCYERTLAMLIEKYAGAFPTWLAPVQVEIIPVSDDQVDYAYEVKGILKEAGI
FT                   RVEVDDTNEKLGYKIRQAQMEKIPYMLIVGNREVENRTVSVRDRKEGDLGAISIKEFKE
FT                   KIVREVEEKSH"
FT   gene            609745..610125
FT                   /locus_tag="Hore_05590"
FT   CDS_pept        609745..610125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_05590"
FT                   /product="initiation factor 3"
FT                   /note="PFAM: Translation initiation factor IF-3, N-terminal
FT                   domain; Translation initiation factor IF-3, C-terminal
FT                   domain; TIGRFAM: translation initiation factor IF-3"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_05590"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69316"
FT                   /db_xref="GOA:B8D289"
FT                   /db_xref="InterPro:IPR001288"
FT                   /db_xref="InterPro:IPR019813"
FT                   /db_xref="InterPro:IPR019814"
FT                   /db_xref="InterPro:IPR019815"
FT                   /db_xref="InterPro:IPR036787"
FT                   /db_xref="InterPro:IPR036788"
FT                   /db_xref="UniProtKB/TrEMBL:B8D289"
FT                   /protein_id="ACL69316.1"
FT                   /translation="MEVAPQARPPVCKIMDYGKYKYEQAKKAKEAKKKQNVMNVKEVQM
FT                   GVKIEDHDFNVKAKMAKRFLKNKHKVKVRIRFRGREVMHKQLGYDLMNRLIDEVKDLGV
FT                   VESKPKMEGRNMIMVLTPISDK"
FT   gene            610138..610311
FT                   /locus_tag="Hore_05600"
FT   CDS_pept        610138..610311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_05600"
FT                   /product="ribosomal protein L35"
FT                   /note="PFAM: Ribosomal protein L35; TIGRFAM: ribosomal
FT                   protein L35"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_05600"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69317"
FT                   /db_xref="GOA:B8D290"
FT                   /db_xref="InterPro:IPR001706"
FT                   /db_xref="InterPro:IPR018265"
FT                   /db_xref="InterPro:IPR021137"
FT                   /db_xref="InterPro:IPR037229"
FT                   /db_xref="UniProtKB/TrEMBL:B8D290"
FT                   /protein_id="ACL69317.1"
FT                   /translation="MPKLKTHKGIAKRIKKTGKGKLKRNKAYHSHLLTKKTGKRKRNLR
FT                   KSTVLHKTYYKR"
FT   gene            610368..610727
FT                   /locus_tag="Hore_05610"
FT   CDS_pept        610368..610727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_05610"
FT                   /product="ribosomal protein L20"
FT                   /note="PFAM: Ribosomal protein L20; TIGRFAM: ribosomal
FT                   protein L20"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_05610"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69318"
FT                   /db_xref="GOA:B8D291"
FT                   /db_xref="InterPro:IPR000048"
FT                   /db_xref="InterPro:IPR005813"
FT                   /db_xref="InterPro:IPR035566"
FT                   /db_xref="UniProtKB/TrEMBL:B8D291"
FT                   /protein_id="ACL69318.1"
FT                   /translation="MPRVKRGYKARRRRKKILKMAKGYFGGRSKLFRPANQAVMKSLHY
FT                   AYRDRRARKRDFRKLWITRINAAARQEGISYSKFIHGLKKADIQINRKMLADMAIKDKE
FT                   SFSELAAIAKKELGM"
FT   gene            610857..611669
FT                   /locus_tag="Hore_05620"
FT   CDS_pept        610857..611669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_05620"
FT                   /product="tRNA/rRNA methyltransferase (SpoU)"
FT                   /note="PFAM: RNA 2'-O ribose methyltransferase substrate
FT                   binding; SpoU rRNA Methylase family"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_05620"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69319"
FT                   /db_xref="GOA:B8D292"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:B8D292"
FT                   /protein_id="ACL69319.1"
FT                   /translation="MKEVIKSSDNKNFKYLKKLYNKSFRKKEGKFILEGYRLIMEACGK
FT                   ARFDRIFMTPYFAKTDEGEEIIRKFKDHIPVHFVTGKLLYNVADTENPQGIAAITYVPR
FT                   SGANILFHNRNRGIILILDRIQDPGNMGTIIRTAVAAGIEGIICLKGSVDIYNLKVIRA
FT                   SMGAIFSIPILTGVSFKRLQKIRDEYPDYKLICTDLNTSKFYHEIDYQEPLMLVIGNEA
FT                   RGIREELLSLADIKIKIPLMGNIDSLNAAVSTAIVLYDIVVKCRHSNG"
FT   misc_feature    611920..612149
FT                   /note="T-box leader"
FT   gene            612320..613345
FT                   /locus_tag="Hore_05630"
FT   CDS_pept        612320..613345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_05630"
FT                   /product="phenylalanyl-tRNA synthetase, alpha subunit"
FT                   /EC_number="6.1.1.20"
FT                   /note="PFAM: tRNA synthetases class II core domain (F);
FT                   Aminoacyl tRNA synthetase class II, N-terminal domain;
FT                   TIGRFAM: phenylalanyl-tRNA synthetase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_05630"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69320"
FT                   /db_xref="GOA:B8D293"
FT                   /db_xref="InterPro:IPR002319"
FT                   /db_xref="InterPro:IPR004188"
FT                   /db_xref="InterPro:IPR004529"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR022911"
FT                   /db_xref="UniProtKB/TrEMBL:B8D293"
FT                   /protein_id="ACL69320.1"
FT                   /translation="MDLKKQLEEIKTKAEKEFQDVKDLDHLEQLRVKYLGKKGEITSVL
FT                   RQMGKIPAEERPVIGKKANILKNKLNNIIIKKKAELEELAKQRKLEKEKIDVTLPGVRP
FT                   EVGHRHPLNQVIDEIKDIFIGLGFTIAEGPEVESEYNNFEALNIPAHHPARDLQDTLYL
FT                   YDDLLLRTHTSPVQIRTMAKQNPPIRVIAPGRVYRADELDASHSPIFHQVEGLVINENI
FT                   SFSDLKGTIETVVHALFGKDSKIRFRPSYFPFTEPSAEVDVSCNVCHGEGCSLCSRTGW
FT                   LEIMGSGMVHPNVLEMAGIDPVKYSGFAFGMGLDRIAILKYKLDDIRLLYENDRRFLHQ
FT                   F"
FT   gene            613568..615967
FT                   /locus_tag="Hore_05640"
FT   CDS_pept        613568..615967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_05640"
FT                   /product="phenylalanyl-tRNA synthetase, beta subunit"
FT                   /EC_number="6.1.1.20"
FT                   /note="PFAM: Putative tRNA binding domain; Ferredoxin-fold
FT                   anticodon binding domain; tRNA synthetase B5 domain; B3/4
FT                   domain; TIGRFAM: phenylalanyl-tRNA synthetase, beta
FT                   subunit, non-spirochete bacterial"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_05640"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69321"
FT                   /db_xref="GOA:B8D294"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004532"
FT                   /db_xref="InterPro:IPR005121"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="InterPro:IPR005147"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR020825"
FT                   /db_xref="InterPro:IPR033714"
FT                   /db_xref="InterPro:IPR036690"
FT                   /db_xref="InterPro:IPR041616"
FT                   /db_xref="UniProtKB/TrEMBL:B8D294"
FT                   /protein_id="ACL69321.1"
FT                   /translation="MRVPVNWLKSYIDFQYSPQELADKLTMLGLEVEGIEYMGEGLEGI
FT                   IVGEIKKVKPHPNADKLVICEVDTGQELLQIITGAPNVKEGIKVPVAPVGVTLPGGLKI
FT                   KKARLRGENSYGMICSIDELGLSEKRASGIMILDEDAEVGTDIIDYLHLDEYVLKLDLT
FT                   PNYARCLGLLGIAREIKSVLGNEIKKPDTDLVESESESIENYISIEVEDKDLCPRYTGR
FT                   VIKNIKIGPSPRWMQARLRAAGIRPINNIVDITNYVMLEYNQPLHAFDYDKIDKKIIVR
FT                   RGKEQEKLITLDNKERELDEEVLVIADTEKALGLAGVMGGANSEVCDDTTTVFLESAYF
FT                   NPVNIRKTAKKFALPSEASHRFEREVDIEGVIAASNRAAYLMQKYAGGEIVRGIVDVYP
FT                   EPRRLHAINLDTGYVNKILGLNLDKTEIEDMLTRLEFKVEERDSKSLKVMVPSFRSDIE
FT                   READLIEEVARMYGYNNIPVTRPESKQRGRKTYKQHLEDITRNYMSAMGLDEVITFSLT
FT                   GKKVYDDLDIPEDSSLRNWVKVKNPLNEALSILRTSLLPSIIEVLSNNAKRQVETMSVY
FT                   ELGKIFTRIKEKKRPEERVVLAGGCMGKTDDPWKTGAPDFFYLKGVVVDYLRELGLDGL
FT                   DFTPSKLPFLHPGRTAEIYYRDTRIGIMGELMPDIADRFNLRSGTAVFQLDFETIVEEA
FT                   DLDRQYEQLPRYPAVERDMAVVVENEVFAGSLLKLIRENGGKLLKKAGLFDLYQGKQIP
FT                   EGYKSLAFKLVFQAHDRTLTDDEVNEVFNSIMDQLKDKFGAEIRGV"
FT   gene            616131..616493
FT                   /locus_tag="Hore_05650"
FT   CDS_pept        616131..616493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_05650"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_05650"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69322"
FT                   /db_xref="InterPro:IPR007838"
FT                   /db_xref="InterPro:IPR036192"
FT                   /db_xref="UniProtKB/TrEMBL:B8D295"
FT                   /protein_id="ACL69322.1"
FT                   /translation="MPTGDKSSKGKAKKYKVNVLGEEMTVVADVTEEYIDKLIEYINDI
FT                   GEAITRAYPGLPRRRITGLTLINMADEYYKLKKVYRDRIKEINNLREENKKLQNKINEM
FT                   EIEQKELISLLEEVDQ"
FT   gene            616494..616985
FT                   /locus_tag="Hore_05660"
FT   CDS_pept        616494..616985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_05660"
FT                   /product="Colicin V production protein"
FT                   /note="PFAM: Colicin V production protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_05660"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69323"
FT                   /db_xref="GOA:B8D296"
FT                   /db_xref="InterPro:IPR003825"
FT                   /db_xref="UniProtKB/TrEMBL:B8D296"
FT                   /protein_id="ACL69323.1"
FT                   /translation="MNQITILDILILVVFLYFVLRGYNNGFIKQTSTVVGLILALLIAI
FT                   KFYQPFQKYLLPYLDFSDQIMQFISFSLLFVFVNIIIQLLGRALKNIMNALFLGPVDQV
FT                   AGAALGLLKAGILTYFLVLFLAQIPYQGITELLNRSVLAGSLLEMTPLVKQRLSQIFGP
FT                   "
FT   gene            617042..618763
FT                   /locus_tag="Hore_05670"
FT   CDS_pept        617042..618763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_05670"
FT                   /product="DNA polymerase X family protein"
FT                   /EC_number="2.7.7.7"
FT                   /note="PFAM: PHP domain; TIGRFAM: histidinol phosphate
FT                   phosphatase HisJ family"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_05670"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69324"
FT                   /db_xref="GOA:B8D297"
FT                   /db_xref="InterPro:IPR002054"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR010996"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR022311"
FT                   /db_xref="InterPro:IPR027421"
FT                   /db_xref="InterPro:IPR029398"
FT                   /db_xref="InterPro:IPR037160"
FT                   /db_xref="UniProtKB/TrEMBL:B8D297"
FT                   /protein_id="ACL69324.1"
FT                   /translation="MYQLTNKEVSRILKELAKLMELKGENKFKVRAYYNASRQLINMSD
FT                   NIQDLAREGKIRNIPGVGEGIARSIKEIMEKGYSPELEELKAELPGGLLEIIKIPGLGP
FT                   KRAYQLFNELGVTNLEELKSALNTGKARKLKGFGVKTEENLKNKIEKYESFKNTYLLKE
FT                   ALGILDELKRYIKKCPGVSRVKMTGEARRKKELVNSLEILVASKEKESVLEYLRKLSFA
FT                   KSIEEKEENGYLLTFEDDIRIKVFIVPPDMFCFYLFYLTGSKDHVQKMETIADDAGYQL
FT                   TIKGLYKDSSKIKVKNEEEIYTTLGVSYIIPELRENRGEITAGFKNCLPDSINLRDIKG
FT                   DLHIHSSYSDGGFSIREIIEAARKKGYEYLAITDHSRSLKVASGLSVDRLFKQIEEIDK
FT                   LQEEYDDIIIFKGIEVDINKDGSLDYSDEVLSYLDFVIASVHTAFNMDRDKMTSRLIKA
FT                   MENPHVNAIGHPRGRLLKRRDAYKIDMDRIIQVASETNTCLEINSSPDRLDIDDVLARK
FT                   AKEVGVKLVINTDAHHLEELNNMSLGVAVARRGWLEREDVINTMNAEELQELLRRD"
FT   gene            618765..621140
FT                   /locus_tag="Hore_05680"
FT   CDS_pept        618765..621140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_05680"
FT                   /product="MutS2 family protein"
FT                   /note="PFAM: MutS domain V; Smr domain; TIGRFAM: MutS2
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_05680"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69325"
FT                   /db_xref="GOA:B8D298"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR002625"
FT                   /db_xref="InterPro:IPR005747"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036063"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8D298"
FT                   /protein_id="ACL69325.1"
FT                   /translation="MEESSLEILEFDKIIDRVQEFAATIIGKEIISRLQPVDNLNYVKN
FT                   KLREVSSAREILEEYGRPPFGGIRDLREIIEKADKGIVLSVKEVMDVRSTLEGVRELKK
FT                   YSREIGTGIDDELQDIYSIITEKFDRLTPLKQLENEINRCIDEHGEIKDSASRKLRSIR
FT                   REMDRIEGKINDKLNSIINNTRYQEMLQDKLVTIRGNRYVVPVKSSYKNTFSGIVHDQS
FT                   TSGLTYFMEPMAIVKLNNRLGELKRAEEQEIYRILKKLSENIKEHTRDLSDNLEMVSLL
FT                   DVDFARARFSIEIEGIEPGINDKGFINIRGGRHPLLKVKPVPIDITVGNEFKTLVITGP
FT                   NTGGKTVALKTVGLFVLMVQAGLHIPAEEETVISIFNGVYADIGDEQSIEQNLSTFSSH
FT                   INRIKRFLGKADARSLVLLDEIGVGTDPREGAALGVAILEHLRERGVTTIATTHYSEIK
FT                   SYAYSQDGVENASVEFDMETLQPTYRLLMGIPGGSNAFEIALKLGLPHDIIKDGKELMS
FT                   GDDIKVENIISDLNEERKKYEQLKIEIEERLEAVKKKEQKYDSLLTDLEKRKKKLITEA
FT                   REEALQIIKKTRKESKEILRRLKNKEFASRSDIDRVENEINLNLKETEKEISEKRQNKD
FT                   GRTRVKEISCGDQVRLKKTGQKGEVISVDREKGEAVIQAGIMKVTTGLDEVAKIDIPDD
FT                   TKDELFHSYQVKKKSRVSPTLDLRGERYETAQHKLDKYLDDVFLAGLKQVEIIHGKGTG
FT                   ALRKAVHTVLEKNPHITSYRLGRQEEGGSGVTIADLKS"
FT   gene            complement(621137..623557)
FT                   /locus_tag="Hore_05690"
FT   CDS_pept        complement(621137..623557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_05690"
FT                   /product="penicillin-binding protein, 1A family"
FT                   /EC_number="2.4.1.129"
FT                   /note="PFAM: Penicillin binding protein transpeptidase
FT                   domain; Transglycosylase; TIGRFAM: penicillin-binding
FT                   protein, 1A family"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_05690"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69326"
FT                   /db_xref="GOA:B8D299"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:B8D299"
FT                   /protein_id="ACL69326.1"
FT                   /translation="MAKQRKNYIFATIILIFALIFGLVIGSITWIIKNTPDITNYKGPN
FT                   EATLIYSADGQLLTKLYRENRVYVPLERIPVDLQNAIVAIEDTKFYAHHGIDFWGIPRA
FT                   LITNIKEGRIAQGFSTITMQLAENALFHRQQRTFYRKIQEIYLALQFERLYTKPEILEM
FT                   YLNEIFLGHSAYGVETAAQQYFGKHVWELDLSECALVAGLPKAPNYYSPFNNIDAAKTR
FT                   RNVVLNRMLELGYITREEYESARKQDIIIKPSEPKKENTAPYFIRYVRDRLIDRFGAQM
FT                   VYGGGLKVYTTLDLEMQKTAESTIKKAIENKYLPTVERDNTPDKLQPQLALITIEPQTG
FT                   AIRAMVGGRGNDQFNRATQAVRQPGSAFKPFVYTTAIKQGWSPGSVINDMPMLAHKEQG
FT                   EPLSIWPSNFEDKYRGYVSLRTALRYSINVAAVKLIKQVGVNNTIKTAEEMGISTFQPA
FT                   DNKESHLSLALGGLNKGVTPMEMASAYGVFANRGIWVEPYVITRVMDRRNNVIYEAHPD
FT                   KKIVLSEDVAYLMTNMLESVISGGTGWRARLGRPVAGKTGTTNNYTDAWFVGFTPDLVT
FT                   SVWIGEDNLHPMEYDQKDENGNYLFTENGRPKIISSAEAAQLWGNYMRQVVKNREVKYF
FT                   NVPDNIVKAEIDPVTGLLPNKYTPRVVKEIFRKHNVPTEVENLHEPIVTEKIDKESGLL
FT                   ATPNCPRENVVEYSYFASSGIRVGPATIEFGGIKKEKDEDENEEEQIQEVIEGTYIVDK
FT                   GEPVQKINPETGVPITNNGQVIYERIPTRKCDLHGNGQQNFFDNLWDMFKFNN"
FT   gene            624034..625257
FT                   /locus_tag="Hore_05700"
FT   CDS_pept        624034..625257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_05700"
FT                   /product="Tyrosyl-tRNA synthetase"
FT                   /EC_number="6.1.1.1"
FT                   /note="PFAM: tRNA synthetases class I (W and Y); S4 domain;
FT                   TIGRFAM: tyrosyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_05700"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69327"
FT                   /db_xref="GOA:B8D2A0"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024088"
FT                   /db_xref="InterPro:IPR024108"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:B8D2A0"
FT                   /protein_id="ACL69327.1"
FT                   /translation="MDINEQLNILKRGVSELITEKELKKKLELAREEGRPLRVKLGLDP
FT                   TAPDIHLGHSVVLRKLKQFQDLGHEVYLIIGDFTGMIGDPTGKSVTRKQLTEEEVRENA
FT                   KTYREQFSKILNPDKTKLVFNSNWLSDLNLSDVIELSSKYTVARMLEREDFSQRYKSGK
FT                   PISIHEFIYPLMQGYDSVAIKADIELGGTDQKFNLLVGRHLQKEFGQKPQVIMMMPILE
FT                   GLDGVNKMSKSLDNYIGINDEPKDMYGKVMSIPDSLITRYFELLTDVPEDKINEMKKSM
FT                   EEDRVNPMNFKKELARIIVTEYHGQDAAREAEKEFKRVFSQGKLPEDIPEVIIEQKDLE
FT                   DGKMWIVHLIAATGLVKSNSEARRMIKQGAVSINDEKHKSINEDIKVEDGMIIRIGKRR
FT                   FAKIKLPD"
FT   gene            625322..625969
FT                   /locus_tag="Hore_05710"
FT   CDS_pept        625322..625969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_05710"
FT                   /product="Sporulation protein YunB"
FT                   /note="TIGRFAM: sporulation protein YunB"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_05710"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69328"
FT                   /db_xref="GOA:B8D2A1"
FT                   /db_xref="InterPro:IPR014197"
FT                   /db_xref="UniProtKB/TrEMBL:B8D2A1"
FT                   /protein_id="ACL69328.1"
FT                   /translation="MFLKRGILLKFFIFIVILIIMVTVFIQKTLTPAFISLAEVEAVGL
FT                   ATTAINRAVDEECEGIKYEDIINYVVSDEGYVVLMQPNINYINSFSSRVSLNIQKRLNK
FT                   MNSNVVAIPLGRVLGIELLAGLGPKVKVKIIPVGFARPPVIRDTFESAGINQTRHKIYM
FT                   EVNVKLKLIVPFSEKTISLKTDVPITEVTIMGKVPRVYVGINNEGSKGILTK"
FT   gene            626341..626826
FT                   /locus_tag="Hore_05720"
FT   CDS_pept        626341..626826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_05720"
FT                   /product="PRC-barrel domain protein"
FT                   /note="PFAM: PRC-barrel domain; PRC-barrel domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_05720"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69329"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="UniProtKB/TrEMBL:B8D2A2"
FT                   /protein_id="ACL69329.1"
FT                   /translation="MYKGIEIIGLPVVEINTGRVLGEVEDIIFSEFDGLVKGFVIRNKN
FT                   KYFLETHNINRIGEDAITVLSQDLLKPWEEHNTVEENEQTFQTLNNTIFGERVMTTSGK
FT                   EVGKVKDLIIDENKNSVIGFELTEGVIQDLLEGRNLLPLSNNLIYGQDTLLLDEEGV"
FT   gene            626827..627204
FT                   /locus_tag="Hore_05730"
FT   CDS_pept        626827..627204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_05730"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_05730"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69330"
FT                   /db_xref="UniProtKB/TrEMBL:B8D2A3"
FT                   /protein_id="ACL69330.1"
FT                   /translation="MLNKKFMAGLLLGSLIGITIATVSGRVVKEKVMIGFKDENKDQGG
FT                   SGGGVQKVDSEKKGQGKYVGPGERGNEKKEEMVRNPEEEVQKKAGQEEAYVADQMLSKL
FT                   NFGKKISQLEEALKNLREDNT"
FT   gene            627226..628281
FT                   /locus_tag="Hore_05740"
FT   CDS_pept        627226..628281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_05740"
FT                   /product="predicted permease"
FT                   /note="PFAM: Domain of unknown function DUF20"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_05740"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69331"
FT                   /db_xref="GOA:B8D2A4"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:B8D2A4"
FT                   /protein_id="ACL69331.1"
FT                   /translation="MLKRYKNELKIGIMLLVLGGIIYFILLIKKVLLPFVFGTFLAYLF
FT                   NPLITFLRKRNISRITALYILILVVLILFISISIFILPIFIRELEELTVTLPKYVNSLE
FT                   KYVEYVNREYRRIHLPEVIKEVIDQALAKLENFILNFIENLTTSVINSLTYIVSLFISP
FT                   IITYYILKDYEEIQSSFLNIVPKKYRKPVLKSGREISKIFVGFLRGQIWVSIIVGVFST
FT                   LGLMLFKVKFYLLLGILAGITNMIPYFGPVIGAIPAVMIAFLSSPVKAFGVIILFSLIQ
FT                   QVESSIIGPKIFSNRVGLHPLTIIFVLLAGADIFDGWGLIFAVPVAGSLKVIFKIFIEQ
FT                   IISIKGLSGQE"
FT   gene            628374..631004
FT                   /locus_tag="Hore_05750"
FT   CDS_pept        628374..631004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_05750"
FT                   /product="alanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.7"
FT                   /note="PFAM: tRNA synthetases class II (A); DHHA1 domain;
FT                   Threonyl and Alanyl tRNA synthetase second additional
FT                   domain; TIGRFAM: alanyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_05750"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69332"
FT                   /db_xref="GOA:B8D2A5"
FT                   /db_xref="InterPro:IPR002318"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018162"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR018164"
FT                   /db_xref="InterPro:IPR018165"
FT                   /db_xref="InterPro:IPR023033"
FT                   /db_xref="UniProtKB/TrEMBL:B8D2A5"
FT                   /protein_id="ACL69332.1"
FT                   /translation="MVTTSDELRKAYLDFFKDRGHLVLPSAPLIPRNDPSLLWINAGMA
FT                   PFKPYFDGRKKPPKTRISTSQKCIRTNDIENVGKTARHLTFFEMLGNFSFGDYFKEEAI
FT                   EWAWEFVTRVLNLEENRLWITIYKDDDEAFKIWHDKVGVPENRIVRMGKKDNFWEIGTG
FT                   PCGPCSEIHYDRGEEFGNSSEDVIGGEGDRFLEIWNLVFTQYNRTEDGEYLSLPQKNID
FT                   TGMGLERVASLLQGVNSNFETDLLKPIINFVSQDSGVQYTEGQRVPFRVISDHIRAVTM
FT                   AIHDGVLPSNEGRGYVIRRLLRRAVRYGGKLNYEEPFLYKIVPVVVDIMSGGYPELKEK
FT                   EEHVSSVVKSEEERFFQTLEQGLNILNEMMEEMKDKGEKILSGKNAFKLYDTYGFPLDL
FT                   TRDVLAEHGYKVDEDVFTREMEKQRERARQARADVGFSGTDGEGIYKELREELGETEFT
FT                   GYRSLSNTTRIVGIVKDGQPVESLNNGEKGEIILNVTPFYARGGGQVGDKGILIDSEHR
FT                   ARVYDTRKKGGLTVHYTEVEKGEFRIDQVVEARVDEELRYNIARNHSTTHLLHKTLKEV
FT                   LGDHVNQSGSLVAPDRLRFDFSHYAPLTEEEINRIEDTVNEKILSNLPVEILEMPFEKA
FT                   KEMGAVALFGEKYGHIVRVVKIGDYSIELCGGTHVDRTGEIGSFKIVSEGSVAAGVRRI
FT                   EALTGKSVLEHIRKNDNTIKKISSILKTSPDEVIGRLSGLLEEQNELENKLQSLKDQLA
FT                   TSRVDELVDEVQKINGVKVLTAELKGIESDNLRKLSDKLKEKMESGIIVLASNLGNKVI
FT                   FVSVVTDDLVERGFHAGKLIGKVARVTGGGGGGRPDMAQAGGKKVDKITEALDEGKRII
FT                   SNHQS"
FT   gene            631085..631345
FT                   /locus_tag="Hore_05760"
FT   CDS_pept        631085..631345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_05760"
FT                   /product="uncharacterized protein conserved in bacteria"
FT                   /note="PFAM: Bacterial protein of unknown function
FT                   (DUF965)"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_05760"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69333"
FT                   /db_xref="InterPro:IPR009309"
FT                   /db_xref="UniProtKB/TrEMBL:B8D2A6"
FT                   /protein_id="ACL69333.1"
FT                   /translation="MTVDNMNDRTMRFKRSKEDDNRTGYILEKVYQALEEKGYNPVNQI
FT                   VGYLLSGDPAYITSYKDARTMIRTVDRDEIIEELLRNYLNK"
FT   gene            631459..633582
FT                   /locus_tag="Hore_05770"
FT   CDS_pept        631459..633582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_05770"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_05770"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69334"
FT                   /db_xref="GOA:B8D2A7"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:B8D2A7"
FT                   /protein_id="ACL69334.1"
FT                   /translation="MKTTTWLIFPIIFFFLFVTCSLVSATSPDVVWIIVDRITVNNIIA
FT                   SKTPHFNGLQNIGAFGLINVRTAGQIRAESTYLTAGAGKRSKGSKDAQKGINKGKGVIN
FT                   YRYDSLVKLNKDNPYHPTVGLLGEVLKDNGIKVGVLGNTDTIDQKNRSIVSFAMDQKGE
FT                   VPLGDVSKGLLKKVEKPWGYESDFEVFRKKFGEFKNKVDLLIIQTGDTTRIDNYVRFIG
FT                   KAEINREKIKAIEKIDNFIGFVLQVINLEETQLGILMLNPPVTDLENGNKLGWILLAGP
FT                   EFEKGWVTSLSTRRKGIVTISDLLPTLLNRFKVSYPEVTGSKISYIRQQKASWHQLYNL
FT                   REKIKRVSNLRPVFVKGFILLQLIMICLAIILLIKKDLPGSVIIHKGVEYLLVSLFLVP
FT                   LNFLILSQIIFPHFIHNLVILIAFTIVEFWVLMKINESRLFHIIVICLGLWIVIIVDLL
FT                   NNSRLMADSLLGFSSVIGARYYGLGNEYMGLFIGSMLVGFTGVLDYLSKKGVNINKKII
FT                   FLSPVLFLSFWFIASPALGANFGGAITALVAITVTMVYLKYGFNFKKIILFTPIVGFVI
FT                   LFVMYLDYTEILGPRTHIGKAFAYLLKGRTGGIIGIIKRKLAMNIKLLKWTIWTRVLLG
FT                   FILYLIVLFLYPIGRFKKLLKKQPNMAAGFYGGLAGTLVTMMVNDSGVVAAATLLFYPI
FT                   MTLLYFISKPGYK"
FT   gene            633624..634886
FT                   /locus_tag="Hore_05780"
FT   CDS_pept        633624..634886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_05780"
FT                   /product="cell division protein FtsA"
FT                   /note="PFAM: Cell division protein FtsA; TIGRFAM: cell
FT                   division protein FtsA"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_05780"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69335"
FT                   /db_xref="GOA:B8D2A8"
FT                   /db_xref="InterPro:IPR003494"
FT                   /db_xref="UniProtKB/TrEMBL:B8D2A8"
FT                   /protein_id="ACL69335.1"
FT                   /translation="MNLLNLFSENTNKGQEFSYRLIVDIGTEFVKTIIAEFNEKEKNIL
FT                   GFGKVRQDYGNMDGGAVTNIEGVISRTREAIKVAESYTPHRPDEVVMGIAGEFVKGVIY
FT                   SLEKVRPKPEKKIDSEEINNLIIESQKKAYQEAVKRVEQETGLENVKLELISSNLVEVK
FT                   VDGYKVNDPGQFQGKNINLVVFNTYAPLVQVGALKTIAGKLGYDLVGIVAEPLSIASSL
FT                   LTEDTFELGAIIIDIGGGTTDIALIRNGGIEGTKMFAMGGRAFTRTLAKNLGISMRDAE
FT                   KLKLEYSRGKRVKNYEVTRKLIKKDMDILYQGIELSLLEMSRGEVLPQKIYFCGGGSAL
FT                   KGLIEGFKKRPLEETLPFSHRPGIHLLKGNELDSIRDANKYLQGSEHVTPRSLAIYGTE
FT                   IESKERGRFGFGNKGIQGILH"
FT   gene            634945..636432
FT                   /locus_tag="Hore_05790"
FT   CDS_pept        634945..636432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_05790"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_05790"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69336"
FT                   /db_xref="GOA:B8D2A9"
FT                   /db_xref="InterPro:IPR006949"
FT                   /db_xref="UniProtKB/TrEMBL:B8D2A9"
FT                   /protein_id="ACL69336.1"
FT                   /translation="MALVVHSRLLLLNNEVNLKLVKKYSEEFQKEVVFINPDPVIADRV
FT                   IRSGFKAFPDLNSLENNNPLHAVAVGKEENNDNPVDSNKQLKSVKRIEDVERIEDVDDR
FT                   GEYGDKKHRVFNLVGVILILLLAWFYFMYPTAVVEVKPVVEQQQHEMELLGSLQLNNID
FT                   WSNHILPLHRFEVSITDEDEIYASGEKLIGETRAEGIVKFINENKNEIKIPAGTIVQTV
FT                   SGIKFKTVKDVNVPGLKVDFLMDVPVGMKAGQAEVGIVALQKGSRGNIGIGRIKKMAKP
FT                   LNKVYVINPEPTSGGKDRKLPVVTKNDINRLKESLEEKLQSSLLAKIYRKLGGNFRVIE
FT                   NEIDYSKIEFNFSHRVGDIVEVINGSGTLTASGYLLKNSELDRMVTVLFEENLEKDKRL
FT                   LSNGISVTRVDLEEKGNGLYNIKIGFVAPVVPDIDTGNLIKALKGSKIDQARQVLSNSQ
FT                   IIDDFNIKTRGNILPKLGFAIKVVVKEPDFEVMPVSN"
FT   gene            636448..636870
FT                   /locus_tag="Hore_05800"
FT   CDS_pept        636448..636870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_05800"
FT                   /product="Holliday junction resolvase YqgF"
FT                   /note="PFAM: Uncharacterized protein family (UPF0081);
FT                   TIGRFAM: conserved hypothetical protein TIGR00250"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_05800"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69337"
FT                   /db_xref="GOA:B8D2B0"
FT                   /db_xref="InterPro:IPR005227"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8D2B0"
FT                   /protein_id="ACL69337.1"
FT                   /translation="MRIMGLDYGDRRIGVAISDKLGMTAQGQEVIIRKTPEEDLEVIKG
FT                   LIDKYEVEEIIVGMPKNMDGSLGPRAEKTRDFIDFLQKSLDTPVKVWDERLSTVEAERV
FT                   LIEADVSRKKRKGVIDKVAASIILQGYLNYQNKLHG"
FT   gene            636882..637148
FT                   /locus_tag="Hore_05810"
FT   CDS_pept        636882..637148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_05810"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_05810"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69338"
FT                   /db_xref="InterPro:IPR009711"
FT                   /db_xref="UniProtKB/TrEMBL:B8D2B1"
FT                   /protein_id="ACL69338.1"
FT                   /translation="MAEGRFYVDEETKTLVLEGEDSEDRFYIEEEINLEGNRYLIVVPA
FT                   KEDEEEQGAYVLKLISDNNGDEVLTVVEDDDEFEKVRRAYEEK"
FT   gene            637468..638481
FT                   /locus_tag="Hore_05820"
FT   CDS_pept        637468..638481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_05820"
FT                   /product="aminodeoxychorismate lyase"
FT                   /note="PFAM: Aminodeoxychorismate lyase; TIGRFAM: conserved
FT                   hypothetical protein TIGR00247"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_05820"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69339"
FT                   /db_xref="GOA:B8D2B2"
FT                   /db_xref="InterPro:IPR003770"
FT                   /db_xref="UniProtKB/TrEMBL:B8D2B2"
FT                   /protein_id="ACL69339.1"
FT                   /translation="MKKAARVFLISIIVITGLLKFTSLISPVNRYDNTIIGVEIKSGSS
FT                   SREISQKLYNKGLIKSARLFNILVSVSGFDNSLKAGYYEWSPSDNLISIIKDLNRGRVA
FT                   TFKITIPEGFTVEEVAEKLGEVTFYSKENYLSLAEGNNFNRPYLPRKRQGVKYVLEGFL
FT                   YPDTYIIPKEYNPGQVLNVMLNNFEEKCWQELREKSLKKGITPYEAIIIASLIEKEARL
FT                   ETEKPIISAVIYNRLRKGMLLQIDATVQYSLPEWKDRVLYKDLRIDSRYNTYKYPGLPP
FT                   GPICNPGKSSIEAALNPADVDYLFYFALEDGSHIFTTTYEEHLRQQNKYRRGLENE"
FT   gene            638474..639112
FT                   /locus_tag="Hore_05830"
FT   CDS_pept        638474..639112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_05830"
FT                   /product="O-methyltransferase family 3"
FT                   /note="PFAM: O-methyltransferase; Methyltransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_05830"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69340"
FT                   /db_xref="GOA:B8D2B3"
FT                   /db_xref="InterPro:IPR002935"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B8D2B3"
FT                   /protein_id="ACL69340.1"
FT                   /translation="MNDDRSISFVKTTELLKNIEEEARRRYIPVVRPEVGQFLMILTRL
FT                   VNPVRILEIGTAIGYSTIWMARGSSPGTEIVTIEKNEESAFEALENFKKAGIEDRINIK
FT                   IGDALEIIPFLRRQFDLVFIDGAKGQYINYFDLVIDLLPIGGVIVADNVLYRGKVKKGG
FT                   YIKHKHRTMVRNLRNYLDKINNHKLFDSTVIPVGDGISLSVRRKNSEKS"
FT   gene            639099..640319
FT                   /locus_tag="Hore_05840"
FT   CDS_pept        639099..640319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_05840"
FT                   /product="peptidase U32"
FT                   /note="PFAM: Peptidase family U32"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_05840"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69341"
FT                   /db_xref="GOA:B8D2B4"
FT                   /db_xref="InterPro:IPR001539"
FT                   /db_xref="InterPro:IPR032525"
FT                   /db_xref="UniProtKB/TrEMBL:B8D2B4"
FT                   /protein_id="ACL69341.1"
FT                   /translation="MKKVELLAPAGNLEKLKLAILYGADAVYCGGLRFGLRYGADNFTP
FT                   EELEEGTRFVHNHGGKIYITVNIYPHNNDLAKLPDYLHKLEEIGVDGLIVSDPGVIEFI
FT                   NREKIEIPLHLSTQANTVNWASASFWHKQGIERIILARELSREEIKEIRDRTSISLEMF
FT                   VHGSMCISYSGRCLLSNYMVGRDANRGKCAHPCRWKYHLVEEQRPGEYYPVYENEQGTF
FT                   IMNSKDLCLIEYLPDVISTGVDSLKIEGRMKSLHYVATVTRVYRKAIDSYYHDPENFKV
FT                   KPEWLDELKKVSHRGYTTGFFISPPTGEDHNYNSSVYIRDHDFMGIIRDYDKKKNEAVV
FT                   EVRHKFFKGDRVEVMGPDTTNFETTVNYIINENGEEVDEAPHPRELIRIPVTHKVKPYY
FT                   LVRRKKS"
FT   gene            640316..640546
FT                   /locus_tag="Hore_05850"
FT   CDS_pept        640316..640546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_05850"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_05850"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69342"
FT                   /db_xref="InterPro:IPR032587"
FT                   /db_xref="UniProtKB/TrEMBL:B8D2B5"
FT                   /protein_id="ACL69342.1"
FT                   /translation="MTSPDRDTQRIKVKVPPEEIVLIDMIFKASEGIATLTVDHKKKGV
FT                   INLDVTEGTRADVMLILENLKKKIPLEILKE"
FT   gene            640622..641320
FT                   /locus_tag="Hore_05860"
FT   CDS_pept        640622..641320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_05860"
FT                   /product="sporulation sigma factor SigK"
FT                   /note="PFAM: Sigma-70, region 4; Sigma-70 region 2;
FT                   TIGRFAM: RNA polymerase sigma-K factor; RNA polymerase
FT                   sigma factor, sigma-70 family"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_05860"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69343"
FT                   /db_xref="GOA:B8D2B6"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014209"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B8D2B6"
FT                   /protein_id="ACL69343.1"
FT                   /translation="MLSLLISFFRGLLILVSYIRNGKVFPQPLSPEEEEKYIKRMRQGD
FT                   EEARNILIEHNLRLVAHIVKKYNSVYTDNEDLISIGTIGLIKGINTYDETKKTKLATYA
FT                   ARCIENEILMHLRSVKKLSNETLLQESIGSDKDGNDITLMDVLDTREDSVINKVEKSID
FT                   EEQLYNKLGELSPREKKVLELRYGLLDGKRLTQKEVASILGISRSYVSRIEKKAIQELS
FT                   DLFHGKAGHR"
FT   gene            641445..641933
FT                   /locus_tag="Hore_05870"
FT   CDS_pept        641445..641933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_05870"
FT                   /product="HAD superfamily (subfamily IIIA) phosphatase,
FT                   TIGR01668"
FT                   /note="PFAM: haloacid dehalogenase-like hydrolase; TIGRFAM:
FT                   HAD superfamily (subfamily IIIA) phosphatase, TIGR01668;
FT                   HAD-superfamily hydrolase, subfamily IIIA"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_05870"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69344"
FT                   /db_xref="GOA:B8D2B7"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR010021"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B8D2B7"
FT                   /protein_id="ACL69344.1"
FT                   /translation="MGSKIQPDFYYKSIFDVELEKLKIEGIEGIICDIDNTIVPWSKRE
FT                   IVKEVVNWFDEIESYGFKICLVSNGTGSRVTYFSEKLGVPAVGRAVKPAKRAFYRAMDK
FT                   LGMDPEQIAVIGDQLFTDVFGGNRMGFTTVLVNPMSDRELFTTRLLRKLEKLFFERED"
FT   gene            641956..642645
FT                   /locus_tag="Hore_05880"
FT   CDS_pept        641956..642645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_05880"
FT                   /product="cell wall hydrolase SleB"
FT                   /note="PFAM: Cell Wall Hydrolase; Putative peptidoglycan
FT                   binding domain; TIGRFAM: spore cortex-lytic enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_05880"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69345"
FT                   /db_xref="GOA:B8D2B8"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR011105"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="InterPro:IPR042047"
FT                   /db_xref="UniProtKB/TrEMBL:B8D2B8"
FT                   /protein_id="ACL69345.1"
FT                   /translation="MKEKMATVILILLFVTVFILDFHKVEASGYYMELGTRILKKGDEG
FT                   PDVAILQRKLKELNLYRGKIDGIFGPGTEKAVKLFQEKNKLKVDGIVGPGTYSKLPKGN
FT                   LLSRMDISRDDILLLARIIHGEARGESFKGKVAVGAVILNRVASRKFPDTIREVILQKG
FT                   QFSCLLDGQANLYPSAESIEAAKAALLGYDPTYGSMFFYNPDVATNTRWISTRPVMTRI
FT                   GDHVFLK"
FT   gene            complement(642724..642966)
FT                   /locus_tag="Hore_05890"
FT   CDS_pept        complement(642724..642966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_05890"
FT                   /product="transcriptional regulator, AbrB family"
FT                   /note="PFAM: SpoVT / AbrB like domain; TIGRFAM:
FT                   looped-hinge helix DNA binding domain, AbrB family"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_05890"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69346"
FT                   /db_xref="GOA:B8D2B9"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:B8D2B9"
FT                   /protein_id="ACL69346.1"
FT                   /translation="MKSTGIVRKIDDLGRMVIPIELRRTMNIDKKDPMEIFVDDEKIIL
FT                   KKYEPACIFCGNADDTVEFKGKVICKNCLNEMAEK"
FT   gene            643194..643631
FT                   /locus_tag="Hore_05900"
FT   CDS_pept        643194..643631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_05900"
FT                   /product="ferric uptake regulator, Fur family"
FT                   /note="PFAM: Ferric uptake regulator family"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_05900"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69347"
FT                   /db_xref="GOA:B8D2C0"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B8D2C0"
FT                   /protein_id="ACL69347.1"
FT                   /translation="MEKLIEKVTNILGSNNYKITSQRKDILKVLIKNKERHFSAEELYE
FT                   EVKKINPDVGLATIYRNLEIFSELGITHQLDFDGNFKKYELSLERHHHHLICKNCGKII
FT                   EFNDDVLEDFEKDLEKHYNFKIVDHQIKFYGICQDCKNEDE"
FT   gene            643691..644212
FT                   /locus_tag="Hore_05910"
FT   CDS_pept        643691..644212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_05910"
FT                   /product="Ferrous iron transport protein FeoB"
FT                   /note="PFAM: GTPase of unknown function; TIGRFAM:
FT                   GTP-binding conserved hypothetical protein; small
FT                   GTP-binding protein domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_05910"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69348"
FT                   /db_xref="GOA:B8D2C1"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030389"
FT                   /db_xref="UniProtKB/TrEMBL:B8D2C1"
FT                   /protein_id="ACL69348.1"
FT                   /translation="MNTKNSITTNDKKVYLVGSPNVGKSVIFNYLTDSYALVSNYPGTT
FT                   VELSTGKILIEGQVVRLIDTPGIYSLYFPISEEEKVTRKVLMTGNPDLVIHVIDAKNIE
FT                   KMLVMTFELLELGYNLILVLNIIDEAKKLGISINTELLSNILGIPVVGTVSITGQGMRE
FT                   LFFLISKMVI"
FT   gene            644322..645764
FT                   /locus_tag="Hore_05920"
FT   CDS_pept        644322..645764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_05920"
FT                   /product="Ferrous iron transport protein FeoB"
FT                   /note="PFAM: Ferrous iron transport protein B C terminus;
FT                   Nucleoside recognition; Nucleoside recognition; Ferrous
FT                   iron transport protein B"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_05920"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69349"
FT                   /db_xref="GOA:B8D2C2"
FT                   /db_xref="InterPro:IPR011640"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="InterPro:IPR041069"
FT                   /db_xref="UniProtKB/TrEMBL:B8D2C2"
FT                   /protein_id="ACL69349.1"
FT                   /translation="MKAFLKFEDPLERSLQELSSLFKKNYPVSHRALVLMVLSGDKEIE
FT                   DLISRSESDNLVDRIKKHKNKLRKDYGYPLEVVISKQRKEKVKKVVGEVLKKDQQSGNV
FT                   LKETIDFLTINPYSGPVILAIVLIGLYYLVGVVGARYLVDFIEKNFFIDYFNPLITEFI
FT                   EMIIPYRILQELFVGDYGIFTLALRYAIALVLPIVGCFFLAFSILEDSGYFPRIAVLSN
FT                   KILKVIGLNGRAVIPILLGFGCGTMATIATRVLERKRERILVTFLLALAIPCSSQMGLI
FT                   SGILAGNPVGLLIWVIVVGAVFTVTGYLLGLILPGRSGAFYMELTELRIPRPVHIIKKT
FT                   VNRMRWYFLEVVPLFIYASFFIWIGRLTGLFERFLNLLHPVVRMVGLPGESAVIFLYGF
FT                   FRRDYGAAGLYDLYRSGVLNNRSLIVVSVILTLFVPCVAHFSMIIRERGLITGLVITGL
FT                   VFIIAFTTGYILNNIFFLLNIV"
FT   gene            645951..646223
FT                   /locus_tag="Hore_05930"
FT   CDS_pept        645951..646223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_05930"
FT                   /product="Ferrous iron transport protein FeoA"
FT                   /note="PFAM: FeoA domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_05930"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69350"
FT                   /db_xref="GOA:B8D2C3"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR038157"
FT                   /db_xref="UniProtKB/TrEMBL:B8D2C3"
FT                   /protein_id="ACL69350.1"
FT                   /translation="MIISVRKKPGFISKNKEFPLSRVEAGTKGIISQLKFNEPHIVKKL
FT                   LGIGLIPGETIEVIRDFPVFIIKIGESKFALDEKLVSGIYIILGN"
FT   gene            646371..647066
FT                   /locus_tag="Hore_05940"
FT   CDS_pept        646371..647066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_05940"
FT                   /product="putative transcriptional regulator, Crp/Fnr
FT                   family"
FT                   /note="PFAM: Bacterial regulatory proteins, crp family;
FT                   Cyclic nucleotide-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_05940"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69351"
FT                   /db_xref="GOA:B8D2C4"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B8D2C4"
FT                   /protein_id="ACL69351.1"
FT                   /translation="MEEMQRRCLKELMVFSKMERDEVALICERAYEKWFRKGEVIFFEN
FT                   DDNRNLYVLVSGRVKLSMLSAEGKEKVLTILQEGDIFGEVSLFDQDPLPVTAEVIKDSR
FT                   LIVLPVKDLENIIMKNPKVAIKIIEALAKKTRLLTGQIRDLVFYDAEGRLASLLLRFAK
FT                   DFGIDVKSGTLIDLVLTHQEIANLLGSSRVTVTKLLNQFIDEGIIKTYKRKIVIMKPEQ
FT                   LHDKMQNMI"
FT   gene            647078..647959
FT                   /locus_tag="Hore_05950"
FT   CDS_pept        647078..647959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_05950"
FT                   /product="permease of the drug/metabolite transporter (DMT)
FT                   superfamily"
FT                   /note="PFAM: Integral membrane protein DUF6; Integral
FT                   membrane protein DUF6"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_05950"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69352"
FT                   /db_xref="GOA:B8D2C5"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B8D2C5"
FT                   /protein_id="ACL69352.1"
FT                   /translation="MLQKAKTKTRVIKADLLLLLVVTVWGTTFPVMKMILVDTDPFYFI
FT                   ALRFMVAFLALYLVFHKKVTRDDFSGETVRKGVILGLCLLAGYAFQIVGLQYTTASRSA
FT                   FITGLSVVMVPLLSIMIIKQIPGPYTWTGVALATIGLYLLTGAGKIAVNLGDYLTFFCA
FT                   VSFALQIVLLSKYLPGNKPVVLTLIQMAVVGGGSFLVSLFSNGITGVTGPALGVIIYTG
FT                   LLATAMAYLIQSYAQQFTPPTHTGVIFTLEPVFGALFSYLILGEVMGFTGLFGGLLIVT
FT                   GMLITEVKAEGV"
FT   gene            647961..648830
FT                   /locus_tag="Hore_05960"
FT   CDS_pept        647961..648830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_05960"
FT                   /product="shikimate 5-dehydrogenase"
FT                   /EC_number="1.1.1.25"
FT                   /note="PFAM: Shikimate dehydrogenase substrate binding
FT                   domain; Shikimate / quinate 5-dehydrogenase; TIGRFAM:
FT                   shikimate 5-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_05960"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69353"
FT                   /db_xref="GOA:B8D2C6"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR011342"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041121"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8D2C6"
FT                   /protein_id="ACL69353.1"
FT                   /translation="MFDNSTQVVGLMGYPLGHSMSPAMHNRAYKDLGINYVYLPLEIKP
FT                   DFLKEGIEGLRAFNFRGVNVTIPYKEKVIPYLDEIDRLAGEIGAVNTIVNNGGKLKGYN
FT                   TDALGFKKMLEDDCSFEIKGTKAVIIGAGGASRAVGAVLAREGASEIFLLNRTLKKAAK
FT                   LVGIWNKTYPGIKTVALPLDEDKYLPVVKRCDVIIDTTPVGMAPGIKGGPVIAKEAITR
FT                   DTLVVDLVYNPPETTLIKAGRQVGARTMNGFPMLIYQAAYAFKLWTGIKPELFIKPVRE
FT                   AISPDFFA"
FT   gene            648991..650667
FT                   /locus_tag="Hore_05970"
FT   CDS_pept        648991..650667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_05970"
FT                   /product="Tfp pilus assembly protein PilB"
FT                   /note="PFAM: GSPII_E N-terminal domain; Type II/IV
FT                   secretion system protein; TIGRFAM: general secretory
FT                   pathway protein E; type IV-A pilus assembly ATPase PilB"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_05970"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69354"
FT                   /db_xref="GOA:B8D2C7"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007831"
FT                   /db_xref="InterPro:IPR013369"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="InterPro:IPR042181"
FT                   /db_xref="UniProtKB/TrEMBL:B8D2C7"
FT                   /protein_id="ACL69354.1"
FT                   /translation="MTRTHIKKLGELLLDFNFITEKQLNEALKKQNKSGKKLGEILVES
FT                   GYLNENDLIQVLEFQLGIPHADLNKYVINPHLAQYIPENIARRHNVVPLEKKNGKLKVA
FT                   MVDPTNLVAIEDIEMTSGLKVEPLIASRKNIKMALNQIYSVNDSDAAEVFASLNEVTTK
FT                   TNEEPELNELKEMIEDAPIVRLANLIINQAIQMKASDIHIEPQEDQVRVRYRVDGVLRE
FT                   NMTVPKHSQAALISRLKIIADLDITERRVPQDGRIELNVSGVKIDMRVSTLPTVYGEKV
FT                   VIRLLNKEEKLLQIEQLGFSETNLSRFMKLIKQPHGIILVTGPTGSGKSTTLFAALNKL
FT                   NTPEKNIITVEDPVEYQLRGINQVQANSRVGLTFASALRSILRQDPDIVMVGEIRDEET
FT                   ARIAVRAALTGHLVLSTLHTNDAVSSVTRLIDMGIPPYLVASSVIGVVAQRLVRRLCTC
FT                   KEEYVPGPEEMEFLQVNDIGKLQRPEGCKKCHSTGYRGRLPVHEILIMDRKLREMIVNG
FT                   EGESVIKKYARKAGMLTLKEDGVNKVIEGLTSYEELARVVS"
FT   gene            650670..651752
FT                   /locus_tag="Hore_05980"
FT   CDS_pept        650670..651752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_05980"
FT                   /product="Tfp pilus assembly protein, pilus retraction
FT                   ATPase PilT"
FT                   /note="PFAM: Type II/IV secretion system protein; TIGRFAM:
FT                   pilus retraction protein PilT"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_05980"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69355"
FT                   /db_xref="GOA:B8D2C8"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR006321"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8D2C8"
FT                   /protein_id="ACL69355.1"
FT                   /translation="MVLMDIKEFLKKFVEDQHISDLHLTVNSKPVVRYDGKLKVFEEFS
FT                   GRIGFEDMQNITKELMTDDQWQQFQEKGELDFSYSVPGFSRFRVNAYYQRGAIALALRI
FT                   IPTKIPTIEELGLPQILKNLALMRKGLFLCTGPTGSGKTTTLASMINIINKNRQAHILT
FT                   LEDPIEYLHRHNKSIVHQREVGIDTTSFKEGLRSALRQDPDVILVGEMRDHETISIALE
FT                   AAETGHLVLATLHTNDAPQTIDRIIDVFPPQQQRQVRVQLSLTLNGIVSQQLLPRKDGN
FT                   GRIAALEVLIGTPAVRNVIRDGKSHQLYSSMQTGGKYGMITMDNYILDLLSKSLINKDT
FT                   ALRRANDPEYIKKRINAVRV"
FT   gene            651872..653077
FT                   /locus_tag="Hore_05990"
FT   CDS_pept        651872..653077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_05990"
FT                   /product="Tfp pilus biogenesis protein PilC"
FT                   /note="PFAM: Bacterial type II secretion system protein F
FT                   domain; Bacterial type II secretion system protein F
FT                   domain; TIGRFAM: general secretion pathway protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_05990"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69356"
FT                   /db_xref="GOA:B8D2C9"
FT                   /db_xref="InterPro:IPR001992"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR011850"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:B8D2C9"
FT                   /protein_id="ACL69356.1"
FT                   /translation="MAPEFEYEAVSKSGERIKGTITADNSTVVARQLREEGYYITSIEE
FT                   QVERKEINIQLSNRVKTKDLVLFTQQFSVLLNAGISLVEALDIMYDQVEHPRLKEVVRS
FT                   IQEDVETGSSLTDALLKHPDVFPELYCQMVKAGEAGGVLDQVLEQLSAHYERQDEINSK
FT                   VKSAMYYPVILLVVAVGVVIFLMTRVVPQFISLFSSMDVELPLPTRILIKLSTFLSSYW
FT                   WALFGGLGLTVALLLKYKSTPEGRRRFDSLILKIPVFGKLMRKIYVSRFTNTLSILLTS
FT                   GIDIISALAIVEEVVGNKVFSDVISRSRTQVSEGISLSRPLDESGEFPRMVIQMINVGE
FT                   EAGSLDNMLQKVSDFYDKEVETSINNTVSLIEPLMIVVLAVIVGFIVMSIILPMFEMYE
FT                   QF"
FT   gene            653254..653685
FT                   /locus_tag="Hore_06000"
FT   CDS_pept        653254..653685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_06000"
FT                   /product="Tfp pilus assembly protein, major pilin PilA"
FT                   /note="PFAM: Prokaryotic N-terminal methylation motif;
FT                   TIGRFAM: prepilin-type N-terminal cleavage/methylation
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_06000"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69357"
FT                   /db_xref="GOA:B8D2D0"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:B8D2D0"
FT                   /protein_id="ACL69357.1"
FT                   /translation="MKFFKTLYTRESGITLVEILIVIAIIGIFVGIALPRLGGMRERAQ
FT                   VATGKSVLGTINTALGLYYSEYGTYELGSNYSDISDLLNDYIDNLTATLGDFQLGNYNT
FT                   PSADEFTLQIGIDQNGDGSLTEADDLILELDQNGDIEVK"
FT   gene            653764..654504
FT                   /locus_tag="Hore_06010"
FT   CDS_pept        653764..654504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_06010"
FT                   /product="Prepilin peptidase"
FT                   /EC_number="3.4.23.43"
FT                   /note="PFAM: Bacterial Peptidase A24 N-terminal domain;
FT                   Type IV leader peptidase family"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_06010"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69358"
FT                   /db_xref="GOA:B8D2D1"
FT                   /db_xref="InterPro:IPR000045"
FT                   /db_xref="InterPro:IPR010627"
FT                   /db_xref="UniProtKB/TrEMBL:B8D2D1"
FT                   /protein_id="ACL69358.1"
FT                   /translation="MKLFVFIMGLLFGSFFNVIILRVPRKESIIWPRSHCPHCQTTLKW
FT                   YELIPVLSFIFLKGKCRYCGYRISWQYPLVEVMTGLIYLLLYYHFGLTMVFLIYIILIS
FT                   LLIISSVIDIREKIIPNVITFPGMVTGLISSIILKHIGFWNSLLGILIPGIFLFIIALI
FT                   FKGGLGMGDVKLVAMIGAFTGVRWALMALFTGAFLGAITGIILIVSGVLDRKKPVPFGP
FT                   FISIGGLVSILWGYEIWIYIINLY"
FT   gene            654733..656022
FT                   /locus_tag="Hore_06020"
FT   CDS_pept        654733..656022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_06020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_06020"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69359"
FT                   /db_xref="UniProtKB/TrEMBL:B8D2D2"
FT                   /protein_id="ACL69359.1"
FT                   /translation="MVLILVLIFTMAMMHMAGTEIDFAARDMNNMVAFYLARSGAAALA
FT                   DWIENNDSNTVRDLFWVEGGRGTDWFNLETGFPGEIKVHAEVILNEDEHRVEVTSEGRI
FT                   YGRTDTVKVILVPEGLSRERVFDIPFFAKESITMESNSLVVGDLGTNASKLSDFDIDYS
FT                   AEVVDGDLQVGPEATDGVINSLESKKVVKDGVVKRLPEERNYPLPLFPRFPDDLPDREF
FT                   NSSLTTIDKDGWYDEIKLTGNRELVIDVGDDARKIRITSLIINSGEITIIGDGTLELYI
FT                   DEEFQVLGNGSFINKGGDPNKVVVYYRGNEDLNLHGQRQIVGSLYTYYADIALGGSGSI
FT                   LGHIVSGGDYITFNGNYYNEYTKDFVRIIYAPLATLDLRSRHDGLSGAVVCNRLILGDD
FT                   FSLNEFFIQEALLPFDFVGGTPYIIDHWEQ"
FT   gene            656041..657591
FT                   /locus_tag="Hore_06030"
FT   CDS_pept        656041..657591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_06030"
FT                   /product="prepilin-type N-terminal cleavage/methylation
FT                   domain protein"
FT                   /note="PFAM: Prokaryotic N-terminal methylation motif;
FT                   TIGRFAM: prepilin-type N-terminal cleavage/methylation
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_06030"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69360"
FT                   /db_xref="GOA:B8D2D3"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:B8D2D3"
FT                   /protein_id="ACL69360.1"
FT                   /translation="MKLLKKERGLSLIEVMVSLVIFAVIVLAFGSFITSNYKGIQEAGE
FT                   MTRSAHENKKTVERMIASGQVSRGHSLELDFGEDNIVIDGGIAESGKLRTFIPTVPAIV
FT                   SVTSDPEFHVMGEGPVIIEVVVTTRMVPDDTAVEVELRTPDDILVDTAVGQIQDNQDTL
FT                   YLNAGEHLSDGIYNIVTRVDGIWSPFVINYVIRPIVYVVVGEDSTVLCSNDGENWTDHS
FT                   EELPVDGVDLNAIIWGGRPDDRKFIIVGDDGYIFTSEDGVNWQEEITPTGSDLYDICWA
FT                   KERYLAVGEGGIILTSDSGTDWNKISFDDNVNLYGVTYGGTSEDSFSVAVPEATPNYTV
FT                   VKIEGEDPTKKNLTPSDNLYSATWGSLPSSGEGVFMAAGVQDIISFDHNIKLLTDNGYY
FT                   NEDYIFNDIVPALIAETSTFLAAGSDGKDGVIMILRKVDSGGLIWDYLHNVDELPEIPS
FT                   NLAGFDAIVWFNDRLVATGVNKSGREVIINLHYNGDSWEWQDVYTGSGYVRLNDVVAR"
FT   gene            657612..659366
FT                   /locus_tag="Hore_06040"
FT   CDS_pept        657612..659366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_06040"
FT                   /product="prepilin-type N-terminal cleavage/methylation
FT                   domain protein"
FT                   /note="PFAM: Prokaryotic N-terminal methylation motif;
FT                   TIGRFAM: prepilin-type N-terminal cleavage/methylation
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_06040"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69361"
FT                   /db_xref="GOA:B8D2D4"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:B8D2D4"
FT                   /protein_id="ACL69361.1"
FT                   /translation="MFSRFFTSNKGLTLIEILVALALVGIASTAIYGFLNFTVNNYQDG
FT                   EEKIRVQDYTRLVADEITEELRGVTSARLIEDVDSSEIDSENYNYMYVKPDIDLVIKRV
FT                   KNELGLIVEEKIPGVSGVKYVDQAGNVIKDFTPDYELTFFIDDDNPGVLHFNLVEVNSG
FT                   FEVESAVYLINIEGDISGVTEGKMLEYTSLYDTGDPFAHLDFNKFWYEWLQENYQDEGM
FT                   IGEGDYGVNFPLDGGELTLTITGSGNAAAGGAMLLKELNSDHFPEGADITSFAVVVDAR
FT                   NLDVGEGGYGVLLRGEVIQARDKDGEILENQYNDYGYMFQFDPGARGFVIRRIKGGFHD
FT                   VENNIGASLITGNGYNTRFGAPYAPEHLVNDVFHWSGYQDWFKRYKTVIKVQTQPGGDL
FT                   ILRAHLIDEDGHRSDEMIFGDFNKLTLIGKYGEENIFDGRKLDYDYWSNEDVTLPGNII
FT                   GLRSWDMHNNEHTTEFYEISIAPAEPGVIDIDYDNKVITLTFDEEVIADDLSLLTGNFI
FT                   ITRVTNNMEFTVFSIEQGNTTRSIELNLSSALGKGTYLISYSRPASGGLADSEGNLVED
FT                   FDRYLEIN"
FT   gene            659456..660514
FT                   /locus_tag="Hore_06050"
FT   CDS_pept        659456..660514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_06050"
FT                   /product="Tfp pilus assembly protein, ATPase PilM"
FT                   /note="TIGRFAM: type IV pilus assembly protein PilM; cell
FT                   division protein FtsA"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_06050"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69362"
FT                   /db_xref="GOA:B8D2D5"
FT                   /db_xref="InterPro:IPR003494"
FT                   /db_xref="InterPro:IPR005883"
FT                   /db_xref="UniProtKB/TrEMBL:B8D2D5"
FT                   /protein_id="ACL69362.1"
FT                   /translation="MFFGNKTITAVDIGSYAIKAVKMRAGKNGLNIITAGSRILPEKAV
FT                   NQGEIQDYAVVSRILKDVLEEINGSKYIITAVPGKNLIIRNMEMPLISEEELTEAIKWE
FT                   ADDYLPFPVEQAMFDYILLSKDEENMSVLLVAAERKTINGLVKIFDNIGLKPAVINAQP
FT                   MALISLLKIQGLVDDTVALVDAGASGTRVIIGDGKNIYLSRNIDIGGNHFTETLMESRN
FT                   LEFSEAEEYKRKEGLAADDQNDNSAGFTDLTTTGLVKTLSALADSLAGEISRSLEYYFM
FT                   KYKDNDLDKIFFTGGCSRLKGLDRVISEETGVTVVSIDPFEYFDFETWGEGAPGFSVAV
FT                   GLGASEVLGNEN"
FT   gene            660504..661022
FT                   /locus_tag="Hore_06060"
FT   CDS_pept        660504..661022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_06060"
FT                   /product="Tfp pilus assembly protein PilN"
FT                   /note="PFAM: Fimbrial assembly protein (PilN)"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_06060"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69363"
FT                   /db_xref="GOA:B8D2D6"
FT                   /db_xref="InterPro:IPR007813"
FT                   /db_xref="UniProtKB/TrEMBL:B8D2D6"
FT                   /protein_id="ACL69363.1"
FT                   /translation="MRINFLPEQKKGIEINLKSILLFLLFMIIVAGLGGRYFYLQYRIN
FT                   ALENEINGINSQLKILRPAQREYQSLVKKIRSLEDTIKAIEEADYFWYSLLEELGNITP
FT                   DYVMLQNVNLSEDNKINIIGIARDEKELMVFVNNLKKSELFEMVQLLTVRKSQDLSFQI
FT                   KAGVAERRK"
FT   gene            661024..661551
FT                   /locus_tag="Hore_06070"
FT   CDS_pept        661024..661551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_06070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_06070"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69364"
FT                   /db_xref="GOA:B8D2D7"
FT                   /db_xref="InterPro:IPR007690"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="UniProtKB/TrEMBL:B8D2D7"
FT                   /protein_id="ACL69364.1"
FT                   /translation="MWHNLSDREKKLIIFGLIAVICMVYWFYGEQPTTRTIDELESDLQ
FT                   QLRRELMIARVQSKKVKVLKKKYDKLLKQKEELPYYFYLDPEEFYETIEEMGKQANVEI
FT                   KIYTVQSGQEDERGVNLGVDGNYEDILNFLSGMRYLKNIVDYNSLNITSDGELNLIINL
FT                   NYNPETPGGEKQ"
FT   gene            661548..662156
FT                   /locus_tag="Hore_06080"
FT   CDS_pept        661548..662156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_06080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_06080"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69365"
FT                   /db_xref="GOA:B8D2D8"
FT                   /db_xref="UniProtKB/TrEMBL:B8D2D8"
FT                   /protein_id="ACL69365.1"
FT                   /translation="MKKRYWIYIILLVILLAGAGYYYYSYYYITPTSNTLNLKAVNKKS
FT                   THEVSPELSRVKDNDQKNKAKPTRVESGMPSDQNPGTKTGGEEEVQKKTKDTEKEKVKE
FT                   EDNNTKETHKKIPRKINNPFDDYRKTIVKKTPFKLIGIIGSEGKVMAVIDTDDGKQTVT
FT                   EGDVVDDHKIVEVTRDSIIILYQDKIHKIKVGSDSGEDS"
FT   gene            662143..664788
FT                   /locus_tag="Hore_06090"
FT   CDS_pept        662143..664788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_06090"
FT                   /product="type II and III secretion system protein"
FT                   /note="PFAM: Bacterial type II/III secretion system short
FT                   domain; Bacterial type II/III secretion system short
FT                   domain; LysM domain; LysM domain; Bacterial type II and III
FT                   secretion system protein; Secretin and TonB N terminus
FT                   short domain; TIGRFAM: general secretion pathway protein D"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_06090"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69366"
FT                   /db_xref="GOA:B8D2D9"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR011662"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="InterPro:IPR038591"
FT                   /db_xref="UniProtKB/TrEMBL:B8D2D9"
FT                   /protein_id="ACL69366.1"
FT                   /translation="MKTHKKLLAGLMLYLIILSIPGFAFASNGIDSHPVKVDMNFEEAE
FT                   IQDVLTAIASLVNINLVVDSSVSGEITVKLDNMSFKEALDYVVKVSGLDYVWKNDTVIV
FT                   ASSERLKSFYGEELVETVSLKYSDPVHIYQLIKVFYPELKVQVDSNNLKLLMSGKRKTI
FT                   LAARNLIDRIDVPDSLITATYVAKFINADSLENHLRRIYPGLVLSSDRDNNILLIYGSK
FT                   RKVREALELVNRIDLPRKEATFIVDINKGDVTRIEETVLNLFPDLVVEGNEASHKLIIS
FT                   GDKEEALKARDLIKEIDIGEEIDTEVVRVDYGNLDNLISVIQGLFPDIRLQSNPLKKEI
FT                   IIKGNTSEVQEIVSLVNSLDIPRRQVIIEARFEEISANKISEFGMRPNLSEIQFIFDEA
FT                   TRELKSMNITWPEYLRFLEEEGQANMLANPRLLTLNGENARLLIGDKVPVKIEETSGSS
FT                   EESEGESNAVSYEYIDVGISLEFTPWITEDGYIIMDVAPEVSSLGSPMGGGESIPPIKT
FT                   REARTKIRLKDGQTFAIGGLIREDELESIAKVPLLGDIPLLGTLFRRSQTDKVKTEVVI
FT                   FITPHIVKESFGDITTVDQSREKVLSNKTDEPSKKESTPDKEVVDTGGKDSENISVVSK
FT                   VSRDGEIKEGKTGSEEEVDNNLAGNKKEDSEPHTTEKEGSKGSEDEIDITSKNSTSETT
FT                   ENEENSEETNTGEIIKSKDDVTGESTDDFGEKNIIEGEVNKKDVNKAEVNETEETVDEA
FT                   TRKELKNIINSEIIKPGNESSDNNLPEYYNILYKVKPGDTLASIARKYGLFVSNIKLVN
FT                   GIDEVKTGQTITLPIPKSHLYIIKKGETLWQIYLKFGVSVSVLQEINNIKDVRKIPAGT
FT                   LIIIPKRIND"
FT   gene            664799..665998
FT                   /locus_tag="Hore_06100"
FT   CDS_pept        664799..665998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_06100"
FT                   /product="Chorismate synthase"
FT                   /EC_number="4.2.3.5"
FT                   /note="PFAM: Chorismate synthase; TIGRFAM: chorismate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_06100"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69367"
FT                   /db_xref="GOA:B8D2E0"
FT                   /db_xref="InterPro:IPR000453"
FT                   /db_xref="InterPro:IPR020541"
FT                   /db_xref="InterPro:IPR035904"
FT                   /db_xref="UniProtKB/TrEMBL:B8D2E0"
FT                   /protein_id="ACL69367.1"
FT                   /translation="MVLSFKTAGESHGKGLMVIIDGMPAGVKVDIDLINKKLGRRQGGY
FT                   GRGGRMKIEKDKVEVLSGIRCGETIGSPVGLLIYNRDWENWKKVMSPVTRPGVGNEEIS
FT                   IKKDGKIKKIKRVVTRPRPGHADLAGALKYNQSDIRNILERASARETAARTAAGAVAQA
FT                   LLKYFDIDIISHVIQIGEVKSSSPEVDFDTLKERILKSPLNCYDKKKEQEMINHIDKIK
FT                   EAGDSLGGVIEIRTTPLPVGLGSHVQWDRRLDGRLAQALISIPAIKGVEIGTAFDNAGS
FT                   YGSRVHDEIFYSKEKGFYRKTNRAGGLEGGITNGEPLIIRLAMKPIPTLYSPLQSVDIV
FT                   TKKPFTASVERSDVTAVPAAGVVAEAMVSFILAQAILEKFGGDHIDEIFDNYKRFLDKM
FT                   "
FT   gene            666011..666526
FT                   /locus_tag="Hore_06110"
FT   CDS_pept        666011..666526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_06110"
FT                   /product="Shikimate kinase"
FT                   /EC_number="2.7.1.71"
FT                   /note="PFAM: Shikimate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_06110"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69368"
FT                   /db_xref="GOA:B8D2E1"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR023000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:B8D2E1"
FT                   /protein_id="ACL69368.1"
FT                   /translation="MKISLVGFMGTGKSSVGKLLAEKLNYPFLDTDDLIVNKAGMGIPQ
FT                   IFSKYGEGYFRKLEEEVLRHVVTTGDNFVLATGGGIVISPYNRKLLKDYTTPVLLSASP
FT                   EVIYERISGDKRPLLFTDDPLEKIKELLAEREQYYSQFDNQVYTGGKEKREVVDEIIHL
FT                   IGVDRLGL"
FT   gene            666516..667613
FT                   /locus_tag="Hore_06120"
FT   CDS_pept        666516..667613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_06120"
FT                   /product="3-dehydroquinate synthase"
FT                   /EC_number="4.2.3.4"
FT                   /note="PFAM: 3-dehydroquinate synthase; TIGRFAM:
FT                   3-dehydroquinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_06120"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69369"
FT                   /db_xref="GOA:B8D2E2"
FT                   /db_xref="InterPro:IPR016037"
FT                   /db_xref="InterPro:IPR030960"
FT                   /db_xref="InterPro:IPR030963"
FT                   /db_xref="UniProtKB/TrEMBL:B8D2E2"
FT                   /protein_id="ACL69369.1"
FT                   /translation="MDFKSIEVNIPSKTVNYSIIIGQGLMENAGSLIKDVYRGRKIMVV
FT                   TDENVDGLYGDIMLKSLEKEGFVVIKYIIPPGEKSKSNYYLHKGYDIMVENGFGRDHLV
FT                   VAFGGGVVGDLAGYLAATYMRGIGLVQIPTTLLSQVDSSVGGKTAINHPAGKNLIGAFY
FT                   QPDRVIIDVGVLKSLEKRELRAGMAEVIKYGLIFDSDFVDYLRNNYQEVFVYNPRVLGR
FT                   IIEQSCNYKARIVEEDQKEKGIRALLNFGHTIGHSLEAVTGYRKYKHGEAVAIGMVGAA
FT                   RLSERLELLQEGEADKVAEILRLYGLPLSYQYGEDPEMVYKTLFYDKKVKDNKLTWILL
FT                   KNIGKGFIKNDVNDNIINEVLEGLK"
FT   gene            667610..668056
FT                   /locus_tag="Hore_06130"
FT   CDS_pept        667610..668056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_06130"
FT                   /product="3-dehydroquinate dehydratase, type II"
FT                   /EC_number="4.2.1.10"
FT                   /note="PFAM: Dehydroquinase class II; TIGRFAM:
FT                   3-dehydroquinate dehydratase, type II"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_06130"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69370"
FT                   /db_xref="GOA:B8D2E3"
FT                   /db_xref="InterPro:IPR001874"
FT                   /db_xref="InterPro:IPR018509"
FT                   /db_xref="InterPro:IPR036441"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8D2E3"
FT                   /protein_id="ACL69370.1"
FT                   /translation="MNRVAVIHGPNLNLLGRREPEVYGTKSLENINKEIEKRANNLKIE
FT                   VDIFQSNHEGEIIDFIHDNYKALSGIIINPGGLTHYSIALRDALAAVRLPVVEVHISNI
FT                   HKREDFRHRSVIASVAVGQITGLGTEGYLYALEAIVNIIKKGSY"
FT   gene            668058..669128
FT                   /locus_tag="Hore_06140"
FT   CDS_pept        668058..669128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_06140"
FT                   /product="peptidase M24"
FT                   /note="PFAM: Creatinase/Prolidase N-terminal domain;
FT                   metallopeptidase family M24"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_06140"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69371"
FT                   /db_xref="GOA:B8D2E4"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:B8D2E4"
FT                   /protein_id="ACL69371.1"
FT                   /translation="MEKRIQQLRKAMKKMDLDSLIIDSSHNRFYLTGFTGTAGRVLFTP
FT                   ENNYFITDFRYTEQAHEQISGFEILEVNQKAVVEISDILDQDNSSRVGFEARSVTYDVF
FT                   QKYKKTFNESIKLVPTAGLVEKIRVVKDRSEVETIKKAAEIADSAFKHILDFIKPGVTE
FT                   REVALELEYFMKKNGGEGNAFDFIVASGKRSSLPHGVASDKVIEDGDFVTMDFGTYYKG
FT                   YCSDMTRTVIVGEPTPEQKEIYNIVLKAQNEVIKNIRAGMTCKEADAIARDIIAEHGYK
FT                   DNFGHSLGHGLGVEVHEDPRVSYASDEVLKPGMVVTDEPGIYIADWGGVRIEDDLLITE
FT                   DGCEVLTSSPKDLISV"
FT   gene            669283..669843
FT                   /locus_tag="Hore_06150"
FT   CDS_pept        669283..669843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_06150"
FT                   /product="translation elongation factor P"
FT                   /note="PFAM: Elongation factor P (EF-P) KOW-like domain;
FT                   Elongation factor P, C-terminal; Elongation factor P (EF-P)
FT                   OB domain; TIGRFAM: translation elongation factor P"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_06150"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69372"
FT                   /db_xref="GOA:B8D2E5"
FT                   /db_xref="InterPro:IPR001059"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR011768"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013185"
FT                   /db_xref="InterPro:IPR013852"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015365"
FT                   /db_xref="InterPro:IPR020599"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8D2E5"
FT                   /protein_id="ACL69372.1"
FT                   /translation="MISTNDFHNGLTIELDGTVYQVVKFQHSKTGRGGAFVRTKLRNIE
FT                   DGGIIEKTFRAGEKVKKAHVDQKNMQYLYHNGDDYVFMDTDTYEQLSISNEQLGDKVDY
FT                   LKENMSLEVLMYENRPIDINLPTFVELEVEKTQPGIRGDTVSGGSKPATLETGAVVQVP
FT                   LFINEGDVIKVDTRSGEYIERVS"
FT   gene            669840..670520
FT                   /locus_tag="Hore_06160"
FT   CDS_pept        669840..670520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_06160"
FT                   /product="sugar fermentation stimulation protein"
FT                   /note="PFAM: Sugar fermentation stimulation protein;
FT                   TIGRFAM: sugar fermentation stimulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_06160"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69373"
FT                   /db_xref="GOA:B8D2E6"
FT                   /db_xref="InterPro:IPR005224"
FT                   /db_xref="InterPro:IPR040452"
FT                   /db_xref="InterPro:IPR041465"
FT                   /db_xref="UniProtKB/TrEMBL:B8D2E6"
FT                   /protein_id="ACL69373.1"
FT                   /translation="MIRKAFFIKRLNRFAALVSLMGEEEKVFVPNSGRMKELLIRGTPV
FT                   LLKKVISGQRKTKYDLIKVYHNSRWVSIDSRVPNRIFSDAIKKGRVTDFKGFKFGRQEV
FT                   RWGNSRLDMLLVKKDVPVKYYLELKSVTLVEGDIARFPDAPTERGRRHLRELTDCLKKG
FT                   HKAGIVFIVQRDDARFFSPNDKTDPEFGKELRRALKAGVNAFAYTCRVDEKSIKIDKKI
FT                   NILL"
FT   gene            670973..671923
FT                   /locus_tag="Hore_06170"
FT   CDS_pept        670973..671923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_06170"
FT                   /product="Sporulation stage III protein AA"
FT                   /note="TIGRFAM: stage III sporulation protein AA"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_06170"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69374"
FT                   /db_xref="InterPro:IPR014217"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8D2E7"
FT                   /protein_id="ACL69374.1"
FT                   /translation="MIKNLFSYLPPDIRSAVQNINENYREKIIEIRLRVNQPLQIIGLD
FT                   GDYFIDSHGQKTSKRNAYIVNREDVKKAVTILTDNSVYAVERQLAEGFITIPGGHRIGF
FT                   TGQAVVESGEIRLIKNINCLNYRITREMIGVGNKVIKQIYDFKNRVYYNTMIVSPPLCG
FT                   KTTLLRDIVRLISNGIKKYGIPGKKVGVVDERSEIGGAYNGIPGNRIGSRTDLLDNCPK
FT                   AKGISLLVRSMSPEVIAVDEIGNEEDVIAIQEATNSGVSLIATAHGENLTTLKMRPAMA
FT                   RLMSKNFFDRFIILSRKRGIGTVEKIIDSTGKEVV"
FT   gene            671924..672445
FT                   /locus_tag="Hore_06180"
FT   CDS_pept        671924..672445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_06180"
FT                   /product="stage III sporulation protein AB"
FT                   /note="TIGRFAM: stage III sporulation protein AB"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_06180"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69375"
FT                   /db_xref="GOA:B8D2E8"
FT                   /db_xref="InterPro:IPR014198"
FT                   /db_xref="UniProtKB/TrEMBL:B8D2E8"
FT                   /protein_id="ACL69375.1"
FT                   /translation="MLVKLIGSLLILISGSSLGWLIGFHYLKRIKELKELQVAINIFDT
FT                   EISYGRTLLPEALEVVSESTHGSISNIYMQLATGLKKDRDKRFRDIFKEILSRYEEEVS
FT                   LTPADIKILIEWSQQIGVTSLEGQRKANKMAIKRLEQVEKRAQDLADKRVKLSRYAGVL
FT                   LSLLVIIALY"
FT   gene            672474..672668
FT                   /locus_tag="Hore_06190"
FT   CDS_pept        672474..672668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_06190"
FT                   /product="Stage III sporulation AC family protein"
FT                   /note="PFAM: Stage III sporulation protein AC (SpoIIIAC);
FT                   TIGRFAM: stage III sporulation protein AC"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_06190"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69376"
FT                   /db_xref="GOA:B8D2E9"
FT                   /db_xref="InterPro:IPR009570"
FT                   /db_xref="InterPro:IPR025664"
FT                   /db_xref="UniProtKB/TrEMBL:B8D2E9"
FT                   /protein_id="ACL69376.1"
FT                   /translation="MDINIIFKIAGIGIFISVINMVLKQADKEEQAQMLTLVGVIIVLM
FT                   FVIQLINQLFNDVRSVFKF"
FT   gene            672681..673067
FT                   /locus_tag="Hore_06200"
FT   CDS_pept        672681..673067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_06200"
FT                   /product="Sporulation stage III protein AD"
FT                   /note="TIGRFAM: stage III sporulation protein AD"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_06200"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69377"
FT                   /db_xref="GOA:B8D2F0"
FT                   /db_xref="InterPro:IPR014211"
FT                   /db_xref="InterPro:IPR025664"
FT                   /db_xref="UniProtKB/TrEMBL:B8D2F0"
FT                   /protein_id="ACL69377.1"
FT                   /translation="MAIMQVVGIGITAAVLIILIRQEKPELAFLLSLVTGIAILILVID
FT                   QVAIVINLLEQLADKAQIDLIYLNTILKIVGIAYIGEFGAEITRDAGESALASKIEMAA
FT                   KIIIMILTIPVMITLIETIIDLIP"
FT   gene            673085..674278
FT                   /locus_tag="Hore_06210"
FT   CDS_pept        673085..674278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_06210"
FT                   /product="Sporulation stage III protein AE"
FT                   /note="TIGRFAM: stage III sporulation protein AE"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_06210"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69378"
FT                   /db_xref="GOA:B8D2F1"
FT                   /db_xref="InterPro:IPR014194"
FT                   /db_xref="UniProtKB/TrEMBL:B8D2F1"
FT                   /protein_id="ACL69378.1"
FT                   /translation="MKRLISIIILINIILMMTIPVLAEETPLKEAPLNKEDIILNQIEK
FT                   INLNQLQKEVDKINKNMEGYMPHLNIKELILGFMKGDLDVSWAQIGGALLKYLGKEVTA
FT                   NFKILGQIIILAVMAAILNVFHNSFTSETISKTASMLIFMVLAILSLNGFKIAVEIGIT
FT                   TIDTMVSFMQALIPVLLTLLVSIGAMTSAAVFHPITFMVISFLSSLIRTIIFPMIFISA
FT                   ILNIVNNITSEFKISRLSGLFKEFSMGMLGLSLILFTGIMVIQGGAAAVTDSLSLRTAK
FT                   YLTGTFIPIIGGIFSDAVDLIVSCSLIIKNAINLFGMIVIVFMISYPLIKIIALIIIYK
FT                   IAGAIIQPISDGRLVNILDNLGNTLVLIFLAVSGVSLMFFIVLTILVGSANLTVMMR"
FT   gene            674284..674871
FT                   /locus_tag="Hore_06220"
FT   CDS_pept        674284..674871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_06220"
FT                   /product="stage III sporulation protein AF"
FT                   /note="TIGRFAM: stage III sporulation protein AF"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_06220"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69379"
FT                   /db_xref="GOA:B8D2F2"
FT                   /db_xref="InterPro:IPR014245"
FT                   /db_xref="UniProtKB/TrEMBL:B8D2F2"
FT                   /protein_id="ACL69379.1"
FT                   /translation="MDELTRWVKNLIFIILFTTFIEMFLPENNMRKYVRIITGFFIIAI
FT                   FLSPLSALFGHDITSLDEIVPDNVSFGNWDKIKHRGQELSNTNRVLLKDYYEKRVASRV
FT                   EEVVKLDYPGYQKKVEVEVDDEYTITGINIVIIPDNEIYIKPVEINGDIQDRDDNERNE
FT                   FQEELLSLKSKVSTVFQIPPGLINISVRDGGK"
FT   gene            674874..675461
FT                   /locus_tag="Hore_06230"
FT   CDS_pept        674874..675461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_06230"
FT                   /product="Sporulation stage III protein AG"
FT                   /note="TIGRFAM: stage III sporulation protein AG"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_06230"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69380"
FT                   /db_xref="GOA:B8D2F3"
FT                   /db_xref="UniProtKB/TrEMBL:B8D2F3"
FT                   /protein_id="ACL69380.1"
FT                   /translation="MGVLNDLNSIFGKEKGNKLLRNIVILGMVGTLLLLFGDIFSSNPQ
FT                   PVTDNKPVITEEKNNYLTYEESLSKELEEIISVMSGVGKVKVQVYTLKGPEYSYVYDQN
FT                   ITNKITEETDQNGGQRQIQEDTTEKSLVVLQDAAGGEEPLISTKQSPVISGVLIVAQGA
FT                   EDSEIKYNITKSVSRLLDIPVHKISVLPYKRR"
FT   gene            675470..676045
FT                   /locus_tag="Hore_06240"
FT   CDS_pept        675470..676045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_06240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_06240"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69381"
FT                   /db_xref="GOA:B8D2F4"
FT                   /db_xref="InterPro:IPR024232"
FT                   /db_xref="InterPro:IPR038503"
FT                   /db_xref="UniProtKB/TrEMBL:B8D2F4"
FT                   /protein_id="ACL69381.1"
FT                   /translation="MLGRKFVWLMILMVWVGMVTSIIIYQGNEYVNLQETTSNKVNIIP
FT                   SDEMVVEDTPEDINYTQAQDEEDSDENFFTEYRLERDKARSEQISIYREMVNNPNTDEA
FT                   IKKDAQQKMMDLTEKMEKEMEIESLIRARGYKDAIAYIHDGAVDVIIQTGGLSRDDVAK
FT                   IGDIIVKTTGFDFKDVTIIEKKNRDNQQ"
FT   gene            676243..676710
FT                   /locus_tag="Hore_06250"
FT   CDS_pept        676243..676710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_06250"
FT                   /product="biotin carboxyl carrier protein"
FT                   /note="PFAM: Biotin-requiring enzyme; TIGRFAM: acetyl-CoA
FT                   carboxylase, biotin carboxyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_06250"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69382"
FT                   /db_xref="GOA:B8D2F5"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001249"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:B8D2F5"
FT                   /protein_id="ACL69382.1"
FT                   /translation="MDLDKIKTLIEMIEETDITEINLEEEGKKIKIKRGLQVEDLGSFP
FT                   PVGVTPSGQLPHQVEAGTKKETREKDQDESNIDEIVAPMVGTFYRAPAPDADPFVEVGD
FT                   VVKPGDTLCIIEAMKLMNEIEAEKKGRIVDILVENGKPVEYGQPLFLVEPV"
FT   gene            676725..678080
FT                   /locus_tag="Hore_06260"
FT   CDS_pept        676725..678080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_06260"
FT                   /product="acetyl-CoA carboxylase, biotin carboxylase"
FT                   /EC_number="6.3.4.14"
FT                   /EC_number="6.4.1.1"
FT                   /note="PFAM: ATP-grasp domain; Biotin carboxylase
FT                   C-terminal domain; Carbamoyl-phosphate synthase L chain,
FT                   N-terminal domain; Carbamoyl-phosphate synthase L chain,
FT                   ATP binding domain; Phosphoribosylglycinamide synthetase,
FT                   ATP-grasp (A) domain; RimK-like ATP-grasp domain; TIGRFAM:
FT                   acetyl-CoA carboxylase, biotin carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_06260"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69383"
FT                   /db_xref="GOA:B8D2F6"
FT                   /db_xref="InterPro:IPR004549"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:B8D2F6"
FT                   /protein_id="ACL69383.1"
FT                   /translation="MAMFNKVLIANRGEIAVRIIRALKELQIPSVAVYSEADRESLHVK
FT                   LADEAYCIGPASSSESYLNIPSIMSVAEVTGADAIHPGYGFLSENAHFAEVCESSGIKF
FT                   IGPNSGVISLMGDKAKARETMKKAGVPVVPGTEDGLDNVDKTLEVAEEIGYPVIIKAAA
FT                   GGGGKGMRIAQNPRDLKKSIQTAQSEARAAFGDATVYLEKYVEEPRHIEFQILADEHGN
FT                   VIHLGERDCSIQRRHQKILEEAPSPVLSGELRQKIGEAAVKAARAVNYTNAGTVEFLLD
FT                   KYNNFYFIEMNTRIQVEHPITELVTGIDLIKEQILIAAGRELEYKQDEITITGSAIECR
FT                   INAEDPDYNFRPSPGKVETYIVPGGPGVRLDSGVYPGYYITPFYDSMVAKLIVWDENRE
FT                   EAIKRMERALKEFTVEGVKTTIPFHLKILNNAFFRKGEYYTNFIQRRILSEG"
FT   gene            678093..678491
FT                   /locus_tag="Hore_06270"
FT   CDS_pept        678093..678491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_06270"
FT                   /product="uncharacterized protein conserved in bacteria"
FT                   /note="PFAM: Protein of unknown function (DUF322)"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_06270"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69384"
FT                   /db_xref="InterPro:IPR005531"
FT                   /db_xref="UniProtKB/TrEMBL:B8D2F7"
FT                   /protein_id="ACL69384.1"
FT                   /translation="MVEKESLGSIKIANEVVAIIAGLAATEVDGVAGMSGNIAGGIAEM
FT                   LGRKNLSKGVKVEVGEKECAVDLFVIVDYGTSISEVAWEIQNNVKQAIESMTGLKIVEI
FT                   NVHVQEVHFAEETEEEEELEEVEETRVK"
FT   gene            678547..679083
FT                   /locus_tag="Hore_06280"
FT   CDS_pept        678547..679083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_06280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_06280"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69385"
FT                   /db_xref="GOA:B8D2F8"
FT                   /db_xref="UniProtKB/TrEMBL:B8D2F8"
FT                   /protein_id="ACL69385.1"
FT                   /translation="MNLFYRFVVFVITVIFMFCSLLMGLYSFGLGQEKLLSGVVLSLYN
FT                   NWQAGILFIIAFLAGAWVIYPIFNLGRERETTLISAGELGNVNITLDALDKLVRKVAAQ
FT                   QEGVTRVSTKLKTLENELHIFLNVKVKPDRPLPQLTKDLQNIVKSYIEDTTGVNINEVK
FT                   VLVDSIGDETKTEED"
FT   gene            679191..679331
FT                   /locus_tag="Hore_06290"
FT   CDS_pept        679191..679331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_06290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_06290"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69386"
FT                   /db_xref="GOA:B8D2F9"
FT                   /db_xref="InterPro:IPR018730"
FT                   /db_xref="UniProtKB/TrEMBL:B8D2F9"
FT                   /protein_id="ACL69386.1"
FT                   /translation="MILVLGLFKTILLFICTVLGYYIGSRWDIDGDLKKLLDRLLPPKN
FT                   R"
FT   gene            679456..679860
FT                   /locus_tag="Hore_06300"
FT   CDS_pept        679456..679860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hore_06300"
FT                   /product="NusB antitermination factor"
FT                   /note="PFAM: NusB family; TIGRFAM: transcription
FT                   antitermination factor NusB"
FT                   /db_xref="EnsemblGenomes-Gn:Hore_06300"
FT                   /db_xref="EnsemblGenomes-Tr:ACL69387"
FT                   /db_xref="GOA:B8D2G0"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR011605"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8D2G0"
FT                   /protein_id="ACL69387.1"
FT                   /translation="MKITRHQERVWALQILYSLDISSELNIQKARKTCREFKYKKVLDK
FT                   KRYYFEDIVEGVINSRQDLDSIINKYAIDWDVER