(data stored in ACNUC6774 zone)

EMBL: CP001100

ID   CP001100; SV 1; circular; genomic DNA; STD; PRO; 3293456 BP.
XX
AC   CP001100;
XX
PR   Project:PRJNA29215;
XX
DT   28-JUN-2008 (Rel. 96, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 4)
XX
DE   Chloroherpeton thalassium ATCC 35110, complete genome.
XX
KW   .
XX
OS   Chloroherpeton thalassium ATCC 35110
OC   Bacteria; Chlorobi; Chlorobia; Chlorobiales; Chlorobiaceae; Chloroherpeton.
XX
RN   [1]
RP   1-3293456
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Schmutz J., Larimer F., Land M.,
RA   Hauser L., Kyrpides N., Mikhailova N., Liu Z., Li T., Zhao F., Overmann J.,
RA   Bryant D.A., Richardson P.;
RT   "Complete sequence of Chloroherpeton thalassium ATCC 35110";
RL   Unpublished.
XX
RN   [2]
RP   1-3293456
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Schmutz J., Larimer F., Land M.,
RA   Hauser L., Kyrpides N., Mikhailova N., Liu Z., Li T., Zhao F., Overmann J.,
RA   Bryant D.A., Richardson P.;
RT   ;
RL   Submitted (04-JUN-2008) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 76be7369861e47cd790067573ae57d3b.
DR   BioSample; SAMN02598461.
DR   EnsemblGenomes-Gn; Ctha_R0001.
DR   EnsemblGenomes-Gn; Ctha_R0002.
DR   EnsemblGenomes-Gn; Ctha_R0003.
DR   EnsemblGenomes-Gn; Ctha_R0004.
DR   EnsemblGenomes-Gn; Ctha_R0005.
DR   EnsemblGenomes-Gn; Ctha_R0006.
DR   EnsemblGenomes-Gn; Ctha_R0007.
DR   EnsemblGenomes-Gn; Ctha_R0008.
DR   EnsemblGenomes-Gn; Ctha_R0009.
DR   EnsemblGenomes-Gn; Ctha_R0010.
DR   EnsemblGenomes-Gn; Ctha_R0011.
DR   EnsemblGenomes-Gn; Ctha_R0012.
DR   EnsemblGenomes-Gn; Ctha_R0013.
DR   EnsemblGenomes-Gn; Ctha_R0014.
DR   EnsemblGenomes-Gn; Ctha_R0015.
DR   EnsemblGenomes-Gn; Ctha_R0016.
DR   EnsemblGenomes-Gn; Ctha_R0017.
DR   EnsemblGenomes-Gn; Ctha_R0018.
DR   EnsemblGenomes-Gn; Ctha_R0019.
DR   EnsemblGenomes-Gn; Ctha_R0020.
DR   EnsemblGenomes-Gn; Ctha_R0021.
DR   EnsemblGenomes-Gn; Ctha_R0022.
DR   EnsemblGenomes-Gn; Ctha_R0023.
DR   EnsemblGenomes-Gn; Ctha_R0024.
DR   EnsemblGenomes-Gn; Ctha_R0025.
DR   EnsemblGenomes-Gn; Ctha_R0026.
DR   EnsemblGenomes-Gn; Ctha_R0027.
DR   EnsemblGenomes-Gn; Ctha_R0028.
DR   EnsemblGenomes-Gn; Ctha_R0029.
DR   EnsemblGenomes-Gn; Ctha_R0030.
DR   EnsemblGenomes-Gn; Ctha_R0031.
DR   EnsemblGenomes-Gn; Ctha_R0032.
DR   EnsemblGenomes-Gn; Ctha_R0033.
DR   EnsemblGenomes-Gn; Ctha_R0034.
DR   EnsemblGenomes-Gn; Ctha_R0035.
DR   EnsemblGenomes-Gn; Ctha_R0036.
DR   EnsemblGenomes-Gn; Ctha_R0037.
DR   EnsemblGenomes-Gn; Ctha_R0038.
DR   EnsemblGenomes-Gn; Ctha_R0039.
DR   EnsemblGenomes-Gn; Ctha_R0040.
DR   EnsemblGenomes-Gn; Ctha_R0041.
DR   EnsemblGenomes-Gn; Ctha_R0042.
DR   EnsemblGenomes-Gn; Ctha_R0043.
DR   EnsemblGenomes-Gn; Ctha_R0044.
DR   EnsemblGenomes-Gn; Ctha_R0045.
DR   EnsemblGenomes-Gn; Ctha_R0046.
DR   EnsemblGenomes-Gn; Ctha_R0047.
DR   EnsemblGenomes-Gn; Ctha_R0048.
DR   EnsemblGenomes-Gn; Ctha_R0049.
DR   EnsemblGenomes-Gn; Ctha_R0050.
DR   EnsemblGenomes-Gn; EBG00001111054.
DR   EnsemblGenomes-Gn; EBG00001111055.
DR   EnsemblGenomes-Gn; EBG00001111056.
DR   EnsemblGenomes-Gn; EBG00001111057.
DR   EnsemblGenomes-Gn; EBG00001111058.
DR   EnsemblGenomes-Gn; EBG00001111059.
DR   EnsemblGenomes-Gn; EBG00001111060.
DR   EnsemblGenomes-Gn; EBG00001111061.
DR   EnsemblGenomes-Gn; EBG00001111062.
DR   EnsemblGenomes-Gn; EBG00001111063.
DR   EnsemblGenomes-Gn; EBG00001111064.
DR   EnsemblGenomes-Gn; EBG00001111065.
DR   EnsemblGenomes-Gn; EBG00001111066.
DR   EnsemblGenomes-Gn; EBG00001111067.
DR   EnsemblGenomes-Gn; EBG00001111068.
DR   EnsemblGenomes-Gn; EBG00001111069.
DR   EnsemblGenomes-Gn; EBG00001111070.
DR   EnsemblGenomes-Gn; EBG00001111071.
DR   EnsemblGenomes-Gn; EBG00001111072.
DR   EnsemblGenomes-Gn; EBG00001111073.
DR   EnsemblGenomes-Gn; EBG00001111074.
DR   EnsemblGenomes-Gn; EBG00001111075.
DR   EnsemblGenomes-Gn; EBG00001111076.
DR   EnsemblGenomes-Gn; EBG00001111077.
DR   EnsemblGenomes-Gn; EBG00001111078.
DR   EnsemblGenomes-Gn; EBG00001111079.
DR   EnsemblGenomes-Gn; EBG00001111080.
DR   EnsemblGenomes-Gn; EBG00001111081.
DR   EnsemblGenomes-Gn; EBG00001111082.
DR   EnsemblGenomes-Gn; EBG00001111083.
DR   EnsemblGenomes-Gn; EBG00001111084.
DR   EnsemblGenomes-Gn; EBG00001111085.
DR   EnsemblGenomes-Gn; EBG00001111086.
DR   EnsemblGenomes-Gn; EBG00001111087.
DR   EnsemblGenomes-Gn; EBG00001111088.
DR   EnsemblGenomes-Gn; EBG00001111089.
DR   EnsemblGenomes-Gn; EBG00001111090.
DR   EnsemblGenomes-Gn; EBG00001111091.
DR   EnsemblGenomes-Gn; EBG00001111092.
DR   EnsemblGenomes-Gn; EBG00001111093.
DR   EnsemblGenomes-Gn; EBG00001111094.
DR   EnsemblGenomes-Gn; EBG00001111096.
DR   EnsemblGenomes-Gn; EBG00001111097.
DR   EnsemblGenomes-Gn; EBG00001111098.
DR   EnsemblGenomes-Gn; EBG00001111099.
DR   EnsemblGenomes-Gn; EBG00001111100.
DR   EnsemblGenomes-Gn; EBG00001111101.
DR   EnsemblGenomes-Gn; EBG00001111102.
DR   EnsemblGenomes-Gn; EBG00001111103.
DR   EnsemblGenomes-Gn; EBG00001111104.
DR   EnsemblGenomes-Gn; EBG00001111105.
DR   EnsemblGenomes-Gn; EBG00001111106.
DR   EnsemblGenomes-Gn; EBG00001111107.
DR   EnsemblGenomes-Gn; EBG00001111108.
DR   EnsemblGenomes-Gn; EBG00001111109.
DR   EnsemblGenomes-Gn; EBG00001111110.
DR   EnsemblGenomes-Tr; Ctha_R0001-1.
DR   EnsemblGenomes-Tr; Ctha_R0002-1.
DR   EnsemblGenomes-Tr; Ctha_R0003-1.
DR   EnsemblGenomes-Tr; Ctha_R0004-1.
DR   EnsemblGenomes-Tr; Ctha_R0005-1.
DR   EnsemblGenomes-Tr; Ctha_R0006-1.
DR   EnsemblGenomes-Tr; Ctha_R0007-1.
DR   EnsemblGenomes-Tr; Ctha_R0008-1.
DR   EnsemblGenomes-Tr; Ctha_R0009-1.
DR   EnsemblGenomes-Tr; Ctha_R0010-1.
DR   EnsemblGenomes-Tr; Ctha_R0011-1.
DR   EnsemblGenomes-Tr; Ctha_R0012-1.
DR   EnsemblGenomes-Tr; Ctha_R0013-1.
DR   EnsemblGenomes-Tr; Ctha_R0014-1.
DR   EnsemblGenomes-Tr; Ctha_R0015-1.
DR   EnsemblGenomes-Tr; Ctha_R0016-1.
DR   EnsemblGenomes-Tr; Ctha_R0017-1.
DR   EnsemblGenomes-Tr; Ctha_R0018-1.
DR   EnsemblGenomes-Tr; Ctha_R0019-1.
DR   EnsemblGenomes-Tr; Ctha_R0020-1.
DR   EnsemblGenomes-Tr; Ctha_R0021-1.
DR   EnsemblGenomes-Tr; Ctha_R0022-1.
DR   EnsemblGenomes-Tr; Ctha_R0023-1.
DR   EnsemblGenomes-Tr; Ctha_R0024-1.
DR   EnsemblGenomes-Tr; Ctha_R0025-1.
DR   EnsemblGenomes-Tr; Ctha_R0026-1.
DR   EnsemblGenomes-Tr; Ctha_R0027-1.
DR   EnsemblGenomes-Tr; Ctha_R0028-1.
DR   EnsemblGenomes-Tr; Ctha_R0029-1.
DR   EnsemblGenomes-Tr; Ctha_R0030-1.
DR   EnsemblGenomes-Tr; Ctha_R0031-1.
DR   EnsemblGenomes-Tr; Ctha_R0032-1.
DR   EnsemblGenomes-Tr; Ctha_R0033-1.
DR   EnsemblGenomes-Tr; Ctha_R0034-1.
DR   EnsemblGenomes-Tr; Ctha_R0035-1.
DR   EnsemblGenomes-Tr; Ctha_R0036-1.
DR   EnsemblGenomes-Tr; Ctha_R0037-1.
DR   EnsemblGenomes-Tr; Ctha_R0038-1.
DR   EnsemblGenomes-Tr; Ctha_R0039-1.
DR   EnsemblGenomes-Tr; Ctha_R0040-1.
DR   EnsemblGenomes-Tr; Ctha_R0041-1.
DR   EnsemblGenomes-Tr; Ctha_R0042-1.
DR   EnsemblGenomes-Tr; Ctha_R0043-1.
DR   EnsemblGenomes-Tr; Ctha_R0044-1.
DR   EnsemblGenomes-Tr; Ctha_R0045-1.
DR   EnsemblGenomes-Tr; Ctha_R0046-1.
DR   EnsemblGenomes-Tr; Ctha_R0047-1.
DR   EnsemblGenomes-Tr; Ctha_R0048-1.
DR   EnsemblGenomes-Tr; Ctha_R0049-1.
DR   EnsemblGenomes-Tr; Ctha_R0050-1.
DR   EnsemblGenomes-Tr; EBT00001702737.
DR   EnsemblGenomes-Tr; EBT00001702738.
DR   EnsemblGenomes-Tr; EBT00001702739.
DR   EnsemblGenomes-Tr; EBT00001702740.
DR   EnsemblGenomes-Tr; EBT00001702741.
DR   EnsemblGenomes-Tr; EBT00001702742.
DR   EnsemblGenomes-Tr; EBT00001702743.
DR   EnsemblGenomes-Tr; EBT00001702744.
DR   EnsemblGenomes-Tr; EBT00001702745.
DR   EnsemblGenomes-Tr; EBT00001702746.
DR   EnsemblGenomes-Tr; EBT00001702747.
DR   EnsemblGenomes-Tr; EBT00001702748.
DR   EnsemblGenomes-Tr; EBT00001702749.
DR   EnsemblGenomes-Tr; EBT00001702750.
DR   EnsemblGenomes-Tr; EBT00001702751.
DR   EnsemblGenomes-Tr; EBT00001702752.
DR   EnsemblGenomes-Tr; EBT00001702753.
DR   EnsemblGenomes-Tr; EBT00001702754.
DR   EnsemblGenomes-Tr; EBT00001702755.
DR   EnsemblGenomes-Tr; EBT00001702756.
DR   EnsemblGenomes-Tr; EBT00001702757.
DR   EnsemblGenomes-Tr; EBT00001702758.
DR   EnsemblGenomes-Tr; EBT00001702760.
DR   EnsemblGenomes-Tr; EBT00001702762.
DR   EnsemblGenomes-Tr; EBT00001702763.
DR   EnsemblGenomes-Tr; EBT00001702766.
DR   EnsemblGenomes-Tr; EBT00001702768.
DR   EnsemblGenomes-Tr; EBT00001702771.
DR   EnsemblGenomes-Tr; EBT00001702774.
DR   EnsemblGenomes-Tr; EBT00001702775.
DR   EnsemblGenomes-Tr; EBT00001702776.
DR   EnsemblGenomes-Tr; EBT00001702778.
DR   EnsemblGenomes-Tr; EBT00001702779.
DR   EnsemblGenomes-Tr; EBT00001702782.
DR   EnsemblGenomes-Tr; EBT00001702783.
DR   EnsemblGenomes-Tr; EBT00001702785.
DR   EnsemblGenomes-Tr; EBT00001702787.
DR   EnsemblGenomes-Tr; EBT00001702788.
DR   EnsemblGenomes-Tr; EBT00001702790.
DR   EnsemblGenomes-Tr; EBT00001702793.
DR   EnsemblGenomes-Tr; EBT00001702794.
DR   EnsemblGenomes-Tr; EBT00001702796.
DR   EnsemblGenomes-Tr; EBT00001702800.
DR   EnsemblGenomes-Tr; EBT00001702802.
DR   EnsemblGenomes-Tr; EBT00001702804.
DR   EnsemblGenomes-Tr; EBT00001702807.
DR   EnsemblGenomes-Tr; EBT00001702808.
DR   EnsemblGenomes-Tr; EBT00001702810.
DR   EnsemblGenomes-Tr; EBT00001702812.
DR   EnsemblGenomes-Tr; EBT00001702814.
DR   EnsemblGenomes-Tr; EBT00001702816.
DR   EnsemblGenomes-Tr; EBT00001702818.
DR   EnsemblGenomes-Tr; EBT00001702820.
DR   EnsemblGenomes-Tr; EBT00001702822.
DR   EnsemblGenomes-Tr; EBT00001702823.
DR   EnsemblGenomes-Tr; EBT00001702825.
DR   EuropePMC; PMC2675224; 19218404.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00002; 5_8S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01724; SAM-Chlorobi.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP001100.
DR   SILVA-SSU; CP001100.
DR   StrainInfo; 302239; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4085263
CC   Source DNA available from Donald A. Bryant (dab14@psu.edu)
CC   Bacteria available from ATCC: ATCC 35110
CC   Contacts: Donald A. Bryant (dab14@psu.edu)
CC             David Bruce (microbe@cuba.jgi-psf.org)
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by Pennsylvania State University
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3293456
FT                   /organism="Chloroherpeton thalassium ATCC 35110"
FT                   /strain="ATCC 35110"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:517418"
FT                   /culture_collection="ATCC:35110"
FT   gene            1..1491
FT                   /locus_tag="Ctha_0001"
FT   CDS_pept        1..1491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="KEGG: cph:Cpha266_0001 chromosomal replication
FT                   initiator protein DnaA; TIGRFAM: chromosomal replication
FT                   initiator protein DnaA; PFAM: Chromosomal replication
FT                   initiator DnaA domain; Chromosomal replication initiator
FT                   DnaA; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12473"
FT                   /db_xref="GOA:B3QRY8"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:B3QRY8"
FT                   /protein_id="ACF12473.1"
FT                   /translation="MLMSEGHDQPGAPVSHLSEQALAQIAWKKCLDIIRDGLHNLQSFK
FT                   TWFEPIVPLKLSGQELTIQVPSQFFYEMIEENYYSLLKRALMEVMGTGAKLRYSVLVQA
FT                   AQAETPVVARIPEKKGKHTPAALPKVISHANGKQTKEAQDLFANNVHRFESYLNPKYRF
FT                   ENFVKGDCNDLAHAAAKSVSETPGKSSFNPLVIYGGVGLGKTHLIQAIGNHARENNKAK
FT                   FVMYVSSEKFTIEFVNAIQNNQAHEFSAFYRNVDLLIIDDIQFFERKEKTQEEIFHIFN
FT                   TLHQANKQIVLSSDRPIKELKGIEERLLSRFQWGLTADLQLPDYETRRAILQRKLEENS
FT                   ATLDESIIDFIATNMTSNIRELEGCLVKLLATASLNAKSIDLPLAKNILRDSVRERSQT
FT                   VTIEMVEKAVCEYFGISANDIKGKSRKKEIAFARQMAMYSAKKWTKSSFKTIGLHFGGR
FT                   DHSTVIHAVNAIDKNADRSEEVRNTIEELHKRLEIMSL"
FT   gene            complement(1606..1956)
FT                   /locus_tag="Ctha_0002"
FT   CDS_pept        complement(1606..1956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0002"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12474"
FT                   /db_xref="GOA:B3QRY9"
FT                   /db_xref="InterPro:IPR005349"
FT                   /db_xref="UniProtKB/TrEMBL:B3QRY9"
FT                   /protein_id="ACF12474.1"
FT                   /translation="MNTIIFAYGIVMIILGISGWMLSGSPTSLIGTLMGVLVILGAKLS
FT                   GTQSWAKFLVLVPALLIVLSLGARLPGYFSLGTNGEISMNVVFIQLFMWVISVAALIYY
FT                   FTVFKASDAPKA"
FT   gene            complement(1998..3026)
FT                   /locus_tag="Ctha_0003"
FT   CDS_pept        complement(1998..3026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0003"
FT                   /product="Holliday junction DNA helicase RuvB"
FT                   /note="KEGG: cte:CT1630 Holliday junction DNA helicase
FT                   RuvB; TIGRFAM: Holliday junction DNA helicase RuvB; PFAM:
FT                   AAA ATPase central domain protein; Holliday junction DNA
FT                   helicase RuvB domain; ATPase associated with various
FT                   cellular activities AAA_5; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12475"
FT                   /db_xref="GOA:B3QRZ0"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004605"
FT                   /db_xref="InterPro:IPR008823"
FT                   /db_xref="InterPro:IPR008824"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041445"
FT                   /db_xref="UniProtKB/TrEMBL:B3QRZ0"
FT                   /protein_id="ACF12475.1"
FT                   /translation="MGKNGALSSASGAGEVQFEEQIRPARFGDFAGQKKIVENLKIFIA
FT                   AARERDDALDHVLLSGPPGLGKTTLAYIVAHEMGVGIKATSGPVIDKPGNLAGLLTSLE
FT                   KGDVLFIDEIHRLNPAVEEYLYSAMEDFKLDIMLDSGPSARSVQIAIPPFTLVGATTRA
FT                   GLLTAPLRARFGINLRLDYYSAELLEKIVQRASRIFGVEIEKDGAFEIARRSRGTPRIA
FT                   NRLLRRARDFAQVNGDLHISKNIAKRTLEALEIDEYGLDEMDKRLISALIEKYRGGPVG
FT                   VATLAMAVGEEPDTIEEVYEPYLIQEGYIMRTPRGRVATDLAYERFGIDKADPQSSLFE
FT                   QE"
FT   gene            complement(3142..3303)
FT                   /locus_tag="Ctha_0004"
FT   CDS_pept        complement(3142..3303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0004"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mlo:mll0653 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12476"
FT                   /db_xref="UniProtKB/TrEMBL:B3QRZ1"
FT                   /protein_id="ACF12476.1"
FT                   /translation="MVVSGVLGATLLTYGYAASKTSDLFKAPKHQKRINRAAGTTMIVT
FT                   GAVLAAKT"
FT   gene            complement(3386..4132)
FT                   /locus_tag="Ctha_0005"
FT   CDS_pept        complement(3386..4132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0005"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12477"
FT                   /db_xref="UniProtKB/TrEMBL:B3QRZ2"
FT                   /protein_id="ACF12477.1"
FT                   /translation="MLKKQFTKYAKLALALMFCCVVLFENVYAQVSYDTTEVNYFEMHR
FT                   QFRLEGSLAVGAGFKNLDLFQKYDGDLVTLSAGGGVGGKLSFGYYLTPQFNANIEFGPQ
FT                   YSLLSESLDNADGGFSRTFVLGTLRLMLPISNDASINIGGGIGSYMGGELDIDASKLYG
FT                   GAHNIYEYKNAVGFHLLTEYEKFLEDGIWSFCIVLKYYNVTYDLDGVSSNGYSFPTEWL
FT                   SEEVKNQIGELDGSGIDLYVSIIMHL"
FT   sig_peptide     complement(4043..4132)
FT                   /locus_tag="Ctha_0005"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 30"
FT   gene            4575..7100
FT                   /locus_tag="Ctha_0006"
FT   CDS_pept        4575..7100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0006"
FT                   /product="DNA gyrase, A subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="KEGG: cte:CT0141 DNA gyrase subunit A; TIGRFAM: DNA
FT                   gyrase, A subunit; PFAM: DNA gyrase/topoisomerase IV
FT                   subunit A; DNA gyrase repeat beta-propeller"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12478"
FT                   /db_xref="GOA:B3QRZ3"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:B3QRZ3"
FT                   /protein_id="ACF12478.1"
FT                   /translation="MQREKIIPINIEDEMRDSYLDYSMSVIVSRALPDVRDGLKPVHRR
FT                   VLFGMNELGLQAGRSYKKSARVVGEVLGKYHPHGDSAVYDSIVRMVQNFSLRYPLVDGQ
FT                   GNFGSVDGDAPAAMRYTEVRMMRISSEILRDLDKNTIDFAPNFDDSLEEPIVLPAAFPN
FT                   LLINGASGIAVGMATNIPPHNLTEVIDGVIAYINNPEITIEELMTYIKAPDFPTAGIIY
FT                   GYNGVRDAYLTGRGKIVLRAKVQVEVTPKNGRESIIITELPYQVNKARLIEKIAGLVQQ
FT                   KKVEGIADLRDESDRDGMRVVIELKKDAVTQVVINRLFKLTQLQETFGVIMLALVGGIP
FT                   RVLTLKETIQYYVNHRHEVILRRTRFELDEAERRAHILEGLKICLDNLDEIIATIRQSP
FT                   DTETARERLMATFSLSDLQAKAILDMRLQRLTGLERQKIEDEYLELLKTIEGLRAILAN
FT                   EKLQMQLIKKELLQIKKTYGDERRTQIVYETEDFSVEDMIAEEDVVITITHQGYIKRFP
FT                   VSGYRRQGRGGRGISGVSAREDDFIEHMFIASTHHYILFFTSHGKCYWLKVHEIPEAGR
FT                   TARGRSITNLIEFATGEKIKASINVKEFNDTQFIVMATKNGTIKKTPLSEYSNPRRSGI
FT                   IAINITDNDELVGASLTDGSHQIVLAKNTGYAVRFPEQNVRPMGRNSIGVKGASISGDE
FT                   AIISMVSTPRNDATLLAITDNGYGKRSAIEDYRMTKRGANGVITLKANEKVGKLVDMLE
FT                   VNDGEDIIIITNKGIVNRQHIADIRVMGRNTSGVRLIRLDEDDFVSAVARVPKEDTEEE
FT                   ETPEENDNQISLPLDSSDNNPQPEDEDPE"
FT   gene            complement(7173..10736)
FT                   /locus_tag="Ctha_0007"
FT   CDS_pept        complement(7173..10736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0007"
FT                   /product="chromosome segregation protein SMC"
FT                   /note="TIGRFAM: chromosome segregation protein SMC; PFAM:
FT                   SMC domain protein; SMCs flexible hinge domain protein;
FT                   KEGG: cte:CT1707 Smc family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12479"
FT                   /db_xref="GOA:B3QRZ4"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR010935"
FT                   /db_xref="InterPro:IPR011890"
FT                   /db_xref="InterPro:IPR024704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036277"
FT                   /db_xref="UniProtKB/TrEMBL:B3QRZ4"
FT                   /protein_id="ACF12479.1"
FT                   /translation="MYLSKLELFGFKSFAQRVQVKFDSGLTAIVGPNGCGKTNIVDAIR
FT                   WVLGEQKTSVLRSDKMENVIFNGTKNRRPLGMSEISLTIENTKNILPTEYSEVTLTRRL
FT                   YRSGESEYFLNKVPCRLRDIWDLFVDTGMGSDAYSVIELKMIEQILSDNAEERRRLFEE
FT                   AAGITKYKQRRKQTYKKLETTSQDLARVEDIVNEVEKKVNALERQAKKAAQVRTLKDEL
FT                   LSLELGLAERQAAALDAKLKPLQAELPIHETKKSELTALIAKLEADIESQQLKLVEIER
FT                   LRSTSQKEINARRENIVVTEKQLVSNKARLHSLQESIARAEKEVREIELQCETLAVEKQ
FT                   KNEVSLEERRKAYDEKKKAYEDARKAHEELEQNLREQRDEIEDKRRELAVISKKISEAK
FT                   LRERSLEGKIENIEENLARAAERKILLERNISERSAKKLENGSLLERLMFQHKQAESEL
FT                   EAAKTRRAEFRSAIDAAKERLLQLRSDLNARQHRIAFLKSLLESYEGLPEGIAHLEKSA
FT                   APRYGLGCLSDMIATDEKFKLAVNAALGEALAYYICPTEQDALAAISELRKAGKGKVSF
FT                   VALEKLQPTSGETQQENSPPESSLPEGVYRTADVIRAPETVRALLAILLENAYVAESLE
FT                   AAQQLAAALPNASFTTLSGERYRSAGFLRGGSVKEDEGLRIGKKEELELLSAEKSEIEA
FT                   DIKKTEAALLEAQTGLNRTSLAEFEKEVRRLAKETTDAEKHRSQIQFELTSFENDIRQL
FT                   DSRLAKDAEEKAALEMELDAQRPQLLALAEDLERENRALELAQESGRSAESELVRSRDA
FT                   MQERHLKQKDAEFALEKARTELWRNDQDSRNAARQQERLTDEIAAAQAEIFRLTGELET
FT                   MNENLRRFYNEKDAAEKVLAEIEFNYNALKGDFNKNESDLRQAQRQREITSQMIFEFQQ
FT                   QASRLEMKIENLQSVIKSEYDLTLEIKAFSDDDEFDQAAATERIGQIKTRLKNLGAVNE
FT                   LALEEFKTEKERFDFLVSQQADLQSAEKQLLDTIEEINKTAQKLFSETFAQIRKNFVEI
FT                   FRSLFNEGDEADLMLDDTADPLDANIDIMAKPKGKRPQSIMLLSGGEKTLTAISLLFAI
FT                   YLVKPSPFCILDEVDAPLDDANVGRFTDLLRQFSKETQFIIVTHNKRTMEASRVLYGVT
FT                   MEEEGVSKLVAVRMDGRDAGG"
FT   gene            complement(11114..13699)
FT                   /locus_tag="Ctha_0008"
FT   CDS_pept        complement(11114..13699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0008"
FT                   /product="glycoside hydrolase family 2 sugar binding"
FT                   /note="PFAM: glycoside hydrolase family 2 immunoglobulin
FT                   domain protein beta-sandwich; glycoside hydrolase family 2
FT                   TIM barrel; glycoside hydrolase family 2 sugar binding;
FT                   KEGG: fgr:FG07593.1 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12480"
FT                   /db_xref="GOA:B3QRZ5"
FT                   /db_xref="InterPro:IPR006102"
FT                   /db_xref="InterPro:IPR006103"
FT                   /db_xref="InterPro:IPR006104"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR036156"
FT                   /db_xref="UniProtKB/TrEMBL:B3QRZ5"
FT                   /protein_id="ACF12480.1"
FT                   /translation="MGLRRVIILSLLFILSQSVSGFAETYLFYENRHAASTSPSAYPES
FT                   KTREMMPLDGKWRAILPDGSEATISVPSAFDFSGKVRFEKKVELPRALEKRHFKLICEG
FT                   INNHCEIFVNDQFIKFHAVSGAAFQVDIANEFLRFGQENKITIVADSRLDPIRTIPIKA
FT                   KAYSKKNYGGIFRDIFLVAEPEIILDDADVNYEIRSDTLNLDLLVKIKTYVLSSPNMVA
FT                   DSKVTCSFRMLLDSAVVLNEPNLFTFKPEQEQILQETTHFNVPHITTWSPAYPALYRME
FT                   FVLRSESGSLLDSISLATGFRKIDIQNGVFHLNGIPAELKGVNLIEEGYTSANALSRQN
FT                   ILNDIKLVKGLGANAIRFKEAPSPIWPKLCDSLGIFVILDEATSGIPSEILGQKSYAEN
FT                   AELYLRELIDLTKFNPSVIAYGFGTGIDLEHEGTEKYLSQLYRRAKERSKNFTFFSPKY
FT                   FVKSSLYKYGDFIGATLFNESFSTSQEQLDAAAKFLPSDKSLIVTEYGAAAEPGNHNGY
FT                   SDPRSLEYQAKYFLDHYKYFKQLNKNKPLIAGSFVYSLADYHYAIPPISCTHYKDIYLA
FT                   SYGLTRLDRERKMSYDMVKSLYADERVYNPPIGKFAPDFSPSLILVATLLTAALVFILN
FT                   ENHRIRENLVRAMVRPFHLFIDIRDMRISSLLEPILLLSLLSLLWGSILAAILFSVKDT
FT                   PILEEWLSHVIGGGSMRSVLNFLILEPALATLIYGILFFVLSGLLCWLINAVLYLVGKK
FT                   RVTFTQILNLWTWASVHWIVLIFIAAFIDRLESPKFTLIIFLVSIVFIAMSFFRTFKGL
FT                   AIVTNQARHKVYIAGFVTILVILLGSFYLYDQYNFTTAYMHYWRNVAGQ"
FT   sig_peptide     complement(13628..13699)
FT                   /locus_tag="Ctha_0008"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.873 at
FT                   residue 24"
FT   gene            13989..14675
FT                   /locus_tag="Ctha_0009"
FT   CDS_pept        13989..14675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0009"
FT                   /product="Isoprenylcysteine carboxyl methyltransferase"
FT                   /note="PFAM: 3-oxo-5-alpha-steroid 4-dehydrogenase domain
FT                   protein; Isoprenylcysteine carboxyl methyltransferase;
FT                   KEGG: ppp:PHYPADRAFT_187807 hypothetical protein Pfam: PEMT
FT                   ICMT"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12481"
FT                   /db_xref="GOA:B3QS90"
FT                   /db_xref="InterPro:IPR007318"
FT                   /db_xref="UniProtKB/TrEMBL:B3QS90"
FT                   /protein_id="ACF12481.1"
FT                   /translation="MPQFLKTFLIGISLAIFVGLLILLPSYFFGNPYDWRVPLAYFSYF
FT                   SLFSSFLLRSVRYGNLSATKTDRQRKTRADSLSYKILFWGLTVAHWLSIYEYFHPILTL
FT                   SDTVATTLTPLGIIFMAGAILLNHHAAHTLGKFFDRLHISDGHQLITTGAYRFVRHPIY
FT                   TSYLCLFLGFCLLFKSAVACLLMFIVCFIGYRSRIKLEENMLLEQFGAEYEAYRNSTKR
FT                   LFPFLY"
FT   gene            14775..15797
FT                   /locus_tag="Ctha_0010"
FT   CDS_pept        14775..15797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0010"
FT                   /product="Abortive infection protein"
FT                   /note="PFAM: Abortive infection protein; KEGG:
FT                   cph:Cpha266_0361 abortive infection protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12482"
FT                   /db_xref="GOA:B3QS91"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:B3QS91"
FT                   /protein_id="ACF12482.1"
FT                   /translation="MDEQQHFSDAFSGENAQPQGILERLRISPLLINATVLIGILFVYM
FT                   LAGGLATLLAAGVNAGSVELSDLKLAINDGNLQMIRLVQFLAQVLIIGLPVLFLVPLHT
FT                   GNWQVLSQENRRFLGLEVKASPMEFIYAALGIIVIHPFLAYSADLQITAMDVIFGVGDT
FT                   LLAERKMMDEFIEKLTVMRSPAEFLGVAGLIAVTPAICEELLFRGYVLKNFSRSLSAGL
FT                   TVFLTGLIFGAYHLNASETLPLVILGIYISFVRYYSGALSVAMTIHFVNNFFSVSGVFV
FT                   LSHADFFHINPSLLESFESRNPDISSASAIFSAGLSLALFFIILNLYKTAVQKRFALGQ
FT                   "
FT   gene            15831..16115
FT                   /locus_tag="Ctha_0011"
FT   CDS_pept        15831..16115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0011"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sru:SRU_1715 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12483"
FT                   /db_xref="InterPro:IPR018551"
FT                   /db_xref="UniProtKB/TrEMBL:B3QS92"
FT                   /protein_id="ACF12483.1"
FT                   /translation="MPHSSNLEEIEGWRVVYNTNSEMEAELIKAYLSDAEIEAQVMSQR
FT                   DHMLPANEFETLLVHVLVEPENLDAAQSLIQAFFENRDSASQESGETNS"
FT   gene            16112..16927
FT                   /locus_tag="Ctha_0012"
FT   CDS_pept        16112..16927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0012"
FT                   /product="phosphatidate cytidylyltransferase"
FT                   /note="PFAM: phosphatidate cytidylyltransferase; KEGG:
FT                   cte:CT0233 phosphatidate cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12484"
FT                   /db_xref="GOA:B3QS93"
FT                   /db_xref="InterPro:IPR000374"
FT                   /db_xref="UniProtKB/TrEMBL:B3QS93"
FT                   /protein_id="ACF12484.1"
FT                   /translation="MSSNLAKRIIIALLGAPLVIWLIVLGGHFFFLLVIVIALASMNEL
FT                   RLMVKETNATTPDFLLFLASAGLLADFFYGFMPVSELAIAITIGFSAIELYRNRGIATH
FT                   NLGASFLTVFYISLSFGTLFWLRHLDDHGLFVIITLLSVWAADTFAFFGGHALGQKIFK
FT                   KKLFERISPKKTWEGYLMGVAGSIFISSLFNEMFPLPHATEIDAILIGAIIGVLSPIGD
FT                   LIESMFKRDSGLKDSSEILPGHGGFFDRFDSLCFISPIIFFYCRYIIQI"
FT   sig_peptide     16112..16234
FT                   /locus_tag="Ctha_0012"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.716) with cleavage site probability 0.562 at
FT                   residue 41"
FT   gene            17017..17526
FT                   /locus_tag="Ctha_0013"
FT   CDS_pept        17017..17526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0013"
FT                   /product="putative PTS IIA-like nitrogen-regulatory protein
FT                   PtsN"
FT                   /note="TIGRFAM: PTS system, fructose subfamily, IIA
FT                   subunit; PFAM: phosphoenolpyruvate-dependent sugar
FT                   phosphotransferase system EIIA 2; KEGG: cch:Cag_1468
FT                   putative PTS IIA-like nitrogen-regulatory protein PtsN"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12485"
FT                   /db_xref="GOA:B3QS94"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR004715"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:B3QS94"
FT                   /protein_id="ACF12485.1"
FT                   /translation="MSVNFLNFNLHFTMKLSDLLSKEYILLGLDINTKEGVIEKMLSLV
FT                   SNHPNLVDNEKLREDVLKREEEMSTGIGKNIALPHAKTEAVTQPILAFALLKKAVEFDA
FT                   IDSQPVRFVFLLATPEQMLAQHLKLLSRISRVASKEEIRNRLLETKDPASVLSVFIEEE
FT                   KAFPEI"
FT   gene            17545..18828
FT                   /locus_tag="Ctha_0014"
FT   CDS_pept        17545..18828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0014"
FT                   /product="histidyl-tRNA synthetase"
FT                   /EC_number="6.1.1.21"
FT                   /note="KEGG: cph:Cpha266_0364 histidyl-tRNA synthetase;
FT                   TIGRFAM: histidyl-tRNA synthetase; PFAM: tRNA synthetase
FT                   class II (G H P and S); Anticodon-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12486"
FT                   /db_xref="GOA:B3QS95"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR015807"
FT                   /db_xref="InterPro:IPR033656"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3QS95"
FT                   /protein_id="ACF12486.1"
FT                   /translation="MKFQTIKGTKDILPSEIHKWHYVENTVRGVFQRFGYNEIRTPVFE
FT                   QTALFQRGIGETTDIVGKEMYSFQPDPESESLTLRPEMTAPVMRAYLQHSLSGTSPATK
FT                   VFYISEIFRKERPQAGRQRQFWQFGCECIGSDQPEADAEVILLMTEIYRQLGIKNFTLR
FT                   LNSLGETESRLAHREALQTYLKPHFDLLDEISKTRFEKNPLRILDSKNPALAEIIAGAP
FT                   HITEFLDDASKAHFQTVQTYLKNAGLDFTVDPTLVRGLDYYSRTAFELVSTDLGAQDAL
FT                   AGGGRYDSLATVLGAKNSSAAVGFAAGIERLLIIMEKLDLFQAVLPPAPLLFIATQSPV
FT                   AKEWAFQTVNRLRTEGIHVALDLLGRSLKAQMREANRTHAKYVLIVGEEELSTGRFQLK
FT                   HLQTSEQVELSEADIFTKMQTETTQDLG"
FT   gene            complement(18896..19690)
FT                   /locus_tag="Ctha_0015"
FT   CDS_pept        complement(18896..19690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0015"
FT                   /product="OmpA/MotB domain protein"
FT                   /note="PFAM: OmpA/MotB domain protein; KEGG: sus:Acid_0513
FT                   OmpA/MotB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12487"
FT                   /db_xref="GOA:B3QS96"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:B3QS96"
FT                   /protein_id="ACF12487.1"
FT                   /translation="MFFCSVFWHSAVALAPKNSIKRSESLAGKTLRDRSDSAITALSSD
FT                   AAHLIDSVADVQPKILVFEAHPSKIRVGESVTLRWETENTLKIGILPQIGTVAHPNGTR
FT                   TIRPATTTTYTLVAFHGEAFIEQKLTIVVEPPLPLIPPPQPDLFNPGDYIVLDIAFPVN
FT                   RTELPYSAHDMLDELAEKLLAKRLSVEIVGHTDSKGSSRFNYNLSVQRAAAVKKYLIRR
FT                   GVPASWLRAYGVGSNEPITRNKTKEGREKNRRIEVKVIKVLK"
FT   gene            20293..22614
FT                   /locus_tag="Ctha_0016"
FT   CDS_pept        20293..22614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0016"
FT                   /product="ABC transporter-related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: sru:SRU_1409 probable toxin secretion ABC transporter
FT                   ATP-binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12488"
FT                   /db_xref="GOA:B3QS97"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:B3QS97"
FT                   /protein_id="ACF12488.1"
FT                   /translation="MQSNKTQDLETQLEQQIISLFEYLNHTGVEHLALEHLYEFLEQEP
FT                   LHPSTLFERLEKNAQDAGLSLRRMQISADHFFEKKPVHSLILRAPAELMLIEEIQHSDK
FT                   TVKLRSFATNDIAIVPAATLFKNQKSLDLLCYDGTIYTYMTSGKEDTAFRSKAHSTHQA
FT                   SDAHKHHEKTSVLSILDKLIRLLKEEQHDFLVVLGYAIIVGLLSLVMPLSAQAIVNTVA
FT                   LGVYSAQLVSLCIVVGIGLIILGAFEVMKRYVVDVLQRRLFVRTAFEIAHRLPRIRTKA
FT                   LENEYAPELVNRFFDVMTVQKTIGKFLLDGVSATLIALSGLILLGIYHPIFLLFNVFLL
FT                   IFVPVLIFVLGRGGLELSIKESKKKYALASWLEDIARCQTSFKMNGSPEFIYRRVDEIA
FT                   TEYVKARDKHFSVLIRQLSGSYIFRALASVGVLGIGGALVIEQQISLGQLVAAELVIVA
FT                   ITASLEKLVEQFEFHYDLLTAIDKISHVTDKELDPVGGELSPDFKGAVSVNLHDVTFSY
FT                   TDGKKVLENVSLEIPAGGRVSLVGKSGAGKTTLMSLIAGLNDAEHGVIEFNGYDISRMN
FT                   LKQLHQIVAIVPAQNEIFEGTIEENILMGRAFDYEQMVWALKISQMYDDIRAMPNRLKT
FT                   PIISAGRNLPGGLIRKIMIARAIIGKPKVLILDEAFGGMEENTKLELIRSLYSESSWTI
FT                   IDISHDAEVIRRSEPIYVLHDKRIVETYMAGDLATKKDTLLGKLFPDLARQIIEERKNP
FT                   ALAKPNMKNNSETASREQAT"
FT   gene            22702..23976
FT                   /locus_tag="Ctha_0017"
FT   CDS_pept        22702..23976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0017"
FT                   /product="HlyD family secretion protein"
FT                   /note="KEGG: sru:SRU_1408 HlyD family secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12489"
FT                   /db_xref="GOA:B3QS98"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:B3QS98"
FT                   /protein_id="ACF12489.1"
FT                   /translation="MIRKENRSSTSDFELKHSIPHYYTTAMRLARIPKTARTFALSVYV
FT                   LLVLIVLGLIFIPWQQNVIGSGTVTSFVPNARPQSIDAQIDGRIVKWFVNEGAPVAAGD
FT                   TIAVLRDIDTKFLDTNFVEKNAIIRENTAKEQELSVIAAEQKVIQARQKHLSAIAQREN
FT                   TKVGTATARIQYNRALALESEGLIPRKDLELSLLKYQKAISDSIKAEAELSIALRTIYA
FT                   AEAERNAKERKANAIIAKAELEFGNVSQRKNAGVVIAPIDGTVVRISQAGPGQTVKKGS
FT                   QLAIIAPETDDIAAEIMVGSLDAALISPGRPARMQFAGFPAIQFSGWPDMSLGTFGGTV
FT                   AVIDAVDDGTGRYRVLIVPDQNDRAWPDRTFLRQGTEVTGWVLLNEVPLGYEFWRIMNG
FT                   FPPIVPVKTNPKSHKDAKKTTKGEK"
FT   gene            23979..25403
FT                   /locus_tag="Ctha_0018"
FT   CDS_pept        23979..25403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0018"
FT                   /product="outer membrane efflux protein"
FT                   /note="PFAM: outer membrane efflux protein; KEGG:
FT                   sru:SRU_1407 outer membrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12490"
FT                   /db_xref="GOA:B3QS99"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:B3QS99"
FT                   /protein_id="ACF12490.1"
FT                   /translation="MLLKKLQRFKPVSFFITVFCVSFSPTASAQVADDTLSLHAFLSIV
FT                   SEAHPKAIAATLEKDLANADILDAKSNFDPVIKTSYKYKSIDGKAKVNYLNTNVEVPLP
FT                   TNFGPSFIAKYRRGLGDGIDPENETTEEGEAGFGIQVPILQGLSLDKRRAQLAKAKLEP
FT                   KVAEASQKETNNNLLLEASNAYWDWVEAHAALQVAENMFDLATERSQVIATRARKGEAA
FT                   AIDTVEALLEIEKRRGDLFKANRKFEKASIKLSTYLWHKDRTPQELNFSAPELPELPVL
FT                   SDSLVMRQKYKALEKRPELRQMHVKLKSAGIEVNLAKQTMLPKLDAEFQTLFYKLDGSK
FT                   INDYLFGIKFSQPLFFRRARASEELARVKVESIKFKKLETERKILAEIDDAISAIQAAQ
FT                   KRVAASLRENHYAWIMQEGERKKYVAGESSLLYLNIRERYAAEAKAKLIEAKADYLRAI
FT                   SGYLWTIGAIDGFWVN"
FT   sig_peptide     23979..24068
FT                   /locus_tag="Ctha_0018"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.958 at
FT                   residue 30"
FT   gene            complement(25462..27825)
FT                   /locus_tag="Ctha_0019"
FT   CDS_pept        complement(25462..27825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0019"
FT                   /product="multi-sensor hybrid histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="KEGG: cth:Cthe_0806 PAS/PAC sensor hybrid histidine
FT                   kinase; TIGRFAM: PAS sensor protein; PFAM: response
FT                   regulator receiver; ATP-binding region ATPase domain
FT                   protein; histidine kinase A domain protein; Hpt domain
FT                   protein; PAS fold-3 domain protein; PAS fold domain
FT                   protein; SMART: PAC repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12491"
FT                   /db_xref="GOA:B3QSA0"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSA0"
FT                   /protein_id="ACF12491.1"
FT                   /translation="MTEKIKVLYIEDDRVDQIAFERLIKQQSHTYDYKVVNSVAAAKAM
FT                   LVKEDFHVIITDYNLGDGTASDVLEQFHKTPVIFITGTGDEEIAVNAMKSGAYDYLVKD
FT                   PERNYLKVLPLSIEKAIHHQKSAERLRLLESVVVNGNDAVLIAEHTGKSSGGYPKVIYI
FT                   NRAFTLATGYELEEVIEKPSDVLFGEKTSQRELVKIRKAMKGNESVRTELICYKKDGAV
FT                   FWNDVNIVPVKDENGIYTHWVSVHRDITHRKKTEEALVKAKILAEESMRSKERFLANMS
FT                   HEIRTPMNAVIGMTNLLLRTPLSSEQAECVDIIKQSSENLLVIINDILDFSKIESGKIT
FT                   FESIPFSLHSLLKKTISTFSLKASEKDLSLSLSLDASCPDSVMGDSVRLNQILVNLVGN
FT                   ALKFTEKGKIVVKVQLDRRTPTHSVVLFSISDTGIGIDAEKQETIFESFTQAGNDTTRK
FT                   FGGTGLGLAITKKLVELQGGKIWVKSELGVGATFSFALPLKVAQTEYSTPKLQVQRQAV
FT                   SDFSKHRILLVEDNYFNQIVAKKTLETFQVSCDVAENGRVALERLAAAKYDLILMDVQM
FT                   PEMDGYEATRLIRKMPPPLNEIPIIAMTAGALKGDDEKCINAGMNDYISKPFDPERLYE
FT                   LLAAHFQNTSPEQNDMDEQDFLDENSLRGKLQKQGLDLPYLFMVSNGRDDFVVEMIQLF
FT                   LSQSTEYLETLRLSLESSNWQLLSRTAHKFLSCTGYMSLSKTAELLKQVELYARDETHL
FT                   DELPELVTEIIDQVHRVRSKLKPIFQSDGQYYKF"
FT   gene            complement(28069..28479)
FT                   /locus_tag="Ctha_0020"
FT   CDS_pept        complement(28069..28479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0020"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   nmu:Nmul_A1288 response regulator receiver domain protein
FT                   (CheY-like)"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12492"
FT                   /db_xref="GOA:B3QSA1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSA1"
FT                   /protein_id="ACF12492.1"
FT                   /translation="MKSDKSILLVEDDKVDVMTVKRALKEIRVTNKVYVVGNGEEALTF
FT                   LHEPSNERPAIILLDINMPKMNGIEFLKVAKNDEEIKRIPTIVLTTSRDDWDRVQSFDL
FT                   GAAGYMIKPVDYLQFVEVMRTIDMYWSLSEMP"
FT   gene            complement(28503..32501)
FT                   /locus_tag="Ctha_0021"
FT   CDS_pept        complement(28503..32501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0021"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /note="KEGG: nmu:Nmul_A1289 multi-sensor signal
FT                   transduction histidine kinase; TIGRFAM: PAS sensor protein;
FT                   PFAM: GAF domain protein; ATP-binding region ATPase domain
FT                   protein; histidine kinase A domain protein; PAS fold-3
FT                   domain protein; PAS fold-4 domain protein; PAS fold domain
FT                   protein; SMART: PAS domain containing protein; PAC
FT                   repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12493"
FT                   /db_xref="GOA:B3QSA2"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSA2"
FT                   /protein_id="ACF12493.1"
FT                   /translation="MTQKDIASKTEPAELNHKISTGEAAAQSQKSSRAQNSHLEHNEPE
FT                   EIITIHVKNLTDLSITSISERFQTLLGYSKEALLAQEVSFRSLLEPNDVAQFNRDLQHL
FT                   ACGEKKPDGIFCSPFQLRHVNGASVFLHAIVRPEPSSEELAIHLFRYPMAEKVAQQKSE
FT                   LLKAAANANRELLTNQDFRSALLKSLQILGESTHVDRIYLFENHICQETGVLLTSQRYE
FT                   WTLAGISQEIHNPDLQNMPYLGGLAYWKERLSSGYSVKGIVENMPDDDVREILLAQNIR
FT                   SIMVVPIMIGTEFWGFIGFDDCTTARLWTESEEAILVSVGASVGGAIDKERSQKALLRS
FT                   QAKYKSVVENIEEVIFQVDREGKCEFINEAWERITGYKPQKECLGKNLFDFFGNEKNPH
FT                   FKEIGQGILEGKIPRFYETMQLKTCDGSLRWVELMLLPRCDEPGNIIGLFGTMMDSTKQ
FT                   VQALESLKNSERIYRRISQLISDYAYRLIPLENGEFDFKWLMVGGFYSNLGFLPNEVSE
FT                   KAWFEFIYPDDRHILDLRDACLRKGEPVTIQLRVETQEGDLIWLEDAASPFLNHETGEI
FT                   EEIICVISDITMRKRAEKEIRQAHDNLKVIMRTAPFGVVVVGQDQRIRWTNETVKRMAR
FT                   LKETDSLVGRSCSDYFCNGEKNLCPILKYGISDSKCENRFQDIHILKTVNEIVFEGEDV
FT                   FLETFVDITELKNAQKALEENQQRFSIAADSAGIGVWELDLVTGGMIWDEWMFKLYQKP
FT                   KEAFHGNFTDWKSALAPGEFERMDPIIQSTIASKSDNDFEMSFEIIWPSGEKRVLKTYG
FT                   RALKDEAGKAVRLTGINYDITDKTKAEERIRKSQEKYKAIFNTIQDVYAEVALDGTILE
FT                   ISPSIKKISGYSRQEMLGKNIYHFYSNPLERENLRKELFKHGYLNDYEVKLRHLDGAVR
FT                   TCSFTVSVILDRSGQPKKIVGSMRDITDRKKAEENIRKSEEKYKAIFNTIQDVYAEVAL
FT                   DGSILEITPSIERFTGYSREYLLGKKTSTLYKDPTARDRMVEELSQKGSLVDYEVVFAH
FT                   KDGSSKMGSFIIGLQYDLNGKPYKLVGSMRDITERKKYEQDILEKEQRYRLLAHDLQKA
FT                   NRELKDFAYIVSHDLKAPLRAIGSLSSWLYSDYVDRLDEEGKETLSLLVGRVKRMHDLI
FT                   EGILQYSRIGRIKEAFVEIELDLLIDEIVDFLSIPKHISVVKDTSLPNIIAEKTRMMQV
FT                   FQNLISNAVKYNDKEHGEISIGHVENGETWQFYVKDNGPGIDEKYHEKIFQIFQTLAPR
FT                   DEHESTGIGLTIVKKIIEMYGGTIAVESTMGKGTTFWIELPKLLNLGA"
FT   gene            32745..33167
FT                   /locus_tag="Ctha_0022"
FT   CDS_pept        32745..33167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0022"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bba:Bd3498 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12494"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSA3"
FT                   /protein_id="ACF12494.1"
FT                   /translation="MQRCIHLLLIGSLFAFSFSCKPDDPNKISADEVLKKAQETMEIST
FT                   KFVLQEKEAFEKNSEARLKTIRGDIEDMKAALSTANETASEIQAQLNAIEKKEAELEAW
FT                   LEKMETDDALQGAQQGFHAAMAELEKAKENLEKRLK"
FT   gene            33271..34368
FT                   /locus_tag="Ctha_0023"
FT   CDS_pept        33271..34368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0023"
FT                   /product="KWG Leptospira repeat protein"
FT                   /note="PFAM: KWG Leptospira repeat protein; KEGG:
FT                   ana:all4040 unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12495"
FT                   /db_xref="InterPro:IPR018337"
FT                   /db_xref="InterPro:IPR032774"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSA4"
FT                   /protein_id="ACF12495.1"
FT                   /translation="MKVLRWLIFGIFLMYMGACSQNNPPKSDVPVEKRNLFVANVDELY
FT                   GFIDEQGNMLIPPKFDIAYRFKNGFAPVRVGDKWGFIDKSGAYLIEPTYSQVTPFRYGF
FT                   ARVQVDDKWGYVDSTGKLVFQPIYDVANQFSEGLAVVCLDGKFGAINRNGTLVIQPKFE
FT                   KAYHFLQGMAVVRLDGNWGYIDSTGKMVVPAKFEKAENFSQGRAMVQLGDKWGFIDKSG
FT                   AFIAEPQYDDAWIFLDGLARVKKDGKWGYIDSTGNMAIQPQFEQALNFTNGTARIAENG
FT                   KWGYIDKSGKVIIQPQFENAMPFSEGLAQVMVDGKWGYIDSTGSMIIQPQFDKASNFEE
FT                   GVALVITDGVSGYIQKSGNYIWHGK"
FT   sig_peptide     33271..33333
FT                   /locus_tag="Ctha_0023"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.825) with cleavage site probability 0.368 at
FT                   residue 21"
FT   gene            34501..35304
FT                   /locus_tag="Ctha_0024"
FT   CDS_pept        34501..35304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0024"
FT                   /product="phosphoesterase PA-phosphatase related"
FT                   /note="PFAM: phosphoesterase PA-phosphatase related; KEGG:
FT                   gfo:GFO_3394 secreted PAP2 superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12496"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSA5"
FT                   /protein_id="ACF12496.1"
FT                   /translation="MRNFQIFLVIFFCLTQTAQAGDKSVGETLGDDATEYYKDMKRIFS
FT                   SPARFSTTQWLVLGSALGATASAYLVEEDVRAFAQENHTPFLDALMPVGDYYGRMVSST
FT                   ALSSVIYLGGLTFDDRETRLTGRAAIEAVTFSLAITGVMKVLFGRSRPYTEHGHAQFNW
FT                   LETQEQFLSFPSGHSTAAFALSSALSVRIDRPWATAGLYSLAAITLLNRMYDDKHWLSD
FT                   TVMGAAIGTAIGIAVGKMVNKEAEQTGDEKVSGAPLEVPIVSVSF"
FT   sig_peptide     34501..34563
FT                   /locus_tag="Ctha_0024"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 21"
FT   gene            complement(35323..36621)
FT                   /locus_tag="Ctha_0025"
FT   CDS_pept        complement(35323..36621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0025"
FT                   /product="glutamate-1-semialdehyde-2,1-aminomutase"
FT                   /note="TIGRFAM: glutamate-1-semialdehyde-2,1-aminomutase;
FT                   PFAM: aminotransferase class-III; KEGG: cte:CT2099
FT                   glutamate-1-semialdehyde 2,1-aminomutase"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12497"
FT                   /db_xref="GOA:B3QSA6"
FT                   /db_xref="InterPro:IPR004639"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3QSA6"
FT                   /protein_id="ACF12497.1"
FT                   /translation="MLNLKTSAALFERAKKVIPGGVNSPVRAFNSVGGTPVFVTKGEGA
FT                   RMIDVDGNSYIDYVGSWGPFILGHSHPRVIEAIERTMKAHGTSFGAPTELEIELAELII
FT                   KVVPSVEMVRMVNSGTEATMSAIRLARGYTKREKIIKFEGCYHGHGDSFLIKAGSGALT
FT                   LGAPSSPGVTEGTAKDTLNATYNDIESVRALVDSNKGNVAAIIIEAVGGNMGVVPSKKE
FT                   FLVALRELCDKEGIVLIFDEVMTGFRVALGGAQEVYGITPDLTTMGKIIGGGLPVGAYG
FT                   GKKEIMEHVSPVGTVYQAGTLSGNPLAMSAGLATIKILAEENPYPELEKKAVIIEEGFK
FT                   SNLEKLGLNLCQTRVGSMSCLFFTDKEVVDFETANSSDTAKFATYFNSMLESGIYLACS
FT                   QFEAMFISTMHTEEDLQKTIEANYNALKLAYGK"
FT   gene            36650..36913
FT                   /locus_tag="Ctha_0026"
FT   CDS_pept        36650..36913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0026"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12498"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSA7"
FT                   /protein_id="ACF12498.1"
FT                   /translation="MLSEQILVFHVGKQTRLIYAIIKIAAKTALAPTANLPHLKRTENR
FT                   EKVLQSQALAQRKNISFQVLFLRAKRILKLNSARLIVLKENH"
FT   gene            37080..38798
FT                   /locus_tag="Ctha_0027"
FT   CDS_pept        37080..38798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0027"
FT                   /product="diguanylate cyclase and serine/threonine protein
FT                   kinase with TPR repeats"
FT                   /note="KEGG: ter:Tery_2811 tetratricopeptide TPR_2;
FT                   TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain containing
FT                   protein; TPR repeat-containing protein; Tetratricopeptide
FT                   TPR_2 repeat protein; SMART: Tetratricopeptide domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12499"
FT                   /db_xref="GOA:B3QSA8"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSA8"
FT                   /protein_id="ACF12499.1"
FT                   /translation="MKISTTQSKIDNIKKRLDSNIDEKERVDLLVSLAETIHITNTQYA
FT                   LDLGKRACDQAKELCYKKGQAKGLCIIGKCLWRLSNNEEALTHLLESLWTFEEIGERTG
FT                   EAKALMAMGVVLKSLSDFEQAIGYFFQSLRILEEVNDKVSQAEVMNNIGNVFKNLNNYY
FT                   EALPYYQQSLAILESANEKHGMALALNNIGYVHYALGKYDEALPYFQQSIKYAKEIGDA
FT                   IAESEALNNMGMVYEKIVDDQTALDIYFKSLLKSQEIGDRYGEARVLLSIGMQYAKNKD
FT                   IESAEQYLQESTLIAEAVKARSIMCQAYRALANVYEQKKDFERALGYYKAFDSIKEELL
FT                   SKDITGKINALKQNFELHTVQKELELFRTKNEELIGAFRDLQSLNISLQAELDLKTRVV
FT                   NELRSKNDAKDAEPRKDFLTNLYTLRAVSPKLKHLFDSAKRQGKELSIAVIEIDLFKQI
FT                   NSRYPSQIMSEVLKKVAQILKEHIRTEDILVRYLGSSFVLLMPDLPAVRAFIICEKMRQ
FT                   AVESFRWGMLASGLKITVSFGLADDLKVPSYEKLIRLAEMKLQQTERSGGNQVRS"
FT   gene            39153..39866
FT                   /locus_tag="Ctha_0028"
FT   CDS_pept        39153..39866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0028"
FT                   /product="protein of unknown function DUF205"
FT                   /note="PFAM: protein of unknown function DUF205; KEGG:
FT                   cph:Cpha266_2581 acyl-phosphate glycerol-3-phosphate
FT                   acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12500"
FT                   /db_xref="GOA:B3QSA9"
FT                   /db_xref="InterPro:IPR003811"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSA9"
FT                   /protein_id="ACF12500.1"
FT                   /translation="MLSVITILVVSYLIGSIPTSILVSKFVKGIDIREFGSGNAGGTNV
FT                   FRVLGWQAGLFVTLFDMLKGVAVVLWVVAYFELNQLDQMPDINRVALQLLAGISAMIGH
FT                   VYTIFAGFKGGKGVSTAAGIMIGIAPVTMLIVLGVFFTVMLSSRYVSLSSMIAALSFPV
FT                   TIAIRKYIFELGNGLDYYVNIFGTSHHIHDSLDYHLMIFGALVALTIVYTHRANIQRLR
FT                   LGTENRVNLFSKKEK"
FT   gene            40082..41068
FT                   /locus_tag="Ctha_0029"
FT   CDS_pept        40082..41068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0029"
FT                   /product="Glycerol-3-phosphate dehydrogenase (NAD(P)(+))"
FT                   /EC_number="1.1.1.94"
FT                   /note="PFAM: NAD-dependent glycerol-3-phosphate
FT                   dehydrogenase domain protein; KEGG: pvi:Cvib_1699
FT                   glycerol-3-phosphate dehydrogenase (NAD(P)(+))"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12501"
FT                   /db_xref="GOA:B3QSB0"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSB0"
FT                   /protein_id="ACF12501.1"
FT                   /translation="MAQAVGEPRLPCYSPKKAFRLLLWAYGASFAEKLQRERENTVYLK
FT                   GIPFPENIQITNSEALAAESADMLVVATPAQAVRETLHRIHQTALSGKTLVNLSKGIEV
FT                   KTGLRISQVIRQVHPEVQDEQIAILYGPSHAEEVCTEHPTTVVAASTCLETAKLVQDTF
FT                   ITPMFRVYVNDDVIGVEIGGSVKNIMAIAAGISDGLGFGDNAKAAIITRGIAEISRLGA
FT                   RLGANPLTFAGLAGIGDLVVTCSSRHSRNRYVGEMIGKGKSLDEIIQSMEMIAEGVETT
FT                   RAVAALSKELNVDMPITQSVYEMLFEGKPVKQAVYELMTRDPKFELS"
FT   gene            41348..42292
FT                   /locus_tag="Ctha_0030"
FT   CDS_pept        41348..42292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0030"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pdi:BDI_3738 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12502"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSB1"
FT                   /protein_id="ACF12502.1"
FT                   /translation="MRKIFTVLCGLLLLATPLFAQDKVYDFLNLERSAKVAALGGNSVS
FT                   FIGDLNAFFQNPAVLNSNTNRRGAFSFQKHLMDINSGFAVYGRSIESIGDFAAGVSYVN
FT                   YGSFDETDELGNIIGSFAAQDLALQIGYAFDLEEYDYGYLRAGISLKYIYSNIADYTSS
FT                   ALALDAGIVLVIPESDVEIGFALTNYGWQLAKYDAASEDLPTDMRLALTTRPEGLPLAL
FT                   TIGLVQLNNDFSLTEKVKNFTIGGEFSFGEFVRFRLGFNNALRNDVKSGENAGMVGASA
FT                   GLGILYRDFHFDYSYSSWGSIGALHQFSISTTL"
FT   sig_peptide     41348..41410
FT                   /locus_tag="Ctha_0030"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 21"
FT   gene            42575..44311
FT                   /locus_tag="Ctha_0031"
FT   CDS_pept        42575..44311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0031"
FT                   /product="DNA polymerase III, epsilon subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: sru:SRU_1441 hypothetical protein; TIGRFAM:
FT                   DNA polymerase III, epsilon subunit; PFAM: Excinuclease ABC
FT                   C subunit domain protein; Exonuclease RNase T and DNA
FT                   polymerase III; SMART: Exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12503"
FT                   /db_xref="GOA:B3QSB2"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR006054"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSB2"
FT                   /protein_id="ACF12503.1"
FT                   /translation="MVADLSNRGKGKDELPAKITDATFAVVDLETTGGLKPENRIIEIC
FT                   AIKCRNGQEVGMLESLVNPEQQISYFISQYTGITNSMVDNAPVIQSLLTKVSEFFQETI
FT                   FVAHNVPFDMGFINMELERNGYAKLTNRWLCTFRLARRLLPTQQKKNLGDLAKYFGIIV
FT                   ENRHRARGDCEATIKLLAELIILAQEQHGVETAEELLSLQFKAIRNFKREPRHFSKIRN
FT                   TVLNKFPTKSGVYLMKSAKDEVLYIGKSKNLKSRVSSYFNQNIDRSEKVVELTHHVRKI
FT                   DYTLTGSELEALLLESKLIKQYKPRFNTLLKRYRSYPFLTFSEHEFPKLEIALDVEDGD
FT                   KEYFGPFPSLELLQHVVEILERYFKVRKCSDHDFSRARFCIYFDLDRCFAPCKHPKHYK
FT                   EAYIKELDQIRAFLSGKNPEIINVMIREMKALASENLFEEAADLKQKIHSLQKVFFRQS
FT                   DIVNSVNENNVIAILPSENFSDCCKEYVLLFVRFGRLIDQKKVFEDETESLVPVIASVY
FT                   HNGHSSPTPCRKEEIDEMQILSNWIYQNKDSLHCFYVKDALTTEQIHETLQKRLKSLSE
FT                   TR"
FT   gene            44426..45169
FT                   /locus_tag="Ctha_0032"
FT   CDS_pept        44426..45169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0032"
FT                   /product="Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase"
FT                   /note="PFAM: Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase; KEGG: cte:CT1646
FT                   tetrapyrrole methylase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12504"
FT                   /db_xref="GOA:B3QSB3"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSB3"
FT                   /protein_id="ACF12504.1"
FT                   /translation="MTSSTTTTLEPALYIVATPIGNLEDMTFRAVTTLRAADCIACEDT
FT                   RQTRKLLQHFAIDSKTLLSYHNFNERTASAKILEFLQSGKSVALVSDAGTPVISDPGFF
FT                   LVRAARDAGFRVVPIPGASALAAAVSVSPLPVNRFYFEGFLPQKKGRQTRLQYLAELES
FT                   SVVLYESPHRILKLLDELSAHFGDRQIMLAREMTKIYEEFLLGTIAEAKANLQERKIQG
FT                   EFVVIVEGKNAKSKNETYENQDENY"
FT   gene            45156..46010
FT                   /locus_tag="Ctha_0033"
FT   CDS_pept        45156..46010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0033"
FT                   /product="pantoate/beta-alanine ligase"
FT                   /EC_number="6.3.2.1"
FT                   /note="KEGG: cte:CT1647 pantoate-beta-alanine ligase;
FT                   TIGRFAM: pantoate/beta-alanine ligase; PFAM:
FT                   Pantoate-beta-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12505"
FT                   /db_xref="GOA:B3QSB4"
FT                   /db_xref="InterPro:IPR003721"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR042176"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3QSB4"
FT                   /protein_id="ACF12505.1"
FT                   /translation="MKIIETVSEMQHFSESLRIAEKRLGVVPTMGALHDGHLSLVKLAL
FT                   KHADVAIMTIFVNPLQFGPSEDFAKYPRTFERDAMLAEKAGVSCIFAPTPETLYPSGFQ
FT                   THVTVDEITQGFEGELRPGHFRGVTTVVAKLFNITKPHVAVFGEKDAQQLAAIRKMQKD
FT                   LNFDVEIVPAPIVRETDGLAKSSRNIYLNPAERKQAVVLNESLEIAKSAIQHGERNVKT
FT                   LLEVLNRHIQSAPLAEPDYIAIVDAESFQPVQEELLAEETYLVLLTVRFGSTRLLDNCR
FT                   IEL"
FT   gene            46157..46942
FT                   /locus_tag="Ctha_0034"
FT   CDS_pept        46157..46942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0034"
FT                   /product="class II aldolase/adducin family protein"
FT                   /note="PFAM: class II aldolase/adducin family protein;
FT                   KEGG: cpy:Cphy_1177 class II aldolase/adducin family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12506"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSB5"
FT                   /protein_id="ACF12506.1"
FT                   /translation="MNIALQEEVVRFTRKVAEHGFVASFDGNLSLRSSEGIYITATRTL
FT                   KSDATTSDICLIDLDGNLLEGERKPSSETLMHLLIYRERPDVMGVVHTHAPYATAFASA
FT                   RQPLDAAVFPEVILDIGPVPLAEYATPSTEDVPNSLKPAIAWANGILLANHGLVCMGGS
FT                   LAEAFFRTEKLEHAAKTLIAAQTLGGAVPLKRCEVDYLYETHQTFKRRGVLMDCESLDH
FT                   PSCRTSDDREKLVCHPSDKNCREEFISKTAHAVLKRLKG"
FT   gene            47180..47467
FT                   /locus_tag="Ctha_0035"
FT   CDS_pept        47180..47467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0035"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, C subunit"
FT                   /note="TIGRFAM: glutamyl-tRNA(Gln) amidotransferase, C
FT                   subunit; PFAM: Glu-tRNAGln amidotransferase C subunit;
FT                   KEGG: plt:Plut_0337 aspartyl/glutamyl-tRNA amidotransferase
FT                   subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12507"
FT                   /db_xref="GOA:B3QSB6"
FT                   /db_xref="InterPro:IPR003837"
FT                   /db_xref="InterPro:IPR036113"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3QSB6"
FT                   /protein_id="ACF12507.1"
FT                   /translation="MSVTKQDVEYIATLARLSFSEDEKEKMTKELNTILHYVEKLNELD
FT                   TEEVEALNNMNERHNVLRPDEIVASIENSKAIKNAPDSVERFFKVPKVIG"
FT   gene            47492..47785
FT                   /locus_tag="Ctha_0036"
FT   CDS_pept        47492..47785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0036"
FT                   /product="protein of unknown function DUF167"
FT                   /note="PFAM: protein of unknown function DUF167; KEGG:
FT                   drm:Dred_0717 protein of unknown function DUF167"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12508"
FT                   /db_xref="InterPro:IPR003746"
FT                   /db_xref="InterPro:IPR005228"
FT                   /db_xref="InterPro:IPR036591"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSB7"
FT                   /protein_id="ACF12508.1"
FT                   /translation="MISCSEKNGAVDFSVRLQPRASKNEIVGEYDGALKIRIAAPPVEN
FT                   AANKACIEFLAKTFGIAKSQVEILSGDTSRNKLIRIYGIDKTTLLAKFYSKS"
FT   gene            47804..47917
FT                   /locus_tag="Ctha_0037"
FT   CDS_pept        47804..47917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0037"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12509"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSB8"
FT                   /protein_id="ACF12509.1"
FT                   /translation="MQKYARVTLSGDEGGNKYRLRLRLARHILEFPSIINF"
FT   gene            complement(48062..50674)
FT                   /locus_tag="Ctha_0038"
FT   CDS_pept        complement(48062..50674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0038"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sru:SRU_0997 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12510"
FT                   /db_xref="GOA:B3QSB9"
FT                   /db_xref="InterPro:IPR018580"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSB9"
FT                   /protein_id="ACF12510.1"
FT                   /translation="MSKASAKATRNKKSAKSSAILGKKTLREPLQKDSSFIPEKYEDVL
FT                   ALGFLWVAIVFFFWPVLFGGKVFLVPDNTASLSISTFLEEAKKEGLFPLWIPYIFSGMP
FT                   SYGSLLATGDRSFDFLYVLWQGAIRLFVLPMSKEAGWIVLYYFIFGAGIYALLRQKSAT
FT                   AFQSLVGAFGGSFATLSVVWVTVGHNTKVVAVAMIPYALLFAERLRQKEGWKQFLLNSA
FT                   LLAMVLHVLVRSTHVQMIYYAVMAFGAYFLFELIATLSKKEPVQRWLQSAAGFLIAFLI
FT                   GVLMSADTYLSVMEYSSHSIRGAESITKTYPELAPESADSKPTSGTGLSYDYATNWSFA
FT                   PSEVITFFVPSYYGYGDQTYWGPQIFTHSPNFFGASILILAIVGLIYYRKEAFVQALAV
FT                   VGVLALLISFGKYFPLLFDPLFNHLPFFNKFRAPSMILVLLEISACVLAGYGLKAVFEV
FT                   RAADENESERVPFRFAAIGSSVLFLASVVGVSGCKTSYFEGLSKSDIGQQILARYGREV
FT                   PNVIAQFGQPIFEMMKTDLFISMMLAMFLLVGIFMFIERKVPAVVFQVGVMLLVIVDFW
FT                   RADARLLDGVKSAQEQQQYFQATDEVKFLQEKAESEKFRILPLVADRKSNWYAYFKLES
FT                   VGGYHAAKMQLYQDLIATVGGGSTEHPSFYNSPAMMDLLNLRYIILSRAAEIPGFTIVF
FT                   SGSKTILERNNWAPRAWFVKNVEQKSDKEIIEAIQSSSFNPRETAFLSSPAPEGIDAPS
FT                   AETNLKITNSGLHQLDLAVKTTGKHFLFLSEVFYPAGWKCLIDGNETEILRTNFAFRGV
FT                   IVPAGAHEVKFVFEPTSFAIGKYLALFSNIFLVLVLGFLAFDWVKNRGEKNKEAPTEK"
FT   gene            complement(50897..51775)
FT                   /locus_tag="Ctha_0039"
FT   CDS_pept        complement(50897..51775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0039"
FT                   /product="integrase domain protein SAM domain protein"
FT                   /note="PFAM: integrase family protein; integrase domain
FT                   protein SAM domain protein; KEGG: sru:SRU_0803
FT                   site-specific recombinase, phage integrase family"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12511"
FT                   /db_xref="GOA:B3QSC0"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR025269"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSC0"
FT                   /protein_id="ACF12511.1"
FT                   /translation="MHFSHSELEHEIQMFLSEYLKDKSEETCGTYQRALREFQRYYTVA
FT                   HSWFRFRTQDIEQYKLYLSQYKKLSQVSVSTYLTSIRRLLDYLVAKGKLATNPAKKVKG
FT                   NRRPTAHTAGTLSEAEAEKLLNVLATEKPQDHRDLITIRLMLECAASEHELVKANVMDF
FT                   QKSAGGYRLFVQGKGKKSKSEIVEMPAALGQEIERYLLRRENVTQSSPLLASHSRRVSN
FT                   QRMTTRAMRYRIKHWLEVAGVLRDNITANSLRHTAAKLWLERDKLSLEEIQRKMRHGMI
FT                   STTQIYAKNQG"
FT   gene            complement(51926..52480)
FT                   /locus_tag="Ctha_0040"
FT   CDS_pept        complement(51926..52480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0040"
FT                   /product="alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; Redoxin domain protein;
FT                   Thioredoxin domain; KEGG: cph:Cpha266_0050 redoxin domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12512"
FT                   /db_xref="GOA:B3QSC1"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSC1"
FT                   /protein_id="ACF12512.1"
FT                   /translation="MKQKKGIILLLALMIATGAFTAYTMNQPESTMNGQAIALKDDGKL
FT                   APNFDLETIDGKKLSLSDYKGKAVILNFWATWCPPCRAEIPDMIELQEEYGGENFTFIG
FT                   VAVGDQLERVKRFVENSGINYPVAMGNNAITDDYGRFIEGGMRGIPTTFVISTKGEILG
FT                   HFVGARSKEAFEAAIKDALKK"
FT   sig_peptide     complement(52406..52480)
FT                   /locus_tag="Ctha_0040"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.839 at
FT                   residue 25"
FT   gene            52875..54086
FT                   /locus_tag="Ctha_0041"
FT   CDS_pept        52875..54086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0041"
FT                   /product="phosphoserine phosphatase SerB"
FT                   /EC_number="3.1.3.3"
FT                   /note="KEGG: cph:Cpha266_0250 phosphoserine phosphatase;
FT                   TIGRFAM: phosphoserine phosphatase SerB; HAD-superfamily
FT                   hydrolase, subfamily IB (PSPase-like); PFAM: amino
FT                   acid-binding ACT domain protein; Haloacid dehalogenase
FT                   domain protein hydrolase; HAD-superfamily hydrolase
FT                   subfamily IB hypothetical 1; Haloacid dehalogenase domain
FT                   protein hydrolase type 3"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12513"
FT                   /db_xref="GOA:B3QSC2"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSC2"
FT                   /protein_id="ACF12513.1"
FT                   /translation="MREIILLSFTGEDKPGLSSSITEILAKYRIDILDIGQAVIHNALS
FT                   LGILAQVPKEFEASPVLKDILFRSHQLGIQVRFYPVEEATYENWVAQQGKPRYIITLLA
FT                   RKITAEHISKVTAIIAANNLNIDQISRLSGRIPLQETYTQTRACIELFVRGEPIDKNKM
FT                   RASFLDITDELGVDIAFQEDDIFRRFRRLVGFDMDSTLIEVEVIDELAKAAGVGDKVSA
FT                   ITEKAMRGEIDFTESFRRRVGLLEGLDESVLAGIAERLPITEGAERLFAILKTLGFKTA
FT                   ILSGGFTYFARHLQKRLGIDYIYANELEIENGKVTGKVTGQVVDGKRKAELLQEIAKKE
FT                   GIRMEQVIAVGDGANDLPMLSVAGLGIAFRAKPIVKESAEHSISTLGLDGILYLLGFRD
FT                   REVA"
FT   gene            complement(54191..56380)
FT                   /locus_tag="Ctha_0042"
FT   CDS_pept        complement(54191..56380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0042"
FT                   /product="glutamine synthetase catalytic region"
FT                   /note="PFAM: glutamine synthetase catalytic region; KEGG:
FT                   pvi:Cvib_1230 glutamine synthetase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12514"
FT                   /db_xref="GOA:B3QSC3"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR022147"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR040577"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSC3"
FT                   /protein_id="ACF12514.1"
FT                   /translation="MATTSPKDSAPKVNGNAPVHDKSIASTFGSMTFNMDVMREKLPKE
FT                   VFYSLKKTIEAGEALAPEIAGVVAHAMKEWALDHGATHYCHWFQPMTGATAEKHDAFIS
FT                   IDKDGSVIERFSGDQLIQGEPDASSFPSGGMRTTFEARGYTAWDPTSPAFLMKTPSGTT
FT                   LSIPTVFISYNGEALDEKTPMYRSIKALSDASVRLLGLMGRTDVKKVTTYLGAEQEYFL
FT                   VDKSLYEQRPDLVMSGRTLFGQLPPKGQQLEDHYFGSIPDRALDFMEEVEKELYLLGIP
FT                   AKTRHNEVAPHQFEIAPIFRETNISADHNLLVMEIMEKVADRKGLALLLHEKPFAGING
FT                   SGKHNNWSIASVDGENFLEPGKTPESNLSFLLFLVSILKGIRKRGGLVRAGVASVGNDH
FT                   RLGANEAPPAVMTVFLGHELTRILDEIENGSVTKASEKQFLNLGLSHLPVLSKDSTDRN
FT                   RTSPFAFTGNKFEFRAVPSSMQIAIPNTVLNTVMAEAINEVADALKAELDGGKALDAAV
FT                   LEVVRKAIKETKGVRFEGDNYSEELQEYARKNNLPNLKNTPDALDMLLDESNRSVFTSL
FT                   GVLSEDEITSRYNIRIEQYIKAIDIEVRTMILMVNSMIIPACVKYQGTLGHAYGSIAHL
FT                   SKDLGLAEDVLKEQAAHLKAIAEDISLLMKRTATLEAKLEEMETKDGETAKAKFCAYEV
FT                   LPTSLAVREVVDRLEGQVDGSIWPMPKYIDLLFKY"
FT   gene            complement(56451..56969)
FT                   /locus_tag="Ctha_0043"
FT   CDS_pept        complement(56451..56969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0043"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="PFAM: regulatory protein AsnC/Lrp family; regulatory
FT                   protein Crp; regulatory protein ArsR; KEGG: plt:Plut_1414
FT                   putative transcriptional regulator, AsnC family"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12515"
FT                   /db_xref="GOA:B3QSC4"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSC4"
FT                   /protein_id="ACF12515.1"
FT                   /translation="MTWHIDKIDLKLLDLLNEQGRIRRNELAEAVGLSIPSVSERLEKL
FT                   EKRGVITGYTVLIDEKKLGFDITSYIRVRMESSKHYPALSKHVQKEDEILECYTVTGEG
FT                   SHLLKVKTQNTSSLEKLLARIQSWPGVIGTETSFVLSTLKHSFNVPAEKAFKDIEKIRF
FT                   EESTTTKRL"
FT   gene            57360..57635
FT                   /locus_tag="Ctha_0044"
FT   CDS_pept        57360..57635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0044"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lma:LmjF35.0290 hypothetical protein,
FT                   conserved"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12516"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSC5"
FT                   /protein_id="ACF12516.1"
FT                   /translation="MAEPLKRPTPTAKVAPKEAPNAPAAPAAPAEPKAAASAAAPSQGN
FT                   FVSDRANFDQMSAIEHAEFVIKTVLSVPVATLNMARDSFKRLTNQI"
FT   gene            57817..58239
FT                   /locus_tag="Ctha_0045"
FT   CDS_pept        57817..58239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0045"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12517"
FT                   /db_xref="GOA:B3QSC6"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSC6"
FT                   /protein_id="ACF12517.1"
FT                   /translation="MQQAAYIKKQTHKILGASPAMTVGVLFLFVSLLSFSAFHFHPLQG
FT                   RHSTCAFSFNDEHGNGQNDKPENHCPICQFKAALSQTTVPALFALEAPLNISYSIYCEF
FT                   ESSVFSLRRIRPRLRAPPTPFRLHISSASLLIRKDA"
FT   gene            58353..59312
FT                   /locus_tag="Ctha_0046"
FT   CDS_pept        58353..59312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0046"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12518"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSC7"
FT                   /protein_id="ACF12518.1"
FT                   /translation="MNFKSRFHIKFLVFALVSALFFTTACDDDDDGMSPNSEHFEANGV
FT                   YISDGGVKVFDYFGPNLPNRDVVLGPIEINAGDNGHWDVNFYNESEQVVEGPINESDKF
FT                   LVIEIKDTSVVEVWDAHNEVKQTLKTTEGWTQYQFNTGVYGVHIKGLKPNEETRMKIKV
FT                   YHIDHNDFTSPEIKVRVRNQVGTNLVKLFEGTTKRTHAYLNDASVNSYYSSTFGDTLNL
FT                   NTGESKSLEAKFFQATMVEKQAGYEITEGDQFTPSVPLHSLNVITNNDVIASIDQENMD
FT                   TWEFKLTGESAGTCTITVQIYHDGHLGKAFHSIPVKIQ"
FT   sig_peptide     58353..58430
FT                   /locus_tag="Ctha_0046"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.999 at
FT                   residue 26"
FT   gene            59317..59643
FT                   /pseudo
FT                   /locus_tag="Ctha_0047"
FT   gene            59645..61552
FT                   /locus_tag="Ctha_0048"
FT   CDS_pept        59645..61552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0048"
FT                   /product="TonB-dependent receptor"
FT                   /note="PFAM: TonB-dependent receptor; TonB-dependent
FT                   receptor plug; KEGG: nar:Saro_0754 TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12519"
FT                   /db_xref="GOA:B3QSC8"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSC8"
FT                   /protein_id="ACF12519.1"
FT                   /translation="MLEPKVFTSDPIIVTSKHTHNKFEEITEKSSVLEGQALQKELSQS
FT                   LAATLKNETGLAMRSMGPAPSRPVIRGLGSDRVLISEDGNRTTDLSSTSPDHAVTVDPF
FT                   TIERLEVIRGPKVLLQSPTTIGGVINAVRHEIPQELRETVSGTLGAYGETANSGYLTAA
FT                   TLEVPLNPFMIRGEISRRKTGDISTPIGTLGNSESENLNYSVGGSYIWDYGFVGASMRD
FT                   FNLDYGIPGGFVGAHPNGVSIEMQKQVRNVKSRINLNMERLENIEIHLTNSYYRHKELE
FT                   SNNSVGADFRIRNNYGFVNLNHLALGFLEKGTVGFWMDSRDFDIGGNVFTPSSKSLHLA
FT                   GYVYESFTLNRVNLEFAARYNFDNIRPDAEDPDSRIGNIRERTFHTYSLSFSALYQLTE
FT                   TFSFGGNLSKSSRVPTIEELYSEGPHLAAYSYEVGNPDLDAESGVGSELFMYYKSASVY
FT                   VLGTAFLNYLSSYIIPRNTGETNWRLILPVYQTYGVDALFFGSEFDLEWYLSPKWTFQT
FT                   SASYTNGSFASSGKPLPWIPPLKGKVGISYSNAPITLNLNTEWAANQYRVDEFEDPTDG
FT                   YAILNASALYALTLGKQVHHFSLSADNIFDTEYRNHLSRVKSIMPEAGRNFRFTYKMFF
FT                   "
FT   gene            61814..62803
FT                   /locus_tag="Ctha_0049"
FT   CDS_pept        61814..62803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0049"
FT                   /product="UDP-glucose 4-epimerase"
FT                   /note="TIGRFAM: UDP-glucose 4-epimerase; PFAM:
FT                   NAD-dependent epimerase/dehydratase; 3-beta hydroxysteroid
FT                   dehydrogenase/isomerase; polysaccharide biosynthesis
FT                   protein CapD; dTDP-4-dehydrorhamnose reductase; Male
FT                   sterility domain; KEGG: syp:SYNPCC7002_A1715 UDP-glucose
FT                   4-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12520"
FT                   /db_xref="GOA:B3QSC9"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR005886"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSC9"
FT                   /protein_id="ACF12520.1"
FT                   /translation="MTVLITGGAGYIGSHAVRRLKQAGYKTLVLDNLVYGHSEFVEADE
FT                   LIIGDLENTKLLNQVFSKHKIQAVMHFAAYAYVGESVQNPAKYYRNNVASTLNLLDAML
FT                   AYKVKKFIFSSTCATYGEPDEIPITETHPQRPINPYGQSKLMVEKILDDYDHAYDLRSV
FT                   RLRYFNAAGADPDGGIGEDHDPETHLIPLVLDAALERRAHISMFGTDYDTPDGTCVRDY
FT                   IHVTDLAEAHVLGLKYLENGGKTDFFNLGNGNGFSVKEVIETARKITGKEIPAKIAPRR
FT                   PGDPASLVGSSEKIKSALGWKPQFPDLPAIIETAWQWHKTRFGRTAQT"
FT   gene            62838..63272
FT                   /locus_tag="Ctha_0050"
FT   CDS_pept        62838..63272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0050"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cte:CT1673 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12521"
FT                   /db_xref="InterPro:IPR028090"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSD0"
FT                   /protein_id="ACF12521.1"
FT                   /translation="MQIPARKLEIVKEHAIQSFPEECCGLLAGKVELSHDGFYENVIYE
FT                   VAPCRNVLTWDRQFGFEISWPEICEVESEARSMGYEILGSYHSHTNAEAVPSNHDYENS
FT                   TPNHSMLILSVKGNLVLQTRCWTRQNGNYFHEERIHVRRW"
FT   gene            63367..64311
FT                   /locus_tag="Ctha_0051"
FT   CDS_pept        63367..64311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0051"
FT                   /product="cysteine synthase"
FT                   /note="TIGRFAM: cysteine synthase; PFAM:
FT                   Pyridoxal-5'-phosphate-dependent protein beta subunit;
FT                   KEGG: cyb:CYB_2315 putative cysteine synthase B"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12522"
FT                   /db_xref="GOA:B3QSD1"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSD1"
FT                   /protein_id="ACF12522.1"
FT                   /translation="MLVTHQAVVEKHIFSLIGNTPLIRIKKLAREWGINDNVEVYGKAE
FT                   WMNPGGSVKDRAALNIIETAEARGDLTHDKILLDATSGNTGIAYAMICAVKGYRVTLCL
FT                   PESASKERKEILQAYGATLVETPASESSDGAILKAIEMYKNNPDLYYYADQYSNDANWQ
FT                   AHYHSTGIEIYEQTHGKITHFVTAIGTSGTFVGTTRRLKTYNPDIKCIAAQPDVAVHGI
FT                   EGIKHLESAMVPKIYDPALSDRLLEISTETAYEYARKLARVEGLLVGISAAANLFATLT
FT                   IAKEVSDSGKNGVIVTVLCDNGMKYLSEPFWIQ"
FT   gene            64419..64784
FT                   /locus_tag="Ctha_0052"
FT   CDS_pept        64419..64784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0052"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12523"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSD2"
FT                   /protein_id="ACF12523.1"
FT                   /translation="MRVNIKITSPKEFHFKNGAPEVDATVIKTTELMSQKAGSLAHAIL
FT                   TEISPALALRTVSGNLLLLLPETNQGMNQMIKGHAIWAKVFLIPFGTKEGAGFYEDEKL
FT                   TLLGRAMVAVVKSKELL"
FT   gene            64781..65209
FT                   /locus_tag="Ctha_0053"
FT   CDS_pept        64781..65209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0053"
FT                   /product="Mov34/MPN/PAD-1 family protein"
FT                   /note="SMART: Mov34/MPN/PAD-1 family protein; KEGG:
FT                   rxy:Rxyl_0745 Mov34/MPN/PAD-1"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12524"
FT                   /db_xref="InterPro:IPR000555"
FT                   /db_xref="InterPro:IPR028090"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSD3"
FT                   /protein_id="ACF12524.1"
FT                   /translation="MIIKENLHTLLLGQAETAYPEETGGLLLGKIVDGALIVEMVLPLI
FT                   NIREESRHNRIELDPMDYAKAERTAMKHGLGVWGFYHTHPDADAIPSEYDRQHFPFTEW
FT                   WYPILSVRKGIFSEMKCWQLTDSRKDFTECIIKIVTDS"
FT   gene            65426..65959
FT                   /locus_tag="Ctha_0054"
FT   CDS_pept        65426..65959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0054"
FT                   /product="Dinitrogenase iron-molybdenum cofactor
FT                   biosynthesis protein"
FT                   /note="PFAM: Dinitrogenase iron-molybdenum cofactor
FT                   biosynthesis protein; KEGG: mgm:Mmc1_1941 nitrogen
FT                   fixation-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12525"
FT                   /db_xref="InterPro:IPR003731"
FT                   /db_xref="InterPro:IPR036105"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSD4"
FT                   /protein_id="ACF12525.1"
FT                   /translation="MLIAVASQNRKEITGHTGRCHRFWIYEMVDGKIQQKEFLELSKEQ
FT                   SFHYASVHEAHELDRVDVLICGGLGQGLVQKLARKNITVISTMEKDIEKAIADYLSGSL
FT                   SQLSPEEHDHDDDHDHDHHHDSNETTFVQLSAGLNAFDADGNAPDKEGNCHHQSGCNHD
FT                   DHHGEKSHGGSCHH"
FT   gene            complement(66017..67090)
FT                   /locus_tag="Ctha_0055"
FT   CDS_pept        complement(66017..67090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0055"
FT                   /product="recA protein"
FT                   /EC_number="3.6.3.8"
FT                   /note="KEGG: cte:CT1930 RecA protein; TIGRFAM: recA
FT                   protein; PFAM: RecA domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12526"
FT                   /db_xref="GOA:B3QSD5"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013765"
FT                   /db_xref="InterPro:IPR020584"
FT                   /db_xref="InterPro:IPR020587"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR023400"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3QSD5"
FT                   /protein_id="ACF12526.1"
FT                   /translation="MAKEKASSQEQEQKVKDEKLKQLNLAVESLEKQFGKGAIMRLGDD
FT                   AVVQVPVVSTGSISLDYALGVGGLPKGRIVEIYGPESSGKTTLALHAIAEAQKAGGIAA
FT                   FVDAEHAFDQSYARKLGIDIKSLLISQPESGEQALSITETLVRSGAVDIIVVDSVAALV
FT                   PQAELEGEMGDSQMGLQARLMSQALRKLTGAISKSNCVAIFINQLRDKIGVMYGSPETT
FT                   TGGKALKFYASVRLDIRKIAQIKDGTEIVGNRTKVKVVKNKVAPPFKTVEFDIIYGEGV
FT                   SRIGELIDLAVELGIVKKAGAWFSYENDKLGQGRETVKTLLKADEALFNKIYAQVKEQM
FT                   VGLKLEGSSDDDSSSDS"
FT   gene            complement(67181..67783)
FT                   /locus_tag="Ctha_0056"
FT   CDS_pept        complement(67181..67783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0056"
FT                   /product="alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; Redoxin domain protein; KEGG:
FT                   rba:RB9164 conserved hypothetical protein-putative
FT                   thiol-disulfide isomerase or thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12527"
FT                   /db_xref="GOA:B3QSD6"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSD6"
FT                   /protein_id="ACF12527.1"
FT                   /translation="MNRQVLQKWIFPVILLVIFSFVSLAAAAQISLQPGDKAPDFSIPD
FT                   HDGESYRLSKRKGKVGFVIVFLSTECPVSNAYNFRLIKLAKYAKENNLDFIGINSNQTE
FT                   SFEEVYTHAKAKSLNFPVLKDEENKVADMYGASVTPEAFLIDKNLIVQYHGPIDDNQRE
FT                   ERVTEPYLHDAIEQLLNGKHISPDNVKPRGCIIKRFR"
FT   sig_peptide     complement(67706..67783)
FT                   /locus_tag="Ctha_0056"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.527 at
FT                   residue 26"
FT   gene            complement(67805..68830)
FT                   /locus_tag="Ctha_0057"
FT   CDS_pept        complement(67805..68830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0057"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; polysaccharide
FT                   biosynthesis protein CapD; NmrA family protein; Male
FT                   sterility domain; KEGG: cph:Cpha266_2290 NAD-dependent
FT                   epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12528"
FT                   /db_xref="GOA:B3QSD7"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSD7"
FT                   /protein_id="ACF12528.1"
FT                   /translation="MPDIKILVTGATGYIGSALVLAIHRKYGKQVQIKALVRKNSPRHV
FT                   LKGVPVEFIDGDVTVPLSLWEATKNVDVVFHTAALVSYQQRDRRKLYKINVLGTRHLVD
FT                   ACLRNQVKKLIHTSSVAAVGVIESGALNPESQAFEPWQHRYGYMAAKYLSELEVLRGTF
FT                   EGLHTVMVNPGAVMGSYPGSLYPVNSASSFIEDIYKGLIPFYPTGGVGFVDISDVVTAH
FT                   LLAWERGENGERYNIVSENLTYKALFDLTTRVPGSRSRTAEPLNKWFGRVLGMGTEVMA
FT                   SVMRRTSTVTFDGVRLAELALYFDNSKSKQALGLKYRPFVETVLDLLRASQATKPFLHK
FT                   A"
FT   gene            complement(68830..69339)
FT                   /locus_tag="Ctha_0058"
FT   CDS_pept        complement(68830..69339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0058"
FT                   /product="biotin/lipoyl attachment domain-containing
FT                   protein"
FT                   /note="PFAM: biotin/lipoyl attachment domain-containing
FT                   protein; KEGG: sru:SRU_0828 pyruvate carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12529"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSD8"
FT                   /protein_id="ACF12529.1"
FT                   /translation="MKYKAMVGQAAKYDIELENAAQEEVSLKIDGEEKTVRMMPLGGDL
FT                   HKVVYENQVFTIRLLQSEGTFTVKFEGNETEVTLVDETQLLIERLGIKIENKKASGDLK
FT                   SPMPGLVVKLHVSVGDPVEKGQGLLVLEAMKMQNEIKSAVSGTVTEILVSERQPVEKNQ
FT                   LLLKIA"
FT   gene            complement(69520..70080)
FT                   /locus_tag="Ctha_0059"
FT   CDS_pept        complement(69520..70080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0059"
FT                   /product="co-chaperone Hsc20"
FT                   /note="TIGRFAM: co-chaperone Hsc20; PFAM: heat shock
FT                   protein DnaJ domain protein; KEGG: aba:Acid345_0481 heat
FT                   shock protein DnaJ-like"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12530"
FT                   /db_xref="GOA:B3QSD9"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR004640"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSD9"
FT                   /protein_id="ACF12530.1"
FT                   /translation="MQERNYFELFGIKEKLNLDMKELQQRFYDLSRQVHPDYHQTSVQK
FT                   DLSLDLSSSLNHAFATLKDRDKRLIYVIERYLGPLQDQKGKKNAPAEMLMELMEMQEKL
FT                   MEYQSEPTEELHQHLNEMIAHLGKEKENFNKEIDALAEKFDQETAPEKKVELITAIRDI
FT                   LLKKNYIRSSLRTILNTLNPDEL"
FT   gene            70222..71511
FT                   /locus_tag="Ctha_0060"
FT   CDS_pept        70222..71511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0060"
FT                   /product="processing peptidase"
FT                   /EC_number="3.4.24.64"
FT                   /note="PFAM: peptidase M16 domain protein; KEGG: cte:CT1932
FT                   peptidase, M16 family"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12531"
FT                   /db_xref="GOA:B3QSE0"
FT                   /db_xref="InterPro:IPR001431"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSE0"
FT                   /protein_id="ACF12531.1"
FT                   /translation="MELRREESGEAQNSAASCVQKTVLPNGLTVITEHVPGVRSLSVGL
FT                   WTNTGSRDETPENNGAAHFIEHMVFKGTSKRDYIQISKSLESVGGYLNAFTTKEHTCFY
FT                   ARSLAEHLKITIDVLTDLVFRPTFPEEELEKEKDVIIEEIKSTEDTPDDLIFDDFDKFL
FT                   FESHPLGLPIAGTEESVDALTRNDTIAFLKACYRPEKMLLVGTGNLTHDALLNFAECFV
FT                   PKRKTKPKSVRQTYDFGQYQPFTKEIAKPIQQAHILIGAPYIRDDKNYFSAILLNTLLG
FT                   GGMSSRLNLSLREKHGLVYSVFSSISTFDEINTFSIYAGTDKDKVKKTVALIHEELGQL
FT                   LGKNVPKRELDLAKAQLKGAVIMGQESVSKRQSHLARDHYYFGRDFSFDELIEMVESVS
FT                   AKDIRSVAEQMLDASKFSTLIYQPKRRGKA"
FT   gene            71657..72571
FT                   /locus_tag="Ctha_0061"
FT   CDS_pept        71657..72571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0061"
FT                   /product="heat shock protein DnaJ domain protein"
FT                   /note="PFAM: heat shock protein DnaJ domain protein;
FT                   chaperone DnaJ domain protein; KEGG: fjo:Fjoh_2374
FT                   chaperone DnaJ domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12532"
FT                   /db_xref="GOA:B3QSE1"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSE1"
FT                   /protein_id="ACF12532.1"
FT                   /translation="MNRNYYDILGVQKSATEEEIKKAYRKLAVKYHPDKNAGNKEAEEN
FT                   FKAVNEAYEVLSDPEKRKMYDRFGKDWKHYKEAGPQARDFDRSQFSGKRRQNAYSNAGH
FT                   EEFFSGDGGESFFDSFFGSGFGGRGRKAQAFRGQDITAEINITLKDAYNGTEQLFKVGS
FT                   QTIKLKIKPGIKDKEVLRLAGQGAPSPNSGQKGDLLLTVNILPDDTFERKGNDLHCQIP
FT                   VDLYTAILGGKVNVKTFKGTVKLDIPKESDNGMKLRLGGLGMPDYDLQGKYGDLIATVS
FT                   VQLPQRLTKKEIALFKELAALRQ"
FT   gene            complement(72680..73231)
FT                   /locus_tag="Ctha_0062"
FT   CDS_pept        complement(72680..73231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0062"
FT                   /product="NADH-quinone oxidoreductase, chain I"
FT                   /note="TIGRFAM: NADH-quinone oxidoreductase, chain I; PFAM:
FT                   4Fe-4S ferredoxin iron-sulfur binding domain protein; KEGG:
FT                   sru:SRU_0496 NADH dehydrogenase I, I subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12533"
FT                   /db_xref="GOA:B3QSE2"
FT                   /db_xref="InterPro:IPR010226"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3QSE2"
FT                   /protein_id="ACF12533.1"
FT                   /translation="MHEKNPKFKPTRLNFLERLYLPEVLKGLGYTFRQIFAPIFTTEYP
FT                   DVKWQPPAVFRGRPVLVERDDKTGERCVACGLCSRVCPPMAISIQAEETELEQERHPAT
FT                   FEINMLRCIYCGYCEEVCPEEAIVMSDEYDITFNNRENAIMDKSKLLVPVARVQKRLDF
FT                   LKEYKNKVRRPEEQVSNLEV"
FT   gene            73622..76954
FT                   /locus_tag="Ctha_0063"
FT   CDS_pept        73622..76954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0063"
FT                   /product="transcription-repair coupling factor"
FT                   /note="KEGG: cte:CT0653 transcription-repair coupling
FT                   factor; TIGRFAM: transcription-repair coupling factor;
FT                   PFAM: helicase domain protein; transcription factor CarD;
FT                   TRCF domain protein; type III restriction protein res
FT                   subunit; DEAD/DEAH box helicase domain protein; SMART:
FT                   DEAD-like helicases"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12534"
FT                   /db_xref="GOA:B3QSE3"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR004576"
FT                   /db_xref="InterPro:IPR005118"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR037235"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSE3"
FT                   /protein_id="ACF12534.1"
FT                   /translation="MKNTDAAQEAVSVEIEGFSLPSFRQRISESATTRLLVQKCEENAP
FT                   SVSAQGVYGSLAAILTALMFETLRRPVLLVCNEERVDLFENDLRQLASAKDVCDFVSEP
FT                   SLTLATLVADPQKITVASTLELQKKVLPKKEALEKQVRLSENEPFGYETLIRFLQENGF
FT                   DQKDFVESEGDFSVRGSVVDVFSFGAASPVRIEFFGDEPESIRFFDINSQLSKENISSV
FT                   SIVSNLVAAEDAESECVSLLDYLPANTLVVLDGYDTLRFEDSDAGVLEESEIRADLETF
FT                   QQVRFHLLSPAEIDFASAVIPKFNSNFAHFSQHVRQAVANEYDILVATKSKKELQELVE
FT                   FISVAPFEAFESDSQNAPAPEEIILRSLHQNLYEGFQFENTVLYTESDVFGKLHSHKQH
FT                   RRRKHRKISLRELRALKVGDYIVHEDYGIGVFMGMEKTKVGGSEQECVLVEYDKGDKLF
FT                   VNIQNLHLLSKYSSAEGKVPTLSKLGSNKWQANKEKIKKRLKDIARNLIAIYAKRKMTK
FT                   GFACKQDSVWQREFEAAFIFDETPDQMSAIESIKADMEAVAPMDRLICGDAGFGKTEVA
FT                   MRAAFKAVESGKQVAVLVPTTILAHQHFNTFKLRFQNFPMRVEVLSRFVPKKSQKAVIA
FT                   EIGEGKVDIVVGTHRIVSKDVKFTDLGLLIIDEEQHFGVAAKEKLREDFPSVDTLVLSA
FT                   TPIPRTLQFSMMGARDLSIISTPPKNRQPVETVIHEFDAEMIKQAIGREIGRGGQVFFL
FT                   HNRINSISEMYELVKKLFPRARVGVAHGQMPTKELEAVMLDFIQKELDVLVSTAIVGSG
FT                   LDISNANTMIINRADMFGLSDLYQLRGRVGRSDKKAYAYLFTPPLSTLKQDALQRLAVI
FT                   EAYTELGSGFSVAMRDLDIRGAGNLLGAEQSGFIFDLGFDVYQKILEEAVSELKSTEFQ
FT                   NIFAESERLKLQPKKPCEVIFFFDALIPAYYVESASERFALYEKLSKANTYEALGKLAA
FT                   ELNDRFGKMPEECQSLFDVGVLRILGTELELQRLEISETKTAVFLPEGENKAFYEGKKF
FT                   EVILASVQSDWLAKFNPQFSNEKKLKIILSFAENMKKRPQKALNEIIDVMKKMKALVEE
FT                   QEG"
FT   gene            complement(77102..77566)
FT                   /locus_tag="Ctha_0064"
FT   CDS_pept        complement(77102..77566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0064"
FT                   /product="iojap-like protein"
FT                   /note="TIGRFAM: iojap-like protein; PFAM: Iojap-related
FT                   protein; KEGG: cte:CT0140 iojap-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12535"
FT                   /db_xref="GOA:B3QSE4"
FT                   /db_xref="InterPro:IPR004394"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSE4"
FT                   /protein_id="ACF12535.1"
FT                   /translation="MEIKTSLRKESHFNAAPTGQFIHAVATSSSQPSAHLSSEAELLAR
FT                   RAAELAFSKKGYDVVIMDLRKVAEMTDFFVICTADSDTQVKAVADAIIEGLHEDGEKPY
FT                   HVEGTHELSWVLIDYVDVVIHVFLKETRSFYSLEKLWGDAEFERIKDPVL"
FT   gene            complement(77691..78401)
FT                   /locus_tag="Ctha_0065"
FT   CDS_pept        complement(77691..78401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0065"
FT                   /product="peptidase M22 glycoprotease"
FT                   /note="PFAM: peptidase M22 glycoprotease; KEGG:
FT                   cph:Cpha266_2665 peptidase M22, glycoprotease"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12536"
FT                   /db_xref="GOA:B3QSE5"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSE5"
FT                   /protein_id="ACF12536.1"
FT                   /translation="MKILAIECTAAPLSIAVKNHEPVSLRFSSEWRKTAEQILPLISET
FT                   LNDAGVLAADLDAVALSAGPGSFTALRIGMSCVKGLCFGLNVPLIMIPTLQAIAEAALS
FT                   KTQAPIILPVVHSKADEFYSAVAVRTEWETSANSEFSLQNDYGILDELMQSVAQKESSA
FT                   EIAIVGRNLSRFTENMQPSEQFSFLEADFFNAAALLPIAERLFHAKAFAPINDAVPLYL
FT                   KEFEAKVSKKTPFV"
FT   gene            complement(78436..78879)
FT                   /locus_tag="Ctha_0066"
FT   CDS_pept        complement(78436..78879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0066"
FT                   /product="protein of unknown function UPF0079"
FT                   /note="PFAM: protein of unknown function UPF0079; KEGG:
FT                   cch:Cag_1987 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12537"
FT                   /db_xref="GOA:B3QSE6"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSE6"
FT                   /protein_id="ACF12537.1"
FT                   /translation="MKEFLSRSAEETRGRAREFAETLQRGDIVLLVGTLGAGKTEFVRG
FT                   ICDVFHCTASVSSPTFTLLNIYEGVSKGSAISLYHFDLYRIESETELPAIGFDEYLFGD
FT                   GVSIVEWADRFPRFFPKQAITVQIEPCGENERRVVISGGKSRF"
FT   gene            complement(78966..79553)
FT                   /locus_tag="Ctha_0067"
FT   CDS_pept        complement(78966..79553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0067"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12538"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSE7"
FT                   /protein_id="ACF12538.1"
FT                   /translation="MKCLLFTACRLIFCASLLFGQNPEKSLQLLEKANLVTIPALNNTS
FT                   EDAKAVLRLPSTLFLTLSQIASEGSMTSKSALENSLFNTFESNMIFLKGVFRGKNALQA
FT                   GGFELMINRDGRSGKTLIYEDTLFAKPRFFLRWRHTGSATEYLLRKFIQRKRLEETALL
FT                   HSDGSGSYERKRCSRILEKFRWNKSGELEKSE"
FT   sig_peptide     complement(79491..79553)
FT                   /locus_tag="Ctha_0067"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.868) with cleavage site probability 0.866 at
FT                   residue 21"
FT   gene            79601..81391
FT                   /locus_tag="Ctha_0068"
FT   CDS_pept        79601..81391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0068"
FT                   /product="N-acetylmuramoyl-L-alanine amidase"
FT                   /EC_number="3.5.1.28"
FT                   /note="PFAM: cell wall hydrolase/autolysin; KEGG:
FT                   cph:Cpha266_0110 N-acetylmuramoyl-L-alanine amidase"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12539"
FT                   /db_xref="GOA:B3QSE8"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSE8"
FT                   /protein_id="ACF12539.1"
FT                   /translation="MVFHQRSLKNKIAAHAQPAFAEGVFSTGDCDKKQHNLALLTLFLF
FT                   LTLLLLLPQNALAGETISVSVTLENKQVYTKKIALYSVGNLKMVAVSELCDALRLSNTQ
FT                   SLADLVVTAKPESQREFCTFRPLNHFAVIRSMEGSKPAHVLQLGVAPAMIGGTIYLPPA
FT                   QVARLFSSWQGLKFEYNLVTKIFTADFSQKLSASIAKSPTPPSLSEKDEKESLTLDEQD
FT                   KVDTRFTIPKFSIDEKANGAIIRIYCTRPEVEYEFIRPNKNGVAYLTFRNAVGDIKNLT
FT                   QTFSTGLLKEVTAFALRSGGLQLTLNFNTKRYKIKSTECKRDEKSDDFLVHVLSDVDVS
FT                   EIYKTEKEKEIKALLQEDRERWKLDVIALDAGHGGKDPGAIGYSGTYEKNVVLGVVMEL
FT                   GKLINQYWPDVKVVYTRKTDDFIELDERGRIANQQNAKLFVSVHCNASRNQRVSGVEVY
FT                   MLGLHKTDAALRVAERENAVILQEDDYKDRYKDFTDENLIMITMAQSAFSYQSQKLADL
FT                   INRNIQERTKQAGRGVKQAGFMVLWTPSMPSVLVEAGYITNPREERFLKSKEGQLRVAR
FT                   AIFEGLKKYRSDYEAQLKAR"
FT   gene            81609..83069
FT                   /locus_tag="Ctha_0069"
FT   CDS_pept        81609..83069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0069"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: atc:AGR_L_863gl hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12540"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSE9"
FT                   /protein_id="ACF12540.1"
FT                   /translation="MTPFNSHPPNRLTKTLDAISNAVDWDKVLKFLDEHSVEDSIVKLP
FT                   PEKLLRNMKFVFLQHIYDLADYDLIELINDRISFKIFFGLEPDDDFEDDEASAAFRELL
FT                   LEKRLYTPLINFIWASLEISGFSIEKGVIMDARIRDTETPAPKPPDTPHEPAKHPSPEL
FT                   HISYDTVQKMIRGEIAQPFETYALQMQLHQAQKDVRSGALSLDEATENLYKLCALVLTK
FT                   KKPAEKSPTPPASPAPKTTTPHALPQKVNHDLLRKLILGEVHYHFKHYALQMQLHQSQK
FT                   EVRNGVISLDEATDNLYELCKRLLTKQLPAHKPQVEHALPPAKEPPATFKINREILEKM
FT                   IRGELNQNFKHYALQMQLHQAKKEVGSGSCSIDEAVEKLYDLCKHVLVHKPYDELTHET
FT                   HDTHETHPLPQHRKLPDINRVEWKKLVTGELEHQFRNYVLQVQLHQTKKEVRSGKLSVE
FT                   RAVQNLYNLCLRVPLAVQTDFKQIFKEW"
FT   gene            83073..84065
FT                   /locus_tag="Ctha_0070"
FT   CDS_pept        83073..84065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0070"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pna:Pnap_3015 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12541"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSF0"
FT                   /protein_id="ACF12541.1"
FT                   /translation="MQKKLYTLAEVTEFILQGAKLVISADESLLDQLPAGNWIGGTIPY
FT                   FMTEQGGSFSKDKLFVDDLSAYGLEVSFKAYDETDIQTITKSSFENGFTILILPAGSKV
FT                   HESFSLNSMSYKDIFFKPITGYVSGFDLNLLGSATAKTYLGKAQMKYEDKGVAMHVKLP
FT                   DDQFAKIEIFNLMEIDESSDVITFPETGFLQKSCMVNGKATNLAEYLSNLNYAAGLPLI
FT                   ANCQGALINRSIEKLDMDNKTVLFYAPVFSDEVYRLAKPVTNYHEEFQKRIEIYADENV
FT                   IYSVLCVVYYMVGELENKKLPVSGSFTFGEVGYQLLNQTLVYLTLSNSH"
FT   gene            complement(84283..85170)
FT                   /locus_tag="Ctha_0071"
FT   CDS_pept        complement(84283..85170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0071"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG: pth:PTH_0928
FT                   uncharacterized Fe-S protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12542"
FT                   /db_xref="GOA:B3QSF1"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR016431"
FT                   /db_xref="InterPro:IPR040085"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSF1"
FT                   /protein_id="ACF12542.1"
FT                   /translation="MLHTGQLEKRVYKAYAHLKRCDLCANYCGVDRLVSTLGAVCHTGR
FT                   QAKVFTYGAHHGEENPLRGWNGSGTIFFSWCNLQCEFCQNWEISHKGIGEEASPERLAE
FT                   MMLELQAQGCHNINFVSPSHVVAQIIEAVFIAAKKGLRLPLVYNTGGYDSLEALKMLKD
FT                   IIDIYMPDVKFADSMTAQRLTHVKSYVEVNRAAVLEMHRQVGDLVLDSYGVAQRGLLLR
FT                   HLVMPGKLVETERVLFFVANSISTNTYVNLMDQYHPCYRTDEFQGVDKRLPEKDFRDAV
FT                   LLARHFGLSRLDRT"
FT   gene            complement(85311..85805)
FT                   /locus_tag="Ctha_0072"
FT   CDS_pept        complement(85311..85805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0072"
FT                   /product="PEBP family protein"
FT                   /note="PFAM: PEBP family protein; KEGG: eba:ebA6371
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12543"
FT                   /db_xref="InterPro:IPR005247"
FT                   /db_xref="InterPro:IPR008914"
FT                   /db_xref="InterPro:IPR036610"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSF2"
FT                   /protein_id="ACF12543.1"
FT                   /translation="MMALLMTFILTSSAFSNGGEIPQAYTCEGRNVSPPLAWQHVPENA
FT                   KSLVLIVDDPDAPDPKAPKMTYVHWVLYNIPPTVKSFPQNGAAMALPEGTREGLNDYKR
FT                   TGYGGPCPPIGRHRYFHKLYALDVVLPDLGNPTKAALEKAMDGHILAKAELIGTYEKKK
FT                   K"
FT   sig_peptide     complement(85749..85805)
FT                   /locus_tag="Ctha_0072"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.967) with cleavage site probability 0.870 at
FT                   residue 19"
FT   gene            complement(85809..86375)
FT                   /locus_tag="Ctha_0073"
FT   CDS_pept        complement(85809..86375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0073"
FT                   /product="nitroreductase"
FT                   /note="PFAM: nitroreductase; KEGG: sat:SYN_01293
FT                   oxygen-insensitive NAD(P)H nitroreductase /
FT                   dihydropteridine reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12544"
FT                   /db_xref="GOA:B3QSF3"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR023312"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSF3"
FT                   /protein_id="ACF12544.1"
FT                   /translation="MIKDLILKNRSYRRFLQDEKISTGTLKELIELARLSPSAANLQPL
FT                   KYILSNDEQKIQRIFTTLRWAGYLKEWPGPKEGERPSAYIIMLGDRRISENIYCDEGIA
FT                   AQSILLGATEKGLGGCVIASVQRDALQDALGIPGDFQIFLVLALGVPKETVVLEDLKED
FT                   VKYWRSEDGVHHVPKRSLDDIILNI"
FT   gene            complement(86372..86989)
FT                   /locus_tag="Ctha_0074"
FT   CDS_pept        complement(86372..86989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0074"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12545"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSF4"
FT                   /protein_id="ACF12545.1"
FT                   /translation="MEMDSKLASSAVIITGVATAEAASAYVMSPTLIGDDIAVTALTAA
FT                   MIMGLGKVHNKSLTMEKALKWLIPNMGLFASSRVLAMTVKWIPLIGTTANASISFTAAQ
FT                   VIGWTVYLIFNDDKELDEVGVKELRIYKRRAENMEKPDVEKWFEDMPKEQVKEYKDLVS
FT                   QLSKPGLTEEQQNEILRRMQDLVAPYATGQGSSEKNGESKKS"
FT   sig_peptide     complement(86921..86989)
FT                   /locus_tag="Ctha_0074"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.985) with cleavage site probability 0.736 at
FT                   residue 23"
FT   gene            complement(87128..87778)
FT                   /locus_tag="Ctha_0075"
FT   CDS_pept        complement(87128..87778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0075"
FT                   /product="Haloacid dehalogenase domain protein hydrolase"
FT                   /note="PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: sfu:Sfum_3382 HAD-superfamily hydrolase,
FT                   subfamily IA, variant 1"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12546"
FT                   /db_xref="GOA:B3QSF5"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSF5"
FT                   /protein_id="ACF12546.1"
FT                   /translation="MNFSAVLFDLDGTLINTLGDIGNGVNAILRKNGFPEHDIPTYKNF
FT                   IGDGVRELMSRALPDGVVDEDFITQCVAEFETYYQAHYDVETTLYPGIEDMLDHLAAKG
FT                   VKFSVFSNKPYDLTHQCVKGILGKWTFLEVLGPKEGIPKKPNPYGAKRIIEKLAISPDQ
FT                   FLYLGDSGVDMKTATSVGMYPVGALWGFRTKEELLAAGAKKTVTHPSEVVRLF"
FT   gene            complement(87858..88178)
FT                   /locus_tag="Ctha_0076"
FT   CDS_pept        complement(87858..88178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0076"
FT                   /product="KaiB domain protein"
FT                   /note="PFAM: KaiB domain protein; KEGG: mma:MM_1091
FT                   thiol-disulfide isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12547"
FT                   /db_xref="GOA:B3QSF6"
FT                   /db_xref="InterPro:IPR011649"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR039022"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSF6"
FT                   /protein_id="ACF12547.1"
FT                   /translation="MMNDKNGSGASAQSTSIALRLYVLGDSVKTNVAINNLKQICEAHF
FT                   PGMYQLEIYDVLENPQLLENDNVLATPLLIKLSPEPKMRIIGDFSDSQRVLQGLGYNPD
FT                   KL"
FT   gene            complement(88197..89921)
FT                   /locus_tag="Ctha_0077"
FT   CDS_pept        complement(88197..89921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0077"
FT                   /product="putative circadian clock protein, KaiC"
FT                   /EC_number="2.7.11.1"
FT                   /note="KEGG: bra:BRADO1478 circadian clock protein KaiC;
FT                   PFAM: Circadian clock protein KaiC central region; KaiA
FT                   binding; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12548"
FT                   /db_xref="GOA:B3QSF7"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010624"
FT                   /db_xref="InterPro:IPR014774"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030665"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSF7"
FT                   /protein_id="ACF12548.1"
FT                   /translation="MNEQHNPMSNVEKMKAGLPKCPTGIKGLDEVLFGGIPKGRSTMVL
FT                   GNAGCGKTLLAMEFLVQGIQQFGAHGLFVSFEEKKEDLLEDMQSFGWNLEAAEQSGALL
FT                   IKHLDLGDSEFLESGEYDLGGLFVRLEFAIDKIGAKRVVLDTVETLFTTYKNVGALRTE
FT                   FRRLIRWLKSKGVTVIITGETDSYGKTRHGIEAFVSDCVVQLDNRIQNQVPTRRLRVLK
FT                   YRGSFHGTNEYPFIISEQGLSLLPITSVGLNYDVATDFVPSGLSSLDELLGGRGFYRGS
FT                   SVLLTGAAGTGKSSLASQFAQAACGRGEKCLYLNMEESVWQIVRNMRSIGVELEPFIEK
FT                   GLLLFEPTRSTMCGLEYHLVKLIKLLETYEPQHLIIDPVSSFLAVGESIEVKSMMSRLI
FT                   DYLKMRHITTIMTNLSDTNAQNEITQMDISSLMDTWMTVQMVRNQNEQNRLIYIIKSRG
FT                   MGHSNQMREFLITSEGIHLMEVYRGQEGVRLGTARTLQEARDSMEDALMKDERELILLQ
FT                   MARKRKILDAQIESLRSEYEYFENELKHQLHVAEMRKTQHTQTKEKIEEMRGYKRGY"
FT   gene            complement(90190..92736)
FT                   /locus_tag="Ctha_0078"
FT   CDS_pept        complement(90190..92736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0078"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: scl:sce6765 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12549"
FT                   /db_xref="InterPro:IPR001322"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR026444"
FT                   /db_xref="InterPro:IPR036415"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSF8"
FT                   /protein_id="ACF12549.1"
FT                   /translation="MMVKNLFFASICILAIFLLAKRAFAQSAWQRTDFSNIEKISIDKE
FT                   RDKSGASGLASGGWVINEILADPDATAGDANGDGTVDSSDDEFVEILNLSGASVDLGGW
FT                   TLSDGVGVRHTFEAGTLVPDSGSIVIFGGGVPAGSFGGSLVQVSSTGRLGLNNTGDDLT
FT                   LSDSAAVHASASYGAEGGQNESLTRDPDLSGAFVKHSAATAAAGAIFSPGTKNDGSRFS
FT                   GNPVFFPTKLQIVVNQGRDPYADKWFSVVVSALDSAGRAQPVQEETGIQLSLTSGSPEK
FT                   LSGALSATIARDASSVTISGLAYAEVENNLALLVSRTSGDLLLSASASFNVQTRPNKPL
FT                   AGELIISEFMANPNFTSDALGEYIELYNPTDSTFNLEGYLIKDDGSDAHTIANNGTLSI
FT                   SPHGFLLFAKSSDPLGDGSLVPDYVFTNVTIGNGADEIVLVEPDSLGGGEIARVDYTDG
FT                   DVFGAGVALELANLALGYDGLLSQSDFVAATHTLSNTNTDKGSPCFYGEAAAQTLANGD
FT                   SAKVGVGLVDESLPLLAIYDDADATPTLMNSYKIFSDSLHHALGAQDRALLGFVQLSGT
FT                   PDSATIEMFYTDAQLARAGFSHTAEFELQLAAWNGVSWRKYPRAASSDTSLNKVVAEHV
FT                   QSFSDWVIVGGFEDSPLPVELQRFTGTVASSGVLLKWQTASEAGNEGFILYRDGVEIAS
FT                   YKNIDALKGQGTTSLATNYNFTDTQIHLGETYNYTIVSVDISGERHEYSQTVSIEITQV
FT                   VAAEPETKAYEYALEQNYPNPFNPSTLIRFSLPQAGTATLKIFDQLGRRIKTEQIQASA
FT                   GWHVYRFDASMLASGVYFYQIRVGSFLETKKMLLLK"
FT   sig_peptide     complement(92659..92736)
FT                   /locus_tag="Ctha_0078"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.994 at
FT                   residue 26"
FT   gene            complement(92843..93586)
FT                   /locus_tag="Ctha_0079"
FT   CDS_pept        complement(92843..93586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0079"
FT                   /product="protein of unknown function DUF558"
FT                   /note="PFAM: protein of unknown function DUF558; KEGG:
FT                   plt:Plut_0227 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12550"
FT                   /db_xref="GOA:B3QSF9"
FT                   /db_xref="InterPro:IPR006700"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSF9"
FT                   /protein_id="ACF12550.1"
FT                   /translation="MELFFVPESHIDLTKNRIELADQEFHHIVRVVRKKSGDTLWITDG
FT                   RGTCFQTEIEQIGKNSAELKILSQEKKPAPKTKIAVALSLMKASERFDFFLEKATELGV
FT                   AEILPMMTHRTVSRPAEKQYEKKHERWEKIVLAASKQSRQMWFPKLHPIQPFEEVLKRN
FT                   DEVKLIAYENSAQHLVQGFSGKSILFLIGGEGGFTEAEVLAAKQAGFQEMTLGESVLRA
FT                   ETAGIFAVAMVRANLLSAAIREPEG"
FT   gene            93761..94318
FT                   /locus_tag="Ctha_0080"
FT   CDS_pept        93761..94318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0080"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dps:DP2912 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12551"
FT                   /db_xref="GOA:B3QSG0"
FT                   /db_xref="InterPro:IPR022930"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSG0"
FT                   /protein_id="ACF12551.1"
FT                   /translation="MQPEILLLGIGIFMLRTVDVSLGTLRTISIIQGRLTASFFLGLVE
FT                   VSIWLTIISATLQYISQNPMIGIFYALGFSTGNVVGIFLERKVPIGNVTMRLFVKEKDL
FT                   DLVEKLREKGFSITKFSGEGHSGAVYLLFCFTQKKRLPEFLAEIQSRDEVFYTVDYGGY
FT                   GAKILAPTPTQPTGWRNKLKFK"
FT   gene            complement(94370..94867)
FT                   /locus_tag="Ctha_0081"
FT   CDS_pept        complement(94370..94867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0081"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   ote:Oter_1584 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12552"
FT                   /db_xref="GOA:B3QSG1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSG1"
FT                   /protein_id="ACF12552.1"
FT                   /translation="MKTDFEHIEIEPVTEQNFEVFFSQIVAFANYESLTPPDADAKARL
FT                   KKYGFSEKPKYEAFLAYFDKQPVGFAMIFETFSSFLAKPTLYLEDIFVDEAFRGKRVGT
FT                   AFFKFFAQLALERGCGRMEWQVLDWNKPAIEFYEKTGAKQTKEWLPYRLTEAELKHFLE
FT                   TM"
FT   gene            complement(95051..95569)
FT                   /locus_tag="Ctha_0082"
FT   CDS_pept        complement(95051..95569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0082"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12553"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSG2"
FT                   /protein_id="ACF12553.1"
FT                   /translation="MNRNKFLQIAMRWRQAAVVLLLFWLAAGCSVGTDEEDISNSSDGE
FT                   ITETDATGNVVDEDSNDWRIQNYFKNNVYIKPAYPNPTSNGIVTITMTFIANIPESGVY
FT                   IYANNINSVGVFLYQLPDVSYGAKTFSFSLVGLSPSSSLTQIQGKQFRLRIYDGMGRLI
FT                   SFGDVEIAE"
FT   sig_peptide     complement(95471..95569)
FT                   /locus_tag="Ctha_0082"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.505 at
FT                   residue 33"
FT   gene            95932..97467
FT                   /locus_tag="Ctha_0083"
FT   CDS_pept        95932..97467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0083"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cph:Cpha266_0474 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12554"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSG3"
FT                   /protein_id="ACF12554.1"
FT                   /translation="MMTLSEIKQSHRLTYQYFSECQHGERWLQRIVELDQYWEQIGKRS
FT                   TTQVVFSSDALPKNVRINGHFDLIYAGSTLGTIHAAAMAAIYKKSVLLFDKHTPAKTHR
FT                   DWNISKQELLALAQIGLLTEKEIESAITKKYQTGFVEFASTEPPTRLYLEHVLDCAIDS
FT                   DTILRHCLEKMEGEKNLVLGKTTFNRCFQCDDGIVVEVTSDDGRLEYYKAKVMMDAMGI
FT                   LSPIALELNNGKPQTHICPTVGTVASGLLDVDYDIGEILVSTEPEEYTATGARQLIWEG
FT                   FPASNTEMITYLFFYDRIDSNNDKSLLNLFETYFQKLPTYKRPGADFKLHKPVFGIIPA
FT                   YHHNGMGKTRETAADRILLLGDAATLSSPLTFCGFGSMVRNLARTTKQLNTLLDEGRCT
FT                   KSDLERVSAYEENVAIMSNLMKFMCFEKDSDPPNFVNDLMNVIMKVLKDLPPRYGVSLF
FT                   RDEMALSDFNTLILTVAKKYPKIFEITFRKLGVSGSLSWIQNWLGWLTAPKEK"
FT   gene            complement(97541..98815)
FT                   /locus_tag="Ctha_0084"
FT   CDS_pept        complement(97541..98815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0084"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   cph:Cpha266_0590 protein of unknown function DUF214"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12555"
FT                   /db_xref="GOA:B3QSG4"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSG4"
FT                   /protein_id="ACF12555.1"
FT                   /translation="MGLYDIFRIAFFHLNDRRRQTFLTALGVAIGSAMLITTISVASGS
FT                   SANIREKIIDSSPHVSVFPKRVQRLIPENLVADQHSKNQITVVEKNVTTKDKPAIKAYT
FT                   EVVATAQTLENVEAISPFVMNKLIIRNKTRFKSCITRGVVPEREAQVANFEKIITSGSI
FT                   EELSYTPNGIILGDVLASDLRAKYRSRLDLVTEDGEIFPVIVVGVFQSGFSEFDKKMGY
FT                   INLRLAQRIEGISASSVTGIGIKTNDINASGFVAATMEKLTGYETESWDETNKNVLDFI
FT                   KRNNSVTLVLVGFVFIVAGLGVSSVMTTVVLQKTKDIAIMRSYGTSKANITLIFMLEGL
FT                   FIGVVGALLGSAIGHLICDFVATIRFESSTAGVVRSDRINIVEMPESHIIVVIFAILVT
FT                   VFSAFGPARRAARLKPVRILRGEVA"
FT   sig_peptide     complement(98687..98815)
FT                   /locus_tag="Ctha_0084"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.872) with cleavage site probability 0.433 at
FT                   residue 43"
FT   gene            complement(98926..99663)
FT                   /locus_tag="Ctha_0085"
FT   CDS_pept        complement(98926..99663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0085"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cph:Cpha266_1734 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12556"
FT                   /db_xref="InterPro:IPR025524"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSG5"
FT                   /protein_id="ACF12556.1"
FT                   /translation="MNKSIFYFFAIFLFVSNAAYGQFEGIINIKMTAEEGEHINTIYLS
FT                   NNNFRSELSFKIPGVGERTAITIRNAKQPNTIYTLNPEAKTYSELKFEAQITEDDSYES
FT                   DDEDTKIEKLGQEKILGYNCNHIRISGYEGVSEFWLTKDVLDWNTFFKLQGSAEEENPE
FT                   LEKQLEKLGIVGFPMKIIDHETNTTSEVTSIKKESLKASLFEIPSDYKKSESFNDDTMN
FT                   KMNEMMEGWEEDMPAPADDDSED"
FT   sig_peptide     complement(99598..99663)
FT                   /locus_tag="Ctha_0085"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.947) with cleavage site probability 0.775 at
FT                   residue 22"
FT   gene            complement(99794..100519)
FT                   /locus_tag="Ctha_0086"
FT   CDS_pept        complement(99794..100519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0086"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cte:CT1489 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12557"
FT                   /db_xref="InterPro:IPR025524"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSG6"
FT                   /protein_id="ACF12557.1"
FT                   /translation="MFRIILTFLVLNFYAAPIFAQFVGEIQMELVSPQGNGQMTFIFGS
FT                   QAERMDMLITPPQFSAPMKTSMILKHENPDEAYILMDATKSYMVLDLKKAAAVTGGLNV
FT                   DEEYDVKVIGKEKIRGYQCQHVKITGATTDMDLWLSSEILDFDTFRRLQSQNPKMSNSA
FT                   LADALHKSGADGFPVKMLQQVNGQTVKMELVKAEKKAIPASAFSIPKDYQQMQPQMQMS
FT                   QEQMEKMKEMMKKLQEQKR"
FT   sig_peptide     complement(100457..100519)
FT                   /locus_tag="Ctha_0086"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.806) with cleavage site probability 0.786 at
FT                   residue 21"
FT   gene            101066..101950
FT                   /locus_tag="Ctha_0087"
FT   CDS_pept        101066..101950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0087"
FT                   /product="protein-(glutamine-N5) methyltransferase, release
FT                   factor-specific"
FT                   /note="TIGRFAM: modification methylase, HemK family;
FT                   protein-(glutamine-N5) methyltransferase, release
FT                   factor-specific; PFAM: methyltransferase small;
FT                   Methyltransferase type 11; Methyltransferase type 12; KEGG:
FT                   cte:CT1487 hemK protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12558"
FT                   /db_xref="GOA:B3QSG7"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004556"
FT                   /db_xref="InterPro:IPR019874"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR040758"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSG7"
FT                   /protein_id="ACF12558.1"
FT                   /translation="MSQSQNWTVLSLLKASSDFFAQKNIDDARLNAELLLAHTLNLKRM
FT                   DLYLKFDMPVTEQERQTFRELCKRRLEGEPVQYIIGNQDFFGLTLDVDSRVLIPRPETE
FT                   LLVEEALNSLSQLDFGDEKIKILDIGTGSGCIALAFASQLSNAEILAVDVSSEALALAK
FT                   QNSEKNKLKSEVRFLNIDMLSAHFYDEVPGSYHLIISNPPYIPIAERDSLQVEVRNFEP
FT                   AIALFVQQGFEFYEKIAQEAARLLKPNGLLCFELHADGATKVNIILKKNGFEQIRFVQD
FT                   YAGFSRIAIASNS"
FT   gene            101963..103159
FT                   /locus_tag="Ctha_0088"
FT   CDS_pept        101963..103159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0088"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase NAD-binding"
FT                   /note="PFAM: 3-hydroxyacyl-CoA dehydrogenase domain
FT                   protein; 3-hydroxyacyl-CoA dehydrogenase NAD-binding; KEGG:
FT                   rxy:Rxyl_1761 3-hydroxybutyryl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12559"
FT                   /db_xref="GOA:B3QSG8"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSG8"
FT                   /protein_id="ACF12559.1"
FT                   /translation="MNSKIIGIVGAKSSGVNMAITVAKANHSVLIYDPNPVLLQQVTSR
FT                   VRKVMEKWQQRNLLTPKEANLLVERICPVSTIKSLSSADAIFETGSESLEKKKELFKSL
FT                   DEFSPESIILVSTSAFISVTTLASVCFFKKRVIGMQIHHQSSMASLIELSQGMDTSREV
FT                   LKQSIELGRSLAKEVVICYDMPGLIVHRVSRNFFGEALRIFEEGTASMLEIDAFMRQAG
FT                   GFHLGPFELLDCLGIDKTYISDLELYNAFFQEPRFRPTHLMKTLFESGYYGKKSGRGFY
FT                   DYSINEAAPRMAIQQSEQEAARKFFQNHYISLFMVKQAVFARIIAMLVNEALFCVQENV
FT                   SSEGDVDLAMKYGMSFPKGPIEWGREIGFDKIASVLNALYNEFRDDRYRPAPLLKIYQ"
FT   gene            complement(103266..103970)
FT                   /locus_tag="Ctha_0089"
FT   CDS_pept        complement(103266..103970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0089"
FT                   /product="Abortive infection protein"
FT                   /note="PFAM: Abortive infection protein; KEGG: cch:Cag_1314
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12560"
FT                   /db_xref="GOA:B3QSG9"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSG9"
FT                   /protein_id="ACF12560.1"
FT                   /translation="MGENMEQTRFSNAGFKESLYEKRLQLSLILTGVIWVSGLIGHFTP
FT                   AGEWPALFIYVLGGIGIVLWHGKNTGEWKEMFISTENLGKSLKWGGIIGGFLFVMDVAN
FT                   TYMYLKGGGEPMAQMEEILVGMNMLYLFPLLILAEEFLWRGILFSALLEKGLNKHLVVA
FT                   ITTILYMVNHFAVAPVGLFERGLMAMMAMPIGIIGGYLVANTRNLWGSALIHTTTMVSM
FT                   ILDIFLIPKLVS"
FT   gene            complement(104224..106278)
FT                   /locus_tag="Ctha_0090"
FT   CDS_pept        complement(104224..106278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0090"
FT                   /product="DNA ligase, NAD-dependent"
FT                   /EC_number="6.5.1.2"
FT                   /note="KEGG: plt:Plut_1699 DNA ligase (NAD+); TIGRFAM: DNA
FT                   ligase, NAD-dependent; PFAM: BRCT domain protein;
FT                   zinc-finger NAD-dependent DNA ligase C4-type; NAD-dependent
FT                   DNA ligase OB-fold; NAD-dependent DNA ligase adenylation;
FT                   SMART: Helix-hairpin-helix DNA-binding class 1;
FT                   NAD-dependent DNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12561"
FT                   /db_xref="GOA:B3QSH0"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR001679"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004149"
FT                   /db_xref="InterPro:IPR004150"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013839"
FT                   /db_xref="InterPro:IPR013840"
FT                   /db_xref="InterPro:IPR033136"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="InterPro:IPR041663"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3QSH0"
FT                   /protein_id="ACF12561.1"
FT                   /translation="MNKSEAEAKIRALRREINEHNYNYYNLAKPKISDYDFDALLRTLA
FT                   ELEAKYPDLVTPDSPSQRVGGEVTKNFPIVRHKTRMLSLSNTYNLGELGDFLARVAKSL
FT                   ESEGVQAYDFTAELKYDGVAVSLIYRDGLLVQGATRGDGSQGDEITANLKTVRTIPLRL
FT                   RAPASGSAFDTEKWNGSGDIEVRGEVFMTKADFEKINAERDESEQFANPRNATAGTLKQ
FT                   QDSREVAKRRLTMVAYYLDGRPFADLSHGERLEKLAELGFYTGEAHRTCRSLQDIQAFL
FT                   DEWENKRDALAYEIDGAVIKLNNVRYQELLGATSKSPRWAIAYKYAARRAETVLENVVF
FT                   QVGRTGAITPVAELQPVKLSGSVISRSTLHNLDEIRRLDLHIGDRVIIEKSGDVIPKVV
FT                   GVVAEKRPPEARTIEPLSTCPSCGTPLEHPENEVIYYCPNEFGCPAQRKARLVHFASRH
FT                   AMDIEGLGEAVVEQLLGAGLIGDPGDLYFIEKTALLALERFAEKSAQNLLNGIEASKSR
FT                   SFERLIFALGIRYVGRRTASILADRFTSLDTIKSASQAELCETEEIGETIAKSVALFFT
FT                   KPQVQELLGKLERAGLRLASDKKSPDAPQTFAGMTVVFTGSLENFTRDDAAAKVGERGG
FT                   KVTSTVSKKTSLVVAGKEAGGKLAKAEKLGVKIVTEAEFQTMLAAESGD"
FT   gene            106438..108648
FT                   /locus_tag="Ctha_0091"
FT   CDS_pept        106438..108648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0091"
FT                   /product="ComEC/Rec2-related protein"
FT                   /note="PFAM: ComEC/Rec2-related protein; KEGG:
FT                   cph:Cpha266_1722 ComEC/Rec2-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12562"
FT                   /db_xref="GOA:B3QSH1"
FT                   /db_xref="InterPro:IPR004477"
FT                   /db_xref="InterPro:IPR025405"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSH1"
FT                   /protein_id="ACF12562.1"
FT                   /translation="MQAYPSVRLLFLSIAGILLGEAFPAYAKIYLCAAAGLGALSFFLA
FT                   VFDLFFKRYVFLKSWPASYIFSVIFSFAALISFQETRVSHNSILHYLNDEHWIKGKILG
FT                   KPNISENHAYWDMEVREIIVEIDTLPVSGKVRVWQSSPRKLDIALQDGEFVWAFGKLKL
FT                   PEPTQNKGEIDFAKYLASKGIYAELKSYGEGNLQQINEVDLSIFEQFLVKPTYDFIDHS
FT                   IEKLIPFGDEKSFIKAILLGDKSGLSDEIKLAFQRTGTFHVLAISGLHVGLFVLVLGAF
FT                   SQRFKQSRSGKWVVFLISTFVLLLYAAVTGAAPPVKRAVLMAIVFLGTTLYEKKTYALN
FT                   TLAFADFLILLISPKDLFSLSFLLSNAAVISIILLYPKLISLAIFDNIESSKYWLLPQI
FT                   GGIVKNIWQAIALTISASLGVSPILGLTFGSVPLLGLLANLPVTFLVSLAVYAMLPALF
FT                   FNLCCAEFAALYALCAWFFIRVSIQISNWFSQFSFAAISINASWLSALSFYLFIGFLFN
FT                   LYNQKSRAKWTIFLLISLNFILFGKLFFEKNKEEKLIINDLRKGVSVLCKTQTESIVID
FT                   VGMSDYDATRTLKQVQVFHALPSAFLQFASSDRIITEAATAPIFSRKEHQLRLKTIGVF
FT                   RPNKNVMKVMTKTQQVLFVKKVGVLKPEPFYRVSTLILHLRKFSDADEVRLREWVNFAK
FT                   PERVVFSTSPFMRKSERQKLHKLIFAEARYFSPQINGQLVFD"
FT   sig_peptide     106438..106521
FT                   /locus_tag="Ctha_0091"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.979) with cleavage site probability 0.977 at
FT                   residue 28"
FT   gene            108664..108981
FT                   /locus_tag="Ctha_0092"
FT   CDS_pept        108664..108981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0092"
FT                   /product="HesB/YadR/YfhF-family protein"
FT                   /note="PFAM: HesB/YadR/YfhF-family protein; KEGG:
FT                   btl:BALH_4472 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12563"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSH2"
FT                   /protein_id="ACF12563.1"
FT                   /translation="MQMIDIKITKAAEEKIHDLTTSGEVEQGTIRVATGCAACGGLSFA
FT                   LDFNTKKKPDDALVPHDKWEFAVGREVQELVENITIDYVENEFGGNFIIETAYGTSACW
FT                   W"
FT   gene            complement(109059..110060)
FT                   /locus_tag="Ctha_0093"
FT   CDS_pept        complement(109059..110060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0093"
FT                   /product="KpsF/GutQ family protein"
FT                   /EC_number="5.3.1.13"
FT                   /note="KEGG: cph:Cpha266_0401 KpsF/GutQ family protein;
FT                   TIGRFAM: KpsF/GutQ family protein; PFAM: CBS domain
FT                   containing protein; sugar isomerase (SIS)"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12564"
FT                   /db_xref="GOA:B3QSH3"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004800"
FT                   /db_xref="InterPro:IPR035474"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSH3"
FT                   /protein_id="ACF12564.1"
FT                   /translation="MNANASFNQNTCTLNFIDLARQTLLLESKALEAVSTRLDEQFNAA
FT                   VRLILNATGKVIITGMGKSGIIAQKIAATMTSTGTPAVFMHPSEAAHGDLGVVSKGDVV
FT                   IGLSKSGTTEELLYILPALKQLQVQIIAMVGNVRSALALRADAVLDVAVEKEACPYDLA
FT                   PTTSTTAMLAMGDALAMALMQAKKFSQYDFAVTHPSGALGKRLTMRVADIMATRERLPI
FT                   IQDTVSFTGLLLEMTSKRFGAAIVVDGETGKLVGFFTDGDLRRIVQTGKDLSRLSAKDV
FT                   MTPNPKYLTKETLAKDCLETMEAHRITQMIICDDAQKPIGIVHIHDLVSLGL"
FT   gene            complement(110220..112862)
FT                   /locus_tag="Ctha_0094"
FT   CDS_pept        complement(110220..112862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0094"
FT                   /product="DNA mismatch repair protein MutS"
FT                   /note="TIGRFAM: DNA mismatch repair protein MutS; PFAM: DNA
FT                   mismatch repair protein MutS domain protein; MutS III
FT                   domain protein; MutS II domain protein; MutS IV domain
FT                   protein; KEGG: cte:CT1503 DNA mismatch repair protein MutS"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12565"
FT                   /db_xref="GOA:B3QSH4"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR005748"
FT                   /db_xref="InterPro:IPR007695"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR007860"
FT                   /db_xref="InterPro:IPR007861"
FT                   /db_xref="InterPro:IPR016151"
FT                   /db_xref="InterPro:IPR017261"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="InterPro:IPR036678"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSH4"
FT                   /protein_id="ACF12565.1"
FT                   /translation="MAKSKIQKGKKDETPMMRQYDKIKSQYPGVILLFRVGDFYETFFD
FT                   DAKAVSEALNIVLTRRSNGSSAEVPMAGFPHHAAENYVARLVKRGFRVALCDQVEDPKF
FT                   ARGVVKREVTDIVTPGVNFNDRILDEKRNNYLCAVHFAEIDRKREISGVAFIDVTTAEF
FT                   QVAEVPLSGLKDLLQTVQPAEVIISKKNRSWKDSLRNMTYEELNFTELDEWMFSHDFAE
FT                   QTLLGQFKTHSLKGFGVEEFSAGKVAASVILNYLEETQRGKLQYIKKISRFETADHIAL
FT                   DPQTKRNLEILYAMQTGAREGTLIDVIDKTVTAMGARLLKKWVGRPSRRMSQIQNRLDA
FT                   VEVFLTRKDLKANLREAFKSICDMERVLARIATGRANPKEVLSLGGSLAQVPDFKAALL
FT                   EIETPLVAELQNGLTATPELTEEIFRAINPETPATLNDGNVIREGYNAELDELRSLAGS
FT                   AKEMLQKVQADERKKTGISSLKVQFNRVFGYYIEVSKANSEKVPDYYEKKQTLVNAERY
FT                   TIPILKEYEEKILTAEERRITLEQELFSALRQRIAEDAETIQADAEHIATLDCLCSYAE
FT                   LAEKSNYVKPEIHENDVIDIKNGRHPVLEKIMPIDRKYVPNDCRLDVETRVQIITGPNM
FT                   SGKSSFLRQVGLIVLLAQAGSYVPAESASIGLVDKIFTRVGASDNLAAGESTFLVEMNE
FT                   AANILNNGTAQSLILLDEIGRGTSTYDGMSIAWAMTEFIHDAIGAKTLFATHYHELAEL
FT                   EEQLVRVKNFNATVEETEDTVIFLRKIVRGAADNSYGIEVAKMAGLPDKVISRAKAILA
FT                   ELEEGETEPTKKAQKNKKRIVPKEDLQISLFEMGDTKLRDALAEIDINKITPIEALIKL
FT                   SELKHLAES"
FT   gene            112996..113430
FT                   /locus_tag="Ctha_0095"
FT   CDS_pept        112996..113430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0095"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rrs:RoseRS_2932 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12566"
FT                   /db_xref="GOA:B3QSH5"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSH5"
FT                   /protein_id="ACF12566.1"
FT                   /translation="MYQVLLFLHVASFAIWMGIVVASLMLIKSMQPKLTDFEAKEIPEF
FT                   VKVLKSYIGWEVKIVDVMFLTVIITGALLAHFYIGWNTWTITKGILVFFQLFATIGYVF
FT                   VAVRKLEYPCKPSEFKKWYTLFTISLSFFTAMLLFVFFGR"
FT   gene            113535..113831
FT                   /locus_tag="Ctha_0096"
FT   CDS_pept        113535..113831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0096"
FT                   /product="ribosomal protein L21"
FT                   /note="PFAM: ribosomal protein L21; KEGG: plt:Plut_1508 50S
FT                   ribosomal protein L21"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12567"
FT                   /db_xref="GOA:B3QSH6"
FT                   /db_xref="InterPro:IPR001787"
FT                   /db_xref="InterPro:IPR018258"
FT                   /db_xref="InterPro:IPR028909"
FT                   /db_xref="InterPro:IPR036164"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3QSH6"
FT                   /protein_id="ACF12567.1"
FT                   /translation="MRALVEISDKQFFVTEGEKLFVPTQKAEAGDTLTFEKVLLQSDGA
FT                   AASLSPSCKVTAKLLRHIKGDKVTVFKKKRRKRYRVTRGHRQGFSEIEILSVA"
FT   gene            113867..114121
FT                   /locus_tag="Ctha_0097"
FT   CDS_pept        113867..114121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0097"
FT                   /product="ribosomal protein L27"
FT                   /note="PFAM: ribosomal protein L27; KEGG: cte:CT1506 50S
FT                   ribosomal protein L27"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12568"
FT                   /db_xref="GOA:B3QSH7"
FT                   /db_xref="InterPro:IPR001684"
FT                   /db_xref="InterPro:IPR018261"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3QSH7"
FT                   /protein_id="ACF12568.1"
FT                   /translation="MAHKKGGGSTKNGRDSNPQYLGVKAFGGQEVSAGSIIVRQRGTAF
FT                   KPGKLVGIGRDHTIFALQSGKVFFRSGRNNKKFVDIIPA"
FT   gene            114424..115356
FT                   /locus_tag="Ctha_0098"
FT   CDS_pept        114424..115356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0098"
FT                   /product="malate dehydrogenase, NAD-dependent"
FT                   /note="TIGRFAM: malate dehydrogenase, NAD-dependent; PFAM:
FT                   Lactate/malate dehydrogenase; UDP-glucose/GDP-mannose
FT                   dehydrogenase; KEGG: pvi:Cvib_1331 malate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12569"
FT                   /db_xref="GOA:B3QSH8"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR011275"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3QSH8"
FT                   /protein_id="ACF12569.1"
FT                   /translation="MKITVIGAGNVGATATQRIVEKQLAREVVLVDVVDGVPQGKALDM
FT                   YESAPVELFDTRVVGTTGYEETAGSDIILITAGRPRKPGMSRDDLLAMNTEIVKTVTEE
FT                   AVSKSPNAIIIVVSNPLDVMTYVAYVRSGFPKERVIGMAGVLDTARFRTFIAMELNVSV
FT                   QDVNAFVLGGHGDSMVPVVKYTTVAGIPISELLPQDRIAALVDRARKGGIEIVNYLKTG
FT                   SAYYAPSASAVEMIDAIVNDRKRIMPCSAYVTGQYGLNDVFVGVPVKLGRGGVEQVLEI
FT                   NLDEADRNALQASANEVKESCEKVNSMMQ"
FT   gene            complement(115474..117411)
FT                   /locus_tag="Ctha_0099"
FT   CDS_pept        complement(115474..117411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0099"
FT                   /product="peptidase M61 domain protein"
FT                   /note="PFAM: peptidase M61 domain protein; KEGG:
FT                   syp:SYNPCC7002_A1862 M61 glycyl aminopeptidase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12570"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR007963"
FT                   /db_xref="InterPro:IPR024191"
FT                   /db_xref="InterPro:IPR034019"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR040756"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSH9"
FT                   /protein_id="ACF12570.1"
FT                   /translation="MNKGRDFFRVKAELFAFFAILMFFASGCQSSAPSTASVQPSPAAR
FT                   VLYQVDATDTTHGLYRVSLSVENLSLPHEIKFSMPSWAPGAYEFFQFGKYVQNLRAITT
FT                   SGDEIFPTEIETGSWLFQDADEIKSICYSVAETQSSQLFWPEKTILNGRYGYANSTNVF
FT                   GYIWGLKALPCQVIFSVPDSFQVASPLETSPNSKICLAKNYDELVDSPFILGKYERHDF
FT                   FVQGKPHSLILLIDSTVKRDPSLEIVNSIFDKNELYKKRFSFRADSLLAVTKEIVQAHY
FT                   NFYKELPYEKYIFIHHLTPMRYSEMYGALEHRQASAYHLPLFNWEKARQHQITSTVSHE
FT                   FFHVWNPKKIFSDRLTAFDYQAKCHTKNMWFVEGVTDYYADLLLVKSGVIPKELFFANL
FT                   LQRYQYWELDKDDYDANLEKLSLEIASIESLDEILPLYVKGTLVAMMLDVELRLQTKNR
FT                   FGLDSLMLTMNKIYGNTGKAFQDDSLMTIINRLSGADVSAFYEKYISGTAPIPFDKYLY
FT                   KAGLLLNRSVSEKPFMGFSASPDSAGAFFADYVSEGSTAQEIGLKPDDIILSINQVKAE
FT                   NSADFLRQFLSAEVYQNKKDISVTVLRKGMSKVLKGKIVWRKAIDDAIVPFPDPIKSQK
FT                   DIYKSILSLP"
FT   sig_peptide     complement(117301..117411)
FT                   /locus_tag="Ctha_0099"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.722 at
FT                   residue 37"
FT   gene            117509..118264
FT                   /locus_tag="Ctha_0100"
FT   CDS_pept        117509..118264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0100"
FT                   /product="imidazoleglycerol phosphate synthase, cyclase
FT                   subunit"
FT                   /note="TIGRFAM: imidazoleglycerol phosphate synthase,
FT                   cyclase subunit; PFAM: histidine biosynthesis protein;
FT                   KEGG: cph:Cpha266_1907 imidazole glycerol phosphate
FT                   synthase subunit HisF"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12571"
FT                   /db_xref="GOA:B3QSI0"
FT                   /db_xref="InterPro:IPR004651"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3QSI0"
FT                   /protein_id="ACF12571.1"
FT                   /translation="MLAKRIIPCLDVKNGRVVKGVQFEELRDAGSILEQAKFYNDELAD
FT                   ELVFLDISASIESRRTTLEEVLKVSEQVFIPLTVGGGINSVERAREAFLHGADKVSVNT
FT                   SAVKEPTLISELAERFGSQAVVVAIDIKNVGSHYEVFTHSGKTPTGLDTLEWAHKVVEL
FT                   GAGEILLTSMDRDGTQKGYDNVILKEISTSVGVPVIASGGAGNLQHLYEGFSIGMADAA
FT                   LAASIFHFRQHSVREAKAFLQEKGIAIRL"
FT   gene            118548..119687
FT                   /locus_tag="Ctha_0101"
FT   CDS_pept        118548..119687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0101"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sru:SRU_0361 putative alpha-amylase"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12572"
FT                   /db_xref="InterPro:IPR026444"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSI1"
FT                   /protein_id="ACF12572.1"
FT                   /translation="MRKRFTLFFLFALFGFWGVISAQTSSSYFPAEQNHVWYYKVTPLT
FT                   AKGKNESSAFLKVDSLKETTTTTYQGKSAKRLLSAYGLLNGSLTTPFLDTTYLHFEGTS
FT                   AWQYLSALPSTLNTSLLSDTLQMKNVLAFLDSLEGWGNLYRFGESVSKTYTVFEKQIQV
FT                   DFENFQLPVQFKVAGKRLPDQTLSLEAGDFNCKKFAISFGINLIIDLGIFGKQTVPAIT
FT                   IMDSTWIAPNHWIVKQLLPTTKVDLSSLNTLLKSAGLDTLPVTAFTIPGELTELINQPI
FT                   SSTPALGTVPVSAFSLDQNYPNPFNPQTAIPFELEKAGFVSLKIYDILGREVQPLVEKK
FT                   LSAGKHLAFFNGEKLPSGLYFYKLIAGGKQEIRKMMLVK"
FT   sig_peptide     118548..118616
FT                   /locus_tag="Ctha_0101"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.760 at
FT                   residue 23"
FT   gene            119915..120670
FT                   /locus_tag="Ctha_0102"
FT   CDS_pept        119915..120670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0102"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gme:Gmet_1031 protein of unknown function
FT                   DUF1573"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12573"
FT                   /db_xref="InterPro:IPR011467"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSI2"
FT                   /protein_id="ACF12573.1"
FT                   /translation="MRHKKISSEKQPSFAMKKRLMPVAFYFCLITLISPLSALQAQPKL
FT                   KASSTMENLGTLYDGARKTAAFTLTNVGKDTLKLFKVTTSCGCTTLEEKPDYILPGKSW
FT                   KMEVELNSTGLKGEVQKSVSLLTNEPGTESTHRFSLKANVISEFELLNKQDIVQLGEFI
FT                   LGGRAKRSAELKNITNEAILIMKTRFDNEQIEAIAENKIVEPGETLEVTFDFSISEVGT
FT                   FTDVVYLVTSSMNQQYVPVKLTYTVVARQ"
FT   sig_peptide     119915..120037
FT                   /locus_tag="Ctha_0102"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.483 at
FT                   residue 41"
FT   gene            121049..122260
FT                   /locus_tag="Ctha_0103"
FT   CDS_pept        121049..122260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0103"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG:
FT                   dol:Dole_2461 radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12574"
FT                   /db_xref="GOA:B3QSI3"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSI3"
FT                   /protein_id="ACF12574.1"
FT                   /translation="MQAAVVDHTEVYRLPWSLTDNAISWLEPTALCNLYCDGCYRMNEK
FT                   DSHKSLDVVKQELDTFQKLRNSDCISIAGGDPLLHPQILDIVADVKRRGLKPIVNTNGK
FT                   ALTMELLKDLKKAGVYGFTFHVDSKQGRDGKWAGKTEIELNALRQEYADMLAKVGGISC
FT                   SFNSTVYEDTMQYMPDMLNWAHRNIDIVHTMVFIAYREVIPDMPFDWYAGGQKVDWDKI
FT                   WYHTDRKRDINISALHMLQKARETHPEFMPCGYLNGTEIPDSFKWMLNVRVGTKEKIFG
FT                   FMGPKFIELVMTGYHWFTGKYLSYASPKETRIGRTALMFLWMLDKGARKAAGRFFTNPL
FT                   NWFKRLHFQTVMFIQPVDFTKHGGQSMCDSCPDITVWNGQLVWSCRLEELKKYNTFLKS
FT                   VPKD"
FT   gene            122453..122803
FT                   /locus_tag="Ctha_0104"
FT   CDS_pept        122453..122803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0104"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fjo:Fjoh_1945 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12575"
FT                   /db_xref="InterPro:IPR021857"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSI4"
FT                   /protein_id="ACF12575.1"
FT                   /translation="MNGNMTNQPDSESKQQPLQINIQLDPDTAQGIYSNIAVINHSPSE
FT                   FILDFTRLFPGMQSAKVHARIVMTPQHAKMLAKALEQNIAKYESDNGAIKVDEASHSEQ
FT                   MGFHIARNLQQK"
FT   gene            122834..123151
FT                   /locus_tag="Ctha_0105"
FT   CDS_pept        122834..123151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0105"
FT                   /product="iron donor protein CyaY"
FT                   /note="TIGRFAM: iron donor protein CyaY; PFAM: Frataxin
FT                   family protein; KEGG: spe:Spro_0180 frataxin family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12576"
FT                   /db_xref="GOA:B3QSI5"
FT                   /db_xref="InterPro:IPR002908"
FT                   /db_xref="InterPro:IPR036524"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3QSI5"
FT                   /protein_id="ACF12576.1"
FT                   /translation="MTEKEIRIFLDETLEDIQDKLDAMDDDELDFETSDGLVSIETEDG
FT                   TKYIVSRQSATNQIWLAEPINGWKFNLQDGKWISDKENHELYSFLEALLSQKLGKPIRL
FT                   K"
FT   gene            123200..125125
FT                   /locus_tag="Ctha_0106"
FT   CDS_pept        123200..125125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0106"
FT                   /product="peptidase"
FT                   /note="KEGG: sru:SRU_0537 peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12577"
FT                   /db_xref="GOA:B3QSI6"
FT                   /db_xref="InterPro:IPR014782"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSI6"
FT                   /protein_id="ACF12577.1"
FT                   /translation="MRLILWTFSLLFFLFNARVSYSQTDAARRPIPYPVRYSNAFKEAV
FT                   HHQTRTLNGAPGKAYWSNPTRYTLHALLSPETKMLQGQATISYTNQSPDTLSQLVVQLR
FT                   QNLHKEGAIRNREVETTDGMQLSKVMVNGQHYMERRLRSRTGYKVQGTLMYISLYQDLY
FT                   PGETAELAFSWNFQIPDGDSPRMGQDGEVFFLGYWYPQMAVYDDIQGWNDDLYMGNAEF
FT                   YMDYADYDVNITVPEGWLIAATGELQNPEEVLSTETLTKLEQARESDEVTTIVDKTEQF
FT                   PGVSTRTSESGLLTWHFTAENVRDFAFGTSDRYVWDAIPTNISGKKIMVHSFYRWGTSA
FT                   WKRAAEFARYSVEYLSSRLVPYPYPNLSVVEGIIGGGMEYPMITLIGGRRTDFTLFSVV
FT                   FHEIAHNWFPMLVGSNETQFAWMDEGLVTYYTNEGKETFFTNDMVWEFEADQYEIFSET
FT                   DTEIEPMRHADLFPISGIARRVGCYNKPALALRALQGVFGYQLFNNAMRLYIDRWTNKH
FT                   PQPFDFFNTFEQVTGKNLDWFWTSFFYETWPLDQAISEVKIENGQTTVFIEDLGLLPMP
FT                   VLVCATLQDSSLLEKEIPVEHWLQGNRTAEITFESNKVKKVDLDPQHFFPDINRKNNSW
FT                   SLESAP"
FT   sig_peptide     123200..123268
FT                   /locus_tag="Ctha_0106"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.971) with cleavage site probability 0.943 at
FT                   residue 23"
FT   gene            125311..126399
FT                   /locus_tag="Ctha_0107"
FT   CDS_pept        125311..126399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0107"
FT                   /product="nicotinate-nucleotide/dimethylbenzimidazole
FT                   phosphoribosyltransferase"
FT                   /EC_number="2.4.2.21"
FT                   /note="KEGG: gur:Gura_4187
FT                   nicotinate-nucleotide--dimethylbenzimidazole
FT                   phosphoribosyltransferase; TIGRFAM:
FT                   nicotinate-nucleotide/dimethylbenzimidazole
FT                   phosphoribosyltransferase; PFAM:
FT                   Nicotinate-nucleotide-dimethylbenzimidazole
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12578"
FT                   /db_xref="GOA:B3QSI7"
FT                   /db_xref="InterPro:IPR003200"
FT                   /db_xref="InterPro:IPR017846"
FT                   /db_xref="InterPro:IPR023195"
FT                   /db_xref="InterPro:IPR036087"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSI7"
FT                   /protein_id="ACF12578.1"
FT                   /translation="MQKEVFSDLLKQAQHKLDRKTKPVGSLGKLETLAAQLAAIQGSLE
FT                   PNIDKKRMLIFAASHGIAAEGVSAYPPEVTGQMVLNFLNGGAAINVLSRHGKMNLHVID
FT                   VGVDVDLSDSAKEASNFFSRRVTNGTKSFLREPAMTAEECEAALKAGYEQVQLAHEQQV
FT                   RLLGIGEMGIGNTTAAAALFSALLNIHPEEIVGPGTGLNEAGVRHKALVIQKALDLHRE
FT                   KSGADPVAWLQHVGGLEIAAMTGVILEAYRLQMPVVVDGFIATSAAMVALQIEPAAKQI
FT                   CFFGHRSNEKAHRLVLEKLDANPVLDLEMRLGEGTGAALAMHLLDAAAKIMCEMATFDT
FT                   AGVSDSEQDANKQARSASEKND"
FT   gene            126409..127206
FT                   /locus_tag="Ctha_0108"
FT   CDS_pept        126409..127206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0108"
FT                   /product="cobalamin 5'-phosphate synthase"
FT                   /note="TIGRFAM: cobalamin 5'-phosphate synthase; PFAM:
FT                   cobalamin-5-phosphate synthase CobS; KEGG: azo:azo3561
FT                   cobalamin synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12579"
FT                   /db_xref="GOA:B3QST6"
FT                   /db_xref="InterPro:IPR003805"
FT                   /db_xref="UniProtKB/TrEMBL:B3QST6"
FT                   /protein_id="ACF12579.1"
FT                   /translation="MKTQFNVFLSAVMFLTRLPVGRWVHYNAEHLAQSSIYFPLVGALV
FT                   GAIAVGALSLSLLLIPVLPAVLISMIATILATGALHEDGFADCADGFGGGFETERVLEI
FT                   MKDSRLGTYGAIALWISLSLKAALLYEITSRDALLCAGALISGHTLGRFSSLVLIYRYP
FT                   YVRKTASKSKSVMNGLSSPRLAIAMIYTLIITATSLLEQALLPLGFAALATGFAGRYFN
FT                   RRIGGITGDTLGAASQFVELSVYLGILIQSNFLTTISLLWKSF"
FT   gene            127191..127781
FT                   /locus_tag="Ctha_0109"
FT   CDS_pept        127191..127781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0109"
FT                   /product="Phosphoglycerate mutase"
FT                   /note="PFAM: Phosphoglycerate mutase; KEGG: mfa:Mfla_0100
FT                   phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12580"
FT                   /db_xref="GOA:B3QST7"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR017578"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:B3QST7"
FT                   /protein_id="ACF12580.1"
FT                   /translation="MEVFLVRHLEIPSYEKGVCVGQSDVALTETGLANIQPLAETLADL
FT                   EPEVIITSDLQRCKKLAEAIGSCLNLQIEVNPEWREINFGEWENREWEELRENDPENVK
FT                   KWIDDYVHVTPPEGESFFQLFERVGNQLMDLTRREKKRIIIVTHSGAIRSALCFALGIP
FT                   LDRSFSLEISYGAIAGLHYLNDRWSLFRLTNQL"
FT   gene            127799..128830
FT                   /locus_tag="Ctha_0110"
FT   CDS_pept        127799..128830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0110"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ote:Oter_1909 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12581"
FT                   /db_xref="InterPro:IPR025164"
FT                   /db_xref="UniProtKB/TrEMBL:B3QST8"
FT                   /protein_id="ACF12581.1"
FT                   /translation="METFYHNGVEKSVTIKEAQLFQRSMSLFLGSRLAKITIILAFVTL
FT                   FLDGVNISSRYKSNRLFGITTFTQRWDKTFQVAEGGTLVLNSEMGNIRIESWPEKKIEI
FT                   QADAQGSGGAIESYAIDFSQPTSHRVVVDAKHKTFFSYRPHLDLVYHIKVPENFNLELV
FT                   NGEGKVTVNGLKGSVHVHSSNGDIELINFEGIGKLETEKGTVLGQNVKGTLSASSIDGE
FT                   IEFEVFQGSLTAKTDAGKLTLMSVDGNIHATTREGNIQAELEGENTGAYFFSEEGVVEL
FT                   QLPSDIKANIEASSEHGTASFLPAGKLKAKKQNSFRKLSGAVNGGGKTIIAKSKEGNVV
FT                   VAM"
FT   gene            complement(128986..129936)
FT                   /locus_tag="Ctha_0111"
FT   CDS_pept        complement(128986..129936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0111"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG:
FT                   rrs:RoseRS_0808 radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12582"
FT                   /db_xref="GOA:B3QST9"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR040084"
FT                   /db_xref="UniProtKB/TrEMBL:B3QST9"
FT                   /protein_id="ACF12582.1"
FT                   /translation="MKYVFGPISSRRLGKSLGVDPIPSKTCNWNCVYCQLGRTRPLANE
FT                   RKEFVSTQEIVSEIREAVCQHKPSEIDWISFVGSGEPTLHAGIGRMIREVKSFTEIPVA
FT                   VITNGSLLSLPEVRADLQPADTVLPTLSAGSETLFRTIHRPHPDLTFAKHVDGLKAFRD
FT                   EYHGKLWVEVMLLKEVNDSEEELRKLADILRDLSPDAVHLVLPTRPAAESWVKLPEYDG
FT                   LMRAQAIFAGIAEIVHPAKGTLDLNADENIVQSILNVISRHPVMHQELEEALNAEPKIT
FT                   DPESVFAALRKSEQAQEVLQNGVLFWASSSAKETE"
FT   gene            complement(130156..132453)
FT                   /locus_tag="Ctha_0112"
FT   CDS_pept        complement(130156..132453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0112"
FT                   /product="TonB-dependent receptor plug"
FT                   /note="PFAM: TonB-dependent receptor plug; KEGG:
FT                   pdi:BDI_3481 putative TonB dependent outer membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12583"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSU0"
FT                   /protein_id="ACF12583.1"
FT                   /translation="MKKLYVQSFFTIFLLLSVLASPAVHAQDAGIIEGSVIDRDTQQPI
FT                   IGARIEVLGTTLGAIADMNGQFFIEGLQSGTYRLKATAVDYQPIVKSDIAVGSAQSVKL
FT                   VVEMQIDAYQAGEIVVTATQLFNKAEDVKVSSNELSQEEIRRSPGSAEDVSRMVQALPG
FT                   VATAADSRNDLIVRGGSPIENFIMIDGIEVPNINHFGTQGASGGPIGMINVDFLQEVTF
FT                   SAGGFPVKYGDRLSSIMDIQYRDGDKNKLTGKFDLGLAGAGFIVEGPIQKGKSSYIVSA
FT                   RKSYLDLLLSSTGLTAVPNYTNFNLKATYELSPTHKLAVIGLGGIDRIEFKGAEDEDDP
FT                   SNDHIEYDAWQSVIGLSHKWLAGKQTYVQTSLSQNNYHYGIDVDSAGTSEFSNNSLDSE
FT                   VLLRSDLSHRFSPADLFELGLQLCYLRTNNDIFQNSWIDYFSVQHETLHIDKLTEAFKL
FT                   GFYTQYTKTFYRRFSLTGGLRYDYFNYLNDPHAISPRASLSIDLQQNLKLNFAYGLYRQ
FT                   AVPLIWLIGDEANKNLKYIKATHAIAGVEYYPMEDVKVTVEVFNKNYDDYPASVANPQV
FT                   SYATVGTEYGLLGMEALESASTGYARGIEFFVQKKLTQTLYGLVNYAYSQIRFKALDGV
FT                   ERPSSFDYRHMFTIMLGYKFSNTLELSGKWRYTSGKPYTPVDLEASTALNQLQLDFSKV
FT                   NAYRFAAYHRLDIRIDKRYEFDGWNLVAFIDFENLYNRKNIDQLQWDEKKKRVDTVYQW
FT                   SFLPAGGIKVEF"
FT   sig_peptide     complement(132373..132453)
FT                   /locus_tag="Ctha_0112"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 27"
FT   gene            132647..133354
FT                   /locus_tag="Ctha_0113"
FT   CDS_pept        132647..133354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0113"
FT                   /product="cytidylate kinase"
FT                   /EC_number="2.7.4.14"
FT                   /note="KEGG: cte:CT0286 cytidylate kinase; TIGRFAM:
FT                   cytidylate kinase; PFAM: cytidylate kinase region"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12584"
FT                   /db_xref="GOA:B3QSU1"
FT                   /db_xref="InterPro:IPR003136"
FT                   /db_xref="InterPro:IPR011994"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3QSU1"
FT                   /protein_id="ACF12584.1"
FT                   /translation="MPEATLTKKIIIAIDGPAASGKSTTAKQLAQKLSYTYIDTGAMYR
FT                   AVTLKVLRDAFFEKIFSDELFLKKLLSETEVILKGEKVFLDGEEVTKDIRTNEVSSKVS
FT                   KVSSLPLVREKLVEYQRNMGKARGVVMDGRDIGTIVFPDAELKVFMIADAKERAKRRYA
FT                   ELKAKSPSGDPGVTLETLEQEILQRDEDDRTRAIAPLRKPDDARELDTSKMTIEEQVAA
FT                   IYELATDVISQLK"
FT   gene            133423..134370
FT                   /locus_tag="Ctha_0114"
FT   CDS_pept        133423..134370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0114"
FT                   /product="hydroxymethylbutenyl pyrophosphate reductase"
FT                   /EC_number="1.17.1.2"
FT                   /note="KEGG: pvi:Cvib_1518 4-hydroxy-3-methylbut-2-enyl
FT                   diphosphate reductase; TIGRFAM: hydroxymethylbutenyl
FT                   pyrophosphate reductase; PFAM: LytB protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12585"
FT                   /db_xref="GOA:B3QSU2"
FT                   /db_xref="InterPro:IPR003451"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3QSU2"
FT                   /protein_id="ACF12585.1"
FT                   /translation="MKVNVDMNSGFCFGVQFAIDRVEDEMKASGPLYSLGDIVHNAVEV
FT                   ERLEKLGLKTITIEEFKTLKNTRVFIRAHGEPPSTYKLALENNIELIDATCPVVMKLQQ
FT                   RIKEFYDRGYQVLIYGREGHPEVIGLCGQCNNEAIVLKHADLSDRGETEKIDFSRKTVL
FT                   FSQTTKDTTGFYELKANLENVFREHHAAQNFDSAATESIVPDFQAKDTICRQVSNRDQK
FT                   LAAFSKENECVIFVAGRKSSNGKVLFEVCKDANSNTHFIENQSELERAWFLRPDDSLVE
FT                   SVGVCGATSTPMWVMQQVAEHIRATFAAERFVQS"
FT   gene            134453..136303
FT                   /locus_tag="Ctha_0115"
FT   CDS_pept        134453..136303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0115"
FT                   /product="ribosomal protein S1"
FT                   /note="TIGRFAM: ribosomal protein S1; PFAM: RNA binding S1
FT                   domain protein; KEGG: cch:Cag_0570 30S ribosomal protein
FT                   S1"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12586"
FT                   /db_xref="GOA:B3QSU3"
FT                   /db_xref="InterPro:IPR000110"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSU3"
FT                   /protein_id="ACF12586.1"
FT                   /translation="MAASQTTQTVEEKVEPKVKKSKPVKFFADYGEAELKEMEALYSST
FT                   LNELNEEEIVKGRVVSISEKDVTIDVGLKSEGIVQLIEFQNPEELKEGDDVEVFLESIE
FT                   DKMGQLILSKRKADVMRIWEKIYDSLEKGTIISGKIIARVKGGMTVSLSGVEAFLPGSQ
FT                   IDVKPVRDFDALVGQTMDFRVVKINPLTQNIVVSHKVILEEEYEARRKEMLANIKVGMV
FT                   LEGTVKNITDFGIFVDLGGLDGLVHITDITWGRISHPSEAVNLDDPIKVVVIGYDADKQ
FT                   RVSLGMKQLTPHPWENIEEKYPAGTRVTGKVVSITDYGAFVEIEKGIEGLVHISEMSWT
FT                   QHIKHPNQFVTMGQEVECVILNIDKEHTKLSLSMKQTEEDPWIVLAEKYPVDSEHKGIV
FT                   RNITDFGVFVELESGVDGLVHISDLSWTKKIRHPSEIVKKNQELDVKVLKFDVKARRIA
FT                   LGHKQIEPDPWSDFENDYAVGTETKGKIAQIIEKGVIVELPSGVDGFVPASHLLQGGVR
FT                   DINASFKVGDELPLKVIEFDRENKRIILSALEYFKGKSKEEIEEYMKQHPKEKQEIQEA
FT                   TAELDAPSGSGDKKAKETEPAKAASSASESAPAKSNDEKK"
FT   gene            complement(136409..137374)
FT                   /locus_tag="Ctha_0116"
FT   CDS_pept        complement(136409..137374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0116"
FT                   /product="GTP-binding protein Era"
FT                   /note="TIGRFAM: small GTP-binding protein; GTP-binding
FT                   protein Era; PFAM: GTP-binding protein HSR1-related; KH
FT                   type 2 domain protein; KEGG: plt:Plut_1731 GTP-binding
FT                   protein Era"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12587"
FT                   /db_xref="GOA:B3QSU4"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005662"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030388"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSU4"
FT                   /protein_id="ACF12587.1"
FT                   /translation="MNEEETQQAELAKQNDPQNKGFKAGFATILGEPNAGKSTLLNVLL
FT                   GEKISIVTPKPQTTRKRVLGIFTDKSCQIVLLDTPGIMKPKYKLHEAMLDLADKSVEDS
FT                   DVLVLLLDVEKYQKGKAELKADLAFQRIANTKKPVILVLNKVDLITKDASLELIAKFSS
FT                   EYPFREIVPLSALKGYNIREFLKAVVPYLPASPPLYPPDILSTAPERFFVSEIIREKIF
FT                   QFFSQEIPYSTEVDVEEFQENYEKNPARKDVLRCAIVVDRLSQKSILIGKDGKAIKRVG
FT                   QAARKDIEAFLGRPVFLELFVKVKEGWREKESSLRDFGYK"
FT   gene            137456..138688
FT                   /locus_tag="Ctha_0117"
FT   CDS_pept        137456..138688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0117"
FT                   /product="rod shape-determining protein RodA"
FT                   /note="TIGRFAM: rod shape-determining protein RodA; PFAM:
FT                   cell cycle protein; KEGG: plt:Plut_1730 rod
FT                   shape-determining protein RodA"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12588"
FT                   /db_xref="GOA:B3QSU5"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR011923"
FT                   /db_xref="InterPro:IPR018365"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSU5"
FT                   /protein_id="ACF12588.1"
FT                   /translation="MREIKLFAQIDLTLLLSMLGLIVFGLMAIYSASHGVGVMGNYYKQ
FT                   LVWFGLSFFLLIIIFYMPPRIFQDYAYWIYGLSITGLVLVLLLGRKVGGATSWIDIGFA
FT                   RIQPSEFTKYSTILALARFLSERTTNIKTLRHFTTAIGIAVFPVILVLLQPDTGTALTY
FT                   LTFIVPMIVIAGFDFYIIVLMAIPFVFALVGFINLYALVVLGFVMMGFLILMRKEAIFL
FT                   SIGALAIGVMFGVFSSFYGKSILQPHQLKRIETFLDPMSDPKGAGYNALQAKVAIGSGG
FT                   LWGKGFLEGTQTQLRFIPAQWTDFIFCVIGEEFGFIGSTVLLTTFLIFITRLVMLIHII
FT                   KNEFAALVISGIVSVFFGHILVNIGMTIGLMPIVGVPLPFLSYGGSSLLANMVAVAIVL
FT                   NFYRNRRDLAL"
FT   sig_peptide     137456..137563
FT                   /locus_tag="Ctha_0117"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.905) with cleavage site probability 0.441 at
FT                   residue 36"
FT   gene            138696..139592
FT                   /locus_tag="Ctha_0118"
FT   CDS_pept        138696..139592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0118"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: afw:Anae109_2782 protein of unknown
FT                   function DUF6 transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12589"
FT                   /db_xref="GOA:B3QSU6"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSU6"
FT                   /protein_id="ACF12589.1"
FT                   /translation="MKTSFGAYAAMLGQTVLAGLSFAFARDASVEFEPFVLLLLRTLGS
FT                   ALFFGLIFYLRGGFNHSPKPSGSAWLKVGLLAFIGVALNQFLFLLGLKYTTPANSAVLY
FT                   TLTPLIVLFISVYFFKTEQLNAHKISGAVIAIVGALLVLFAQGYSFESDLMFGNFITLG
FT                   AVLSWAAYLSFGKRILPKYDSLQITATIMMLAAVIYFPIGIWFLPDFDWHEISMQAWIG
FT                   FIYITFFSSALAYLLLTVALNKIDSSQASVFINAQPFVAVLFSVLAYGEVLTPSLIFGG
FT                   LLSMLGILLMQRTALKS"
FT   sig_peptide     138696..138773
FT                   /locus_tag="Ctha_0118"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.988) with cleavage site probability 0.778 at
FT                   residue 26"
FT   gene            complement(139639..139971)
FT                   /locus_tag="Ctha_0119"
FT   CDS_pept        complement(139639..139971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0119"
FT                   /product="protein of unknown function DUF202"
FT                   /note="PFAM: protein of unknown function DUF202; KEGG:
FT                   cno:NT01CX_0294 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12590"
FT                   /db_xref="GOA:B3QSU7"
FT                   /db_xref="InterPro:IPR003807"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSU7"
FT                   /protein_id="ACF12590.1"
FT                   /translation="MAYSKFHPDDLILRDLLARDRTVLANERTLLAYIRTAVGILFTGG
FT                   TLIKFYHDILHFVILGAVLIFLSFVVAVLGGVRFFQVRGRLETIERIPEPHEMIQRQEK
FT                   GALENV"
FT   gene            complement(140057..141076)
FT                   /locus_tag="Ctha_0120"
FT   CDS_pept        complement(140057..141076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0120"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rca:Rcas_2174 uncharacterized component of
FT                   anaerobic dehydrogenase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12591"
FT                   /db_xref="InterPro:IPR020945"
FT                   /db_xref="InterPro:IPR036411"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSU8"
FT                   /protein_id="ACF12591.1"
FT                   /translation="MKNDTSPQQLETYSKGYHLLAGFFLGPFDRKLLSHAQALPYVMES
FT                   LRRAYRGAPDEAALLDLAGADHYELFCRQVFPYESFFLSEDARLGGSVSGAVQDFYGRY
FT                   RFEDELLLQESPDHFGLQLRFLGFLINREATALKARKLREAKAMRHAQRDFLSEHLLHW
FT                   IYPLVVSVREHGFCFFSFLTEVAFELVLEHWRLLAAHSDKPQAIRHHSGEATEAFEPEA
FT                   FLEQEETDLKKITGILMRPMQSGVMLSHKTMARVTQASRLPGFFNQRETTFKKLLETAI
FT                   EYEKLPEVLQSLDACLLQWKQNYEAAPGELKPFTEHWIKRLENSRRVVDAMLKATATQ"
FT   gene            complement(141356..144388)
FT                   /locus_tag="Ctha_0121"
FT   CDS_pept        complement(141356..144388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0121"
FT                   /product="molydopterin dinucleotide-binding region"
FT                   /note="PFAM: molybdopterin oxidoreductase; molydopterin
FT                   dinucleotide-binding region; molybdopterin oxidoreductase
FT                   Fe4S4 region; KEGG: cau:Caur_3201 nitrate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12592"
FT                   /db_xref="GOA:B3QSU9"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSU9"
FT                   /protein_id="ACF12592.1"
FT                   /translation="MPSSLSKFLSNVLGVGNLYNDPKEDAPKETTNVAGESLPKFGVTD
FT                   TAPENMIEVRQPDGRISSYPPPDKWDDWVQWDAKAWPQKVARRYTLVPTICFNCESACG
FT                   LTAYVDKTTFEIQKFEGNPVHPGSRGRNCAKGPATHNQIYDPERILYPLKRVGERGEGK
FT                   WKRISWEEALTEIGEKMRESRKIRKDGIVYHVGRPGEDHYVNRCIQSWGVDGHNSHTNI
FT                   CSAAARAGYAFWSGFDRPSADFSNARVILLLSAHLESGHYFNPHAQRIIEGQTKGAKII
FT                   TLDPRLSNTASKSDVWLPTWPGSEPTVLLAFANYLIQNDRYDKEFMRKWVNWEDTLAHF
FT                   ATHGTEGDLSNDGELESLRAELQDPEHRKNFEFFDRLLKVLYRDFTFERAAEESEVPIE
FT                   RLIESAEYIANCDGKLATHTWRSATMGNRGGWQVARTLFFLNVLTGSVGTKGGTSGNSW
FT                   NKFVPKPFKTPPPITAWNELHLPHEWPFAFYEMSFLLPHFLLEGRGEMDVYFTRVYNPM
FT                   WINPDGFVWMKALKDEQKIKCHVALTPTWNESAWFADYVLPMGHGPERHDLMSQETHAG
FT                   KWIGFRQPVRRVAMERAGKKVRFTYEANPGEVWEENEFWVELSGKMDPDGSLGVRQWFE
FT                   SPYREGELITQDEYWQWIFENSVPGLPEAAAKENLTPLAYMRKYGCFEVVHETYTPYAA
FT                   PIDGDAPGAEVDGERYKGFDTPSKKLEFFSPTLYNWGWKELEYTVPWQLKSHVHQDFIN
FT                   RSKGEMILLPTFRLPTLIHTRSANAKWLYEISHRNPVWMNPQDANRLQVTSGDLIRVET
FT                   EIGYFVDKVWVTEGIKPGVVACSHHLGRWRLDKQIGVSKGMSSLAELDESGHRFNLKII
FT                   HGAQSWESFDPDTSRVWWKDVGVHQNLTHAVHPDPISGAHCWLQKAMNVSKAAPDDNYG
FT                   DVFVDTEKSMQVYREWVALTRSAVDYSPDGTRRPHWLKRPLKPVKEAYKLPENPFGREV
FT                   KSAESSAGSAYMRFGSAQRSV"
FT   gene            complement(144415..146058)
FT                   /locus_tag="Ctha_0122"
FT   CDS_pept        complement(144415..146058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0122"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; Polysulphide reductase NrfD; KEGG: rrs:RoseRS_1792
FT                   4Fe-4S ferredoxin, iron-sulfur binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12593"
FT                   /db_xref="GOA:B3QSV0"
FT                   /db_xref="InterPro:IPR005614"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSV0"
FT                   /protein_id="ACF12593.1"
FT                   /translation="MNYSFVIDNRKCIGCHACSTACKSENSVPLGVSRTWVKYTEQGAY
FT                   PNTKRYFQVTRCNHCANPPCVRICPVTAMYQREDGIVEFDKNVCIGCKACTQACPYNAI
FT                   HVDPDSGTASKCHFCAHRLENGLEPACVVVCPQHAIVCGDLDDPNSEIQKVLSKNSVTV
FT                   RKPEQGTAPKLFYIEGHDLNLTPTAAEHLSKEFLWAETPAAYRNGHAKKSASTNGTKRK
FT                   STSGTAIRRLAAQGHPNGGTVQTGEREASQMAQVAYDIRHALQWHWPVPAYLVTKGVAA
FT                   GLILFLAVVHAFGLAKIGGTLAAVGFFTSLIFSALTSVFLVVDLEKPDRFLRVMFRPQT
FT                   KSWLARGAVYLGLFSTLSAVWWGSEMLSLMGVIGEISPELRTAALVAMIPFSLGVTVYT
FT                   AFLFGQAEGRDLWQSPLLPLHLIVQAVMAGAGTLLILNLFAPLAPEVFSLAKNGFLIFL
FT                   TLDLLVIFFGEIAMPHASETAAAAAHKMIHGEFKSYFWGGAIAVGHLAAFLLVLTNVGI
FT                   GMALGGVAMLVGLYFYEYAFVTAPQKVANS"
FT   gene            complement(146067..146285)
FT                   /locus_tag="Ctha_0123"
FT   CDS_pept        complement(146067..146285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0123"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12594"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSV1"
FT                   /protein_id="ACF12594.1"
FT                   /translation="MEKDKPLNDKFTVSAQAETKGGLSRSRISSPLNPTRKNLSAGAKT
FT                   EVIIKIVVFAQTDRVKTTLQQKQQRDR"
FT   gene            complement(146315..147424)
FT                   /locus_tag="Ctha_0124"
FT   CDS_pept        complement(146315..147424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0124"
FT                   /product="radical SAM domain protein"
FT                   /note="KEGG: bam:Bamb_0428 radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12595"
FT                   /db_xref="GOA:B3QSV2"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSV2"
FT                   /protein_id="ACF12595.1"
FT                   /translation="MQRGSLKEYLTEPFLKTLYDEVRKAGAIRSISLDLTHECNIHCKG
FT                   CYYFSQQINRLGSNATDGDFDRLIESEKERGTNFVTVVGGEPSLELGRLKKVYDNFKMN
FT                   VSTNGFRKIPYEGFEQMPIGVSVWGNHATDRKMRGSGKRDIFPVALKNYRNDSRAFWYY
FT                   TVTPGNAHEIQQVTEECVRNGNRVLYTFYSDLTNMGGSYDHRQGFQFAREEIARMIERF
FT                   PEHILLSNYIGEVVSTGKLFEQEWGYSVCTSISTNNPVNAERLTNGNPYSPHFRAYNAD
FT                   FLTTRRCCTATTRSCDSCLDVWQHFSWIILNMKKHLTTEADFTNWLTTMYLFYFINRLV
FT                   DWEKGAALLPEIHRRIGMERFTAEARKAS"
FT   gene            complement(147406..148434)
FT                   /locus_tag="Ctha_0125"
FT   CDS_pept        complement(147406..148434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0125"
FT                   /product="biotin/lipoate A/B protein ligase"
FT                   /note="PFAM: biotin/lipoate A/B protein ligase; KEGG:
FT                   sai:Saci_0351 biotin/lipoate A/B protein ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12596"
FT                   /db_xref="GOA:B3QSV3"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSV3"
FT                   /protein_id="ACF12596.1"
FT                   /translation="MMMQDTKQNAPIRVISLGKTDAVMTQAVYHAVAAAMTQDTPDTII
FT                   LTQPATPYLCIGYHQALEQILDLEICKAKQISIVRRKLGGGTTYLDENQIFYQCVFHQS
FT                   RLPARFEKIYAKLLSPPIEVLKNMGLDASLQGANEIEVSGKRIAGTGGGQLGEAAVVVG
FT                   NILLDFDMSAMTTVWFAPSHGFRRLAENALSERLTTLKQLGIDASPSELCEKLTNAYSQ
FT                   SLGRPIAIGSLTSEEQAKAEAFCQTLASDEFLALHEPEKKYRPLKISARAFIHHETLEI
FT                   DGMSFSVAMKVTDGIISDAVIECPKKRFHRKLHQFLIGKPLKNWQSELLLQEKEVLCNE
FT                   EA"
FT   gene            complement(148449..149549)
FT                   /locus_tag="Ctha_0126"
FT   CDS_pept        complement(148449..149549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0126"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB; KEGG: mta:Moth_0445 radical SAM"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12597"
FT                   /db_xref="GOA:B3QSV4"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSV4"
FT                   /protein_id="ACF12597.1"
FT                   /translation="MEQIKQTEKRTSEVSLTSPDVVRISMAAAVELGLKPGTIQGCRCN
FT                   CINLLQVYDEGCAANCSYCGLARERPGLADENTFIRVSWPIYPTELIAQKIAEVEARLG
FT                   VGRVCVSQVHHRSNNADMLAIVRQIRKVAPVVPISGLVNATTMSEGVLRELKAAGADMV
FT                   GFGLDAATPEIFEQARGRKARGPHNWERYWSMIRLARRLYGARHVNCHVIVGLGETDRD
FT                   LVRLISDAVRDEIAVFLFSFNPEPGTVMQHVQAQPIWRHRRVQLVKHLIENHGLTESEI
FT                   EFDDHGMISKLDVSDELIDRTIDEGIAFMTDGCPDRHGVMACNRPYGSYRPGEAFRDYP
FT                   FMPKAADKADIHKQLKLEELQPMKVA"
FT   gene            complement(149781..150746)
FT                   /locus_tag="Ctha_0127"
FT   CDS_pept        complement(149781..150746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0127"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB; KEGG: aae:aq_403 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12598"
FT                   /db_xref="GOA:B3QSV5"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSV5"
FT                   /protein_id="ACF12598.1"
FT                   /translation="MQDETMLRTDERAEAAFELRKANFPNEIVFHTPGLKQYQTSEYTK
FT                   HNSREFVAVSLTGTDCALNCKHCGKVLLRGMLNLKKFQGSLFEMCRKLSEDGAKGVLIS
FT                   GGSDRAGSVPLLKFIPDLARVKKELGLTVRVHPGLIDDETCSALREANIDGVMFDVIGD
FT                   RQTIREVYGLEKEPEDYEAVLARLEKYELPCVPHVVIGHYFGKLKGELNALEMVRRHPP
FT                   KMLVLVVLMAVAGTEMAEIAPPTIQDIEEIFFAARTMLPETLIGLGCARPIGEVKKQID
FT                   RSAIDMGLNSIAYPTEGMVKYAESKGLQARFINACCGVNW"
FT   gene            complement(150736..151884)
FT                   /locus_tag="Ctha_0128"
FT   CDS_pept        complement(150736..151884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0128"
FT                   /product="biotin/lipoate A/B protein ligase"
FT                   /note="PFAM: biotin/lipoate A/B protein ligase; KEGG:
FT                   sai:Saci_0345 biotin/lipoate A/B protein ligase family"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12599"
FT                   /db_xref="GOA:B3QSV6"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSV6"
FT                   /protein_id="ACF12599.1"
FT                   /translation="MDTWRLIQDDDASAGFGLAADETLARRVGAGTSEPTLRIYTYASH
FT                   SALVGRFQTVENEVNLPNCAKLGIAVNRRPTGGGAIIMGEGQLGVALTLSAKNQPAYAR
FT                   VKEMMARFSSGILSTFEQLGIDAAFKRKNDIEVNGKKIAGLGLHRTATGGLLFHASILF
FT                   DLDVALMLEVLKTPFEKITDKEIGTVAERITTVRKEARAPVSIDELRRLVGEGYEKTFE
FT                   TRLREDCFSAEEFLEANVLEKGKYATRDWIFQNSDVPDSAGKAKLKTPGGLLDVAVTLA
FT                   GKTLKALHLGGDFIASENAIADLEARFRWHSAKSDAVQETLYALYRERETELSHLPIHQ
FT                   VFQAIDAAIENALQKNESEKTEPYGCFVTPKTELGLGGGYAG"
FT   gene            complement(151896..152345)
FT                   /locus_tag="Ctha_0129"
FT   CDS_pept        complement(151896..152345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0129"
FT                   /product="glycine cleavage H-protein"
FT                   /note="PFAM: glycine cleavage H-protein; KEGG:
FT                   aby:ABAYE2103 glycine cleavage complex protein H, carrier
FT                   of aminomethyl moiety via covalently bound lipoyl cofactor"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12600"
FT                   /db_xref="GOA:B3QSV7"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR002930"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR033753"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSV7"
FT                   /protein_id="ACF12600.1"
FT                   /translation="MSRNEKLKFPEDRFYDSRYHFWAKPDPTTGNVVIGIDALGLDSAG
FT                   ELVYMSFHSAGSRVRRHESLGSLEAAKMTGEILSPVSGTIIQRNTNVLEEPSIVNAEPY
FT                   GRGWFVLINPDNWHDESKLLVSGNRITSWAKGEMMKRETESIFDR"
FT   gene            complement(153030..155069)
FT                   /locus_tag="Ctha_0130"
FT   CDS_pept        complement(153030..155069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0130"
FT                   /product="protein of unknown function DUF224 cysteine-rich
FT                   region domain protein"
FT                   /note="PFAM: protein of unknown function DUF224
FT                   cysteine-rich region domain protein; KEGG: ttj:TTHA1117
FT                   iron-sulfur protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12601"
FT                   /db_xref="GOA:B3QSV8"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSV8"
FT                   /protein_id="ACF12601.1"
FT                   /translation="MLYPAEQIAFVLLVLVCGGIAFQGFSRIVKLMQKSGSADRSDNLA
FT                   GRFIGALIDVGMQKPIFKARPLASLFHAFIFFGFSFYLLVNVNDVLEAFVPGWTTIGSE
FT                   NPIARGFNLFADIFSIFVLTGMIFFLIRRFVMKPKVFEFNKNVKLLPAVAEGGVRRDSL
FT                   IVGIFILIHVGSRWLGTVFHLAEHGHGDPFLPTASLIAPIFHGWGGLEVGIHVTWWLAM
FT                   GLIVVFLPYFTQSKHIHLMIAPVNLALARKTPRGRLDAPLDAKAPGAAKLRDLAWPQVL
FT                   DSYACIMCTRCHEVCPAHNSGTPLSPSALEINKRYFINQNAKQLTNGWEDPKLSDYAIS
FT                   EDAIWNCTTCYACVRVCPVGNEPMLDIVEMRRNLVFDAKMPAELADALRGLDEQGNSFG
FT                   DSARKRTKWTKPLDFKIKDATKEPVKYLWFVGDFASFNQNCEDTTRKVATVLQAAGVDF
FT                   GILGKDEKSAGNDVRRAGEEGLFAMLAEQNIKALEKANFEEIITTDPHTYNALKNEYPQ
FT                   FGGKFKVKHYTTLLLELVESGKIKLKKPLGVKTTYHDPCYLGRYNGIYDAPRELISRCG
FT                   VELVEMPRNHENSFCCGAGGGRIWMKEHEDMTQRPSENRVMEAAELGVAYFAVACPKDK
FT                   TMFTDAVKTSGNEGKLKVVDVIDFIYDAMEQSKAEAAKKEAVEA"
FT   gene            complement(155158..156102)
FT                   /locus_tag="Ctha_0131"
FT   CDS_pept        complement(155158..156102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0131"
FT                   /product="Electron transfer flavoprotein alpha subunit"
FT                   /note="PFAM: Electron transfer flavoprotein
FT                   alpha/beta-subunit ; Electron transfer flavoprotein alpha
FT                   subunit; KEGG: nph:NP3168A electron transfer flavoprotein,
FT                   alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12602"
FT                   /db_xref="GOA:B3QSV9"
FT                   /db_xref="InterPro:IPR001308"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR014731"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSV9"
FT                   /protein_id="ACF12602.1"
FT                   /translation="MGDILVVTEHLKGDFQDITFEMLGKAKELAGATGGKCLALVFGDM
FT                   KNKASELGAADAVIAVGTETEYNPESYAAAVKAAVEAKSPSLTLVGSTSMGMDIAAPVA
FT                   TALGLPVVGYCCGISNEGDGFSFVSQQYGGKMNVVTNVSGAAVALVLAGSFPAEAGQTS
FT                   GSPAVEDLAVSAGNGKVRFKKLIEPQGSDVDITQSEILVAVGRGIGSKDDIELAENLAE
FT                   ALKADVACSRAVVDAGWLPKTRQVGKSGLKVKPKVYIALGISGAPEHLEGMKSASTIIA
FT                   INTDKNAPIFDVAHYGINADLFEVCEEMLEELE"
FT   gene            complement(156357..157148)
FT                   /locus_tag="Ctha_0132"
FT   CDS_pept        complement(156357..157148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0132"
FT                   /product="Electron transfer flavoprotein
FT                   alpha/beta-subunit"
FT                   /note="PFAM: Electron transfer flavoprotein
FT                   alpha/beta-subunit; KEGG: afu:AF0286 electron transfer
FT                   flavoprotein, subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12603"
FT                   /db_xref="GOA:B3QSW0"
FT                   /db_xref="InterPro:IPR012255"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSW0"
FT                   /protein_id="ACF12603.1"
FT                   /translation="MFSTKQQNKNSKEVEMKIIVPLKQVPDLVEDLEVDGSGKALDTDD
FT                   IKFKLNEYDDHALEEALLLKEEGAATEVVVMAIDGDETDKMLYTALAKGADKAIKLTGD
FT                   TPHDTHQLAQAFANAAKTEGCDLILAGVQSVDDRDGQLGPVLATYLGLPCISAVAGVKV
FT                   QGSSVLVNKEYAGGMVAEFEMDLPGVLGIQAARQTPRYAPVSKVRQVQDSMSLATGSTG
FT                   DLGAGAGSEIASMAPPEKSGSATMLDSAGDLLEILKEKGVI"
FT   gene            complement(157579..158865)
FT                   /locus_tag="Ctha_0133"
FT   CDS_pept        complement(157579..158865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0133"
FT                   /product="protein of unknown function DUF224 cysteine-rich
FT                   region domain protein"
FT                   /note="PFAM: protein of unknown function DUF224
FT                   cysteine-rich region domain protein; KEGG: sat:SYN_01643
FT                   Fe-S oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12604"
FT                   /db_xref="GOA:B3QSW1"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSW1"
FT                   /protein_id="ACF12604.1"
FT                   /translation="MSEHKYQQTTQLESAIIDGVDISGEWNRMYVPREITDYDTQYLEE
FT                   ITALTGGESLGYCYQCAKCVGVCPVDNVGSYAPRKIFRKVQAGLNLIEDKDLWMCTTCM
FT                   NCLRVCPKEVNMLEIMPSAREKAVLDGKTPDELQEMLRSVAEYGNPMGESARNRIKWMK
FT                   KLNEKVRDLSKEDGSKPVDVLWHVSDYYAYHGRGNDAAKAMVRVFNKLGTDFGILGKEE
FT                   KTDGDSQRLVGESGLFDELVRHNDALFQKYPHNRLVVTDPHALNAFKKHYPAITGNELK
FT                   AEHYTQFLSEKLEEIKPLLKREFAKKVTFHDPCYLGRHNGEYDAPRNLINAIPGAEFVE
FT                   MYRNKQGSYCCGGGGGGQWLGGTVDEHLSERLSDNRVREAVEVGAEVLIVCCPYEVSRF
FT                   EDSVKATGNDGKLIVRDIIEILDYCMGED"
FT   gene            complement(158866..159621)
FT                   /locus_tag="Ctha_0134"
FT   CDS_pept        complement(158866..159621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0134"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: aae:aq_397 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12605"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSW2"
FT                   /protein_id="ACF12605.1"
FT                   /translation="MLYDNISIETLIDSEASHELLKQVNRLASSEKLKTLGVRLEEKGR
FT                   LFEQTFAESAIDRMTETDLRRVLLSVFSVRKKSLFFVQANGFEPLKAEIKTLLYGNKPV
FT                   AERHDWFLDAVKGINEMRALNLAGELLHFTMPDKYWLWTTWIWSPKNGKGALPLVLSDK
FT                   AELAGATYGESYLKVGQAVAELTRDGHTSGYARFGKGLYGTDVFLACVYAVYMNLVFKV
FT                   KLSQEYNRILPELSELAERVLGVQGKETN"
FT   gene            159791..160057
FT                   /locus_tag="Ctha_0135"
FT   CDS_pept        159791..160057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0135"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12606"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSW3"
FT                   /protein_id="ACF12606.1"
FT                   /translation="MSACFVSLPFFFVSLSGDEGLLFQEAVFRLRSTRHGFSSSFSCQP
FT                   VFFHVSLLCQPAMFLVSLSGDEGLLFQEAVFLVSLSGDEGLPF"
FT   gene            complement(160168..161229)
FT                   /locus_tag="Ctha_0136"
FT   CDS_pept        complement(160168..161229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0136"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: aae:aq_395 heterodisulfide reductase
FT                   subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12607"
FT                   /db_xref="GOA:B3QSW4"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSW4"
FT                   /protein_id="ACF12607.1"
FT                   /translation="MPNLPVLVIGGGPAGLEAARGVADLGYKAVLVEKESVLGGRPILE
FT                   SYAALTPDMRNTEEAMNEMIGRISNNEAVDIRTGATVTAVEGEAPNFKVTLQNGSGAET
FT                   LDVSSVIVSTGFQHFDPGRETQMYGYYEFDDVITLTDAEKMLKAGKFVRPSTGEAPKRV
FT                   AFIQCVGSRDRQIGNKWCSKVCCGIASKQASEIRHFVPDAKLFIFYIDLRAYGFWEDEL
FT                   YWKAQEENKVNYIRGIVTEINKRGESVVVKGEDTTMGRPMEIPMDMVILSVGMEPSEGT
FT                   KDMSKLFNLPLESHGYIATTGGALNTVETTVPGVFIAGAAGGPADLEDSVSMAGAAASR
FT                   ACAFIRKSEMAVA"
FT   gene            complement(161222..162430)
FT                   /locus_tag="Ctha_0137"
FT   CDS_pept        complement(161222..162430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0137"
FT                   /product="protein of unknown function DUF224 cysteine-rich
FT                   region domain protein"
FT                   /note="PFAM: protein of unknown function DUF224
FT                   cysteine-rich region domain protein; KEGG: sso:SSO1129
FT                   Heterodisulfite reductase, subunit B (HdrB-1)"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12608"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSW5"
FT                   /protein_id="ACF12608.1"
FT                   /translation="MSHASNGAPTVITPPKVAERIFKRQGNPEKEDYREQLFELEAKGE
FT                   LEVIRVPEPYVEVETKFGRKKKIPLEHTWHHKSCGQCGHIPGYPTSIFWLHRQFGFDYF
FT                   DPKDQTSCTAWNYYASSTSNPPAQASIAVRNFSQAHVDGYFPFIHCGTSYGHYKETRDQ
FT                   IIHFPKLREQVRRIMDRLNMPFAFPEEIVHYSEWLHVMRDRIAERKVLDLSNVTVSVHP
FT                   ACHYHKLIPEDAIYNDDIYNGQRTSVVTGIAQALGAKVADYSNWHDCCGFGFSHILVNR
FT                   DFSRSFAAIRKIERMKEEANPDLVLAHDTGCLTTLDKSQFATRAHNRKVGIPVMSDVQF
FT                   AALAMGAHPYKVCQLHWHGVDNKPLLEKMGIDHEKAWAEFEEQAEKIKSGETQFMTWEE
FT                   ADA"
FT   gene            complement(162472..163209)
FT                   /locus_tag="Ctha_0138"
FT   CDS_pept        complement(162472..163209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0138"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: aae:aq_391 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12609"
FT                   /db_xref="GOA:B3QSW6"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSW6"
FT                   /protein_id="ACF12609.1"
FT                   /translation="MSIYRDAKYADVAPAEKLRLFNEVKADFRWHHVLYGCYECGICTA
FT                   SCPSARFYDFSPRVFAQIMAREDIDSFYELLNDVMWSCSQCFSCTRCPRHNSPGGIITI
FT                   MREVAVNNGLDSAKEALKAYSRIIYKVMSTGTQVAPDMLQPDFFPDWGPDVKRVSENLD
FT                   VWRRAIPPDTLHTTELAWDVSDKTRLQLYMIFKLTGNLEMIENIDEGIYMILEEVMESL
FT                   MDEKDLDIDDFENILEGEEEAEH"
FT   gene            complement(163221..163505)
FT                   /locus_tag="Ctha_0139"
FT   CDS_pept        complement(163221..163505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0139"
FT                   /product="thioredoxin"
FT                   /note="KEGG: llm:llmg_0779 thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12610"
FT                   /db_xref="GOA:B3QSW7"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSW7"
FT                   /protein_id="ACF12610.1"
FT                   /translation="MAELVLCVFTHPACPRCPAAVEMAWRLSEEFRDMKLKTVKLENKE
FT                   GLSFAQKLHVKTIPTMIFFKNGKEEKRFVGLPKPEELKAEFVRLSDTET"
FT   gene            complement(163509..163970)
FT                   /locus_tag="Ctha_0140"
FT   CDS_pept        complement(163509..163970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0140"
FT                   /product="glycine cleavage H-protein"
FT                   /note="PFAM: glycine cleavage H-protein; KEGG: aae:aq_944
FT                   glycine cleavage system protein H"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12611"
FT                   /db_xref="GOA:B3QSW8"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR002930"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR033753"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSW8"
FT                   /protein_id="ACF12611.1"
FT                   /translation="MPEINNCMLPEDLLYHVGNNVWIKVNDDGTIDLGMTDIAQSMAGS
FT                   IIHCKPKKVGKTVEKGKSVATVESGKWVGPVKTPCSGEIIATNPAIDSDATILNKSPYK
FT                   QGWIVRLKPTDFEADKSELQSGADAADGFKAYMKEKDFNECIHCEGFDG"
FT   gene            complement(164163..164537)
FT                   /locus_tag="Ctha_0141"
FT   CDS_pept        complement(164163..164537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0141"
FT                   /product="DsrE family protein"
FT                   /note="PFAM: DsrE family protein; KEGG: aae:aq_401
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12612"
FT                   /db_xref="InterPro:IPR003787"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSW9"
FT                   /protein_id="ACF12612.1"
FT                   /translation="MVDEGSVVIFVTSGTQTPQRCGTPFYMASISASMDHEVTMIFQID
FT                   GVLLMKKGQTDNIAAKEGGKKIIDFIREAKEAGVKMHVCAAAMQLHDMKESDLIEECDG
FT                   LIGASFMTEMAMDSDLTLIY"
FT   gene            164911..166122
FT                   /locus_tag="Ctha_0142"
FT   CDS_pept        164911..166122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0142"
FT                   /product="DNA polymerase III, subunits gamma and tau"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: cte:CT1324 DNA polymerase III, gamma/tau
FT                   subunit; TIGRFAM: DNA polymerase III, subunits gamma and
FT                   tau; PFAM: AAA ATPase central domain protein; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12613"
FT                   /db_xref="GOA:B3QSX0"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSX0"
FT                   /protein_id="ACF12613.1"
FT                   /translation="MSYLVIARKYRPQKFSDITAQEHVTRTLRNAIRTGRIAHGYIFSG
FT                   SRGVGKTTAARILAKGLNCEKILKDEAYRETVSEPCGECESCRDFDAGSSLNISEFDAA
FT                   SNNSVDDIRALRENVRYAPQKGRYKVYIIDEFHMLSNAAFNAFLKTLEEPPSHAVFIFA
FT                   TTELNKVPPTIASRCQKFNFKRISVLDIQERLAEICAAEAINIDVDSLTLIARKADGAM
FT                   RDAQSLLDQVISFFLSTENEKIEYTNVAALLGDIDDEHFFAVTDSIKEKNHAKVLELSR
FT                   YIFDNGFDTLDFLARLVEHFRNFLLVKNLRSSKLIERTEAAKKRYEAEADTFSAEELMR
FT                   FIDVVNQAEKDIRFFREPQLRFELALLKLLHADVSSGDTEARLSEFDQRLKAIETEIKK
FT                   KTSR"
FT   gene            166161..166742
FT                   /locus_tag="Ctha_0143"
FT   CDS_pept        166161..166742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0143"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cph:Cpha266_1651 DNA polymerase III, gamma/tau
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12614"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSX1"
FT                   /protein_id="ACF12614.1"
FT                   /translation="MAGQTNITALTRIPSSSEVLSIDFQAWKEKFNKFIEESTYQPKLL
FT                   GKKRSQENNPDASKETQPERFAEEHKPILPIEEISRRWENFLLSLEEKGNGLLASNLKV
FT                   CEIKALKGRELTLLCSKEFAFEMLSGELARLSEAMQNFFQTPIYANLTIDKELVKATTE
FT                   KSPYELFQELAKKNKLIKYLVDEFGAELIY"
FT   gene            167055..168035
FT                   /locus_tag="Ctha_0144"
FT   CDS_pept        167055..168035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0144"
FT                   /product="Mg2 transporter protein CorA family protein"
FT                   /note="PFAM: Mg2 transporter protein CorA family protein;
FT                   KEGG: tcx:Tcr_0935 Mg2+ transporter protein, CorA-like"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12615"
FT                   /db_xref="GOA:B3QSX2"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSX2"
FT                   /protein_id="ACF12615.1"
FT                   /translation="MAHTRNHGLIHGYLLDGKGGALEMDWPAIQAWSEEKGVRWLHFDY
FT                   SDSHIEKWLTAESGLKPLISEALLAEDPRPRATLIDDGLLIALRGINHNPGAEPEDMVS
FT                   IRLWLTSSQIISTGKRDLRSVKDMVADFSAKKGVKNAGEFIVDLSDYVIWRMTETLENL
FT                   DDEISATELEVLSFGGGELRGKLTEIRLQAVALKRYLAPERDALNRIQIEKVTWLSDHH
FT                   RLQLKEITDRLIRHIEDLDEIRERAAIAHDELGNKLSEQLNRRMYMLAIVTIVFLPLGF
FT                   LTGLLGVNIAGIPGAQNPNAFNIFLGLIFAVIFVQLILFKFKKWF"
FT   gene            168109..172587
FT                   /locus_tag="Ctha_0145"
FT   CDS_pept        168109..172587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0145"
FT                   /product="signal transduction histidine kinase"
FT                   /note="KEGG: mbn:Mboo_1812 signal transduction histidine
FT                   kinase; TIGRFAM: PAS sensor protein; PFAM: ATP-binding
FT                   region ATPase domain protein; histidine kinase
FT                   dimerisation/phosphoacceptor; PAS fold-3 domain protein;
FT                   PAS fold-4 domain protein; PAS fold domain protein; SMART:
FT                   PAS domain containing protein; PAC repeat-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12616"
FT                   /db_xref="GOA:B3QSX3"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR011495"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSX3"
FT                   /protein_id="ACF12616.1"
FT                   /translation="MCKTDTLNAAILNSLDSEIVAIHADGRIIAANDAWLDFAKEIFPN
FT                   EAFANGGVGKNYVQLCEEVVQINPQAKSALVGLKSVLSGQCAHFELEYPFKIGEKLSWV
FT                   WMKATPLKQEGGGAVITQTNVTMPKCSQAKHLQHDITEKVLHVFPDLIYVHDLQERRNV
FT                   YVNRELFSVLGYQPEDVQEPGFITSIIHPEDYAKVYQKNMRFSEEHDREFFEIEYRIRH
FT                   ANGEWRFLRSREMIFARDDNGFPKQILGIAQDVTKEKQSEFALQESEERFHLLLESAED
FT                   MIFVHDKTGKILYYNGSSKYGICAKDLVGKHPTDFLPAKKAADILERIHLVFESGQSCQ
FT                   FEVAGYFGGVDYVVSEHAFPLQDSNGHIHSVARICRNIAHQKAMQKALQESEAQYRTLV
FT                   ENSLIGLLIVQQDRVLYANPVLVEKLGFPANALIGESIDNFVLHIHPEDRELVKRHYRQ
FT                   FMQGKQTHQTYECKVLAKDGSLLWTVICAKEIHFKGEPALQVAVLDISDRKKIERALQE
FT                   SEKKYRLLVENSLQGILILQHDQLLFVNKAVSDITGYSMAEMKQLPFSTVTGIIEKRDR
FT                   DAVLENYSHRKTDQPAPEQYEIWIRTKQDKRVCVIINAKVLQYQNEPAVYVTLTNITEK
FT                   KQIMKALQESERKYRMLVEHSLQGIFVVRNHRICFANQAATEILEYSLDELMAFSREEL
FT                   LNLVHPDHRERLVEYQASILRRNPRWKNTEAKILTKSGRYAWLLLSGKQMDFDGQDEML
FT                   IATIDISQQKQAESELRKSEAFLEHVIESIQDGIFVLDKHLTVRHSNSVMRKWNNHSGE
FT                   LIGKKCHEGYRENASSCADCPTLRALSSGKTEHGTVPGLPHSEIEWLELYSYPLFDKET
FT                   NEIQGVVEFARDITERKRAENELLESEEKYNRLFQNSQDGILLHDADGRIIDANSKALQ
FT                   SFGYSLEELLCKAVCELHPPNMQNKCREAFLALSEKATVTFEIEFLTKNGSTFLAEVTS
FT                   SQFDFHQKKLVQGIVRDITERKRAELALKQSEAKYRRLFEDAALGIFQSTLAGKVLSAN
FT                   ISFANMFGFKSEHDAIISVKDAAQELYADPHKRAAVIQKALSGAQPVIEECQFRRKDGS
FT                   CFTGILFLRAVKDELGQLTHLEGFIEDITERKTAEKALQKSQAMYKLLADNADDVIWTT
FT                   DNHLNFTYVSPSVKLMYGYEPDEFLEFSVQAILPSPVFEDALTAQLLQDEFDPSIVEKC
FT                   VSLRNEYEQQRKDGSRFWAEVIMRRLHNENGEALSGFIGITRDITHRKQAEEKLKASLK
FT                   EKELLLRELYHRTKNNMQVISSLLALQTRHFQDPDIKAVFQDTENRIRTMALVHQKLYQ
FT                   SESLTNIDLQEYIEDLVALLAASYEVSANRILVSLNTEKVIVAIDFAIPCGLVLNELIS
FT                   NAFKHAFPGERQGRIRIGLRKKDEGTTELYVSDNGIGLPKMLDIRKTKSLGLKTIFTIV
FT                   EQQLHGLVDFSTQSGVTCRCIFSNTLYKSSL"
FT   gene            172592..172963
FT                   /locus_tag="Ctha_0146"
FT   CDS_pept        172592..172963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0146"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   mbu:Mbur_2285 response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12617"
FT                   /db_xref="GOA:B3QSX4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSX4"
FT                   /protein_id="ACF12617.1"
FT                   /translation="MNEETKILIVEDEAITSMLLEVELSNLGYACTCVSTGEEAIDRVR
FT                   MMNFSLVLMDIRLAGGMNGIETAAQIRQQAQTLPIIFATGYSDKKMIEDANHVNPVCYL
FT                   VKPLKLKELLAVIQSLLKP"
FT   gene            complement(173041..174114)
FT                   /locus_tag="Ctha_0147"
FT   CDS_pept        complement(173041..174114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0147"
FT                   /product="putative adenylate/guanylate cyclase"
FT                   /note="KEGG: gfo:GFO_0037 membrane protein containing
FT                   adenylate/guanylate cyclase catalytic domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12618"
FT                   /db_xref="GOA:B3QSX5"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSX5"
FT                   /protein_id="ACF12618.1"
FT                   /translation="MKTLLQIITGFILAGYTYLTVIIAVGHAFGKTIYPCDFFSYFRVT
FT                   LIAILVGTAVTIPELFIIPKMIGRLSFGLNLLARTVLYLFFAALAVVLFSVAYYSISLS
FT                   TLPWHLLRHASVVAFVKGEFLVILLLCLIVAFLINALRLIVNRFGEGVFWNYISGRYHI
FT                   PHEEERIFMFLDLYASTTIAEKIGHYQYHQFLNELFTDISEPIWHNLGEIYQYVGDEVV
FT                   ITWPVQIGLKDAHCLKCFFEIRSVLKSKEAHYEAEYGFVPEFKAGLHAGKVIAGEVGEL
FT                   KTEIVFHGDTVNTASRIHSECSVYRRDFLISGDVLKLLQPYLKGQYDIEYIGHILLKGK
FT                   ENEIALYSIHPAIALKL"
FT   gene            complement(174353..176404)
FT                   /locus_tag="Ctha_0148"
FT   CDS_pept        complement(174353..176404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0148"
FT                   /product="Oligopeptidase B"
FT                   /EC_number="3.4.21.83"
FT                   /note="PFAM: peptidase S9 prolyl oligopeptidase active site
FT                   domain protein; peptidase S9A prolyl oligopeptidase domain
FT                   protein beta-propeller; KEGG: ava:Ava_1786 Oligopeptidase
FT                   B. Serine peptidase. MEROPS family S09A"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12619"
FT                   /db_xref="GOA:B3QSX6"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002470"
FT                   /db_xref="InterPro:IPR023302"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSX6"
FT                   /protein_id="ACF12619.1"
FT                   /translation="MSKKSAISPVAKKKPIFKKLHGITLQDDYFWLREKTNPEVIAYLE
FT                   AENRYTADSLKHTTGLQKKLYEEMLARIKETDLSVPDKKDDFYYYSRTEKGKQYSIFCR
FT                   KQGSAEAKEEILLDKNKLAEGHSFFSTGVIIVSPNHQYLAFSTDKNGSETYILYIKDLQ
FT                   TGRLFHEQIENVSTAVWANDNKTLFYTIVDKTKRPYKVLRHVLGQPVSHDVEVYHEKEQ
FT                   GFEINLSRSKSGAFIFLHTSIKTQTEVRFLRADCPEARFQLVQSREKNHEYSVEHHDDR
FT                   FFILTNKNAINFRLMTAPVSNPESANWTECIAANDHVKIDHIAAFREHLVVFERRDGLQ
FT                   QLCIIHLDSKTQHAVQFPEPVYTFWPALNPDFNTSVLRFHYTSLVTPETVYDYDMNTKK
FT                   WELKKRYEVLGGYEPANYESERIFAKAEDGAEIPISLVYKKGLKKDGSNPIFLYGYGSY
FT                   GINIEPEFRSMRLSLLDRGFIFAIAHIRGGEEMGRRWYEDGKFLKKKNSFTDFIACTEH
FT                   LVAEKYASPKKLVISGGSAGGLLMGAVINMRPELFTAVVANVPFVDVLNTMLDPSLPLT
FT                   ISEYDEWGSPEEKDYFEYIRSYSPYDNVQEVEYPNMLVTGGLHDPRVSYWEPAKWVAKM
FT                   RAMKKGNNRLFLKINMGAGHSGASGRYDYLKELALEYAFILDSLGIPD"
FT   gene            complement(176620..177075)
FT                   /locus_tag="Ctha_0149"
FT   CDS_pept        complement(176620..177075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0149"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; KEGG: chu:CHU_0954
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12620"
FT                   /db_xref="GOA:B3QSX7"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSX7"
FT                   /protein_id="ACF12620.1"
FT                   /translation="MKLEEEIQQKEFDSAYHKAAVNIMYTYHWLHEKFSQALKSEGITT
FT                   QQYNILRILRGQYPNPSTIYLLRDRMLDKQSDTSRLVKRLAQKGLVKRDENEQDKRKID
FT                   VLISPLGLELLHKLDVKVNRVIEGFSYLNKKDAECLNSLLDKFREEV"
FT   gene            complement(177190..177777)
FT                   /locus_tag="Ctha_0150"
FT   CDS_pept        complement(177190..177777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0150"
FT                   /product="YceI family protein"
FT                   /note="PFAM: YceI family protein; KEGG: fjo:Fjoh_1733 YceI
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12621"
FT                   /db_xref="InterPro:IPR007372"
FT                   /db_xref="InterPro:IPR036761"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSX8"
FT                   /protein_id="ACF12621.1"
FT                   /translation="MKKVVFALVFLFTASKALFAADVWSFDKAHSNVRFSVSHLVITDV
FT                   EGAFKSYDGKVVSENEDFSGSKINFTIDVASIDTDNEKRDEHLKAADFFNADKYPHITF
FT                   ESKSFEKVSGKKYKLVGDLTIKGVTKEVALEVIYNGTVNSPMGGIKAGFKITGEINRFD
FT                   YGLEWNKLMETGGAIIGETVSITCNIELNKEA"
FT   sig_peptide     complement(177715..177777)
FT                   /locus_tag="Ctha_0150"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 21"
FT   gene            178183..179349
FT                   /locus_tag="Ctha_0151"
FT   CDS_pept        178183..179349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0151"
FT                   /product="6-phosphofructokinase"
FT                   /EC_number="2.7.1.11"
FT                   /note="PFAM: phosphofructokinase; KEGG: rca:Rcas_2513
FT                   6-phosphofructokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12622"
FT                   /db_xref="GOA:B3QSX9"
FT                   /db_xref="InterPro:IPR000023"
FT                   /db_xref="InterPro:IPR012003"
FT                   /db_xref="InterPro:IPR022953"
FT                   /db_xref="InterPro:IPR035966"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSX9"
FT                   /protein_id="ACF12622.1"
FT                   /translation="MKIGILTGGGDVPGLNPCMKAVVYHAIDDGHEIVGIRRGWGGLLN
FT                   FNPDDPKSYDENIIPLDKQKVRTIDRTGGTFLHSSRTNPSKVRVKDVPDFLRDPKTKNT
FT                   DDASSDILDFTPHVLKNLEILGIDTLIPIGGDDTLSYGERLHREGVSVVAIPKTMDNDV
FT                   FGTDYCIGFSTAVTRSVQFIHQLRTSTGSHERIAVIELFGRNSGETSLISSYLSGVDRA
FT                   IISEVPFDPEILASLLLKDYNANPSSYAMVTISEGASMVGGKIIEYGEADAYGHRKLGG
FT                   IGMITGEAVKKLTGKGIVYQQVGYLMRSGAPDALDLMIAINFAGIAMGLLKDKVSGRMV
FT                   ALRDGTYTHIPISTIASGIKRVDVDELYDPKEYRPKVRNVLGKPMFLY"
FT   gene            179963..180229
FT                   /locus_tag="Ctha_0152"
FT   CDS_pept        179963..180229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0152"
FT                   /product="RNP-1 like RNA-binding protein"
FT                   /note="PFAM: RNP-1 like RNA-binding protein; KEGG:
FT                   dvl:Dvul_1024 RNP-1 like RNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12623"
FT                   /db_xref="GOA:B3QSY0"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSY0"
FT                   /protein_id="ACF12623.1"
FT                   /translation="MRKTIYVANLPFGTSEDEVRELFEQHGTVHSVKFIMDRETGKFRG
FT                   FGFVEMDEDEAIPAIDALNGLSFGGRNLQVNEARERKPKSKRF"
FT   gene            complement(180386..183106)
FT                   /locus_tag="Ctha_0153"
FT   CDS_pept        complement(180386..183106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0153"
FT                   /product="exporter of the RND superfamily protein-like
FT                   protein"
FT                   /note="KEGG: pca:Pcar_2082 predicted exporter of the RND
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12624"
FT                   /db_xref="GOA:B3QSY1"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSY1"
FT                   /protein_id="ACF12624.1"
FT                   /translation="MREKMLRKFAKMHAKNPWLWLGATLILTLLFAYFASNLRTTMRWA
FT                   DLLPEKDPRTIEYNEIVNEFTAASSIVVLVQGEEARIKAFADFLAPKLKTLIDSADGKP
FT                   FVKRVDYKQEVDFVRNHGLMLIKSDYLKNTQDIFKNPNLQPFLTNLNNSLEKEYVGKSE
FT                   AISGREKEDRAVMFLDGIDFFVRSLQQAISNECLATGNVSDAVDRILLGDPYFMSYDKK
FT                   VLILNVIPTFTAVDMEKVMRGVGAVQAALDEAKKSYPDVKAGLTGMLPLSHDEMVYSEE
FT                   SLGYTTVIALVAIFFMLAFALRMWSAPALAILNLMIGIVWAMGMAALLVGELNIFTSMM
FT                   AVILLGLGIDFSIHLISTLSEFRSLRHTIEDAMVETFLKSGKGIITGGLTTFAAFFTLI
FT                   ISSSRGMKEMGLVTAFGLLMILIATFMFLPSLLVLRERRLEKAFLQKKKEIKRQDVSFK
FT                   QFGNFSGWLGRKYGFTLTAVVLVTFALGFYAQKITFDQNYMNMEPEHLASVALQDTVLK
FT                   KFDLSMDFAMILANSPDEVRQQADAVKKRSTVAMTDDISAYLPAPDEQRARAEIIKKIK
FT                   SEIVASQAKPELINQEFEDFIGELERLEMNIMEMQDLAYLGGQDKVDRKCASLVGNPND
FT                   KQAKSILASLVHLIKEKPEHAHVALDAYQAEFAPYFKSTALQMATISPIELNTLPESIL
FT                   DRYANASRDKFLLTVFPNQSVWADMSYLDCFTQDLQTVSTKVTGMPIVFMTLIEVIGKD
FT                   GKNAVLLTLFVVFLLLWVDFQNPLFALIAMIPLTVGMIWMIGLMVIFGMELTVINVMAL
FT                   PMIVGIGIDDGVHVLHRWQSEGQGKLSLIYAGTGKAILLTSLTTMLAFGSLMFSVWPGF
FT                   ASLGNAMSVGVGACFLTTTVILPGILGLFEQRKHR"
FT   sig_peptide     complement(182999..183106)
FT                   /locus_tag="Ctha_0153"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.968) with cleavage site probability 0.661 at
FT                   residue 36"
FT   gene            complement(183189..184418)
FT                   /locus_tag="Ctha_0154"
FT   CDS_pept        complement(183189..184418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0154"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vpa:VPA0561 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12625"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSY2"
FT                   /protein_id="ACF12625.1"
FT                   /translation="MKREKKTERAMRFFCQEKQKSEVALFFILCLISFHLPSAEAQELN
FT                   IFGYLEPQMMIVRQNKKWVQMSSNRLRVETRSVLNEQVSFGGNVIFLTYHGQTNWNFLD
FT                   YLPSHLTKQIPAALQSGFAYTYQDSIFLDNAFLKIRFEQFDLTIGKQQLSFGTGYAWNP
FT                   TNLFNVKNLTDPTYEQPGHNAIRADIGLTERSSLTAIVQLEEFLRRSAAFLRWTFPLSR
FT                   LDFSLIAAQKYWALSDYEVFDFSTQKRQMLGFDFAGELLGLGVWGEFGHNFMARDENFT
FT                   EILVGTDYTWDGGFYLMAEFYHNSLAKSNWQSYTLTDWIRYLNGELLTVTKNQAYVFLS
FT                   YPLTDLLTASLSNILSLSDKSAGFVSSVRYSLFENLMLTVIGQIYTGREGTAYGKNFGD
FT                   GGLVRLRLFY"
FT   sig_peptide     complement(184293..184418)
FT                   /locus_tag="Ctha_0154"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.982 at
FT                   residue 42"
FT   gene            complement(184415..185131)
FT                   /locus_tag="Ctha_0155"
FT   CDS_pept        complement(184415..185131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0155"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tde:TDE2009 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12626"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="InterPro:IPR033399"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSY3"
FT                   /protein_id="ACF12626.1"
FT                   /translation="MNLQIAAAQTAEEIIKKINDLLNQETVFSKSKMVIETSSGQLRTF
FT                   EYDSWGKDHNEKTLIRYTSPARAKGQAILMRNNADDIWMYFPRTDRVRKMATHAKRQKM
FT                   EGSDFSYEDMGSGDSFLTDFDVKLLGSGKIADEDCFKLELIRKSGSTSAYQKMSIWSAK
FT                   KHFHPLQMEYFEDDGIQPAKRLTLSDIETIQGVPTAMKMIMKDLADGTQTEMQLLEVKY
FT                   GVSLDEKMFTERGLRQ"
FT   gene            complement(185219..185830)
FT                   /locus_tag="Ctha_0156"
FT   CDS_pept        complement(185219..185830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0156"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: nfa:nfa37280
FT                   putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12627"
FT                   /db_xref="GOA:B3QSY4"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039538"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSY4"
FT                   /protein_id="ACF12627.1"
FT                   /translation="MPKFVDKEAKRLEIISAAMKVFAQSGVVNAKMSEIAEVAGVGKGT
FT                   IYEYFRSKEEIFSHAFELFFQEMRTALREIANSSDSPEARLRKFIKTALVDFTTGNEEF
FT                   LNIMLDFWAEGIRSKNENVSQILDLDAIYSEFRAVIASILDEGIREGSFRPVDSNIAAS
FT                   TLIGVLDGLYLQWAINPFVFKFEEVGDFLVDNFLRGIKNN"
FT   gene            complement(186008..186214)
FT                   /locus_tag="Ctha_0157"
FT   CDS_pept        complement(186008..186214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0157"
FT                   /product="zinc finger CDGSH-type domain protein"
FT                   /note="SMART: zinc finger CDGSH-type domain protein; KEGG:
FT                   sus:Acid_5312 zinc finger, CDGSH-type domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12628"
FT                   /db_xref="GOA:B3QSY5"
FT                   /db_xref="InterPro:IPR018967"
FT                   /db_xref="InterPro:IPR042216"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSY5"
FT                   /protein_id="ACF12628.1"
FT                   /translation="MSAKITVFSNGPIKVEGDAQILDMNGAPLAESGKMVFLCRCGHTQ
FT                   NTPYCDGSHKKVDFKSEVKAENA"
FT   gene            186419..187516
FT                   /locus_tag="Ctha_0158"
FT   CDS_pept        186419..187516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0158"
FT                   /product="histidinol-phosphate aminotransferase"
FT                   /note="TIGRFAM: histidinol-phosphate aminotransferase;
FT                   PFAM: aminotransferase class I and II; KEGG: cte:CT1256
FT                   histidinol-phosphate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12629"
FT                   /db_xref="GOA:B3QSY6"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR005861"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSY6"
FT                   /protein_id="ACF12629.1"
FT                   /translation="MQKDFSNDLEFRAFLNPAVRNMSAYHISGGQNAEIKLNQNENPLD
FT                   LPDWLKEKILADFAKEQWNRYPEIFPNQATRKYAEFLDVPAECVLMGNGSNELLYTIFM
FT                   ATLTKGASVLIPQPSFSLYEKIADILNADVIAVPMTSSFEFQPERIIAEAKNSQPNLIV
FT                   LSTPNNPTSKSLSYEQIKQIVTETDSIVLADEAYIEFSKQKSALDLIYEHSNLLVLRTM
FT                   SKAFSLAGVRVGFAISHPELLKEISKPKIPFASNRLAELCLIHVLENYSVIDERVKMLL
FT                   GERERMAGILAKMNGIFLHESDTNFFIIEVEQPGEVFNRLKAKDIIVRNVSSYPMMEKC
FT                   LRINVGTKAENDRFLSELEKIMNEG"
FT   gene            187532..188071
FT                   /locus_tag="Ctha_0159"
FT   CDS_pept        187532..188071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0159"
FT                   /product="tRNA/rRNA methyltransferase (SpoU)"
FT                   /note="PFAM: tRNA/rRNA methyltransferase (SpoU); KEGG:
FT                   cph:Cpha266_1411 tRNA/rRNA methyltransferase (SpoU)"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12630"
FT                   /db_xref="GOA:B3QSY7"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSY7"
FT                   /protein_id="ACF12630.1"
FT                   /translation="MLRKLHGSEMGRLEPDAFRESQKHPIYVMFQNIRSMWNVGSIFRT
FT                   CDAARIQKVIITGYTATPPRPQIDKVALGATETVDWEYVADPLEALADLKDQGVKIAAL
FT                   EITENARNYDELSAEDFPLCLVLGNEVTGIDDEVLQECDFALEIPQYGTKHSLNVAVSA
FT                   GIAIFEAVRQFRACDI"
FT   gene            complement(188173..188751)
FT                   /locus_tag="Ctha_0160"
FT   CDS_pept        complement(188173..188751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0160"
FT                   /product="Rubrerythrin"
FT                   /note="PFAM: Rubrerythrin; KEGG: dol:Dole_2647
FT                   rubrerythrin"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12631"
FT                   /db_xref="GOA:B3QSY8"
FT                   /db_xref="InterPro:IPR003251"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSY8"
FT                   /protein_id="ACF12631.1"
FT                   /translation="MSKSVKGTRTEKNLLTAFAGESQARNRYTFFAEKAREEGLIQIAE
FT                   IFEETANQEREHAKRFFSFLEGGDLKIEEMFPAGVVSSTLENLRAAAAGEEHEWTSMYP
FT                   EFAKIAREEGFEPVARAFEAICVSEKQHGKRYKDLADNLEAGKVFKRGGKVVWRCINCG
FT                   YLHEAEEAPKACPACLKPQAYFELLGENW"
FT   gene            complement(188830..190329)
FT                   /locus_tag="Ctha_0161"
FT   CDS_pept        complement(188830..190329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0161"
FT                   /product="Glutamate synthase (NADPH)"
FT                   /EC_number="1.4.1.13"
FT                   /note="PFAM: ferredoxin-dependent glutamate synthase;
FT                   Rubredoxin-type Fe(Cys)4 protein; KEGG: mmp:MMP0496
FT                   glutamate synthase subunit-related"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12632"
FT                   /db_xref="GOA:B3QSY9"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024188"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="InterPro:IPR024935"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSY9"
FT                   /protein_id="ACF12632.1"
FT                   /translation="MEQFECVICGWVYDENLGDPDSGIASGTKFEDISGDWTCPVCGAG
FT                   KEHFEKIVRRAAAEEAEKNLSREQPGRNVTDSTRHTEPANTGKTVTSYLGNYERQWDET
FT                   EREMRSIFLKAVTGKQEYSAMRTPKHRNLFDEILFLPGQLARRPLRPDEVAVNLKTIIG
FT                   AQSAKPIELALPFFVSHMSFGSLSKEAKIALAKGSAMAKTATCSGEGGMIDEEQQAAYK
FT                   YIFEYSTGRFGVTDDALKKCDAVEIKIGQAAKAGLGGHLLAEKVTEEIARVRKVPPFQD
FT                   IISPANHTDIKSEDDLRKKVNWLREKIDGKPVGIKLVAGNLEDDLEVALYAQPDFITID
FT                   CRGGSTGAAPAHVKDNFGIPAPYAVYQARKIFREKQVADTALILTGGIRTTADIAKCIA
FT                   MGADAVALGTTAMIGIGCQQYRVCHKGTCPVGIATQDPKLRERFNIEESAKMLANLFLV
FT                   YKSELEDIVRILGRKNIHDLEYSDLVTLSREISEYTDIAHA"
FT   gene            complement(190630..191478)
FT                   /locus_tag="Ctha_0162"
FT   CDS_pept        complement(190630..191478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0162"
FT                   /product="CoB--CoM heterodisulfide reductase"
FT                   /EC_number="1.8.98.1"
FT                   /note="PFAM: protein of unknown function DUF224
FT                   cysteine-rich region domain protein; KEGG: cph:Cpha266_0175
FT                   succinate dehydrogenase subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12633"
FT                   /db_xref="GOA:B3QSZ0"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSZ0"
FT                   /protein_id="ACF12633.1"
FT                   /translation="MKKYAYYLSCINEAMTKEVDKSLEQWEKDLDLELVKLEQGTCCGG
FT                   SNLDYVNPDEFLVVNGRNIALAEKLGLDMVTSCNTCLLSLRRAKDELDRSKEKREMVNG
FT                   FLKREDLEYTGKSAVKHLLWVLNEDIGLEAIAKKVKNPLKEYKVASFYGCHILRPSSLL
FT                   GVDDPKAPKSLDQLVDVLGAKPVKYKSSNQCCGFHTLLVAEDESLRIAAAALDDAIKSG
FT                   ADYIVTPCPLCHTVLDGYQKKALDKQGIKGSIPVLHLSQLVGLAFGYTQKELGINRHLV
FT                   S"
FT   gene            complement(191497..192516)
FT                   /locus_tag="Ctha_0163"
FT   CDS_pept        complement(191497..192516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0163"
FT                   /product="succinate dehydrogenase and fumarate reductase
FT                   iron-sulfur protein"
FT                   /EC_number="1.3.99.1"
FT                   /note="KEGG: cte:CT2041 succinate/fumarate oxidoreductase,
FT                   iron-sulfur protein, putative; TIGRFAM: succinate
FT                   dehydrogenase and fumarate reductase iron-sulfur protein;
FT                   PFAM: ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12634"
FT                   /db_xref="GOA:B3QSZ1"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSZ1"
FT                   /protein_id="ACF12634.1"
FT                   /translation="MTMPEVKEEKREITFRVYRFNPQIDASPFYDEYPITVEKGITVLR
FT                   ALNYIKEHIEPRLSFRSFCQAGICGSCAMRINSVSKLACTTQVWDELAFADRENVILVE
FT                   PIANLPVIRDLVVDMDSVVGKIEKYFGWVESKMPENQMGKKEFNIAEAEFKLYDAATDC
FT                   ILCASCISECTMTKANKEYITPAVLLKSYRMEADSRDAVHDKRLGVLVSDNGVWDCTHC
FT                   YRCMEHCVKHIPIMEAIHHIREDAVQKRGLSDTPGAKHAAAFVKDIEKKGRLVESLLPI
FT                   RTNGLSWTVKNMLPMAFKMTKKGKTPPPPFMVKAVPGIENLRSMLKELKSRGNSNHHK"
FT   gene            complement(192872..193621)
FT                   /locus_tag="Ctha_0164"
FT   CDS_pept        complement(192872..193621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0164"
FT                   /product="succinate dehydrogenase and fumarate reductase
FT                   iron-sulfur protein"
FT                   /EC_number="1.3.99.1"
FT                   /note="KEGG: cph:Cpha266_0176 succinate dehydrogenase
FT                   subunit B; TIGRFAM: succinate dehydrogenase and fumarate
FT                   reductase iron-sulfur protein; PFAM: ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12635"
FT                   /db_xref="GOA:B3QSZ2"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSZ2"
FT                   /protein_id="ACF12635.1"
FT                   /translation="MKEVKAITFRVFRFNPQIDEHPYYDSFEIPTERGITVLRALDYIK
FT                   QNLEPRLSFSSFCHAGICGSCSMKINGMAKLACTTQVWDELKNSVEKNVITVEPINNLP
FT                   ALRDLIVDMQPLVRKLETYLGWVEPAMPEQEMGKKECTVSEEEFRVYDPATDCILCGTC
FT                   LSDCPALKADPDYVSPPVLLRSFRMNADSRDKSEEERLELLGELHGVMDCRGCNRCAFT
FT                   CVKNIPIMQAIQSLRERVMQKKLSGKS"
FT   gene            complement(193678..195378)
FT                   /locus_tag="Ctha_0165"
FT   CDS_pept        complement(193678..195378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0165"
FT                   /product="succinate dehydrogenase or fumarate reductase,
FT                   flavoprotein subunit"
FT                   /EC_number="1.3.99.1"
FT                   /note="KEGG: cph:Cpha266_0177 succinate dehydrogenase
FT                   subunit A; TIGRFAM: succinate dehydrogenase or fumarate
FT                   reductase, flavoprotein subunit; PFAM: fumarate
FT                   reductase/succinate dehydrogenase flavoprotein domain
FT                   protein; HI0933 family protein; FAD dependent
FT                   oxidoreductase; FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12636"
FT                   /db_xref="GOA:B3QSZ3"
FT                   /db_xref="InterPro:IPR003952"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR014006"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSZ3"
FT                   /protein_id="ACF12636.1"
FT                   /translation="MQLFDIVIIGGGGAGLYAAMEAMKTAPQLKIAVLSKIYPNRSHTS
FT                   AAQGGVNAALANTAKDDSIESHIFDTIKGSDYLADQDAAEVLCQDAPGIIRELENMGTP
FT                   FSRLEDGTIAQRPFGGAAKPRCCYCADKTGHTILQNLYEQCLRKGVKFYNEFLLLSLEH
FT                   NNGAVQGVLALDIKTGKVVDFPARTVIFATGGYAKMYWNRSSNAAGNSGDGQAVALRAG
FT                   IPLKDMEFVQFHPTGLRKSGLLVTEGARGEGGYLINKSGERFMSRYAPQKMELGPRDLV
FT                   SRSIETEIREGRGFDSTAGRYVHLDLRHLGADLIKTRLPQIRELSMYFEGVDPIEEPIP
FT                   ILPTAHYSMGGIDTDIDGRTVMKGVYAAGECACVSVHGANRLGGNSLLEILVFGKRAGH
FT                   AAALEAKDNSPKPISGTAVSDQYKYLRDLMHHDRRERYGILREELGRTLANNVGIYRTG
FT                   EDLKNGLQDVKALRDRFKKVRVFDSSDVFNTNLIQVLELRNMLDLAQTVAEGALMREES
FT                   RGSHTREDFPTRDDEKWHKHTMFTIENGQVKIDFKQVTMGKYELQERKY"
FT   gene            complement(195510..195956)
FT                   /locus_tag="Ctha_0166"
FT   CDS_pept        complement(195510..195956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0166"
FT                   /product="putative signal-transduction protein with CBS
FT                   domains"
FT                   /note="PFAM: CBS domain containing protein; KEGG:
FT                   cte:CT2044 CBS domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12637"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSZ4"
FT                   /protein_id="ACF12637.1"
FT                   /translation="MEQLKKLRVLPVSALMTKDVVTIDGSKTVAEAIQLMKRFNTSSIV
FT                   VKPRNEDDTYGIVTEKDILEKVIDPGDDVHRDPWNTPVFEVMSKPIVSVYPEMRLKYAL
FT                   RLMKRVQIRRVAVLDGDKLVGILSETDVLHAVEELPPYSDQAAY"
FT   gene            196592..197023
FT                   /locus_tag="Ctha_0167"
FT   CDS_pept        196592..197023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0167"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12638"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSZ5"
FT                   /protein_id="ACF12638.1"
FT                   /translation="MTGKIAKRNEKILQNIELDNFDFLEIPELYIHSGELNKNEIEYIR
FT                   ARLEEMQRVRENCEPESLLRMRQANERAILNFLGEMRYRRLQLRMQMYLKEYCEKFIES
FT                   YDKDIVKPEKEPLGSVAQKFHLALKDLWQKVCTLFSPYH"
FT   gene            complement(197143..198012)
FT                   /locus_tag="Ctha_0168"
FT   CDS_pept        complement(197143..198012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0168"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cph:Cpha266_2286 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12639"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSZ6"
FT                   /protein_id="ACF12639.1"
FT                   /translation="MSKSQLSLSIEKQEITLVHLTQEDSGQYIVQDCHEMHFGFDIYED
FT                   VFEHGHSKAMLAVMHELIPALEKYIPQKLSVCVNMDKIKCVRTFFDRDLSETEFADECE
FT                   DEAEKFLCNPEAYTLQAVRLWEQSDMPYERYLLVFMPKQVLNRLQMLIAPARKNINLID
FT                   GSHMSLQNLYRDSQEAMLLIEIESRYFALSLMNKFRIEEFSYWNLASETDAAYFALTEM
FT                   QKLEIPSKIYAIGSGASPDAMAFLSGVIGVRVMPLTMPAQMTFNCEKKDATKYLKALGC
FT                   AIKAVNEF"
FT   gene            complement(198024..198524)
FT                   /locus_tag="Ctha_0169"
FT   CDS_pept        complement(198024..198524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0169"
FT                   /product="helix-hairpin-helix motif"
FT                   /note="PFAM: helix-hairpin-helix motif; SMART:
FT                   Helix-hairpin-helix DNA-binding class 1; KEGG: cch:Cag_1625
FT                   helix-hairpin-helix DNA-binding, class 1"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12640"
FT                   /db_xref="GOA:B3QSZ7"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSZ7"
FT                   /protein_id="ACF12640.1"
FT                   /translation="MMRLLRAISTKLSLTRMEVIIISFLLGFLMMGLLLKKHSASLSRA
FT                   ELLEKKRHEQFIGTELDNVLAVEDSLYEASLAKSNKVDTQKSKETTKSSSEKQRFAGKL
FT                   NYNEATEEELIDVPGIGPVMAERLVRFRAYKGGRVETLNALLEVKGIGQKKLGQLKNYL
FT                   KVE"
FT   gene            complement(198913..199998)
FT                   /locus_tag="Ctha_0170"
FT   CDS_pept        complement(198913..199998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0170"
FT                   /product="3-dehydroquinate synthase"
FT                   /EC_number="4.2.3.4"
FT                   /note="PFAM: 3-dehydroquinate synthase; KEGG: cch:Cag_1219
FT                   3-dehydroquinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12641"
FT                   /db_xref="GOA:B3QSZ8"
FT                   /db_xref="InterPro:IPR016037"
FT                   /db_xref="InterPro:IPR030960"
FT                   /db_xref="InterPro:IPR030963"
FT                   /db_xref="UniProtKB/TrEMBL:B3QSZ8"
FT                   /protein_id="ACF12641.1"
FT                   /translation="MSSKIVIETPAIAKIGNKFAELGRQKKVVVLYDKNTAGLFEKSIS
FT                   EQLEKDGFIFHNLIVPASEASKSFRMAYRLYGEMLEREVDRSWSVVAVGGGVVGDLGGF
FT                   IAASFMRGVPVVQVPTTLLAMTDSAIGGKVAINHPMGKNMIGFFHEPVLILIDPNYLRT
FT                   LPNREIFGGLAEVLKYALILDGSFLDFMEDNFQEISTLVSPYIDEAVKRSVNAKVKVVT
FT                   EDFRETTGLRAILNFGHTFGHSLEKLSNYKALRHGEAVLVGMACATQLSMKIGNISSED
FT                   AERICAMIQKFPYPKRLIKKYFLDVAPETIIENMRSDKKKEGKHIRFALLKRIGNAYLH
FT                   REEIAKEDIIFAIEAAKPLFA"
FT   gene            complement(200010..200573)
FT                   /locus_tag="Ctha_0171"
FT   CDS_pept        complement(200010..200573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0171"
FT                   /product="Shikimate kinase"
FT                   /EC_number="2.7.1.71"
FT                   /note="PFAM: shikimate kinase; KEGG: cte:CT1405 shikimate
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12642"
FT                   /db_xref="GOA:B3QSZ9"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR023000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3QSZ9"
FT                   /protein_id="ACF12642.1"
FT                   /translation="MKKPSLIFLTGFSTSGKSTIGPLLANSLGFEFIDIDKEIVDREQK
FT                   SINEIFAEKGEPYFRELEYNVLSSISQSEDLVVALGGGTLENDKCFEFIRKAGTLVYLK
FT                   SDVATLARRLSHKEDRPLMKGENGEKLSIEDISDRVEKLLAKREPRYSAAEILALTDKT
FT                   PLGVTIENLTRQIERHIRANCKTN"
FT   sig_peptide     complement(200496..200573)
FT                   /locus_tag="Ctha_0171"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.678) with cleavage site probability 0.535 at
FT                   residue 26"
FT   gene            200804..201196
FT                   /locus_tag="Ctha_0172"
FT   CDS_pept        200804..201196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0172"
FT                   /product="OsmC family protein"
FT                   /note="PFAM: OsmC family protein; KEGG: ade:Adeh_4072
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12643"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:B3QT00"
FT                   /protein_id="ACF12643.1"
FT                   /translation="MELEVFFEDNLKVNAKLGDQIIRTDQSIAAGGDGSAPAPFELFLA
FT                   SIGTCSGIFVKHFCLQRGIDPTGIRILQKHDFNPQTHMIEQINIEVHLPEGFPEKYKDV
FT                   IIKVVDQCAVKRHLQHPPVFNVTTVS"
FT   gene            201435..203930
FT                   /locus_tag="Ctha_0173"
FT   CDS_pept        201435..203930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0173"
FT                   /product="ferrous iron transport protein B"
FT                   /note="TIGRFAM: ferrous iron transport protein B; small
FT                   GTP-binding protein; PFAM: GTP-binding protein
FT                   HSR1-related; FeoA family protein; Ferrous iron transport
FT                   protein B domain protein; Ferrous iron transport B domain
FT                   protein; nucleoside recognition domain protein; KEGG:
FT                   pdi:BDI_1461 ferrous iron transport protein B"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12644"
FT                   /db_xref="GOA:B3QT01"
FT                   /db_xref="InterPro:IPR003373"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR011640"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030389"
FT                   /db_xref="InterPro:IPR038157"
FT                   /db_xref="InterPro:IPR041069"
FT                   /db_xref="UniProtKB/TrEMBL:B3QT01"
FT                   /protein_id="ACF12644.1"
FT                   /translation="MNLAELHAGQNGFITKVKGRGAFRKRISEMGFVRGKQITRIKDAP
FT                   LKDPIEFKLMGFNVSLRKSEAEQIEVVTESEAVSLNGNAHSNGTPVEHFFEKKIKEASK
FT                   QINVVLVGNPNSGKTSLFNYASGSNERTGNYSGVTISPHESLVSLNGYRINIVDLPGTY
FT                   SLSAYTPEETFVRRYIIDKQPDVVINIVDASNLERNLYLTTQLIDMDIKVVMALNMYDE
FT                   LTTKGDTLHIEQLGELLGIPIVPTIASKGKGIKQLFDHVIQIHEETEPTYRHIHIQYGD
FT                   DIEKSLHSLQELIWKNKHITDKASSRLLAVQLLEKDKSIDSFLSQFSEYETIKTKADHE
FT                   IASLEKQFHEESSSLISEARYGFIAGALKETYQKKEDIQLSRSDKIDNLLTHRIYGYPI
FT                   FLFFLWIVFQATFSLGQYPVEWLEFLVGEISSFFSSILPAGFFKDLVVSGIIDGTGSVL
FT                   VFLPNIVILFLFISIMEDTGYMARVAFIMDKLMHRLGLHGKSFIPLIIGFGCNVPAIMA
FT                   TRTIENPKDRLLTMLIVPFMSCSARLPVYILLISAFFPEHPVTILFSLYLIGILLSMLF
FT                   SFVFNKIIFKTGQTPFVMELPPYRVPTLQSVIKHVWFRAYLYLKKVGGVILIASVVVWM
FT                   LQYFPRQPELDQQLEQDAARVSQTYETKIQAASTDEIKTQLKTALSEKIADMEFATEMT
FT                   RTERSYLGQFGKTLEPVFRPLGFDWKISVSLLSGIAAKEIVLSTMGVLFQTANVEEDAH
FT                   KLEEGLSLHFASLNSAPPFLTALSLLLFILIYFPCLGVVVAVGKESGSWKWAVFVVSYT
FT                   SLLAWVISFGVFQIGSLIY"
FT   gene            complement(204068..206011)
FT                   /locus_tag="Ctha_0174"
FT   CDS_pept        complement(204068..206011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0174"
FT                   /product="deoxyxylulose-5-phosphate synthase"
FT                   /note="TIGRFAM: deoxyxylulose-5-phosphate synthase; PFAM:
FT                   Transketolase central region; Transketolase domain protein;
FT                   KEGG: cte:CT0337 1-deoxyxylulose-5-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12645"
FT                   /db_xref="GOA:B3QT02"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005477"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:B3QT02"
FT                   /protein_id="ACF12645.1"
FT                   /translation="MNPNLKESEELASFGTYLSKIDSPEDLRKFSIEELPAIAQECREL
FT                   VIDAVSKNGGHFGSSLGVAELSVALHYAYNTPKDQIIWDVGHQAYVHKILTGRKNFFYS
FT                   NRKYGGVSGFPKRAESCYDAFGVGHASTSISAATGMAAARDLAHEDFKVVAVIGDGSMT
FT                   GGMAFEGMNHLGHLKTDVTVILNDNRMSIDPNVGGLREYLTDITTNFTYNKIRRDIWQT
FT                   LSKFDNEIGSTARRLVRGIEDGLKAALTPGSYFEALGFRYFGPIDGHDVGHLARVLTEI
FT                   RGLPHPKLLHIVTVKGKGFAPAEANQSKWHAQSGAFDKVTGVSLKKADPNAAPKYQDVF
FT                   GDAITKIAGKDQRVVGVTAAMPSGTSLKKLGEKYPERFFDVGIAEPHAVTFAAGMAVHG
FT                   FKPVCAIYSTFLQRAYDQIIHDVALQKLNVIFAIDRAGLVGADGPTHHGVFDLSFLRMI
FT                   PNMVVMAPMHEQELCDMLLTAVKYENGPVAVRYPRGNGLGMALQEFKQLPIGKGEVLRD
FT                   GEEIAILGIGLMSNVALEAAALLEAQGVSPLVANMRFVKPIDTELLDAICARFDRIVTI
FT                   EENTVIGGFGSAVCEYLQEKGHRNRVLTLGIPDRFIEHGSVADLHREIGLDAQGVVKRI
FT                   LEFAHSEDIVAM"
FT   gene            complement(206361..207497)
FT                   /locus_tag="Ctha_0175"
FT   CDS_pept        complement(206361..207497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0175"
FT                   /product="sodium ion-translocating decarboxylase, beta
FT                   subunit"
FT                   /EC_number="4.1.1.70"
FT                   /note="KEGG: plt:Plut_1434 Na+-transporting
FT                   methylmalonyl-CoA/oxaloacetate decarboxylase, beta subunit;
FT                   TIGRFAM: sodium ion-translocating decarboxylase, beta
FT                   subunit; PFAM: Na+transporting
FT                   methylmalonyl-CoA/oxaloacetate decarboxylase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12646"
FT                   /db_xref="GOA:B3QT03"
FT                   /db_xref="InterPro:IPR005661"
FT                   /db_xref="UniProtKB/TrEMBL:B3QT03"
FT                   /protein_id="ACF12646.1"
FT                   /translation="MEGILKFLEYSGFSNVTLGHVLMIAVGLIFIYLAIRYEYEPLLLV
FT                   PIGFGILIGNTPFLESAGMQLGIYEDGSVMNYIYQGVLKGIFPPLIFLGIGAMTDFSTL
FT                   ISSPRLMLLGAAAQLGIFATFLGALALGFTLQEAGSIGIIGGADGPTAIFLSSRLAPNL
FT                   IGSIAIAAYSYMALVPVIQPPIMKLLTTKAERKIRMKPPRSVSKKEKVLFPIIGLILTG
FT                   FIAPGSLPLLGMLFFGNLLKESMVTKRLADTARTAMIDIVTILLGVTVGASTQATTFLT
FT                   PQSILIFVLGALSFMVATAGGILFAKAMNLFLPADDKINPLIGAAGVSAVPDSARVAQV
FT                   EGLKEDSTNHLLMHAMAPNVAGVIGSAVAAGILMSFLM"
FT   gene            complement(207507..207923)
FT                   /locus_tag="Ctha_0176"
FT   CDS_pept        complement(207507..207923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0176"
FT                   /product="biotin/lipoyl attachment domain-containing
FT                   protein"
FT                   /note="PFAM: biotin/lipoyl attachment domain-containing
FT                   protein; KEGG: pvi:Cvib_1250 biotin/lipoyl attachment
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12647"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:B3QT04"
FT                   /protein_id="ACF12647.1"
FT                   /translation="MRKYKFKISGNEYTVDIKTFEDNVAEIEVNGTQYFVELEKEIKTP
FT                   KTPKLVRAQAPPPKEHKPLSSTGVSVLKAPLPGTILKVMAKPGDIVKKEQNLLVMEAMK
FT                   MENNILSEKDGTIKSVKVAPGDTVLQGDVLLEIE"
FT   gene            complement(207929..208300)
FT                   /locus_tag="Ctha_0177"
FT   CDS_pept        complement(207929..208300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0177"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pvi:Cvib_1249 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12648"
FT                   /db_xref="GOA:B3QT05"
FT                   /db_xref="InterPro:IPR005899"
FT                   /db_xref="UniProtKB/TrEMBL:B3QT05"
FT                   /protein_id="ACF12648.1"
FT                   /translation="MMIMQILLVFDWSLITEDGIMISLVGYLVVFFSLILLSLVFGALP
FT                   KVLNFNLKRKLKKKGEHEQAKKVDEEIPGEVNAAIGMSLFLYFNELHDTEQTILTMKKV
FT                   SKRYSPWNSKIYNVINFRR"
FT   gene            complement(208303..209844)
FT                   /locus_tag="Ctha_0178"
FT   CDS_pept        complement(208303..209844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0178"
FT                   /product="carboxyl transferase"
FT                   /note="PFAM: carboxyl transferase; KEGG: plt:Plut_1431
FT                   propionyl-CoA carboxylase beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12649"
FT                   /db_xref="GOA:B3QT06"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:B3QT06"
FT                   /protein_id="ACF12649.1"
FT                   /translation="MKRLLEEREKARLGGGEKRIDAQHQKGKFTARERIEMLLDEGSFE
FT                   EYDMFVTHRTTDFGLDKEKYLSDGVITGHGTIDGRLVYIFSQDFTIFGGSLSETYAQKI
FT                   CKIMDQAMKVGAPIIGINDSGGARIQEGVRSLAGYADIFQRNILASGVVPQISAIFGPC
FT                   AGGAVYSPALTDFIMMADKTSYMFVTGPKVAKTVTGEMITEEDLGGASVHATKSGVTHF
FT                   VAQDENEGILLIRKLLSYLPQNNLEEPQVVECDDPIDRLEDSLNTIIPENPNIPYDVKD
FT                   IIHEIVDNGEFLEIQRLYARNIVIGFAKFNGMSTGIVANQPSYLAGCLDIDASRKAARF
FT                   VRFCDAFNIPIVTLVDVPGFLPGSAQEYGGIILHGAKLLYAFGEATVPKVTVILRKAYG
FT                   GAYDVMSSKHLRGDVNYAWPSSEIAVMGPRGAIEVLYSKDLRKIENEEERAKFVAEKEA
FT                   EYKDKFANPYEAARYGYIDDIIEPRNTRFRVIRALQTLSTKKDTNPPKKHCTMPL"
FT   gene            210147..210896
FT                   /locus_tag="Ctha_0179"
FT   CDS_pept        210147..210896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0179"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cph:Cpha266_1548 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12650"
FT                   /db_xref="InterPro:IPR021458"
FT                   /db_xref="UniProtKB/TrEMBL:B3QT07"
FT                   /protein_id="ACF12650.1"
FT                   /translation="MCRKRIFLVNRRTSQGFSILCCGEKRFLALILAQISYHIGLEFYP
FT                   TFFRDVLMARVEPITILNVQGVLVEKEVLREQFKCDLACCKGICCVEGELGAPVQSAEI
FT                   DDIERNIENILRYLPEKNVSVIQKKGFYEAYKGDLYLQTVAGKECVFALKNAQGIVTCG
FT                   IEAAFYEGQSDFLKPISCHLFPIRVKKKFGMDCLVYEYIPECNEARTVGQRIGLPVYAF
FT                   IKPALIRKYGEAWYHDFEEVCHQFSEQ"
FT   gene            210966..212519
FT                   /locus_tag="Ctha_0180"
FT   CDS_pept        210966..212519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0180"
FT                   /product="RNA polymerase, sigma 54 subunit, RpoN"
FT                   /note="TIGRFAM: RNA polymerase sigma-54 factor, RpoN; PFAM:
FT                   sigma-54 factor; regulatory protein LacI; sigma-54 factor
FT                   core-binding region; sigma-54 DNA-binding domain protein;
FT                   KEGG: cte:CT1193 RNA polymerase sigma-54 factor"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12651"
FT                   /db_xref="GOA:B3QT08"
FT                   /db_xref="InterPro:IPR000394"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR007046"
FT                   /db_xref="InterPro:IPR007634"
FT                   /db_xref="InterPro:IPR038709"
FT                   /db_xref="UniProtKB/TrEMBL:B3QT08"
FT                   /protein_id="ACF12651.1"
FT                   /translation="MNTQSLSQRQVQTMRLSPQQLLYTKLLQLPLIQLEQRVKQELEEN
FT                   PMLEEFSESDEEAGQPEEMATDLSQNNDDENKLNEKSEQNEEDLYIAEKPTKDEPLPKD
FT                   DDYTKEFDQEIEEYFPDGDEEGFNVPSFREEPSDESYFQPVFHESFTERVLNDLRYQDV
FT                   TEKELAIAEEIVGNIDEDGYLRCPIEVIADGLMTTGIEVTEAEILKVLEKIWYIDPVGI
FT                   GARNLQECLLIQLEAKYQRTEDIDDTLYEQAKLILNKYYHEFTMKHFEKLMTLLSISPE
FT                   ELTQALLLIQSFNPKPGGDVSASSNYIIPDFIVTFDGKNLVAFSNERNSFQIRISEQYK
FT                   PLLEDKSQPKGAKEFVRNKYEAAKNFMTAIEMRRQTLQRVMNALLNLQYEFFTIGPNRL
FT                   KPMILKDVAEVAGVDISTVSRVVNGKYVQAHKGILELKYFFSTGLETESGDEISNKLIK
FT                   EKIKSFIEKEDTRKPLSDDKISEMLQQNGFKVARRTVAKYREQMNIPVARLRKQIQSLK
FT                   "
FT   gene            212559..213086
FT                   /locus_tag="Ctha_0181"
FT   CDS_pept        212559..213086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0181"
FT                   /product="20S proteasome A and B subunits"
FT                   /note="PFAM: 20S proteasome A and B subunits; KEGG:
FT                   pvi:Cvib_0960 ATP-dependent protease peptidase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12652"
FT                   /db_xref="GOA:B3QT09"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR022281"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:B3QT09"
FT                   /protein_id="ACF12652.1"
FT                   /translation="MRATTVIGVLRNGKAALGSDGQMTYGNTILKHSTTKIRKMHDGKI
FT                   IVGFAGATADALTLLERFEEKLQAYGGRLDRSAVELAKEWRMDKYLRRLEAMLAVVSRE
FT                   KALIISGTGDVIEPEDGIVAIGSGSMYALSAARALLKHTNCDAKTIVEESLNIAGEICI
FT                   YTNTNIQIQEIV"
FT   gene            213225..214730
FT                   /locus_tag="Ctha_0182"
FT   CDS_pept        213225..214730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0182"
FT                   /product="heat shock protein HslVU, ATPase subunit HslU"
FT                   /note="KEGG: cph:Cpha266_1545 ATP-dependent protease
FT                   ATP-binding subunit; TIGRFAM: heat shock protein HslVU,
FT                   ATPase subunit HslU; PFAM: ATPase AAA-2 domain protein;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12653"
FT                   /db_xref="GOA:B3QT10"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004491"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3QT10"
FT                   /protein_id="ACF12653.1"
FT                   /translation="MPKSKSSKELTEDEVKSTSEQKKSDMTETGDERDNKIPEHFLTPS
FT                   QIVKELDKYIIGQREAKKSVAIALRNRLRRQRVEGALRDEIMPNNIIMIGPTGVGKTEI
FT                   ARRLAKLSGAPFVKVEASKFTEVGYVGRDVESMIRDLMDLAVGMVRSEQSVVVQEKAKQ
FT                   LAEERILDILLPPVKKIPAGFKKQQSAETDADTDEDKTENEINDRSREKMRDRLRNGKL
FT                   DDKTIELEVSSDSQGMMQILGPFGPMEDIGGMMQDIISGLPKKRKKRRVTISEAKVILE
FT                   QEETQKLIDMDAVVKEATQRVENSGIVFIDEIDKIASSSTGNGRSPDVSREGVQRDLLP
FT                   IVEGSNVATKYGLVKTDHVLFIASGAFHVAKPSDLIPELQGRFPIRVELKSLQEDDFVK
FT                   ILTQPENALIKQYTALLKTENVELEFLEDGIQEIARIAAQVNESVENIGARRLHTIMTT
FT                   LLEELMFNIPENIPDNKIVVDKAMVESRLSDIAKDRDLSRYIL"
FT   gene            214818..215531
FT                   /locus_tag="Ctha_0183"
FT   CDS_pept        214818..215531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0183"
FT                   /product="protein of unknown function UPF0005"
FT                   /note="PFAM: protein of unknown function UPF0005; KEGG:
FT                   dvl:Dvul_0772 protein of unknown function UPF0005"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12654"
FT                   /db_xref="GOA:B3QT11"
FT                   /db_xref="InterPro:IPR006214"
FT                   /db_xref="UniProtKB/TrEMBL:B3QT11"
FT                   /protein_id="ACF12654.1"
FT                   /translation="METRPFYYNPGYSQVSADVQNRVINQVFVWMALGLALTAGTAFAT
FT                   ASSEAMMQLVFGNPIVFFGLIIAEFGLVVGVSAAINRLSLAAATGLFFLYSALNGVTLA
FT                   SIFMVYSLGSIGGVFLVTAGTFGAMSLYGLTTKRDLTKIGSLAFMALIGIIIAGVVNMF
FT                   LHSSVLSLIVSLIGLVVFIGLTAYDTQKIKEMAAMTNDGESEGKVAVLGALSLYLDFIN
FT                   LFLILLRLFGGGKDE"
FT   gene            215670..216071
FT                   /locus_tag="Ctha_0184"
FT   CDS_pept        215670..216071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0184"
FT                   /product="ACT domain-containing protein-like protein"
FT                   /note="KEGG: pai:PAE3582 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12655"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="UniProtKB/TrEMBL:B3QT12"
FT                   /protein_id="ACF12655.1"
FT                   /translation="MVSESQLRKIIDLTIEELGENATKENIQAVVASVLEAYEQPDAER
FT                   LSGTPLLPQKALITVLGPKKPNALTALTPVFSKHNCDIIDISQKTLQAHFSLVFIVDIS
FT                   KLNTPFSVLQHELQKEVQALGLQLLAAQE"
FT   gene            216114..216530
FT                   /locus_tag="Ctha_0185"
FT   CDS_pept        216114..216530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0185"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   cvi:CV_1941 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12656"
FT                   /db_xref="GOA:B3QT13"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR006684"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B3QT13"
FT                   /protein_id="ACF12656.1"
FT                   /translation="MKKVETRFKVRSYELDSFGHVNHAVYVQYLEFARSEMFRSIGFSM
FT                   QDAFRKGIYPVVANLTVNYRKELLLHDEVLLTCFISKIGRSSFTIREEGYKLTNGQMKA
FT                   FDAEVVMAFVDKTSSVSVMIPTEVRNQFQQLLFS"
FT   gene            216539..216985
FT                   /locus_tag="Ctha_0186"
FT   CDS_pept        216539..216985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0186"
FT                   /product="3-dehydroquinate dehydratase, type II"
FT                   /EC_number="4.2.1.10"
FT                   /note="KEGG: plt:Plut_0932 3-dehydroquinate dehydratase;
FT                   TIGRFAM: 3-dehydroquinate dehydratase, type II; PFAM:
FT                   dehydroquinase class II"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12657"
FT                   /db_xref="GOA:B3QT14"
FT                   /db_xref="InterPro:IPR001874"
FT                   /db_xref="InterPro:IPR018509"
FT                   /db_xref="InterPro:IPR036441"
FT                   /db_xref="UniProtKB/TrEMBL:B3QT14"
FT                   /protein_id="ACF12657.1"
FT                   /translation="MIEQNHILVLNGPNLSRLGKREPGVYGSRTLMDINSSLAAVFPKI
FT                   GFQFVQSEYEGKLIEALFQAEDQPEMKGTVLNAGALTHYSIALRDAIKAISKPVVEVHL
FT                   SNIYAREEFRRKSVISEVCLGVISGFGEEGYHFAVEALLSNLSE"
FT   gene            complement(217062..217460)
FT                   /locus_tag="Ctha_R0001"
FT   tmRNA           complement(217062..217460)
FT                   /locus_tag="Ctha_R0001"
FT                   /note="tmRNA as predicted by Rfam (RF00023), score 119.69"
FT   gene            complement(217615..218178)
FT                   /locus_tag="Ctha_0187"
FT   CDS_pept        complement(217615..218178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0187"
FT                   /product="protein of unknown function DUF179"
FT                   /note="PFAM: protein of unknown function DUF179; KEGG:
FT                   cte:CT0663 putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12658"
FT                   /db_xref="InterPro:IPR003774"
FT                   /db_xref="UniProtKB/TrEMBL:B3QT15"
FT                   /protein_id="ACF12658.1"
FT                   /translation="MLDDYASPKRGILLIAGAQLIDPNFKRSVVLLCEHNEEGTFGLIL
FT                   NKPLDINISEAIEDIEDWDIALHAGGPVQPNTVHVLHRLGDEIEDAIEVVDGVYWGGNY
FT                   ETIRSMINTRHASPDDFRFFLGYSGWGPGQLQQEIDQDSWYQAKATANVVFNPVYDRMW
FT                   ARALRAKGGDYAIIANTPEDPRMN"
FT   gene            complement(218601..219833)
FT                   /locus_tag="Ctha_0188"
FT   CDS_pept        complement(218601..219833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0188"
FT                   /product="nuclease SbcCD, D subunit"
FT                   /note="TIGRFAM: nuclease SbcCD, D subunit; PFAM:
FT                   metallophosphoesterase; KEGG: sru:SRU_0687 nuclease SbcCD,
FT                   D subunit subfamily, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12659"
FT                   /db_xref="GOA:B3QT16"
FT                   /db_xref="InterPro:IPR004593"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR041796"
FT                   /db_xref="UniProtKB/TrEMBL:B3QT16"
FT                   /protein_id="ACF12659.1"
FT                   /translation="MKILHTADIHIGYTTHGKLDQQAGLNTRLLDFQKSFDFLVQTALD
FT                   EKIDALLFCGDAYRDATPSPTEQQIFARCLKPILEANIPVVMVVGNHDHPFAHGRANAL
FT                   QIFQELAAQVVVIDKLEVQLVETKSGLLRIVGLPWPVRTNLFAKEAYAAFSPEELKSKI
FT                   HEFYLEFILEQADALREQPDEIPSILAGHLHIDTAMMSKSERITLLAKDPMFSVGALAH
FT                   KEFDYIALGHIHKFQDLNPGNQPPVVYSGSIERISFNECDEEKGFVMVTIDDAKRVSYA
FT                   RVLTPARPFVSFDIDVTLKSPEPMAFILAEIAKKNIADAIVRVRILCSIDQKSEIDIST
FT                   IKEALQEAFLVSEVSVEVNEKPKRLRNPDLSKTMTAAEALEIYVEQNAQFKPIKEKVLK
FT                   IAAELESGLFG"
FT   gene            complement(219918..221366)
FT                   /locus_tag="Ctha_0189"
FT   CDS_pept        complement(219918..221366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0189"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mar:MAE_17510 serine/threonine protein kinase
FT                   with WD40 repeats"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12660"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:B3QT17"
FT                   /protein_id="ACF12660.1"
FT                   /translation="MKSFFTSLIILCSSLLFVSSPSNEAIGQTTKVGLAQKKLRKLQKE
FT                   YRQIDGDISKQLHKSLTKLAKQRPKKWEIKDTTRYNKLLANYNAKKERVSTAYENKADR
FT                   LKRSKHRQIMQVLNQSYTDKVKLFLGKYDSTQETFDLKVRGAGYNFPANVAVPKGQVEA
FT                   FKKNFRKAKAFGTFRIVENQKPYLVRVKAYINGRRYNPFVPLAYYNFQRETLPGGKPVI
FT                   SFSPNGRYMSLASGGAAAGSQLTVWDTYYWQDVVKMETKPDDDISNFWPSKAIFDPNGK
FT                   YLIAGGMKPDPRALPTTKVFSIRKWKELKTLNGCDANFSTDGKYLISVINDKDKKVWRM
FT                   GTWEDQRKNFLTDQEYKEWVGTLEESSKVNEQYKSTALFRIERYDRDTILVVETQTGKV
FT                   AAKIPAITPYENPPKELTNMAAIRSLREKEFYDEEIFTGISPDGNTLIRVFTHTYPIPG
FT                   EEKGREYSSHVHFWRLLWNKYNYN"
FT   sig_peptide     complement(221292..221366)
FT                   /locus_tag="Ctha_0189"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.723 at
FT                   residue 25"
FT   gene            complement(221737..223281)
FT                   /locus_tag="Ctha_0190"
FT   CDS_pept        complement(221737..223281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0190"
FT                   /product="Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase;
FT                   Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase; KEGG: tdn:Tmden_0615 nitrilase/cyanide
FT                   hydratase and apolipoprotein N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12661"
FT                   /db_xref="GOA:B3QT18"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR001110"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:B3QT18"
FT                   /protein_id="ACF12661.1"
FT                   /translation="MEAKKDSRSIDNIELVFLKMEDYEEVKNSMKEAYANMQQAYWKER
FT                   HIKTLIEKFPEGQIGIKVNNELAGCALSIIVDYSMFDDKHTYKEITGGYTFNTHTSNGD
FT                   KLYGIDVFVRPKYRGLRLGRRLYDYRKELCEKLNLKGIVFGGRIPNYHQYSESMSPREY
FT                   IENVRKKEIHDPVLDFQMSNDFHPARVLKGYLEGDKESQEYAVLLEWDNVYYEKKTNTA
FT                   AMKKSIVRLGLIQWQMRLYKDFEELMHQAEYFVDAVSGYRADFALFPEFFNAPLMSKYN
FT                   HLSVPEAIRKLAGYTEEITKRFAELAISYNINIITGSMPEMVNNNLYNVGYLCKRDGGV
FT                   EKFEKLHVTPDEAKVWGLQGGSTIQAFDTDCGRIGILICYDVEFPELSRILAEDGMDIL
FT                   FVPFLTDTQNGYSRVRSCAQARAVENECYVAIAGSVGNLPKVHNMDIQYAQSVVFTPCD
FT                   FSFPTNGIKAEATPNTEMILIADVDIDMLRELNQLGSVRNLKDRRTDIYSIKRLNK"
FT   gene            complement(223593..225740)
FT                   /locus_tag="Ctha_0191"
FT   CDS_pept        complement(223593..225740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0191"
FT                   /product="alpha-glucan phosphorylase"
FT                   /EC_number="2.4.1.1"
FT                   /note="KEGG: pvi:Cvib_1386 alpha-glucan phosphorylase;
FT                   TIGRFAM: alpha-glucan phosphorylase; PFAM: glycosyl
FT                   transferase family 35"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12662"
FT                   /db_xref="GOA:B3QT19"
FT                   /db_xref="InterPro:IPR000811"
FT                   /db_xref="InterPro:IPR011834"
FT                   /db_xref="InterPro:IPR024517"
FT                   /db_xref="UniProtKB/TrEMBL:B3QT19"
FT                   /protein_id="ACF12662.1"
FT                   /translation="MSSSLSKQTSNNTQSIPEQIALLKKLSKNLWWSWNADAQNVFSEL
FT                   SPRLWSKYNHSPIKVMQNVSEAELAATLSEKDYAEKVQSVLARFEEYLSEKNTWAATHA
FT                   DEFTANPVAYFSAEFGLHESLPIYSGGLGILAGDHIKSASDLGLNFIGVTLYYREGYFQ
FT                   QHLSMDGWQQEEYPLHPASTLPLEPVLDDAGKPVTVAIELAHSIVHVCAWTIKVGRAKL
FT                   YLLDTNLEENEEHYRDITCHVYGGDATTRINQEIVLGIGGTRFLHKLGIKPAVYHMNEG
FT                   HSGFLTLELLRRELDCGKSLDDAIAAVKPQCVFTTHTPVPAGHDRFSRDLMDYSLGKFA
FT                   ETMKIDFDTLMRLGKEHHNEPQNQFTMTVLCLNMSRAANGVSELNGVVAREMWQHLFQK
FT                   ENPNDVPIGHITNGVHTKTWMRDRTEAFWSFYTNNEQDFFSDPEHLAEILERIPDDSLW
FT                   GLRYRLKRDLIEFVRYRLERQMSRTGMDNGFWASDFLSTDVLTIGFARRFATYKRAPLI
FT                   FSDIDRIAAILSNSEKPVQIIFSGKAHPRDNEGKKFIQRIFQISRMPQFMGKVVFLENY
FT                   DMNVARYLISGVDLWLNNPLRPLEASGTSGEKVIAHGGLNCSILDGWWREGYNGQNGWA
FT                   IGKDENQPSTHEQSELDAKMLYEILETDIVPTYYARDSRNLPTEWIKKMRASILSLLPV
FT                   YNTHRMVRDYCEKYYKSGKNA"
FT   gene            225975..226841
FT                   /locus_tag="Ctha_0192"
FT   CDS_pept        225975..226841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0192"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: cph:Cpha266_0595
FT                   metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12663"
FT                   /db_xref="GOA:B3QT20"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:B3QT20"
FT                   /protein_id="ACF12663.1"
FT                   /translation="MKIAHISDIHIDHVALPNRSEQFENLIINIFEEGFDHLIITGDVT
FT                   DVAREEDMLLVKDIFERNGLLDWKKITLIPGNHDLFGKYEFNAERVLSNAIRASGTNSL
FT                   KKLQIFCEIFRDVMTPNNTARYYFPFVKIFNGPGEGVAIVAFNSVFEFSLANNPIGSRG
FT                   YIRTEELRAMLDPEVLDVLKGKFVIALCHHAYKILESAIAPYEQAFVWTMELINRSEYV
FT                   DTLRKIHAKVALHGHLHKTETYEVDGITFMNAGAFKRDQTLVNSLKIHEDGGFSQKFLK
FT                   FYSTVAV"
FT   gene            226869..227657
FT                   /locus_tag="Ctha_0193"
FT   CDS_pept        226869..227657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0193"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12664"
FT                   /db_xref="UniProtKB/TrEMBL:B3QT21"
FT                   /protein_id="ACF12664.1"
FT                   /translation="MIQAKPILNIFCLIAVFLSFGSSKANAQSTAGSSASEEPRYLFNM
FT                   PTAGVLQRGVYAIEGWAYGGGGSFVSLSVGLSEQLTFGIAYGAGNLIGSGSPDWNELPG
FT                   VMVRYRIFEEELNFPAITIGFESQGRENYLDGANRFERKSPGFFAAATKNYALLGFIAL
FT                   HGGINYSLENDDDKDLNFYFGVEKTIGKELSAYAQYDAAINDNNKTALGDGRGYLDMGL
FT                   RWSLGKGMTIELNLANISDNFKHLDAASRSVRLEYVHRFD"
FT   sig_peptide     226869..226952
FT                   /locus_tag="Ctha_0193"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.994 at
FT                   residue 28"
FT   gene            227871..228116
FT                   /locus_tag="Ctha_0194"
FT   CDS_pept        227871..228116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0194"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: vfi:VF2457 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12665"
FT                   /db_xref="InterPro:IPR019620"
FT                   /db_xref="UniProtKB/TrEMBL:B3QT22"
FT                   /protein_id="ACF12665.1"
FT                   /translation="MNNLHGHVILEKLIQSPRVYTRQKLQQEIEAKYGRDVVFYACGGE
FT                   NMSLSDLLQYLFNQGKIAEKDGLLTAFADKMCSHDH"
FT   gene            complement(228130..229053)
FT                   /locus_tag="Ctha_0195"
FT   CDS_pept        complement(228130..229053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0195"
FT                   /product="metalloenzyme domain protein"
FT                   /note="PFAM: metalloenzyme domain protein; KEGG:
FT                   rca:Rcas_0933 metalloenzyme domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12666"
FT                   /db_xref="GOA:B3QT23"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR010045"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:B3QT23"
FT                   /protein_id="ACF12666.1"
FT                   /translation="MKLIFLFLDGVGLATRTETNPFHLYDMPKLRDALGLGFFLEDAAV
FT                   QMPSLVFKPIDSGLGCEGTGQSGTGQFSIYTGFNGAQLFGRHYGPFLPSTLRATLAQEN
FT                   IFKKLKLFGKKPCYANAFPDSFINANLVLREQGKIRSSVLFEAAVIEAIQLRNNKDLKE
FT                   KKAVSGDIISWWWGQNEAHGDSDVPVILPEEAAENLIDLFECYDAVFFEFFLADYAGHR
FT                   RIKTHASEIVSRLDAYLASVLSRLPGDALFILTSDHGNFEDNSHDRHTLNPVPLLVKGL
FT                   YAEAFQQITGIHEIVPSMLSVLKNEN"
FT   gene            complement(229081..230334)
FT                   /locus_tag="Ctha_0196"
FT   CDS_pept        complement(229081..230334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0196"
FT                   /product="diaminopimelate decarboxylase"
FT                   /note="TIGRFAM: diaminopimelate decarboxylase; PFAM:
FT                   Orn/DAP/Arg decarboxylase 2; KEGG: cte:CT1371
FT                   diaminopimelate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12667"
FT                   /db_xref="GOA:B3QT24"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002986"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR022657"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:B3QT24"
FT                   /protein_id="ACF12667.1"
FT                   /translation="MPTDSFFHYQNGSLYCEGVPVSEVSKQYGSPVFVTSKASILSQYH
FT                   AFEEAFQSLNHLTCYSVKANYNLEVIKVLVDAGCGFDVNSGGELFRALKAGAEPSKIIM
FT                   AGVGKTAEEIEYALSTGIMMIKAESQSELILINEIAKKNNLVAPVGIRVNPNVLAETHP
FT                   YITTGDSEEKFGIDETLAEETFSLIKRLENLNLIGLDMHIGSQIFDTLPYYEATLKLLG
FT                   VKNIAESMGFEIEHIDIGGGFPVTYNAEKPATPIAEFAKKLVPILSNLNAKVIFEPGRY
FT                   MVANASVLLTKVLYRKQNYKDKIFLIVDSAMTELLRPSLYKSHHDVLAVAKKDNEILAD
FT                   IVGPVCESGDFFARARKVGDVQEGELLAVMSSGAYGSVMGSNYNARLKPAEVLVSGDAH
FT                   KLIRKRESYEQLIQNEML"
FT   gene            complement(230539..231174)
FT                   /locus_tag="Ctha_0197"
FT   CDS_pept        complement(230539..231174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0197"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: yli:YALI0A17853g hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12668"
FT                   /db_xref="UniProtKB/TrEMBL:B3QT25"
FT                   /protein_id="ACF12668.1"
FT                   /translation="MRSLILLLVGLFYVQSAFAANAYEAANEAVAVKEMQRRATKKEKP
FT                   EQQKQSATSVEPRKLISEDSLKALNKWLDTEKEYKRLKNLMAKQNSRIRLFKERLDKAE
FT                   KVAELYNQPGKDPEYLRDQKEAQANLGEAKKNHDVEAKKLDDLKSELAVAEKRYTIAEK
FT                   AYKIYNPTLIGFAGKSVDENKVTDESELESEEVAPEDDASSEDAAPAE"
FT   sig_peptide     complement(231115..231174)
FT                   /locus_tag="Ctha_0197"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.884 at
FT                   residue 20"
FT   gene            complement(231322..232641)
FT                   /locus_tag="Ctha_0198"
FT   CDS_pept        complement(231322..232641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0198"
FT                   /product="chlorophyllide reductase subunit Y"
FT                   /note="TIGRFAM: chlorophyllide reductase subunit Y; PFAM:
FT                   oxidoreductase/nitrogenase component 1; KEGG: cte:CT1826
FT                   chlorophyllide reductase, BchY subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12669"
FT                   /db_xref="GOA:B3QT26"
FT                   /db_xref="InterPro:IPR000510"
FT                   /db_xref="InterPro:IPR010245"
FT                   /db_xref="InterPro:IPR016209"
FT                   /db_xref="UniProtKB/TrEMBL:B3QT26"
FT                   /protein_id="ACF12669.1"
FT                   /translation="MSEEKNKTNLQSESNFESLFNELSKTRGKGQGQSEKVNLHPQTMC
FT                   PGFGGLRVLARINGAQVCLVTDKGCLYGLTFVSQFYAARKSVLSVEITDKTLSVGSLDT
FT                   DIKKALEKIAEDKSVRVIPVVSLCVAETAGFAAELLPKKIGDVEIFPVKLPAYQLRSHP
FT                   EAKDVAVLALLSRFADFSVKRKKTLLIVGEIFPLDAMAIGALLQQLGVEAVFTLPSQSL
FT                   DDYKEAGSVGACAILHPFYEQTAAFFQEKGVPIITGNPVGANSTYKWIKDIGEVLALNP
FT                   AQVELVAQQEKDKIKAVMQQHKVEGSVIVAGYEGNEFPLVRLLLEAGLTVPYASTSIKQ
FT                   TPLGEEDDKLLKMLGTDVRYRKFLEEDRRAVLEHKPDLVIGTTSLDSYVKEMGIPAVYY
FT                   TNIMSSRPLYFAQGAATVLTLINGLLKRKNIYEKMQAFFQ"
FT   gene            complement(232691..233344)
FT                   /locus_tag="Ctha_0199"
FT   CDS_pept        complement(232691..233344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0199"
FT                   /product="Sporulation domain protein"
FT                   /note="PFAM: Sporulation domain protein; KEGG:
FT                   pap:PSPA7_5789 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12670"
FT                   /db_xref="GOA:B3QT27"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:B3QT27"
FT                   /protein_id="ACF12670.1"
FT                   /translation="MSWLYEEGSSSSKNLYIIIGAVAVVLLLAIGGFFIFSGGGESEEK
FT                   MPDVSAAHTVEAPVEEKASEAAQAVEESQEKEMIPEQSAAETPQPERRYAQPNREIESS
FT                   PAPSKASSAISSRAAASRETPWFVPPQLTKKMNLSDGGYAISVGSFPDKSKADALVETY
FT                   AKKGIAAAVWETEVRGKTFNRVLVGSFSSRAEALRTKEEAASVLPGDAFIVKVK"
FT   gene            complement(233341..234198)
FT                   /locus_tag="Ctha_0200"
FT   CDS_pept        complement(233341..234198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0200"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cph:Cpha266_2076 sporulation domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12671"
FT                   /db_xref="UniProtKB/TrEMBL:B3QT28"
FT                   /protein_id="ACF12671.1"
FT                   /translation="MNNEIFAKVLAPSLGFDKDKVVQYIDKLFEQSLEELLLQGTVSFA
FT                   GVGVLKRVYHPAEPRQEKDGNLFLFPPRQSVQLTSSSSENPEDFVYDIALSQFNLNEVH
FT                   ALKFSKGVAATLQKVLEVKGEVEIGNIGALKKAEDGTVTFEESDWLLELLNKQYAHLKP
FT                   APVSSKKSQENAAAEFEKTMNPDASAERLQAEQKGQADVLSYETASTASSKDDESEREE
FT                   FGELIDISSKATGTASEEKAAKKPLESSKQNQKTTMESPKHLYKKMIVNHRFHPVKAKA
FT                   KSMI"
FT   gene            complement(234516..236045)
FT                   /locus_tag="Ctha_0201"
FT   CDS_pept        complement(234516..236045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0201"
FT                   /product="amino acid carrier protein"
FT                   /note="TIGRFAM: amino acid carrier protein; PFAM:
FT                   sodium:alanine symporter; KEGG: vvy:VV2044 sodium/alanine
FT                   symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12672"
FT                   /db_xref="GOA:B3QT29"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="UniProtKB/TrEMBL:B3QT29"
FT                   /protein_id="ACF12672.1"
FT                   /translation="MRKTLTILFQILILSFPAKTFAQAGTELSIDEKINAVVEPIATTV
FT                   ANVIFYSVPINNEIAIPVVLVWLLLGAVVFTLYMNFINVRGFRLGLDLILGVYDNPKYQ
FT                   KGEVSHFQALTAALSGTVGLGNIAGVAVAITLGGPGATFWMIIAGLLGMSSKFVECALG
FT                   VKYRNINPDGSVSGGPMYYLSKGLAEKGQVKLGKVLSVFFAIMCIGGSLGGGNMFQINQ
FT                   AYKQFIVATGGEYSFAYESAWLFGLVMAVLVAIVIIGGIKSIARVTDKLVPFMFFIYAS
FT                   AALFIIFVHWRDIPAAFLLIFSGAFSPEAISGGVIGVMIQGFKRAAFSNEAGIGSASIA
FT                   HSAVRTDEPITEGLVALLEPFIDTVLICTMTALVIIITGFYNEQGVDGVALTSSAFESV
FT                   ISWFPYLLSLAVILFAFSTMIAWSYYGLKAWTYLFGETKVANLTYKFIFCVFLVFGATM
FT                   NLDSVIYFSDAMIFSMSFPNIMGLYLLGADVKSDLNQFLARVKSGEIRRFK"
FT   sig_peptide     complement(235977..236045)
FT                   /locus_tag="Ctha_0201"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.981 at
FT                   residue 23"
FT   gene            236301..236378
FT                   /locus_tag="Ctha_R0002"
FT                   /note="tRNA-Asp1"
FT   tRNA            236301..236378
FT                   /locus_tag="Ctha_R0002"
FT                   /product="tRNA-Asp"
FT   gene            236474..237262
FT                   /locus_tag="Ctha_0202"
FT   CDS_pept        236474..237262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0202"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: tet:TTHERM_00864990
FT                   TPR Domain containing protein Pfam: TPR_3 TPR_2 TPR_1 Sel1
FT                   MIT FAT PROSITE: TPR TPR_REGION"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12673"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:B3QT30"
FT                   /protein_id="ACF12673.1"
FT                   /translation="MGKRLTFVLTFAILIFPNVRHSQAQQISDLTKSKIDSLTTLLDTC
FT                   ENLPAYETLATYYYQKREFIEAAKLFKHAVRLSDSIAANHFGLAQSYFALHQYRYAAAS
FT                   YQKVTKLTPFFFTAFYNLGITYLHLGQYQEAKKTFIHALSLEPENSYCFFHIAKAYRGL
FT                   RLFEQALAALHYAAELSPGFSEAHFLLGDIYFELEQYQNAAVNYQQMLILSPNATLALY
FT                   RLGLTFIRLKEKTKAQQAYNLLEKINPYLAQKLLNQIEIM"
FT   sig_peptide     236474..236542
FT                   /locus_tag="Ctha_0202"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.985) with cleavage site probability 0.839 at
FT                   residue 23"
FT   gene            237364..237948
FT                   /locus_tag="Ctha_0203"
FT   CDS_pept        237364..237948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0203"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_3; Tetratricopeptide TPR_2 repeat
FT                   protein; SMART: Tetratricopeptide domain protein; KEGG:
FT                   cph:Cpha266_2087 tetratricopeptide TPR_2 repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12674"
FT                   /db_xref="GOA:B3QT31"
FT                   /db_xref="InterPro:IPR000331"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:B3QT31"
FT                   /protein_id="ACF12674.1"
FT                   /translation="MIYSRFKKAFLFCGLLLAMFGCGVENGLQKLEQKVWANPNDVEAQ
FT                   FNLGKAYGSIGDYEKAATTLKKVTELDSTHPVAYSALGAAYFMLERYDDAIQAFQSAKA
FT                   LQPKDPEKSVDLGNAYFNAKKFPEAISEYKTALALDSTLHEVYYNLGMSYAKNGQKSEA
FT                   LHAYEILKTYNSYLASSLQREFIDILGLEIE"
FT   sig_peptide     237364..237435
FT                   /locus_tag="Ctha_0203"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.344 at
FT                   residue 24"
FT   gene            238037..239359
FT                   /locus_tag="Ctha_0204"
FT   CDS_pept        238037..239359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0204"
FT                   /product="nucleotide sugar dehydrogenase"
FT                   /EC_number="1.1.1.22"
FT                   /note="KEGG: gur:Gura_2308 UDP-glucose 6-dehydrogenase;
FT                   TIGRFAM: nucleotide sugar dehydrogenase; PFAM:
FT                   UDP-glucose/GDP-mannose dehydrogenase; 3-hydroxyacyl-CoA
FT                   dehydrogenase NAD-binding; NAD-dependent
FT                   glycerol-3-phosphate dehydrogenase domain protein;
FT                   Ketopantoate reductase ApbA/PanE domain protein;
FT                   UDP-glucose/GDP-mannose dehydrogenase dimerisation;
FT                   UDP-glucose/GDP-mannose dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12675"
FT                   /db_xref="GOA:B3QT32"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028357"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B3QT32"
FT                   /protein_id="ACF12675.1"
FT                   /translation="MKHVAVVGTGYVGLVAGTCFAETGNQVICVDIDKAKVEKLRNNVV
FT                   TIYEPGLEVLFKRNLREKRLHFTTELAEAMESCDIIFLALPTPPGEDGSADLKYVLGVA
FT                   KEIGKLIKSYKVVVNKSTVPVGTADKVRAAIAEHATCDFDVVSNPEFLREGVAVDDFLK
FT                   PDRVVIGSSSERATEVMQQLYEPFVRQGNPILVMDERSAEMTKYAANSMLALRISFMNE
FT                   IANLCDKVGANVDMVRRGIGTDFRIGKHFLYPGVGYGGSCFPKDVKALIKTAQDYEYNF
FT                   QILKSVECVNESQKHLLVQKIEAYYGGREHIAGKKFAMWGLSFKPNTDDIREAPSLVVI
FT                   HALLEMGAEIVAYDPEAMGHVKQIVGDKVTFASLAEDALNDADALIIVTEWNEFRNPDF
FT                   NSVKKRLKHHLIFDGRNVFDNHKMKELGFEYYSIGRPTCQL"
FT   sig_peptide     238037..238102
FT                   /locus_tag="Ctha_0204"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.974) with cleavage site probability 0.973 at
FT                   residue 22"
FT   gene            239529..240371
FT                   /locus_tag="Ctha_0205"
FT   CDS_pept        239529..240371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0205"
FT                   /product="3-methyl-2-oxobutanoate hydroxymethyltransferase"
FT                   /EC_number="2.1.2.11"
FT                   /note="KEGG: cph:Cpha266_1658 3-methyl-2-oxobutanoate
FT                   hydroxymethyltransferase; TIGRFAM: 3-methyl-2-oxobutanoate
FT                   hydroxymethyltransferase; PFAM: Ketopantoate
FT                   hydroxymethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12676"
FT                   /db_xref="GOA:B3QT33"
FT                   /db_xref="InterPro:IPR003700"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:B3QT33"
FT                   /protein_id="ACF12676.1"
FT                   /translation="MSTRLDIKKRLAPQVTTRKLVEMKAQGEKIAILTAYDYTMARILD
FT                   NSGIDVLLVGDSASNVFGGNETTLPITMEEMIYHAKAVFRGVHAATGRAMIVVDMPFMS
FT                   YQLSSEDALRNAGKLMKETGCHAVKLEGGKAIIEAVKRITDVGIPVMGHLGLTPQAIYK
FT                   FGSYKVRAREEEEAEQLLEDAKQLENAGAFAVVLEKIPMELSQKVTDSLHIPTIGIGAG
FT                   AACDGQVLVVNDMLGFNTDFHPRFVRKYANLDNVIGTSVKNYVNDVRQGTFPNESESY"
FT   gene            complement(240382..241008)
FT                   /locus_tag="Ctha_0206"
FT   CDS_pept        complement(240382..241008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0206"
FT                   /product="NADP oxidoreductase coenzyme F420-dependent"
FT                   /note="PFAM: NADP oxidoreductase coenzyme F420-dependent;
FT                   6-phosphogluconate dehydrogenase NAD-binding; KEGG:
FT                   sus:Acid_3142 NADP oxidoreductase, coenzyme F420-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12677"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B3QTD1"
FT                   /protein_id="ACF12677.1"
FT                   /translation="MKVGILGTGHIGSGLGKRWAENGHQVFFGSRVPEKAAALAKTIGH
FT                   GALFGTYQQTCAFAEVILLAFPWSACDAALQSCGSLTGKILIDCINPLGNDYRSLTIGY
FT                   STSVAEEIAKQAPGAKVIKAFNSISDKVIRLGADFNGQKASAFYCGDDAEAKVAVQELI
FT                   STIGFEPVDCGALKTARYLEPMAVLLINVAMNGYGSNIAFNLLQR"
FT   gene            241345..243453
FT                   /locus_tag="Ctha_0207"
FT   CDS_pept        241345..243453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0207"
FT                   /product="OmpA/MotB domain protein"
FT                   /note="PFAM: OmpA/MotB domain protein; KEGG:
FT                   lbi:LEPBI_I0545 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12678"
FT                   /db_xref="GOA:B3QTD2"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR006860"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:B3QTD2"
FT                   /protein_id="ACF12678.1"
FT                   /translation="MKAQLRTNVLKEKCFFKHCLCFALFLVSILGFQSTVIAQSYELSP
FT                   GNIWIINDDVFYPGTATINKSTQAAVDRLGLYVAARPDLKILIQGNWSNEGNTVREKLY
FT                   SEERALAIQRFLIYTHNIDPSRIQTVGYGSARPLTVEKTAADKARNRAVTIVGLTKLSD
FT                   KPLTKNGYAANCTAYLALLEGNVQTKAPWDVQFVNGRYQQQLFEGHKLNVYNDSRAAIR
FT                   FVDGSLISMGENARVVFNGGLDFGEEPNMEIDRGKIHIELRPMSTRKDFEISFPDGKLI
FT                   FYGERALLNVINGEKAKSVSLSVFEGNAKVIYKGREYFLQEGEGFQVQDHEQDTLKKSK
FT                   LPKTPALILPLDNQTVYKGKTKFSWTTNAKLNLLQISKKPDFRNYVYEEVVAGQNKTVT
FT                   LEKGTYFWRVSSLTGEGLPGSPSAARRILVSEEYVTMSLIDKKAKTVFEEGEKATLITN
FT                   VPKDTVVHEQLFSVMGIVDPGSNVFINNTLLENVSPKGVFSQKLRLIKGQNELSVDTRA
FT                   QNGLQNQVSAKIYYQPIDKIRCALTLSPVIPVTTSNYSLGLGGKFIVSYMLANEFYCKM
FT                   TAGYNAYLVEAVANGFTNTNRKQVNSSIITEIGGIYEFFPHSTTIPYLEMNTGLFWLNR
FT                   SAKVLSETRKSVYFSPGIGAGVIFVTEGQNIGLGGYYRLIFQGSDLIDKTAEGQFAGLL
FT                   EIQLTFWF"
FT   sig_peptide     241345..241461
FT                   /locus_tag="Ctha_0207"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.851 at
FT                   residue 39"
FT   gene            243677..244534
FT                   /locus_tag="Ctha_0208"
FT   CDS_pept        243677..244534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0208"
FT                   /product="CDP-diacylglycerol/serine
FT                   O-phosphatidyltransferase"
FT                   /note="TIGRFAM: CDP-diacylglycerol/serine
FT                   O-phosphatidyltransferase; PFAM: CDP-alcohol
FT                   phosphatidyltransferase; KEGG: cte:CT1340
FT                   CDP-diacylglycerol-serine O-phosphatidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12679"
FT                   /db_xref="GOA:B3QTD3"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR004533"
FT                   /db_xref="UniProtKB/TrEMBL:B3QTD3"
FT                   /protein_id="ACF12679.1"
FT                   /translation="MTEKNRPAEQPHQPKYAPHDAPRTTKRKFKMRKVQIPRVPPSAVP
FT                   SAFTVMNMACGYVAIVMASQDSFTAAGWFIIFAAIFDTLDGFVARLTNASSEFGVELDS
FT                   LSDLVSFGAAPSFLAYKFGLNEYGVGVGLGLSSLLMIGSGLRLARFNVQLVGFSKDYFS
FT                   GLPTPSQAMTLATFVMWAHNEQVFFAPHLHVVLAVLTVLLAGLMVSKVRYDTLPKFRPD
FT                   DFRSSPVKMSLYIISFICILIFQAKAFFIAMMMYILFGLIRSIYHFFSEETDIASENAT
FT                   THNM"
FT   gene            244641..244892
FT                   /locus_tag="Ctha_0209"
FT   CDS_pept        244641..244892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0209"
FT                   /product="phosphoribosylformylglycinamidine synthase, purS"
FT                   /note="TIGRFAM: phosphoribosylformylglycinamidine synthase,
FT                   purS; PFAM: phosphoribosylformylglycinamidine synthetase
FT                   PurS; KEGG: plt:Plut_1326 phosphoribosylformylglycinamidine
FT                   synthetase PurS"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12680"
FT                   /db_xref="GOA:B3QTD4"
FT                   /db_xref="InterPro:IPR003850"
FT                   /db_xref="InterPro:IPR036604"
FT                   /db_xref="UniProtKB/TrEMBL:B3QTD4"
FT                   /protein_id="ACF12680.1"
FT                   /translation="MAFNAKIRVTLRKSILDVQGKAVHQALGNLGYNDIDSVRIGKYIE
FT                   VHINEEDIEKAKKITDDICHKLLSNPVMEDYSYDLETI"
FT   gene            244955..245662
FT                   /locus_tag="Ctha_0210"
FT   CDS_pept        244955..245662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0210"
FT                   /product="phosphoribosylformylglycinamidine synthase I"
FT                   /EC_number="6.3.5.3"
FT                   /note="KEGG: cte:CT1338 phosphoribosylformylglycinamidine
FT                   synthase I; TIGRFAM: phosphoribosylformylglycinamidine
FT                   synthase I; PFAM: CobB/CobQ domain protein glutamine
FT                   amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12681"
FT                   /db_xref="GOA:B3QTD5"
FT                   /db_xref="InterPro:IPR010075"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B3QTD5"
FT                   /protein_id="ACF12681.1"
FT                   /translation="MAKTKFGIVVFPGSNCDHDTEYVCNAFPNAEAKLIWHQESDLQGA
FT                   DVIVLPGGFSYGDYLRAGAIAKFSPVMQEVIRFAGEGRPVIGICNGFQVLLESGLLEGA
FT                   MMHNKSRRFICKFVYLKVANNQTLFTSKYEKDAVVRIPIAHGEGNFFASEATLSRLQEN
FT                   EQIVFQYCDKAGQLSEAANPNGSCLNIAGIVNEKRNVLGMMPHPERASDAMLGSTDGSK
FT                   VFESILNNFVEAV"
FT   gene            245875..246765
FT                   /locus_tag="Ctha_0211"
FT   CDS_pept        245875..246765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0211"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12682"
FT                   /db_xref="UniProtKB/TrEMBL:B3QTD6"
FT                   /protein_id="ACF12682.1"
FT                   /translation="MFRTRLTFIWMLLAFFGGHSSLLAENQAQIKPKNSAKRYPPKLRF
FT                   NAEAFRSFEKNYIDTRQKYNFVYQNVIFDSVGCTLNQLTRPVIPIQLALNLAENDTATA
FT                   ILVAAKAFLDENEPLFHANSKQVVLGSLNDYDEFCAVLFERAAYGKHPAAGQSRGKVEF
FT                   IVEKKTGHLYLLASTMTRIIGNLPDSATYPKNKLYDKLKDRTLRFSLGQKHIKFTINRL
FT                   ETIQLSRVCVYEKKTFDDIYDSHGKRVERRLVSDEPHLAYEVIIGEDLANPIATIFFDA
FT                   ITGEELAIDYPEPKW"
FT   sig_peptide     245875..245949
FT                   /locus_tag="Ctha_0211"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.876 at
FT                   residue 25"
FT   gene            246803..248083
FT                   /locus_tag="Ctha_0212"
FT   CDS_pept        246803..248083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0212"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   cte:CT1337 MFS transporter family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12683"
FT                   /db_xref="GOA:B3QTD7"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR024671"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B3QTD7"
FT                   /protein_id="ACF12683.1"
FT                   /translation="MPLSSETAEPVPLQNEEPYSKRNIFAWTLFDFANTSFSVMIVTFV
FT                   YPLYFKNIICAGHAIGDALWGTNVSISMLIGAVVAPVLGAASDYSGRRKRFLLAFTLIS
FT                   ILCTSLMFFTSADMILIGSVLFILANVGFEGGLVFYDAYLPEITSKRSYGRVSGYGFAM
FT                   GYLGALVTLAASFPLIIGGFEPENLLNIRYSFLLAAGFFFFFSIPLFLALRDKKPARAE
FT                   HISFLKAGFREVRATLSNIRNYPNLVRFLTAFFFYNDGILTIIAFASIYAANTLNFSFQ
FT                   ELVIFFITVQTTAILGSVIFGVITDKIGAKRTIVITLLIWIFVILLAYFTDTKEMFYIV
FT                   GLFAGISMGASQSASRSLMARLTPAEHSAEFFGFYDGSFGKASAIVGPWIFGLISTLAG
FT                   SQRIAILSLLLFFTVGLWLILKVRTEK"
FT   gene            248454..250046
FT                   /locus_tag="Ctha_0213"
FT   CDS_pept        248454..250046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0213"
FT                   /product="L-aspartate oxidase"
FT                   /EC_number="1.4.3.16"
FT                   /note="KEGG: pvi:Cvib_1210 L-aspartate oxidase; TIGRFAM:
FT                   L-aspartate oxidase; PFAM: fumarate reductase/succinate
FT                   dehydrogenase flavoprotein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12684"
FT                   /db_xref="GOA:B3QTD8"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR005288"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:B3QTD8"
FT                   /protein_id="ACF12684.1"
FT                   /translation="MTEELKTDILVIGSGIAGLYFALKAAELGEVILITKKERSDSNTN
FT                   WAQGGIAAVLDENDTFDAHIADTLNAGVGLCNQEAVEVMVKEGPAHISKLIEIGTNFTK
FT                   KSGKLDLGREGGHSYNRIVHAADLTGHEVEQTLLSKVAESPNIQLLEHHFGIELITEHH
FT                   LKCKTNDITCYGVYALDSKSRKIKKILAKATMLATGGLGQVYQHTTNPSIATGDGIAMS
FT                   YRAGAEIHNMEFIQFHPTTLFHPNADSFLISEAVRGFGGVLRLKNGEEFMHKYDERKSL
FT                   APRDIVARAIDNEIKKSGEECVFLDVTHLDSESVTQHFPNIYNTCLEYGIDITKEMIPV
FT                   VPAAHYSCGGVATDLIGRTTINRLYACGEAASVGVHGANRLASNSLLEALVFSHRAFLD
FT                   MKERLQYIENNISFPDWDDSGTENAEEWILVSHNRKEAQQVMNDYVGIVRSDLRLDRAS
FT                   RRMEFLKEETEVFYKKTKITPQVLELRNAIKVSSLVIESALKRRESRGLHYTTDYPYVD
FT                   DKHFLKNTVLRSF"
FT   gene            complement(250134..251978)
FT                   /locus_tag="Ctha_0214"
FT   CDS_pept        complement(250134..251978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0214"
FT                   /product="GTP-binding protein TypA"
FT                   /note="TIGRFAM: small GTP-binding protein; GTP-binding
FT                   protein TypA; PFAM: elongation factor G domain protein;
FT                   protein synthesis factor GTP-binding; elongation factor Tu
FT                   domain 2 protein; KEGG: cte:CT1424 GTP-binding elongation
FT                   factor family protein, TypA subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12685"
FT                   /db_xref="GOA:B3QTD9"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006298"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035651"
FT                   /db_xref="InterPro:IPR042116"
FT                   /db_xref="UniProtKB/TrEMBL:B3QTD9"
FT                   /protein_id="ACF12685.1"
FT                   /translation="MLRYRSDIRNIAIIAHVDHGKTTLVDAVLKQTGTFRENQKVDERI
FT                   MDSNPQERERGITIFAKNASFFYKDTKVNIVDTPGHADFGGEVERILKMVNGAVLLVDA
FT                   LEGPMPQTKFVLRKALELHLKILVVINKIDRPNCNPMKVLDEVLDLFIHLGAHEDQLDF
FT                   PYVFASAKSGFAINELGDEPKDITPLLDMILAHMPPPEADVDAPFQMLVNTIDYSEYLG
FT                   KIAIGRIFKGSIKKGDPFTCLSAKGKLLNGRVAKLFIFEKLGKVEISEASAGDIIALTG
FT                   LEDISIGDTLTHPEHQEVLPSIEITEPTISMFFSVNNSPFAGKEGKFVTSRNIRDRLYK
FT                   ELLSNVALRVEDTESADTFKVSGRGELHLSVLIETLRREGYELGVSRPEVIIRRDEEGR
FT                   ACEPIESVTIDVPDTFVGIVIEKMGKRKAEMKNMTQMEGGLVRLDFEIPTRGLLGFNTE
FT                   FITDTKGEGILTHIFKCYEPFRGEINSRQNGVLVSAENGDSVAYAISSLDDRGVFFVEP
FT                   GTAVYEGMIVGESNREFDMNVNVCKTKKLTNMRASGSDEALRLTPPRKLTLEQALEFIE
FT                   DDELVEVTPKSIRLRKKTLDSNVRAKETKKKKAATEVA"
FT   gene            complement(252158..253603)
FT                   /locus_tag="Ctha_0215"
FT   CDS_pept        complement(252158..253603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0215"
FT                   /product="surface antigen, putative"
FT                   /note="KEGG: tde:TDE0206 surface antigen, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12686"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:B3QTE0"
FT                   /protein_id="ACF12686.1"
FT                   /translation="MLFTANWAFGQAIKIPIPDKNFRQALIQHDAKNGTNYQIKPAGDG
FT                   AVSVEDPSKISFLILSNKGIQDLSGIEFFESLCYLDCSRNEIEEIEIYKNKDLIGLICD
FT                   RNKLTNLSISNAEVLSYLACNDNALESLQLNGAPNLRNLWCFNNQIHALDISQNLLLDT
FT                   LDCYNNNLLDLDVSNNLELKALWCSVNQLDYIDISQNVKLKEFDCFLNQIRELDVSKNK
FT                   DIEVLYCGNNKLKILDLSKCLNLRILSCQSNQLVAIDLSKNSDLSLINCKNNNLIDIDF
FT                   SQNRKLISIDCSKNNLKQLGVLKNENLIFLACESNELSDLDISFCPLLTDLNFKKNKID
FT                   EINLKKCFDLERLWCSENKLSALDVSENRKLKTLWCCKNQIQLLDISQNFVLDTLDCSE
FT                   NALAELNVCYNSELSILWCGKNKLKSLDVHHNKKLKTFECKENLFSEILIPESHVYDFF
FT                   EKDRHVKIICIKEDEQKLSRRAG"
FT   gene            253788..254249
FT                   /locus_tag="Ctha_0216"
FT   CDS_pept        253788..254249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0216"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: afw:Anae109_2849 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12687"
FT                   /db_xref="UniProtKB/TrEMBL:B3QTE1"
FT                   /protein_id="ACF12687.1"
FT                   /translation="MTLEQLLNEKAPFLIEEALQALSRAHLKHYEEEGAAKRKAQMQAL
FT                   YELTAESIKMRDLSKLLDYVQEAATSYYKDGFDLHEIQMAFNVLEEVVWKNALKELPAS
FT                   QYADALGLISTALGAGKDTLATTYVNLASSRKMPSLDLSELFTGTEGRN"
FT   gene            254574..256145
FT                   /locus_tag="Ctha_0217"
FT   CDS_pept        254574..256145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0217"
FT                   /product="protein of unknown function DUF92 transmembrane"
FT                   /note="PFAM: phosphatidate cytidylyltransferase; protein of
FT                   unknown function DUF92 transmembrane; KEGG:
FT                   cph:Cpha266_0855 protein of unknown function DUF92,
FT                   transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12688"
FT                   /db_xref="GOA:B3QTE2"
FT                   /db_xref="InterPro:IPR002794"
FT                   /db_xref="UniProtKB/TrEMBL:B3QTE2"
FT                   /protein_id="ACF12688.1"
FT                   /translation="MDQNSALSSDFYHFLAALGIILVIVGFAEFLKSILKMQSGVTRKI
FT                   VHVGTSVLVALSPNYFETGFYPAVLAVLFIPFNLLAIKKGWLSSINKDEALEAHHQDQN
FT                   YGTVYFPLSFLILTLLCWDSHAWIMQTAMLILGFGDAFASLVGENTEKPHAYKLLASTK
FT                   SLEGSITMFGTSLIILVGAFVVFQDQSEVIKQMDLSVVIALCVAIALIVTAVEALLSGG
FT                   LDNLFIPLSVAYLLAVLETNGIGAVQGILLGVSLSLILARASLAFKFLTPDGAVGTFLF
FT                   GSNIFSMGGVEWTVPILTFFLLSSVLSKLGKSRKKKYDLIFEKSSQRDFGQVLANGGVG
FT                   WILIIWYSFTNEPMLFIAYLGTLAAVQADTWATEVGTMMKDPKPRFILNMKPVPAGTSG
FT                   GITFTGTMGGFFGALLICASAWAIMPDELMSVGLVQSFLIVGLAGAGGSLVDSFFGATV
FT                   QAQYYDPIRKKETERTHSVAADGTIVENELIKGYRIIDNDIVNFLCATMGALFATFLTY
FT                   FMVGQI"
FT   gene            complement(256284..257483)
FT                   /locus_tag="Ctha_0218"
FT   CDS_pept        complement(256284..257483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0218"
FT                   /product="2-hydroxyglutarate dehydrogenase"
FT                   /EC_number="1.1.99.2"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   bcl:ABC4035 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12689"
FT                   /db_xref="GOA:B3QTE3"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B3QTE3"
FT                   /protein_id="ACF12689.1"
FT                   /translation="MAETSDFLVIGAGIVGLATAQALLEKFPDRKVIVLEKESAPAQHQ
FT                   TGHNSGVIHSGIYYKPGSMKAENCRKGKMLLEAFCKAEHIPYKICGKIILATEPQELPA
FT                   LNALFERGKANDVKSKLIDPAEIHLLEPHVSGIKAIHVEDAGIVDFKTVCQKLVEKIAA
FT                   RGGQVVLNAKVLAISEVENGVLLKTSSGAFRATLVLNCAGLHSDSVAKLSGFQPPVQIV
FT                   PFRGEYFKLAEPAKLFCQNLIYPVPNPEFPFLGVHFTRMINGAVECGPNAVPAFAREGY
FT                   CKSDINFSDLAEMAFYSGFLKLGKMYWREGLAEFRRSFSKSQFLKSLQRLIPEIRIEHL
FT                   ESAPAGVRAQAVAPDGKMLDDFLIYETRHIIHVLNAPSPAATASLNIGNVLAQKAKNRT
FT                   "
FT   gene            complement(257556..258818)
FT                   /locus_tag="Ctha_0219"
FT   CDS_pept        complement(257556..258818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0219"
FT                   /product="8-amino-7-oxononanoate synthase"
FT                   /EC_number="2.3.1.47"
FT                   /note="PFAM: aromatic amino acid beta-eliminating
FT                   lyase/threonine aldolase; aminotransferase class I and II;
FT                   aminotransferase class-III; KEGG: cph:Cpha266_2306
FT                   8-amino-7-oxononanoate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12690"
FT                   /db_xref="GOA:B3QTE4"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B3QTE4"
FT                   /protein_id="ACF12690.1"
FT                   /translation="MNAADSQSTPTVENTPPNESITKPKDLFQKCFDFTIADEIKAKGV
FT                   YPYFRPIEENEGPEVFIEGRKVIMAGSNNYLGLTGDPRVKEAAIKAIERFGTSCSGSRY
FT                   LTGTVSLHIELEEKLADYFGKESVLLFSTGYQTGQGIIPTLVQRGEYLISDRDNHACLV
FT                   VAGLMARGATATLERYKHNDMADLERVLQKLPYEAGKLIATDGVFSVSGEIVNLPEIVR
FT                   LAKQYNARILVDDAHSVGVIGKGGRGTASEFGLEKEVDLTMGTFSKTFASLGGFVAGDR
FT                   AVINFIKHQAPALIFSASPTAASVAAALKSLEILQAEPERITKLIENADRVRQGLKQLG
FT                   FRLMDSRTAIVSAIIGDQEKTLIFWRKLFDAGVFVNAFVRPGVMPGYEMLRTSYMSTHE
FT                   AWQLDKIVTEFEKIGKELGVI"
FT   gene            259080..260099
FT                   /locus_tag="Ctha_0220"
FT   CDS_pept        259080..260099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0220"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; polysaccharide
FT                   biosynthesis protein CapD; dTDP-4-dehydrorhamnose
FT                   reductase; NmrA family protein; Male sterility domain;
FT                   KEGG: cte:CT1949 NAD-dependent epimerase/dehydratase family
FT                   protein/3-beta hydroxysteroid dehydrogenase/isomerase
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12691"
FT                   /db_xref="GOA:B3QTE5"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B3QTE5"
FT                   /protein_id="ACF12691.1"
FT                   /translation="MAETALVTGATGFIGSWLTEKLLEKGYKVRALVRQSSNRANLQGL
FT                   DVEYVVGDYKDFNSLKKAVQGVSYVFHTAGVTKAKAEMEYIDGNVRATESLLKATYEAN
FT                   PNITRFLHVSSLASVGPAKSPNEPVNEKTTAKPITMYGSSKNITEQACQRYIFFPTGKV
FT                   QTRLPVTIVRPPAVYGPRDKDVLEFFKTVNSGILPIVGFGPKKLVSLIHVKDLVRGIID
FT                   AAEAEQAKGETYFISSEKFYSWEEVGEVTKKALGKGFVLKLPIPHFAVSIAAAISEATS
FT                   KSGNTPPPLNREKVKDIVQNYWICSVDKAKKELGFKEQISLEQGIKETVDWYKSKGWL"
FT   gene            complement(260223..261803)
FT                   /locus_tag="Ctha_0221"
FT   CDS_pept        complement(260223..261803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0221"
FT                   /product="D-3-phosphoglycerate dehydrogenase"
FT                   /note="TIGRFAM: D-3-phosphoglycerate dehydrogenase; PFAM:
FT                   amino acid-binding ACT domain protein; D-isomer specific
FT                   2-hydroxyacid dehydrogenase catalytic region; D-isomer
FT                   specific 2-hydroxyacid dehydrogenase NAD-binding; KEGG:
FT                   cph:Cpha266_1089 D-3-phosphoglycerate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12692"
FT                   /db_xref="GOA:B3QTE6"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR006236"
FT                   /db_xref="InterPro:IPR029009"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B3QTE6"
FT                   /protein_id="ACF12692.1"
FT                   /translation="MKVLITDNVNKDCGEILSQNGYEVTEKAKLSKDELKSVIKDYEIL
FT                   IVRSATKVTSDVIEVADNLKLIGRAGAGVDNIDIEAATRKGIIVMNTPGGNTVSAAEHA
FT                   CGMLLATARNIPQASAQMHQAVWDKKKWMGAELEGKTLSVIGLGKIGREVAVRMQAFGM
FT                   KTVGYDPMLPEEFAAKMNIELLTLSETLKQADFITIHSSLNESTKNLICKETIEIMKDG
FT                   VYIVNCARGGIVNEFDLAEAIKSGKVAGAALDVFAQEPIVSDNPLIGIERVIMTPHIAA
FT                   STEEAQVKVAIQIAEQIVEWKNNHRLNGAVNASAIELAQAPEVKPFLSLSEKLGVMIAQ
FT                   LATKKPKHLNVWVSGDFLRKFSEVITAAVLKGFLDVVQEGDINYINAAAMANDMGLDVE
FT                   QRYEKENFDYTNLIRVELETEACKRMIGGAVLGAKELRVVMIDKFLCEFKPEGQILIYN
FT                   NQDKPGVLARVGMALLKRGLNIASVALSRDEEKKEALTVISLDDTVDTEVLEDIEKVDG
FT                   VFSPRLIKV"
FT   gene            complement(261927..262244)
FT                   /locus_tag="Ctha_0222"
FT   CDS_pept        complement(261927..262244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0222"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mxa:MXAN_2060 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12693"
FT                   /db_xref="InterPro:IPR010376"
FT                   /db_xref="InterPro:IPR038492"
FT                   /db_xref="UniProtKB/TrEMBL:B3QTE7"
FT                   /protein_id="ACF12693.1"
FT                   /translation="MLQLIKLKKSGEQDLTLFWNDGVETKISFQRLRDECPCAECKGET
FT                   VLFESTEPKKKSPETPGIYELRQVEVVGNYSIQPIWGDGHNSGLYSWEYLRKISTHSAK
FT                   S"
FT   gene            262432..264687
FT                   /locus_tag="Ctha_0223"
FT   CDS_pept        262432..264687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0223"
FT                   /product="protein serine/threonine phosphatase"
FT                   /note="PFAM: Stage II sporulation E family protein; SMART:
FT                   protein phosphatase 2C domain protein; KEGG: chu:CHU_0195
FT                   sigma factor SigB regulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12694"
FT                   /db_xref="GOA:B3QTE8"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:B3QTE8"
FT                   /protein_id="ACF12694.1"
FT                   /translation="MSSKKRITYLFAFVIVLCEMFLLGLDVSIFYAIKAKTYLLPSGFI
FT                   YLKDILASLVFIALYALIRKGIRLNRNDQTNPIWIEPSRGAWDAMVTLVLIIGAIFVYD
FT                   QTFPEAVYRRISNFGLDFYAPESLYTIFKSHFITLLLGSALLAGLITIERLILYKRTKN
FT                   TAINFALFIIALFGFSFSMAGTVPGAQFSPISLGLGITALILMFINAFRVSWILPMSRQ
FT                   DKWQIMGLTVIIGICGLILLNGFHFPPYLLWYSSFVGHFLLSLTAFVTLYFCVSFLGIL
FT                   IYLPSSRDFERKSEEVRKLYKMSKFITDVFDEDKIYTSLIRFVCESIGENSLGWFDLYV
FT                   PNSVSEKAAGTFHTVHYTDVSGTKQVAHFRTVATNNVSSNIIAEMQRSAGFIWQQVLEK
FT                   KDIVQVDDMVTDKRLNAKIPPIHAVLKRLNIRKRHPKPLFPIGSIVSVPLTMRSELIGI
FT                   IHVAKDVEFSFIREDLELITIFADQAAIAIDNSRLIKQLIGKERLEQQLEIAREIQSRL
FT                   LPQEPLQVPGFDMAGISEPAYEVGGDYYDFFQLDDGDEISRFGIVIADVSGKGTSAAFY
FT                   MAELKGIIQSLCKVYPDAPRDLLKKANETLSQSLGKNAYISLLYGVVDVKENTLSLVNA
FT                   GHCPAAAVMNKNPSYLKLQGLALGLDTGKIFNQVVSKNIYPLADGDVIVFYTDGVVEAI
FT                   NHEGKQFGYDRLLKIVNQSREKNAKDITNDIFTAVNDFTKTGGAVRDDLTLVVVKKL"
FT   gene            264817..265179
FT                   /locus_tag="Ctha_0224"
FT   CDS_pept        264817..265179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0224"
FT                   /product="anti-sigma-factor antagonist"
FT                   /note="TIGRFAM: anti-anti-sigma factor; PFAM: Sulfate
FT                   transporter/antisigma-factor antagonist STAS; KEGG:
FT                   fnu:FN1914 anti-sigma F factor antagonist"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12695"
FT                   /db_xref="GOA:B3QTE9"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR003658"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:B3QTE9"
FT                   /protein_id="ACF12695.1"
FT                   /translation="MSNFNCTLRTIEEFSILDLSGDLDAHTASILEKKFQELIENKSFK
FT                   IVVTFSNLNYISSAGLGVFMGVIEDIRSGGGDIKFSNTSDNIYQVFDMLGFPLLYEFFD
FT                   DESEAIEKFKTSNVVS"
FT   gene            265216..265659
FT                   /locus_tag="Ctha_0225"
FT   CDS_pept        265216..265659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0225"
FT                   /product="putative anti-sigma regulatory factor,
FT                   serine/threonine protein kinase"
FT                   /note="KEGG: cau:Caur_1060 anti-anti-sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12696"
FT                   /db_xref="GOA:B3QTF0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B3QTF0"
FT                   /protein_id="ACF12696.1"
FT                   /translation="MKMNEMKEKITVTSNLEDLYLVRCFIGNAACRAGFGESETWKIIL
FT                   AVDEACSNVIRHAYNGKTDRNFEITVEFDDNRFVVHIDDAGSGYDLRNHRAPNLQDCIA
FT                   KRKAGGLGIRIIKELVDEIDYQQVDNRNKLTLTKHLPLEAANA"
FT   gene            265727..267436
FT                   /locus_tag="Ctha_0226"
FT   CDS_pept        265727..267436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0226"
FT                   /product="protein serine/threonine phosphatase"
FT                   /note="PFAM: Stage II sporulation E family protein; SMART:
FT                   protein phosphatase 2C domain protein; KEGG:
FT                   aba:Acid345_3068 serine phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12697"
FT                   /db_xref="GOA:B3QTF1"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:B3QTF1"
FT                   /protein_id="ACF12697.1"
FT                   /translation="MPEDDSLHAQSLERIKPQDFDYNSLLESSKILNSSLDLEFILSHI
FT                   LRTVMGKFMLLKACIITFSESDQSVFELAASRGLHGAKKQFTNLELFQQQHDIHALIDL
FT                   SIGNKRIGYIGLSDKFNRQPFKSAESEFLESLASLAASAIENALFLNQLNEQKAHLKQV
FT                   NESLQQKILQFNTLFELTQRYRVDQTKEDILQILMHALMLQMNFKSYVVLLRNEMNFDV
FT                   AMAKDIKSDHLEAKEIGIIFSSSFAHELKWEEFPSITAAGCYHAIPLRTTSTSLGVILF
FT                   GERRTEEPFTETDYEFMFLAAAQAAGAIEQVRLFKDALEKQAIEKELALAYEIQTNLFP
FT                   KSLPKSSIYEIDATNFPSLHVGGDYYDVFEVDDRLLFLAIADVTGKGVPASLIMSNLQA
FT                   LIKAYIEMVRAGAMSINDMVGKINDIIYGNTTIDKFISFFCCLIDKEKLSLTYINAGHN
FT                   PPILLRTDGSLSQLQTGGIVLGVLPSTSPYESETLALQKGDMLFLYTDGVTEAMSKEHE
FT                   EFGENRLIQILKNAQGNSCPSILSEVTRAIDNFEPPGEHHDDVTMICFKVTP"
FT   gene            267591..268034
FT                   /locus_tag="Ctha_0227"
FT   CDS_pept        267591..268034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0227"
FT                   /product="Proto-chlorophyllide reductase 57 kD subunit"
FT                   /note="KEGG: cph:Cpha266_1871 Proto-chlorophyllide
FT                   reductase 57 kD subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12698"
FT                   /db_xref="InterPro:IPR026816"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:B3QTF2"
FT                   /protein_id="ACF12698.1"
FT                   /translation="MNAIILFDSHSSGGATDRIIDTIGQELAKRDIYVEKGKVLPNADY
FT                   SFLDEFDLILLGSPIYNLRLSENLAGAIIQSNLLAKLDGKQIALFVICGGPELSADLLY
FT                   LPQLQIPLLNKNIIAKKAFGMSCKNDPESAVSFAEEIYEKAAK"
FT   gene            complement(268061..268273)
FT                   /locus_tag="Ctha_0228"
FT   CDS_pept        complement(268061..268273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0228"
FT                   /product="FeS assembly protein IscX"
FT                   /note="TIGRFAM: FeS assembly protein IscX; PFAM: protein of
FT                   unknown function DUF528; KEGG: aba:Acid345_0478
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12699"
FT                   /db_xref="GOA:B3QTF3"
FT                   /db_xref="InterPro:IPR007479"
FT                   /db_xref="InterPro:IPR036762"
FT                   /db_xref="UniProtKB/TrEMBL:B3QTF3"
FT                   /protein_id="ACF12699.1"
FT                   /translation="MEKLTWRHAEELGILLSEKYPELDPLGVRFRDLHRMVMELGEFED
FT                   DPKASDEKKLEAIQMAWYDEWQENQ"
FT   gene            268688..270667
FT                   /locus_tag="Ctha_0229"
FT   CDS_pept        268688..270667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0229"
FT                   /product="acetate/CoA ligase"
FT                   /note="TIGRFAM: acetate/CoA ligase; PFAM: AMP-dependent
FT                   synthetase and ligase; KEGG: cph:Cpha266_0550
FT                   acetyl-coenzyme A synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12700"
FT                   /db_xref="GOA:B3QTF4"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011904"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B3QTF4"
FT                   /protein_id="ACF12700.1"
FT                   /translation="MPTNTESNAGISSVLHEQRVFKPGPEFSEGATIKSMDEYEKQYKI
FT                   AADDPQKYWANVASQYHWFKKWDTVLEWNEPFSKWFVGGETNLCYNALDVHINTWRKNK
FT                   AAIIWEGEPGDQRTLTYLQLHREVSKFANVLKRRGIQKGDRVAIYMGMTPELVIAVLAC
FT                   ARIGAVHNVIFAGFSAHALTERINDSHAKMIVCADGTIRRGKSLNLKEVVDEALVDTPS
FT                   IQNVIVYQRTKETIHMQDGRDHWWHDLMGLASEYCPAESLDSEHPLFILYTSGSTGKPK
FT                   GILHSTGGYMTHVANSFKHVFDVKEQDIYWCTADIGWITGHSYMIYGPLINGSTIVVYE
FT                   GAPNYPQWDRFWDIIQRHKVTIFYTAPTAIRAFIRAGDEWVTKHDLSSLRLLGTVGEPI
FT                   NPEAWMWYYKNVGKEKCPIVDTWWQTETGGIMISPLPGATPLKPGTATRPLPGILVDVV
FT                   HKDGTPCQANEGGFLVVKHPWPSMLRTIYGDEERYKTTYWSEVDGMYFTGDGARKDNDG
FT                   YIWIMGRVDDVVNISGHRLGTSEVESALVSHEAVAEAAVVSRPDEVKGNALVAFVTLKE
FT                   EFEGNQKLREELRAHVAKEIGPIAKPDDVRWAAALPKTRSGKIMRRLLREMASSKEVKG
FT                   DVTTLEDFTVLEKLREEEEESKKD"
FT   gene            270886..273672
FT                   /locus_tag="Ctha_0230"
FT   CDS_pept        270886..273672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0230"
FT                   /product="Fibronectin type III domain protein"
FT                   /note="PFAM: Fibronectin type III domain protein; KEGG:
FT                   mbr:MONBRDRAFT_12802 hypothetical protein Pfam: FG-GAP
FT                   RepA1_leader"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12701"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR026444"
FT                   /db_xref="UniProtKB/TrEMBL:B3QTF5"
FT                   /protein_id="ACF12701.1"
FT                   /translation="MKYRYKILFFFFLLYLCFPHHSHAQVSFNTHAVTSSANGASAVHS
FT                   ADMDGDGDIDLLSASAGDNKITWYQNNGSQTFTENIIATDALGASSVFAIDVDRDGDMD
FT                   IVAALAGVGEITWYQNDGSQNFNKEFIVDAIWGISSVYATDVDQDGDIDLLSASSSDHS
FT                   IRWYENNNQEFTAYEVSDMAYGASSVYAADADADGDIDIFSAAKTGNKISWYENNGSQT
FT                   FSEHTISSVATGAISVYATDVDHDGDMDVLSASADNNQIAWYENDGSQTFSEQIISSTA
FT                   NGASSVYATDVDNDGDMDVLSASASDNKIAWYENDGSQTFSEQVISSAASGASAVFAMD
FT                   VDRDGDMDILSAAASSNEITWYENTLPFKEKEITTDHNIASSIPYATFAYASDIDRDGD
FT                   MDAISVSPDLTTGGISWHENSGSETFTQHVIDNSLQTARMAIPIDMDRDGDIDLLAAIY
FT                   GDDEIVWYENNGSQSFTKQTIKSSATYVSFVSAADVDRDGDIDVLAGISGLSTFSWFEN
FT                   NGAQNFTEHVITSSATSARTIYAVDMDHDGDFDVLTAASGDDEISWFENDGSQGFSEHM
FT                   ISDTLLIPSSVFAIDLDRDGDMDVLSTSVNDDKIAWYENNGSENFTEHFVAQPDLDGNR
FT                   FNADNGDVNEPKMVSAADMDNDGDIDLLTASGDHRILWFENDGAQNFTLHEAFAVGGAN
FT                   TAYAADMDGDGDRDIITAATYTTHVDWVETTIKLADDPLPVELAHFSGASTESGISLSW
FT                   KTVTETNNAGFVLYRNGVKVASFQDVEALVGQGTSSKSTTYSFTDADVELGTTYTYTLI
FT                   SKDFSGTSHEYGLQVQVAFTDVTSEAGTPDKYALEQNYPNPFNPSTTIKFSLKQAGVAT
FT                   FKVFDILGRVVHKEVLQGTAGENTPISFEGKSLNSGVYFYQISSGEYSETKKMMLLK"
FT   sig_peptide     270886..270960
FT                   /locus_tag="Ctha_0230"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.995 at
FT                   residue 25"
FT   gene            complement(273816..275873)
FT                   /locus_tag="Ctha_0231"
FT   CDS_pept        complement(273816..275873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0231"
FT                   /product="GLUG domain protein"
FT                   /note="PFAM: GLUG domain protein; KEGG: swo:Swol_1078
FT                   surface proteins containing Ig-like domains-like"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12702"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR026444"
FT                   /db_xref="UniProtKB/TrEMBL:B3QTF6"
FT                   /protein_id="ACF12702.1"
FT                   /translation="MKKLFLILLPLLFFNSQIQAQSAVAPSGDGSSTNPYKIATWQNLY
FT                   WLSQNSGQWGKYYKQTADIHFADASPAIDTWDGGAGWTPIGNSTTKFTGTYDGGNYRID
FT                   SLYINRSTAKYVSLFGNIGLASVENLGVTNVRITGSIYVSGLVGRDSLSQITNCYATGQ
FT                   VTGNSDNVGILVGENIYYSTISNCYATGQVKNGRYYVGVLVGSNHTGGNISNSYARGSA
FT                   RGSNSIGVLVGSNTNSSTISNSYASGSSKATAGTRAGGLVGYNNGNYSTIDASFWNADS
FT                   SAKGVGYRGGGDTTGVIAATTAELKTQSIFTNESWDFASETANGEDDYWNMDGVTNDGY
FT                   PYLYYEPVTIPAGDTNLHIFANNDVELIFTTGNAGEVVIQVIRNDETPEVIGSLPGAVI
FT                   NLSPRYWTVRVISGTITGTYSITLYLEGIPGIFNCSTLYVLKRDDSTSPWKDVVADLSA
FT                   TIDRTNCPTSITVEGLTSLSEFVIGGEEDNPLPVELVSFTGSSTSSGVLLNWKTASETD
FT                   NAGFILYRDGTEIASYTNVTALKGQGTTSNATSYRFTDTDVYLGESYTYTIFTEDLSGT
FT                   RQEYDNSVSVSVTEAVSNEETIATQYALAQNYPNPFNPSTVIRFSLAQAGTATLKVFDM
FT                   LGREVLSKQLQGSAGWNAYHFNAGTLSSGVYYYRIISGSFMETKKMILLK"
FT   sig_peptide     complement(275811..275873)
FT                   /locus_tag="Ctha_0231"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.963 at
FT                   residue 21"
FT   gene            complement(276633..277934)
FT                   /locus_tag="Ctha_0232"
FT   CDS_pept        complement(276633..277934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0232"
FT                   /product="Histidinol dehydrogenase"
FT                   /EC_number="1.1.1.23"
FT                   /note="PFAM: histidinol dehydrogenase; KEGG:
FT                   cph:Cpha266_0801 histidinol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12703"
FT                   /db_xref="GOA:B3QTF7"
FT                   /db_xref="InterPro:IPR001692"
FT                   /db_xref="InterPro:IPR012131"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR022695"
FT                   /db_xref="UniProtKB/TrEMBL:B3QTF7"
FT                   /protein_id="ACF12703.1"
FT                   /translation="MFEIINYTGGSDALGKFLSRREVLDEAVEKTVKEILSDVKTRGDE
FT                   AVRDYTEKFDKVRLADFTVSEAELDRAFNETDKSLIDIMEKAAENIFEFHRHELDKSFF
FT                   YEQPNGVLIGQKITAVEKALLYVPGGQAAYPSSVLMNAIPALVAGVPEIYLTTPCNAKC
FT                   EVHKHILAAAKILGLKNIYKLGGAQAIGAFAYGTKTLPKVDKITGPGNKYVAMAKRLVF
FT                   GEVSIDSIAGPSEIAVIADETANPRFVALDLFSQTEHDADASAVLITTSETLAQAVNDE
FT                   AKSLLPKMERKHNIEAAVQKNSAIVLTQHLDEACAVSNIIAPEHLEVHTASPWELLPKL
FT                   RNAGAIFLGHYSSEPVGDYFAGPNHTLPTSGTSRFFSALSTKDFLKRSSIISYTKEMLD
FT                   KTGEQIARFADAEGLEAHAEAVRVRLGSSKFYKP"
FT   gene            278096..280258
FT                   /locus_tag="Ctha_0233"
FT   CDS_pept        278096..280258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0233"
FT                   /product="cytochrome c biogenesis protein transmembrane
FT                   region"
FT                   /note="PFAM: cytochrome c biogenesis protein transmembrane
FT                   region; KEGG: gvi:glr3963 thiol-disulfide interchange
FT                   protein DsbD homolog"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12704"
FT                   /db_xref="GOA:B3QTF8"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR028250"
FT                   /db_xref="InterPro:IPR035671"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B3QTF8"
FT                   /protein_id="ACF12704.1"
FT                   /translation="MLKRPFKNAFWFTAFFSVLSLFFAKNAAAQFPDFGDGKKLVQPSL
FT                   VVGTENFREPFIIGIRFKLEPEWHIYWKNAGDAGTPVEVEWNLPDGFRVSELDYPVPIK
FT                   FVLSGVVGYGYTDEVVLLAKVEPPKNYSPKKAPEISAKLSWLVCRESCIPGEGEVSLNL
FT                   ETLSQKDVAEGKKLIEKFEAKLPGQSGNLDIKLEQAVAKGSGKNVTAELRFSGKQASEI
FT                   TDFFPDILENAFIGYNDIQVANNTISFPMQLSAPDAELPEIRGLLVTETHGYEFSATLK
FT                   AATESLLDDSFQVAGERPDESPLWMILLLAFVGGLLLNIMPCVLPVLSLKVLSFVEHSS
FT                   MEKSHTRYLSFIFALGVLVSFWVLALGVGVLQNAGEQIGWGFQFQSPWFVVGMSVVVFI
FT                   FGMNLVGVFEFASPNVTGDVSKTLSRHDALGAFMNGVLATTLATPCTAPFLGTALGFAF
FT                   SQPFYMIFLIFSLVALGLAAPYVILSLNPAWLKFIPKPGVWMERFKQAMGFLLFATLVW
FT                   LLSVLGSQTGATGILAALTLLLGVSVGLWLIGAFIDYGTPATKKFMIWGIALLLAGASY
FT                   YLGFEKWFPIRETAQTQTEAAKPHDGLIDWKPFSIATVEKEVSAGKPVFIDFTADWCFT
FT                   CKVTEQTVLHTDAVSGKIKELGIVPIRADWTNRNDEITGLLKKFGRSGVPLYVVFPAGK
FT                   LSEPIVLPEVVTPELLIEAFEKAVSK"
FT   sig_peptide     278096..278185
FT                   /locus_tag="Ctha_0233"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.686 at
FT                   residue 30"
FT   gene            280339..280995
FT                   /locus_tag="Ctha_0234"
FT   CDS_pept        280339..280995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0234"
FT                   /product="alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; Redoxin domain protein; KEGG:
FT                   mpt:Mpe_A1488 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12705"
FT                   /db_xref="GOA:B3QTF9"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B3QTF9"
FT                   /protein_id="ACF12705.1"
FT                   /translation="MSYQKLKELRSTLSKFSAALIAFMLFTAVVLVTVTNASAPESEVG
FT                   KLAPDFSLKDTDGKTHKLGDYKGKTVVLEWTNPGCPFVVGHYKTGNMQQLQEKYTEAGV
FT                   VWLTVNSTNPAHPNHLSAEALAEKFQSWESHASANLLDEDGKVGELYGAKTTPHMFIID
FT                   KNGKLAYAGAIDDDRSTNGGANASVNYVAQALDELLAGKSVSVKQTKQYGCGVKY"
FT   sig_peptide     280339..280452
FT                   /locus_tag="Ctha_0234"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.762 at
FT                   residue 38"
FT   gene            281161..281466
FT                   /locus_tag="Ctha_0235"
FT   CDS_pept        281161..281466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0235"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12706"
FT                   /db_xref="UniProtKB/TrEMBL:B3QTG0"
FT                   /protein_id="ACF12706.1"
FT                   /translation="MDAPAASDPFQPSDKFDAPLRIKLRELKKNEAKETLRVLVKCSSK
FT                   ISDEMKTALEKTGLKIGTIAGNICTTSGNIHVIEHLQALQFVQRVSLSQQQQYFHP"
FT   gene            281474..283759
FT                   /locus_tag="Ctha_0236"
FT   CDS_pept        281474..283759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0236"
FT                   /product="peptidase S8 and S53 subtilisin kexin sedolisin"
FT                   /note="PFAM: peptidase S8 and S53 subtilisin kexin
FT                   sedolisin; KEGG: amr:AM1_1670 subtilase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12707"
FT                   /db_xref="GOA:B3QTG1"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR026444"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:B3QTG1"
FT                   /protein_id="ACF12707.1"
FT                   /translation="MFKFKVFSLLLIFSIFGSSFSGAIALASQPDSTSNKFSAKIGAPL
FT                   RVLLREAKTAKAKSPQSLETFSEEHRQFAVRKSASGQTMVGLLLKSENVMLAKSAIINA
FT                   GGTVSTIAGNILVARVPLDSVESIVAGESISRVEACQKQALLLDSSRAEIYADVVQAGE
FT                   GGLDQSYNGTDVIVGVVDSGIDEDHADFNTTSGSRILYLWDMSGSGNSPSSYDYGTEYT
FT                   QSQITAGQCNQSDDDGHGTHVTGIAAGNGRAESGFTGIAPDADIIFVKGYRDVDGFYSD
FT                   DVINGCAYIFERADKVNKSAVVNLSLGGHVGPHDGTSLYEQALSNLVDEGKIIVAAAGN
FT                   SGSSLVHVNYETGGSSFSEARETYFEISSSTSAAYIDLWYETGSVNVGIAAYRNGSRVD
FT                   YTSSVAPGGQLSNESLGSGFQTFGTVTIDATETSYSENGDKRVLIEITNNNVTGVTWSL
FT                   FTYGSGTLDAWLSGGSFTEDSGRLIYPGDNEKSVAIPSTAEKVICVGSYTTKNKWKAYD
FT                   GNTYSLTSQPEIGAISSFSSLGPSRDGRTKPDIAAPGQVIMSALSSDLTIGSDVTVPYV
FT                   SPSGELQAMQGTSMASPHVAGTIALMLEKNPQADYETVMDILTTTARQDDETGSVPNNT
FT                   WGYGKLDVLEAMLQIAEGEKDTTTSGDSEDDTTATQVTVLKSGYPNPVFSSRGYITILY
FT                   EIPENTSVQAPYYLKIYDVLGREVASHRISADETTVSPSIKAFASGMYFYRITGFSDMK
FT                   KFVILKNE"
FT   sig_peptide     281474..281557
FT                   /locus_tag="Ctha_0236"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.933 at
FT                   residue 28"
FT   gene            283776..284114
FT                   /locus_tag="Ctha_0237"
FT   CDS_pept        283776..284114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0237"
FT                   /product="export-related chaperone CsaA"
FT                   /note="TIGRFAM: export-related chaperone CsaA; PFAM:
FT                   t-RNA-binding domain protein; KEGG: aby:ABAYE3402 secretion
FT                   chaperone CsaA"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12708"
FT                   /db_xref="GOA:B3QTG2"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR008231"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:B3QTG2"
FT                   /protein_id="ACF12708.1"
FT                   /translation="METISFDDFLKVELRVGKIISVEPFPKAKKPAYILKVDFGEEIGV
FT                   KKSSAQITALYDPEELVGKLVVGVVNFPKKQIGPVMPECLITGFHDENGDVALCIPDKP
FT                   VPLGTKIL"
FT   gene            complement(284158..285360)
FT                   /locus_tag="Ctha_0238"
FT   CDS_pept        complement(284158..285360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0238"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   deb:DehaBAV1_0869 phosphatidylinositol
FT                   alpha-mannosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12709"
FT                   /db_xref="GOA:B3QTG3"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:B3QTG3"
FT                   /protein_id="ACF12709.1"
FT                   /translation="MKKIKIALITQDPRNGGGVRAVLDFAYQTLLSYGLEPTVLAYAPY
FT                   RFERNVSCTLANGLTTPRLGKVEKEIDGLKTVLLGAYFPELEINRYRSNHLWEAELKKH
FT                   QQFLIIGGSAIYGYAAFRHAPKYLTWTATTIFDDRIDALTSSKNAIYPVHKFILKRLQH
FT                   YENQVMRRSSLMLFQSKYAEDSTKRAGIPITRQKFLPYAIDTESFFPLQEKPSEAFILM
FT                   VGRFNDQRKNVNLLFEAYRKAKQKMPNLPKLKLAGAEPSDATREVVRQMNLEGDVVFCG
FT                   EVSWDELRRLYREATIFVLPSWQEGLGIVILEAMASGTPVISTRCGGPEIIIEHEKNGF
FT                   FCENNNADDMANKIIRLVSNKALQEKFKEEGLHTIAQRFSKQAVGRELINSLKEVYPET
FT                   C"
FT   gene            complement(285378..286676)
FT                   /locus_tag="Ctha_0239"
FT   CDS_pept        complement(285378..286676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0239"
FT                   /product="GTP-binding proten HflX"
FT                   /note="TIGRFAM: GTP-binding proten HflX; PFAM: GTP-binding
FT                   protein HSR1-related; KEGG: plt:Plut_1355 GTP-binding
FT                   protein HflX"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12710"
FT                   /db_xref="GOA:B3QTG4"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR016496"
FT                   /db_xref="InterPro:IPR025121"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030394"
FT                   /db_xref="InterPro:IPR032305"
FT                   /db_xref="InterPro:IPR042108"
FT                   /db_xref="UniProtKB/TrEMBL:B3QTG4"
FT                   /protein_id="ACF12710.1"
FT                   /translation="MENQAVGFVSLENSPEKAVLIGISHPPEVLKWQAEEHLEELEELA
FT                   DTAGAKVLFKFIQDRKQIDPVYAIGSGKVQELKPIIEENTIDLVIFDDELTPGQKRNLE
FT                   RELDCKILDRTGLILQIFAVRAKSAQAKHQVELAQLEYLLPRLTRQWTHLSKQKGGIGT
FT                   KGPGETQIETDRRLIWRRISTLKQKLKEHSRQRETRTSWRDSITKIALVGYTNAGKSTL
FT                   MNALCPKANAYSEDRLFATLDTTTRRLHLKQNKQAILSDTVGFIRKLPHNLVESFKSTL
FT                   EEVREADILLHVVDVSHPSFEEHIRIVDETLDEIGAKNKQTILVLNKIDRLEQNDTFLG
FT                   LAQKFEGSVLISAARGINLSGLMERLSDLIQADFDERFIRVHVSDYKLISYLHEKTEII
FT                   SKRYDDEDVEIQFRVPKKIANQIDGVLRQHQVS"
FT   gene            286919..287872
FT                   /locus_tag="Ctha_0240"
FT   CDS_pept        286919..287872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0240"
FT                   /product="Squalene/phytoene synthase"
FT                   /note="PFAM: Squalene/phytoene synthase; KEGG: cch:Cag_1175
FT                   phytoene desaturase"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12711"
FT                   /db_xref="GOA:B3QTG5"
FT                   /db_xref="InterPro:IPR002060"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR019845"
FT                   /db_xref="InterPro:IPR033904"
FT                   /db_xref="UniProtKB/TrEMBL:B3QTG5"
FT                   /protein_id="ACF12711.1"
FT                   /translation="MQFNSVGKEFDKVDSSGQACSVAKKGTSQHQKKIESIQLNPEEVS
FT                   ESYEYCRAVSKRHAKTFYFATQFLPKSKRKSVYAVYALCRYVDDIVDRAEDKLSRQTLT
FT                   KEKIVFLIDKWKTDLEACYRGELINNPIMIAWLDTLKKYQIPMELPFELIEGVCMDLKF
FT                   KSFETFDELYIYCYKVASVVGLMTSEIFGYKNKEALDYAIKLGIAMQLTNILRDVGEDS
FT                   QRGRIYLPLEDLARFNYSPEKLKQGTLDENFIKLMQFEIGRARDFYAEADKGIPMLDKD
FT                   SRMAVLVSRVNYSKILTYIEKTSTTFFANARSFLSP"
FT   gene            287980..288615
FT                   /locus_tag="Ctha_0241"
FT   CDS_pept        287980..288615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0241"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pvi:Cvib_0135 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12712"
FT                   /db_xref="InterPro:IPR018971"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:B3QTG6"
FT                   /protein_id="ACF12712.1"
FT                   /translation="MKVEGTCSGQVILQSDLENTFQYLSDHEKIIMFNPLCKRVTPTGL
FT                   DNVYQWDFEVADPKGHPMRLIFFVEQNEQPVLALPEHHRNTPSHELPAHVINEHKVGNQ
FT                   IIWSEYPVKINGKMPDEHTFIGQAHGSMDLKKVDEHRTRVGVNIKVHIDFQVPALFRIF
FT                   PEPIFKVMAETAMSVSMQNVSKKMLENISRDFHCSLLGETNFGAARSR"
FT   gene            288734..290287
FT                   /locus_tag="Ctha_0242"
FT   CDS_pept        288734..290287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0242"
FT                   /product="lysyl-tRNA synthetase"
FT                   /note="TIGRFAM: lysyl-tRNA synthetase; PFAM: tRNA
FT                   synthetase class II (G H P and S); tRNA synthetase class II
FT                   (D K and N); nucleic acid binding OB-fold
FT                   tRNA/helicase-type; KEGG: plt:Plut_1357 lysyl-tRNA
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12713"
FT                   /db_xref="GOA:B3QTG7"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="InterPro:IPR034762"
FT                   /db_xref="UniProtKB/TrEMBL:B3QTG7"
FT                   /protein_id="ACF12713.1"
FT                   /translation="MSNQPTKPVQSEENAEHLSQQAQEELNDQMLRRREELEKLREMDV
FT                   NPYPYSFEVTHTGKQIIENFKDDEKAAVAIAGRIMSIRKMGKASFFHVQDASGRIQVYI
FT                   KKDEVGETAYQVFKLLDIGDIVGVKGFSFRTKTGEVSVHAEACELLSKSLRPMPIAKQK
FT                   EVDGKTVTYDAFSDKELRYRQRYVDLIVNPEVKTVFLKRTKMINSIRNFLNERGYLEVE
FT                   TPILQPIYGGASARPFVTHHNTLDMPLYLRIANELYLKRLIVGGFDGVYEFAKDFRNEG
FT                   MDRFHNPEFTQIELYVAYKDYAWMMNLVEEMLSKTAEAVNGSTVVEFAGHKIDLKPPFK
FT                   RMTITDSIKEYTGKDIDGKSEAELRQIAKELGIEIEANLGSSKIIDEIFGEYVEPKLID
FT                   PTFIMDYPVEMSPLAKKHREKPGFVERFELIAAGKEICNSFSELNDPLDQRARLEEQAS
FT                   LRARGDDEAMAVDEDFLRALEYGMPPCAGLGIGIDRLAMILTGQESIRDVLFFPQMKPE
FT                   "
FT   gene            290611..291141
FT                   /locus_tag="Ctha_0243"
FT   CDS_pept        290611..291141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0243"
FT                   /product="NADH:ubiquinone oxidoreductase complex I
FT                   intermediate-associated protein 30"
FT                   /note="PFAM: NADH:ubiquinone oxidoreductase complex I
FT                   intermediate-associated protein 30; KEGG: plt:Plut_1519
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12714"
FT                   /db_xref="GOA:B3QTG8"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013857"
FT                   /db_xref="InterPro:IPR039131"
FT                   /db_xref="UniProtKB/TrEMBL:B3QTG8"
FT                   /protein_id="ACF12714.1"
FT                   /translation="MQKNLPELQYELLFDFSSIEQACRWRPVNDVIMGGRSSGTICVSN
FT                   ENVAVFEGFITPKQGIGFSSVKAPINNFSFLGYDGVCLKMRTDGKRYKFRLIYADDYQG
FT                   FAYQHGLEIQKGEWREVHLAFSNFKPCFRGQQPANAKLLNIAQVRQVGLLISDRRAGAF
FT                   KMECDWIKAYQEK"
FT   gene            291229..292050
FT                   /locus_tag="Ctha_0244"
FT   CDS_pept        291229..292050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0244"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein; KEGG: pdi:BDI_0955
FT                   putative universal stress protein UspA"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12715"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:B3QTG9"
FT                   /protein_id="ACF12715.1"
FT                   /translation="MHTILFPTDFSENAYQALVFALKIAAKQQAKLILMNAFPIPYDFA
FT                   SKVLEELEYSKKRSLEKLQALAKSIRENPDFENLDIDILSLPGDGVSVIKATARSQHAD
FT                   LIVMGAKGASGLQRFLFGNITADTILFSNIPVLTVPIHAKFENMNRIIYAAAYDEKDIQ
FT                   HLRETAAFAKLFDAEIHVLHVAEKQSVREEALFRGFREMVKEHDIYHKIQHNLLINQDF
FT                   MAGIQSYAKECDGSLVVMSSQKKSFLQQLLNLSHSQEMLYHTKVPLLVLKS"
FT   gene            complement(292055..293209)
FT                   /locus_tag="Ctha_0245"
FT   CDS_pept        complement(292055..293209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0245"
FT                   /product="Beta-N-acetylhexosaminidase"
FT                   /EC_number="3.2.1.52"
FT                   /note="PFAM: glycoside hydrolase family 3 domain protein;
FT                   KEGG: cte:CT0090 glycosyl hydrolase, family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12716"
FT                   /db_xref="GOA:B3QTH0"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:B3QTH0"
FT                   /protein_id="ACF12716.1"
FT                   /translation="MKKVAFKRVLKKPRLFVYSLMLLCFSAWKIGAAQSLPAPDSLDIK
FT                   IGQLLMIGFRGLHVADSSKVIVDIRQQRIGGVILFDYDLPLKQASRNIQSPEQVCALIK
FT                   ELQAAAPIPLLIAIDQEGGRVNRLKEKFGFPKSVSAAWLGEVNSLDSTQKYAEQTAKTL
FT                   AALGINLNFAPVLDVNTNPENPVIGKLARSFSENPEIVAEHGLATVKAFHQFGVLSAVK
FT                   HFPGHGSAWNDSHKGLADVTETWQPLEIEPFKRVIQAGECDMVMTAHVFNAKLDTTFPA
FT                   TLSQNVITGLLRKELGFDGVVVSDDMQMEAIRSFYGLETAVRLALNAGVDLLVFANNSV
FT                   FEPDIAERAHQMIRAMVLQGKVSRERIDASYQRLMKLKSRLSNK"
FT   sig_peptide     complement(293120..293209)
FT                   /locus_tag="Ctha_0245"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.391 at
FT                   residue 30"
FT   gene            complement(293308..293577)
FT                   /locus_tag="Ctha_0246"
FT   CDS_pept        complement(293308..293577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0246"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12717"
FT                   /db_xref="UniProtKB/TrEMBL:B3QTH1"
FT                   /protein_id="ACF12717.1"
FT                   /translation="MTKSEHELFEAWFQEYKLDLYDIVRPALEPLNRNKARYLLFREID
FT                   KMHSNVAVSLMNRFNGMYFFSHVLDRLIEEVKNNTIGLNMNLEV"
FT   gene            294101..294802
FT                   /locus_tag="Ctha_0247"
FT   CDS_pept        294101..294802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0247"
FT                   /product="Inorganic diphosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /note="PFAM: Inorganic pyrophosphatase; KEGG: mka:MK1450
FT                   inorganic pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12718"
FT                   /db_xref="GOA:B3QTH2"
FT                   /db_xref="InterPro:IPR008162"
FT                   /db_xref="InterPro:IPR036649"
FT                   /db_xref="UniProtKB/TrEMBL:B3QTH2"
FT                   /protein_id="ACF12718.1"
FT                   /translation="MVNYKSLPSGQNPPKEVYAVIEVPQGERNKYEFDPDLCVFKLDRV
FT                   LYASVHYPTGYGFIPRTLAEDGDPLDVMVMTHGRTFTGCLIEVRPVGMLKMRDDKGLDH
FT                   KILSVPINDPMYSHVRRLSDLPSHLPTEIEHFFSVYKELEGKAVESFGWYDFFTAEQTI
FT                   IEAMKAYDAANEEADEEDGKKKKKKDKKGKKDKKGHDAEVGETMASQDSAQMAFDGREE
FT                   DIEEGHDETVA"
FT   gene            294951..295439
FT                   /locus_tag="Ctha_0248"
FT   CDS_pept        294951..295439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0248"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12719"
FT                   /db_xref="GOA:B3QTH3"
FT                   /db_xref="UniProtKB/TrEMBL:B3QTH3"
FT                   /protein_id="ACF12719.1"
FT                   /translation="MHSDELNGRTPSSANKPQEPQPQDPALRSPKRAAIFFASLLIMTI
FT                   GVSGIIEGAYLFFKSAILVRAKGLDSGLLRINSIFSFLAGLLMVLTAAGTIRISYMAWR
FT                   AAFFTTTIFVLNSAWGSYIFYGNPLSFGSFIHLTASLAIFLLLWKASGVWNDTLLYEE"
FT   gene            295451..295954
FT                   /locus_tag="Ctha_0249"
FT   CDS_pept        295451..295954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0249"
FT                   /product="L-asparaginase"
FT                   /note="KEGG: vok:COSY_0226 L-asparaginase"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12720"
FT                   /db_xref="GOA:B3QTH4"
FT                   /db_xref="InterPro:IPR006034"
FT                   /db_xref="InterPro:IPR027474"
FT                   /db_xref="InterPro:IPR036152"
FT                   /db_xref="InterPro:IPR037152"
FT                   /db_xref="UniProtKB/TrEMBL:B3QTH4"
FT                   /protein_id="ACF12720.1"
FT                   /translation="METKIKLFITGGTIDKKYNELDGSLGFHQTHFPAMLSQARNAASV
FT                   TLDIILMKDSLEMNDTDRALICQKCLECEETLILISHGTDTMVETGKFLSQSLKGKTVV
FT                   LFGAMIPYSFSTNTDALFNFGFALAAVQLAPSGVFIAMNGKLFNWDTVTKNKQKGVFQT
FT                   VENA"
FT   gene            complement(296119..296454)
FT                   /locus_tag="Ctha_0250"
FT   CDS_pept        complement(296119..296454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0250"
FT                   /product="anti-sigma-factor antagonist"
FT                   /note="TIGRFAM: anti-anti-sigma factor; PFAM: Sulfate
FT                   transporter/antisigma-factor antagonist STAS; KEGG:
FT                   sus:Acid_4696 anti-sigma-factor antagonist"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12721"
FT                   /db_xref="GOA:B3QTH5"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR003658"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:B3QTH5"
FT                   /protein_id="ACF12721.1"
FT                   /translation="MDLIEKHVGDVIVVELKGDVLGGPDATKISTRIRELIKDQKKNLV
FT                   LDLQGVDYMNSSGLGMLTAAHTLLKKEGGTLKLARPATRIQSLLSITKLNTLIDAYGTV
FT                   DDAVASF"
FT   gene            complement(296454..297377)
FT                   /locus_tag="Ctha_0251"
FT   CDS_pept        complement(296454..297377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0251"
FT                   /product="protein-export membrane protein SecF"
FT                   /note="TIGRFAM: protein-export membrane protein, SecD/SecF
FT                   family; protein-export membrane protein SecF; PFAM:
FT                   SecD/SecF/SecDF export membrane protein; KEGG: cch:Cag_0027
FT                   preprotein translocase subunit SecF"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12722"
FT                   /db_xref="GOA:B3QTH6"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR005665"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/TrEMBL:B3QTH6"
FT                   /protein_id="ACF12722.1"
FT                   /translation="MRFLEKPSFDFLGRRKIAYIISTTLILLGFASMLFKGLNYGIDFK
FT                   GGTEMEIRFDKDINIGELRTALLAAGVGGSVKNYGSQQEVIIRTDFDGDLSTLQNLVTN
FT                   VLTDKLPDNHHEIRRIDAVGPSIADDLKWSALQALFGALIAILLYVGARFEFKFATAGV
FT                   VAIFHDVLIVLGLFSIFGGVFGVMPLEVDQSTIAAFLTIAGYSITDTVVVYDRIRENLK
FT                   LRKNEPYEKIFNDSLNETLSRTVITSGTTLLTVLVLFILAGPAIRSFAFAILMGILIGT
FT                   YSSLFVAAPIVLDWQLRSKTKLKLRG"
FT   gene            complement(297414..299357)
FT                   /locus_tag="Ctha_0252"
FT   CDS_pept        complement(297414..299357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0252"
FT                   /product="protein-export membrane protein SecD"
FT                   /note="TIGRFAM: protein-export membrane protein, SecD/SecF
FT                   family; protein-export membrane protein SecD; PFAM:
FT                   SecD/SecF/SecDF export membrane protein; KEGG:
FT                   cph:Cpha266_0033 preprotein translocase subunit SecD"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12723"
FT                   /db_xref="GOA:B3QTH7"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR005791"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/TrEMBL:B3QTH7"
FT                   /protein_id="ACF12723.1"
FT                   /translation="MKKNQFRLFLIVLFTALAVWSIIPTIQDYLHTKKLGELSSEEALK
FT                   YVRENRADIEAAKEKRLKLGLDLQGGMHIVLEVDVLGLIEERARNRDEKFEQIIQSVRE
FT                   QSKTSKSLITELLADAFKKENIRMSRYFYDIRDSDADIVEKLETEATEAVNRAREIIRN
FT                   RVDQYGVAEPVIQTQGGRRIIVELPGVSDKQRVRKLLKGTAKLEFRLVRDKQVAFSVLE
FT                   DINKYLASLEKATQSDSLAKIAEPISTEKLVAKTDSSDKDLMQAAMAASDSAVKAEDLF
FT                   GGAQADSSKSKEQLRKENPLFSILGVLPNGMTYTTEYERKALEELLARADVQKRIPSDL
FT                   DFLIGAKSFATAEDGTKLYYVYPLKKQAELTGGVITEAKATFSSEGMRPEVTMKMDGEG
FT                   TRVWARVTGANIGKQIAIVLDKTVYSAPVVQSKIPNGSSVINGIDNIAEAQDLEIVLKA
FT                   GALPAPVKIIEERTVGPSLGADSIRAGIQAIIWGFAVVAIFMVIYYRGAGFIADFALIF
FT                   NVIFVIAVLAGFSAALTLPGIAGLVLTIGMAVDANVLIFERVREEISNGKRVRLAVEIG
FT                   YEKAFSAILDSHITTLGGAFLLYSFGIGPIQGFAVTLMIGTIASLFTAVVITKVIIDWM
FT                   IEQDKVQDTTFG"
FT   sig_peptide     complement(299292..299357)
FT                   /locus_tag="Ctha_0252"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.891) with cleavage site probability 0.697 at
FT                   residue 22"
FT   gene            complement(299750..300628)
FT                   /locus_tag="Ctha_0253"
FT   CDS_pept        complement(299750..300628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0253"
FT                   /product="inosine guanosine and xanthosine phosphorylase
FT                   family"
FT                   /note="TIGRFAM: inosine guanosine and xanthosine
FT                   phosphorylase family; PFAM: purine phosphorylase family 2;
FT                   KEGG: lwe:lwe1979 purine nucleoside phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12724"
FT                   /db_xref="GOA:B3QTH8"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR011268"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:B3QTH8"
FT                   /protein_id="ACF12724.1"
FT                   /translation="MNESEISNLTSAMLLAKPNGDNYKKKVADAVKHIHSHCDVPKNTV
FT                   AIVLGSGLGAFASRVKVYHSFKTSEIPHFPTPSVEGHGGRVTFGTLGDRPVALIEGRVH
FT                   LYEGWPVEWVTFYVEILRQLGIKVLILTNSAGGINPDFNVGDLCLIRDHINFMFETRLN
FT                   RYGMEPRLRHVGFYDKDLSEVIYRTANECKITLRQGVYAGVKGPCYETKAEIRMLQACG
FT                   ADLVGMSTVPEVVAANFHHMRVAAVSLVTNKATGISECKLSHDDVKKTAESAREKFDYF
FT                   LEMVINKHLAW"
FT   gene            complement(300637..301002)
FT                   /locus_tag="Ctha_0254"
FT   CDS_pept        complement(300637..301002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0254"
FT                   /product="holo-acyl-carrier-protein synthase"
FT                   /EC_number="2.7.8.7"
FT                   /note="KEGG: cte:CT1935 holo-[acyl-carrier protein]
FT                   synthase; TIGRFAM: holo-acyl-carrier-protein synthase;
FT                   PFAM: 4'-phosphopantetheinyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12725"
FT                   /db_xref="GOA:B3QTH9"
FT                   /db_xref="InterPro:IPR002582"
FT                   /db_xref="InterPro:IPR004568"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3QTH9"
FT                   /protein_id="ACF12725.1"
FT                   /translation="MQVGIDIIEISRIKRAYERYNRLFLKRILTESEIEWCLNKPRPFE
FT                   SVAVRFACKEAFAKAMGTGISGELSWQSIEILNDKEGKPTLFLKQPFNGLKSEQVKLSL
FT                   SHTHEYAVAVVIIEPDK"
FT   gene            complement(301019..301906)
FT                   /locus_tag="Ctha_0255"
FT   CDS_pept        complement(301019..301906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0255"
FT                   /product="nicotinate-nucleotide pyrophosphorylase"
FT                   /EC_number="2.4.2.19"
FT                   /note="KEGG: plt:Plut_0270 nicotinate-nucleotide
FT                   pyrophosphorylase; TIGRFAM: nicotinate-nucleotide
FT                   pyrophosphorylase; PFAM: Quinolinate phosphoribosyl
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12726"
FT                   /db_xref="GOA:B3QTI0"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR004393"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022412"
FT                   /db_xref="InterPro:IPR027277"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR037128"
FT                   /db_xref="UniProtKB/TrEMBL:B3QTI0"
FT                   /protein_id="ACF12726.1"
FT                   /translation="MKNTNDIHLFKEDCEQKAIELALEEDIFTGDITTDAIIEKSHQSK
FT                   GIIKVKTDGVIAGIKVAEMIFERAGEPVKFVQYKIDGDIVYAGDVVAEVTASTSLLLRY
FT                   ERTVLNFMQRMSGIATTTRLFVERVHHTSANILDTRKTAPGLRFFDKEAVMLGGGGNHR
FT                   VGLYDRILIKDNHVDAAGGIGEAIQRAYNYRETHDLQVQIEVEVRSLEELQEALAFKPD
FT                   IILLDNFSLGELREAVHIVKSQGENVMTEASGNVTLETARSIAETGVDYISVGALTHSV
FT                   IAMDISMKIKALDS"
FT   gene            complement(302004..302675)
FT                   /locus_tag="Ctha_0256"
FT   CDS_pept        complement(302004..302675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0256"
FT                   /product="peptidase S16 lon domain protein"
FT                   /note="PFAM: peptidase S16 lon domain protein; KEGG:
FT                   sru:SRU_1204 ATP-dependent protease La domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12727"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:B3QTI1"
FT                   /protein_id="ACF12727.1"
FT                   /translation="MSQKHIIPLFPLPLVVCPDEKLPLHIFEERYKAMIAYCLGTETVE
FT                   NEKGRGEGIFGVSLAYNNKLYSVGCAVKIEEIVKKYDDGRMDIVTVGLKRYRMLELDKE
FT                   SSYIRAEIEYFGDEEADPADVIQRERAIAMHSRLSELVKGQPQQDVFSFNGDVSFKIAH
FT                   SAGLDVLQKQKILEMTSENARLQALIAHFEKVIPDIEKAEEIKRRVLSNGHFKNLRSFD
FT                   I"
FT   gene            302789..303199
FT                   /locus_tag="Ctha_0257"
FT   CDS_pept        302789..303199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0257"
FT                   /product="dihydroneopterin aldolase"
FT                   /note="TIGRFAM: dihydroneopterin aldolase; KEGG:
FT                   pvi:Cvib_0334 dihydroneopterin aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12728"
FT                   /db_xref="GOA:B3QTI2"
FT                   /db_xref="InterPro:IPR006156"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="UniProtKB/TrEMBL:B3QTI2"
FT                   /protein_id="ACF12728.1"
FT                   /translation="MDDLLNRFEKKHCIRLKNAIFYAHHGVSEAESEVGNRYAVDAELY
FT                   LDLSQSGQTDDLSHTIDYGTVYSRIKDMVLSSRFSLLESIAHRLAASLMAEFTQLESVR
FT                   IFVRKYNPPIGGICDYAEIEYWLSQKTPSQTH"
FT   gene            303276..303833
FT                   /locus_tag="Ctha_0258"
FT   CDS_pept        303276..303833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0258"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase"
FT                   /EC_number="2.7.6.3"
FT                   /note="KEGG: cph:Cpha266_2295
FT                   2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase; TIGRFAM:
FT                   2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase; PFAM:
FT                   78-dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12729"
FT                   /db_xref="GOA:B3QTI3"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:B3QTI3"
FT                   /protein_id="ACF12729.1"
FT                   /translation="MELHSSSEHFPTKRVSSPHEIAVVTPVFIGLGTNIGNRFQNIHDA
FT                   IDELRALPESQLAAISNLYETPPLGILDQPSFLNAVCKIDTSLEPEELLAQLKSIERRL
FT                   GRPETYIKWGPRVIDLDILFYGDLTLETAHLSIPHPEIANRKFVMVPLLDLQNPHHPIL
FT                   GKTIKELLAETRDSSSIIQLCI"
FT   gene            complement(303998..304243)
FT                   /locus_tag="Ctha_0259"
FT   CDS_pept        complement(303998..304243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0259"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12730"
FT                   /db_xref="UniProtKB/TrEMBL:B3QTI4"
FT                   /protein_id="ACF12730.1"
FT                   /translation="MKYVLFENDDSAQAFVDEMNALMVAEDADYLKKHSNGYSCIELPI
FT                   DESNTNRLVSIFDEHATYVSETATIHDDVPAGFASK"
FT   gene            complement(304245..306308)
FT                   /locus_tag="Ctha_0260"
FT   CDS_pept        complement(304245..306308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0260"
FT                   /product="GPW/gp25 family protein"
FT                   /note="PFAM: GPW/gp25 family protein; KEGG: mca:MCA2908
FT                   prophage MuMc02, baseplate assembly protein W, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12731"
FT                   /db_xref="InterPro:IPR007048"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR040471"
FT                   /db_xref="UniProtKB/TrEMBL:B3QTI5"
FT                   /protein_id="ACF12731.1"
FT                   /translation="MINLSEITATDWSRKLGDYGNVVQGANDVSQCIHIILTTRKGEVP
FT                   LRPDFGTDIYKWLDAPILQARTNIVREVTRALSEYEPRIEVGKVTVEQAEAGLSVQVAW
FT                   RLKGEDTEYLYHLGEDIEAEQLHYAAPIFTYPTGGASIDQPITFKWRGAVGVNERFDFQ
FT                   FLDAIGSILMSLTGLVSQSYTYSASLVPAGYRVRVRGKWQGRVSEWREISFSLSIPKPA
FT                   NLAINGAAWPGSVTLNWAMTSVSGVISYSVMLYMGENSTTLTTTGLEIDFYSAAKAFVE
FT                   ANGFGYYSAKVRANASGATSEWSDVKTFQIRESDLVINIDSEEYNDYGKIEMDNSVIKS
FT                   LQLDLVRESAIDFTAYEFSATPIDAERTTFEVSPSPATGNSATAIVKYDVDKTEAHDLV
FT                   LQATSALSGKVVYKNIQFLIRKSTPVSFVPETAILADYNPNDYVQGVDFDETETHTVSG
FT                   VGDDDKLFALKAGNLGTATGIVDKAGDYKSVHSDFHLAEKASTYNNAYVVKNNGRWVLY
FT                   ISYGGTSIYALSYYNSGASVPLSIAVVAVFKHFKLSEAQYLFTTGNPDDPYQALQAGMA
FT                   TSHAHSAPIWIRYKRPDTGQTTQAAAQMGPFHVAAMRAVNSADFTSLGNSKIAINGVLK
FT                   LDNQDHNSINYNIIVKAYGYFYLERMIVLNPHFCTWEQIENLAAWLKKKYGI"
FT   gene            complement(306311..306877)
FT                   /locus_tag="Ctha_0261"
FT   CDS_pept        complement(306311..306877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0261"
FT                   /product="phage baseplate assembly protein V"
FT                   /note="TIGRFAM: phage baseplate assembly protein V; PFAM:
FT                   baseplate assembly protein V; KEGG: sec:SC4086 putative
FT                   phage baseplate component"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12732"
FT                   /db_xref="InterPro:IPR006531"
FT                   /db_xref="InterPro:IPR013046"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:B3QTI6"
FT                   /protein_id="ACF12732.1"
FT                   /translation="MLKFAKITEIDEQKALARVMFPELNLTSGWYFVLQRKTKMEKYYV
FT                   MPDIGEHVVCLCSDDLAWGVVLGAIYNDLNTIPADAKSGVEMKVFSDGTTVKYDTAGSE
FT                   LEINLNTSGKVKLIGNVEIVGNVSIDGEMSATKDISTEKNLEAGEDVSDGNGSMNEMRE
FT                   TYNTHTHPVVGSLGAGTAQMTTQKM"
FT   gene            complement(306877..307833)
FT                   /locus_tag="Ctha_0262"
FT   CDS_pept        complement(306877..307833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0262"
FT                   /product="late control D family protein"
FT                   /note="PFAM: late control D family protein; KEGG:
FT                   mca:MCA2911 prophage MuMc02, late control gene D protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12733"
FT                   /db_xref="InterPro:IPR040471"
FT                   /db_xref="UniProtKB/TrEMBL:B3QTI7"
FT                   /protein_id="ACF12733.1"
FT                   /translation="MSYEFIINYENKDITADISPMLLSLTYTDNEHGKSDELELELEDS
FT                   QSLWRTDWYPGKGETLSVFLGRKGQKLLRCGIFEIDEITFSGGSGGERLGLKAIGTGFQ
FT                   QAVRQRNYKTFQDSCFGKIVRAIAAKHGLSVVGDINDVAVQKSVQNGESDLHYLLRLAE
FT                   RTGHVFKINGETLVFYQIKTLEASDSVFSLSRADAIDYSLSSQSLAAHGETEVSEYNPQ
FT                   TGATYQATSSNTDGMPGKERLTGYSESPEQTMAAAEGAKKSTLSGRISLPGNEQLVAGI
FT                   NAQLEGFGKLNGKYHAEKVSHRIDRGGYVTELEIRKI"
FT   gene            307969..308406
FT                   /locus_tag="Ctha_0263"
FT   CDS_pept        307969..308406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0263"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12734"
FT                   /db_xref="UniProtKB/TrEMBL:B3QTI8"
FT                   /protein_id="ACF12734.1"
FT                   /translation="MDASLTRSEPFSMTRQRAFGYAQATAKSTVILRLLSRRIQLHRTH
FT                   GCFTDSFRAIQHDKTTGFRLRSGHSKINCHSESLDEESNFTGHMDASLTRSEPFSMTRQ
FT                   RAFGYAQATAKSTVILRFLSRRIQLHRTHGCFTDSPKSHSA"
FT   gene            complement(308450..308701)
FT                   /locus_tag="Ctha_0264"
FT   CDS_pept        complement(308450..308701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0264"
FT                   /product="putative inner membrane protein"
FT                   /note="KEGG: sec:SC4088 putative inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12735"
FT                   /db_xref="UniProtKB/TrEMBL:B3QTI9"
FT                   /protein_id="ACF12735.1"
FT                   /translation="MMEYYEHITQENDRWDLIAEAYYADATRFPEIIKANLNLLMRLPE
FT                   EDLRVFCPAFPLLPAGVRVKVPVEDDETTVTQNLPPWR"
FT   gene            complement(308698..309189)
FT                   /locus_tag="Ctha_0265"
FT   CDS_pept        complement(308698..309189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0265"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cvi:CV_2120 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12736"
FT                   /db_xref="InterPro:IPR009734"
FT                   /db_xref="UniProtKB/TrEMBL:B3QTJ0"
FT                   /protein_id="ACF12736.1"
FT                   /translation="MFAQFGDIIFELLPSVGGYSEKEAFRYAEHEVVSGKPRSQAVGES
FT                   LLEISLQLRFDAAFCEPEEEIEKLRGLKKQGSPQDFVLGSGIYKGRFVITDLSTTITRM
FT                   HDSTLRSADLAVSLKEFGVSGVTVVKKSKRSVAKKKKSQESSTTQSLPARSELYLGVVE
FT                   "
FT   gene            complement(309211..311187)
FT                   /locus_tag="Ctha_0266"
FT   CDS_pept        complement(309211..311187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0266"
FT                   /product="phage tail tape measure protein, TP901 family"
FT                   /note="TIGRFAM: phage tail tape measure protein, TP901
FT                   family; KEGG: dac:Daci_2622 phage tail tape measure
FT                   protein, TP901 family"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12737"
FT                   /db_xref="GOA:B3QTJ1"
FT                   /db_xref="InterPro:IPR010090"
FT                   /db_xref="UniProtKB/TrEMBL:B3QTJ1"
FT                   /protein_id="ACF12737.1"
FT                   /translation="MSELYSINVQFSGNGLLVLTKQLKDSLRQAEGLDAALQKLAETND
FT                   AVFGKMKTYAKTATDNFVAHQQATTQLKIALSGTPKVIKETFSAIQKETKSLSRVYAGT
FT                   EADFLKMASTMMNKGIQQANVQKLMAPAAKLATALDMPYEKAAEQIAQLSQSTGIAAGN
FT                   MDGFIDKLFRTKDFQGMADAFNEVSLSLDVLGMQGLEAQNNLTPVLKVLGANKQAGTAL
FT                   SAMLKSSHDAANVAKAEKMLSKAGIDIPIAFTDAEGKSLGWDNFMQQLDELKELDGELK
FT                   DKVFAQLFGTGSQAAMKLAQTGQTGLTKESSSLEAQTGLDAATNLKLQELGTSLKKLDD
FT                   ASRSLSQTIGGLFAEEYKWAIDMLTKMTHAVTDFVSSNRGMIKGVIYLTAAVVGFGKLY
FT                   QATQLIRKSPLFQGFLTQAQNAISKITGIFSGFLTRFVPRATFLLTRFGITLLANGTYI
FT                   FSLLGNMVVQGLRIIITGVLAAISSKTVIVTAIIALISSIFFYLYYHVNAFKGFVDSIV
FT                   DMLPSQLSGAVDFISDKLNALAGFFGWIDKKEEKKPKQIAPPARQSESATDVSTGMAMP
FT                   IAPEQIHTPNQEMQLPHRAPISAATAAVQGKQIAVNYNPTIHFSGAISETDRNNFRAML
FT                   QKHKDDIVRLVDSANQRQTALAY"
FT   gene            complement(311217..311744)
FT                   /locus_tag="Ctha_0267"
FT   CDS_pept        complement(311217..311744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0267"
FT                   /product="putative phage tail fiber protein"
FT                   /note="KEGG: sgl:SG0856 putative phage tail fiber protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12738"
FT                   /db_xref="InterPro:IPR006521"
FT                   /db_xref="InterPro:IPR040471"
FT                   /db_xref="UniProtKB/TrEMBL:B3QTJ2"
FT                   /protein_id="ACF12738.1"
FT                   /translation="MSIVPESIRDLHAEAVEILSGRLGSEQLEMLLVYDTEEATPALLR
FT                   LLEWQLNVTWSWIANTDDERRQLLRNAISWHRYKGTKFAIVQALQAIGYSAVSITEGAS
FT                   ANIYDGAMSYSGSALYDGGGTTNWAVFSVSATAPEGQTLDDAEYARVRKLINNMKPART
FT                   KLQALSLTESGT"
FT   gene            complement(311741..312877)
FT                   /locus_tag="Ctha_0268"
FT   CDS_pept        complement(311741..312877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0268"
FT                   /product="Baseplate J family protein"
FT                   /note="PFAM: Baseplate J family protein; KEGG: cvi:CV_2115
FT                   probable bacteriophage tail fiber protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12739"
FT                   /db_xref="InterPro:IPR006949"
FT                   /db_xref="InterPro:IPR014507"
FT                   /db_xref="InterPro:IPR040471"
FT                   /db_xref="UniProtKB/TrEMBL:B3QTJ3"
FT                   /protein_id="ACF12739.1"
FT                   /translation="MSEFSEPQFISTDADEVLTEMIQQYENMAGKTLNPAQPERLMLDL
FT                   LAYRETLLRISIQEIAKQNLLAYALGDQLDFLAELVGVTRLEAQKAKTVLQFTNNSGVS
FT                   VTFSERTQVSTASGEVVFETVEELTVQSGKSETVSAEALEVGTSYNYYVPGQINTLVQA
FT                   MASLEVTNTQASYGGTDDESDEQLKERIRLAPSSFSSAGAREAYRYHALSVSQSILDVT
FT                   VLSPSDDEALDEAVIPGIVAVYLLTNPPLESSSALLSEVEAYLSGDSIKAVCDTLWVRA
FT                   AEAVQCSVSCEVDIEEGYLSDDVNSEVMAVLEAYAESLKAEFAKEAIQSEMIALIHDVE
FT                   GVVSVSLDLKNEAEEEVETISLKRFQFANLAITSVTVL"
FT   gene            complement(313735..314046)
FT                   /locus_tag="Ctha_0269"
FT   CDS_pept        complement(313735..314046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0269"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12740"
FT                   /db_xref="InterPro:IPR019289"
FT                   /db_xref="UniProtKB/TrEMBL:B3QTJ4"
FT                   /protein_id="ACF12740.1"
FT                   /translation="MKIEIKKKKSASFTNVELAEPTVGDLVNAERIAGKIDSIDGVLAL
FT                   LATIGTFDGKKLTLEELKGLSTKDFFELSTALKDTGMGELAEQLSSSLEKDDSLTKTS"
FT   gene            complement(314049..314549)
FT                   /locus_tag="Ctha_0270"
FT   CDS_pept        complement(314049..314549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0270"
FT                   /product="phage major tail tube protein"
FT                   /note="TIGRFAM: phage major tail tube protein; PFAM: major
FT                   tail tube protein; KEGG: mca:MCA2918 prophage MuMc02, major
FT                   tail tube protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12741"
FT                   /db_xref="InterPro:IPR006498"
FT                   /db_xref="UniProtKB/TrEMBL:B3QTJ5"
FT                   /protein_id="ACF12741.1"
FT                   /translation="MESVAINRITNAKVYIDGNILLGQVEEFDLPDVKFKFSDYKALGM
FT                   TGSAEFFEGLEKLEARLKFNALYKDVWAKAAEPGKVVNLMMHAQQQEFLSSGRAEPKPV
FT                   VIHVSGAFKNVPLGKFKQQEPIDVEMNMAIYYVHLLLDGQSVMEIDILSNIYKVNGTAV
FT                   TSI"
FT   gene            complement(314553..315791)
FT                   /locus_tag="Ctha_0271"
FT   CDS_pept        complement(314553..315791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0271"
FT                   /product="tail sheath protein"
FT                   /note="PFAM: tail sheath protein; KEGG: mca:MCA2919
FT                   prophage MuMc02, tail sheath protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12742"
FT                   /db_xref="InterPro:IPR035089"
FT                   /db_xref="UniProtKB/TrEMBL:B3QTJ6"
FT                   /protein_id="ACF12742.1"
FT                   /translation="MPAAYLHGVEIIEVSSGLKPIREVRSAVIGLVGTVSYADTYSGEK
FT                   FTEYNTPTLVRSLKEARELFHVGTHEVTDEGVTSIVSNVSYSSILESLESIFAQGACTV
FT                   LICVMNGSDFSAALTGFEESISLFGFEPKILIAPGFSHKSGILSQMLTAADKHKAVALV
FT                   DVASLDNEKSTTDGAEYGGNNIAVDAAKTAVISGAFNTSDERCVLCYPRLLVAENNTTA
FT                   KRWYSAFLAGVIANKDAEQGYWWSPSNTEINGILGLEQNISAGLSDANSDANSLNENGI
FT                   VSVFAGFGTGYRTWGNRSAAYPASTAPHNFINGRRVSDVLLQSVQQAGLQFVDRPITDA
FT                   LIDSIKASVNAFIRSLVGRGALIDGECVYNAEDSTPADGHLIFGVNYMFPPPAERITIQ
FT                   SYVDINLLSTVGE"
FT   gene            complement(315890..316519)
FT                   /locus_tag="Ctha_0272"
FT   CDS_pept        complement(315890..316519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0272"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cvi:CV_0429 probable bacteriophage tail fiber
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12743"
FT                   /db_xref="UniProtKB/TrEMBL:B3QTJ7"
FT                   /protein_id="ACF12743.1"
FT                   /translation="MAHITEESIFHEKIYQIGTEDPVKGGTPVYSKDGENITSVTDGHA
FT                   NVQAKLLADRTQHLNEQLTALKNDIASGDYDESAGTLDARITALKNDIASGDYDESAGT
FT                   IDSRLTAAEGEIDDILNPSNTMAQTGYCDLPGGLRLQWGYSYSGTDTSRQVSFPVSFTG
FT                   DVYSVVCQTHTANSTIYVAGFTSSSFHTVLSDIGVVFSWIAIGKAA"
FT   gene            complement(316527..317045)
FT                   /locus_tag="Ctha_0273"
FT   CDS_pept        complement(316527..317045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0273"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mca:MCA2921 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12744"
FT                   /db_xref="InterPro:IPR018602"
FT                   /db_xref="InterPro:IPR035934"
FT                   /db_xref="UniProtKB/TrEMBL:B3QTJ8"
FT                   /protein_id="ACF12744.1"
FT                   /translation="MTSFEQILIAIQADILTRLGERLQPLPLALKRTADEVLLENETWT
FT                   DADGLVIVRYAGSTYGQVTAPGLTLQERELLFDVSVLCQNLTGENPEDLALGYVGQVIT
FT                   ALAGFVPTDCTDALRVVRDEFAQADAAAHKFHYRIRFACPALLIQTYDTEELHLLKTTD
FT                   IQDLTIAST"
FT   gene            complement(317042..317443)
FT                   /locus_tag="Ctha_0274"
FT   CDS_pept        complement(317042..317443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0274"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pat:Patl_4200 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12745"
FT                   /db_xref="GOA:B3QTJ9"
FT                   /db_xref="UniProtKB/TrEMBL:B3QTJ9"
FT                   /protein_id="ACF12745.1"
FT                   /translation="MSVLGFFNDAGAGLVAAIGKAVDAASTTDEERLQLKAQIEALVYD
FT                   HSNRMAAELTERLKADMASDNWLAKSVRPLLLIGSFVLFFLASLADGNFGGFQIKDIYI
FT                   PIYKEIMLTGVMFYFGSRGIEKISQIRKQ"
FT   gene            complement(317456..317851)
FT                   /locus_tag="Ctha_0275"
FT   CDS_pept        complement(317456..317851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0275"
FT                   /product="L-alanyl-D-glutamate peptidase"
FT                   /note="KEGG: vfi:VF2017 L-alanyl-D-glutamate peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12746"
FT                   /db_xref="GOA:B3QTK0"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="InterPro:IPR039561"
FT                   /db_xref="UniProtKB/TrEMBL:B3QTK0"
FT                   /protein_id="ACF12746.1"
FT                   /translation="MPKFSETSKARLAKCDARLQEIFYAVVTKADCSILEGHRNEQKQR
FT                   MMLMQGRTKLAWPNSKHNRVPSLAVDVAPYPIIWDERERFIYFAGFVKGIAAAKGIGLR
FT                   WGGDWDMDNSLKDNRFDDLVHFELIES"
FT   gene            318278..318586
FT                   /locus_tag="Ctha_0276"
FT   CDS_pept        318278..318586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0276"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ava:Ava_3116 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12747"
FT                   /db_xref="GOA:B3QTK1"
FT                   /db_xref="UniProtKB/TrEMBL:B3QTK1"
FT                   /protein_id="ACF12747.1"
FT                   /translation="MEVVENGLEIARLGSHLSVAFIISVLWYLFHVIEKKQRSEERKTD
FT                   EEKWNKVFHQYVEERREERKTLRETITAMQSLAASIKEHTIKLDSIERIINAINQKV"
FT   gene            complement(318755..319015)
FT                   /locus_tag="Ctha_0277"
FT   CDS_pept        complement(318755..319015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0277"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gfo:GFO_3474 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12748"
FT                   /db_xref="GOA:B3QTK2"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="UniProtKB/TrEMBL:B3QTK2"
FT                   /protein_id="ACF12748.1"
FT                   /translation="METKVTLKLDKTLIDKAEAYASAHHLSLSEIVEMYLKRLVAEAGS
FT                   SRAGEIEISPFVKSMATGVKLPTDIHPKDAYRDHLSEKLHS"
FT   gene            complement(319131..319430)
FT                   /locus_tag="Ctha_0278"
FT   CDS_pept        complement(319131..319430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0278"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sbn:Sbal195_2124 Mor transcription activator
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12749"
FT                   /db_xref="GOA:B3QTK3"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR014875"
FT                   /db_xref="UniProtKB/TrEMBL:B3QTK3"
FT                   /protein_id="ACF12749.1"
FT                   /translation="MISLDDIPAGDMRFIAEHLGIAVALGLMKLMGGEKLYVPKKCFHR
FT                   LYIRQKFKGDNVKALARELGLSERTVQRYVKDLFITPKSLSQLEIFDNATKEAS"
FT   gene            complement(319433..319786)
FT                   /locus_tag="Ctha_0279"
FT   CDS_pept        complement(319433..319786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0279"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12750"
FT                   /db_xref="UniProtKB/TrEMBL:B3QTK4"
FT                   /protein_id="ACF12750.1"
FT                   /translation="MKEVKLKLLNVEIAESEVNRLMREYQLGCLVKKFPSLTGDMYGAE
FT                   VEVYLMDDACRRLGDGGVSDVGFAAPEHPDSPHSHAVAAEMALTKARRRAVLAFLGKVY
FT                   EYSEASGKKKRAG"
FT   gene            complement(319783..320280)
FT                   /locus_tag="Ctha_0280"
FT   CDS_pept        complement(319783..320280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0280"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ppd:Ppro_2386 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12751"
FT                   /db_xref="InterPro:IPR009363"
FT                   /db_xref="UniProtKB/TrEMBL:B3QTK5"
FT                   /protein_id="ACF12751.1"
FT                   /translation="MNDAATTSQIKQIHILKKNLAISEENYRAFLSGFGVRSSKDLSYR
FT                   GAGEVIRMLSAEQAKCSPNSPQNRDKLAASYGFGRQKYDELGKRPGMASPKQLRMIEAI
FT                   WKEVSVFQSAKRRKAALSNFLHQRFNRISPLQIEAELVQRIFKTLQEMKLQKLETEKEY
FT                   PQ"
FT   gene            complement(320277..320498)
FT                   /locus_tag="Ctha_0281"
FT   CDS_pept        complement(320277..320498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0281"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12752"
FT                   /db_xref="UniProtKB/TrEMBL:B3QTK6"
FT                   /protein_id="ACF12752.1"
FT                   /translation="MPCNEIFGKLRAAEKAVIAAAEKLADAYKCIETLPLRNLNRAEAA
FT                   LCDAVQELRHARQVGSCQGNRIERDWPS"
FT   gene            complement(320488..320769)
FT                   /locus_tag="Ctha_0282"
FT   CDS_pept        complement(320488..320769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0282"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12753"
FT                   /db_xref="UniProtKB/TrEMBL:B3QTK7"
FT                   /protein_id="ACF12753.1"
FT                   /translation="MMDNKIWKRMGYARAVFDVFVLVAHSDEPLAACDRVVATAQGLRT
FT                   EMRIATISVLTGEENFNEINYQEKLAADFAKHFSGVRIVQRKGREHAV"
FT   gene            complement(321121..321996)
FT                   /locus_tag="Ctha_0283"
FT   CDS_pept        complement(321121..321996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0283"
FT                   /product="Uncharacterized ATPase putative transposase-like
FT                   protein"
FT                   /note="KEGG: ypy:YPK_0215 transcriptional regulator, XRE
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12754"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3QTK8"
FT                   /protein_id="ACF12754.1"
FT                   /translation="MTLWILRQEPQNDIILFLSVSGGDEDRKNLTVRKPIFLKKMKTSH
FT                   QEIIQEPRARFAFTETSVWRKFYEAARLCHLYGEIGRVTGPSGVGKTTAVNEYKRRDDS
FT                   AIVIRAHHRYSTREVFVDLCEACHIEPKGTVHRMMRELVTKLHHSARLLILDEAEHLSP
FT                   STLDEVRQLNDRAGIGILYVGIDRFRSRLQSLRGDYEYIVNRVKVPASLRKLTLGDAAS
FT                   LCRTVIPELSDECVKLYHRESGGDGRFMENHVFKSLIAARHSSVPVGSEAFAEIIAQTA
FT                   DILLERGGRK"
FT   gene            complement(322512..324704)
FT                   /locus_tag="Ctha_0284"
FT   CDS_pept        complement(322512..324704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0284"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: btr:Btr_1421 transposase (class III)"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12755"
FT                   /db_xref="GOA:B3QTK9"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR015126"
FT                   /db_xref="InterPro:IPR015378"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B3QTK9"
FT                   /protein_id="ACF12755.1"
FT                   /translation="MTATRKLRAEVVDLVQPIDNLLDNPKTAVVEPDNCLQNQALSESD
FT                   VFLSVLEVANLLGCSKQAVQKKIRKGNFVTRIDEADKRKPVFVALSSLPASAREKWLRE
FT                   NTPPNDAEADTRRLDALSYQQAADYNRRKADKYALLFQATDGLKGAGLREAIQKWNAAH
FT                   PEQKTSYPSLMRARKIFAEEGLSGLLGSYGKLRGTSKIDDPCWGEAMPPVYEFFKSAYL
FT                   KRSQPKLEAVFAATLGFAKEHGFFEAVRQGRFPSRAAFLRKLKKEIGEAAICLHREGEE
FT                   AYNRKYAHFLSRDYSAIRAGKVWVSDHRRLDQAWALADGRARRPWLTVWRDFKTGYWIS
FT                   WSLHFEDPNADHVIETFCEACLKIGVPEEIIIDNGKDYRVKDFAGGRRRFRPNYANQDA
FT                   ADYNYIRTQSRSLTAQLGVRVHFANPYGAQTKPIERDFLIFKEWMDKGMPGYTGGNPLE
FT                   RPERVEAQLDFERGEALVGYFIEEVLHQIKSQGKVLSGRSREAAWREEYDGAAAKWVTE
FT                   DALRLYRYRISGEVTIKRNGVRDAALGDWYYAEWMDGHAGAKVYLRRSLKAWQEAWVFD
FT                   AETDEYLGPATLGFWRVPALAESGLERKTVREKLAHKKRVKKTLKTLAGDGVEVSPEAL
FT                   LRYQSAGVQAGASLSETLAAEAQHANDKQQGKIKSIGQNGSAKIIHKTAMDEALSRERE
FT                   WRKTGTHDIACFSPATDEPPAKKRYSIFKCDLEDEE"
FT   gene            complement(324707..324922)
FT                   /locus_tag="Ctha_0285"
FT   CDS_pept        complement(324707..324922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0285"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12756"
FT                   /db_xref="UniProtKB/TrEMBL:B3QTL0"
FT                   /protein_id="ACF12756.1"
FT                   /translation="MRSMFRGIYAEIAEEETARLVENGITEKKVTADAVKMSIRRGNPR
FT                   LQARFVEIANARKETRRQFEALREAV"
FT   gene            325041..325853
FT                   /locus_tag="Ctha_0286"
FT   CDS_pept        325041..325853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0286"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; peptidase S24
FT                   and S26 domain protein; KEGG: pvi:Cvib_0894 putative
FT                   prophage repressor"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12757"
FT                   /db_xref="GOA:B3QTL1"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR006197"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/TrEMBL:B3QTL1"
FT                   /protein_id="ACF12757.1"
FT                   /translation="MEEMIGDRFKAVRKALMLNQDAFSKDIGISQSSLSEIENGKFSPG
FT                   SDIILSLCRYFNIDSNWLLTGTGKMFLEKKPESENISEAGDEPSAADWQLQAEQAAKTA
FT                   ASRSESEALAGDVAALKKQVNELFGLVRGRMDVLEDAMVEIPVFMHRVSAGPAVASSSE
FT                   IEEYIKLPTVLLKHPKRSYAVRASGNSMVGAGIHSGDLLIVDQEAAIKHKCIVIASING
FT                   EQTVKRLLIEDGELVLAPENSHYQSTPITKEMNFSILGVVMHIIRTVY"
FT   gene            complement(326171..327322)
FT                   /locus_tag="Ctha_0287"
FT   CDS_pept        complement(326171..327322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0287"
FT                   /product="arsenite-activated ATPase ArsA"
FT                   /EC_number="3.6.3.16"
FT                   /note="KEGG: cte:CT1939 ArsA ATPase family protein;
FT                   TIGRFAM: arsenite-activated ATPase ArsA; PFAM:
FT                   Anion-transporting ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12758"
FT                   /db_xref="GOA:B3QTL2"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR016300"
FT                   /db_xref="InterPro:IPR025723"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040612"
FT                   /db_xref="UniProtKB/TrEMBL:B3QTL2"
FT                   /protein_id="ACF12758.1"
FT                   /translation="MRVIIYLGKGGVGKTSISSATAVSIARSGKKVLILSTDVAHSLAD
FT                   ALGVELGAKPIEIEKNLFALEVNILAEIREHWEEFHAYFSTILMQEGASEIVADELAIM
FT                   PGMEEMISLRHIWLAAKSGEYDAIVVDAAPTGETMRLLAMPESYRWYSDKIASWHVRAM
FT                   GLAAPLIQKWMPKKNVFKLLPQVGENMQDLHKILMDPNITTYRIVVNPENMVLKEALRA
FT                   QTYLNLFGYKLDAVVVNKVIMHKSTDPYILAMVEQQKKYLDKINNCFYPLPIFPARLHS
FT                   QEVIGADKLHMLSTELFDGINPADVLYHEQLTQSVEKTDGKYMLRLYLPNVEIDRVQMN
FT                   LKGDELLIEVNNFRKNIILPNVLIGRKTESAKFEDGNLEVTFA"
FT   gene            complement(327366..328721)
FT                   /locus_tag="Ctha_0288"
FT   CDS_pept        complement(327366..328721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0288"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cph:Cpha266_2298 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12759"
FT                   /db_xref="UniProtKB/TrEMBL:B3QTL3"
FT                   /protein_id="ACF12759.1"
FT                   /translation="METIKLYAAKHAEEAHIQEFFRRNLLQLGERPIAAFDGFFYESKN
FT                   EQIGSVAFQDYLIFSDKSLYLWARGADKDYLDRFDLGTVSITAKQRDKNTSTVEIVLNR
FT                   KAKESIYLVFDLVPVEEAEKIVLLQVLIETVLEEHLGKNYLEEIPQEIADKIYTTGIDS
FT                   CPPKVFELAPYQNEGNEAVGTSIPPQSSMGIPGMGYVQNFQDQSNNSHIGYGQDLLEQF
FT                   KARHSFSGYQGGAAQQGSRMFGNQQYPGSMPFNSSRPFGQNPQNMSPNGAQRPPEIDMA
FT                   TMKQMSEMVKELIASIPEEYKEQFKHDLRKIPENFQKLPDNFVESVNALNELLQNVSSN
FT                   KQTQDFLIDVIQAAVKSDGLFGAASKFVKTVVPTPPMPGNRRKNEYERKDSFGGKVYED
FT                   GSAKTEKSSEAKKPIKDNSDSIWQSSKKEEASDDDSSSRSRRKKIKVKSDNG"
FT   gene            complement(328911..329156)
FT                   /locus_tag="Ctha_0289"
FT   CDS_pept        complement(328911..329156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0289"
FT                   /product="bacteriochlorophyll C binding protein"
FT                   /note="PFAM: bacteriochlorophyll C binding protein; KEGG:
FT                   cph:Cpha266_2299 bacteriochlorophyll C binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12760"
FT                   /db_xref="GOA:B3QTL4"
FT                   /db_xref="InterPro:IPR001470"
FT                   /db_xref="InterPro:IPR038387"
FT                   /db_xref="UniProtKB/TrEMBL:B3QTL4"
FT                   /protein_id="ACF12760.1"
FT                   /translation="MPVGGGGAITEVLSSIGRISELMFEGHWYAFSKAVESLAQGSLRL
FT                   NQNLWGSMGGGVGGSSLRGSSPSREYGKQIESKFAK"
FT   gene            complement(329344..329556)
FT                   /locus_tag="Ctha_0290"
FT   CDS_pept        complement(329344..329556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12761"
FT                   /db_xref="UniProtKB/TrEMBL:B3QTL5"
FT                   /protein_id="ACF12761.1"
FT                   /translation="MDKNEFIGEFQSMEMSEKISFCVFGALDTILQGVSNTMNSVLPVA
FT                   NDIIAFNSPGGAQKVQERAKKSDNS"
FT   gene            complement(329587..330012)
FT                   /locus_tag="Ctha_0291"
FT   CDS_pept        complement(329587..330012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0291"
FT                   /product="chlorosome envelope protein C"
FT                   /note="KEGG: cte:CT1943 chlorosome envelope protein C"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12762"
FT                   /db_xref="InterPro:IPR020995"
FT                   /db_xref="UniProtKB/TrEMBL:B3QTL6"
FT                   /protein_id="ACF12762.1"
FT                   /translation="MTEAYDKLRTQFKELPLTDRIAFIAEATVMTGQSALSDSMGLFGG
FT                   VFENIGSSVDSIIKATGLSNSSNNVVSQTVERVAITVKDAGKAAGTIYKDVAKGVDDAT
FT                   GGIAKGLGDVTSQASEVVKNVTGTIQKTAAEVTSPKK"
FT   gene            complement(330175..331383)
FT                   /locus_tag="Ctha_0292"
FT   CDS_pept        complement(330175..331383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0292"
FT                   /product="arsenite-activated ATPase ArsA"
FT                   /EC_number="3.6.3.16"
FT                   /note="KEGG: cch:Cag_0117 anion-transporting ATPase;
FT                   TIGRFAM: arsenite-activated ATPase ArsA; PFAM:
FT                   Anion-transporting ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12763"
FT                   /db_xref="GOA:B3QTL7"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR016300"
FT                   /db_xref="InterPro:IPR025723"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040612"
FT                   /db_xref="UniProtKB/TrEMBL:B3QTL7"
FT                   /protein_id="ACF12763.1"
FT                   /translation="MRIITFTGKGGVGKTSIAAATALRLSELGMRTLVLSTDPAHSLSD
FT                   SFNVSLSAEPTKIKDNLSAIEVNAYVDLKENWHVVQKYYANLFAAQGMPNVMADEMTVL
FT                   PGMEELFSLVRVKRYKMSGQYDALVLDTAPTGETLRLLSLPDTLAWGIKMIRNVDKFIV
FT                   RPLARPLSRMSDKLSNYVPSQEVFDSVDQVYEELDGIREILTDQNLSSVRLVMNPEKMA
FT                   IKETMRALTYLNLYGFKVDMVTVNKLLSEDEDSGYLEKWKAVQKRYLNEINSAFEPLPI
FT                   KTLPMYDNEVVGLDALNRLANDLYGDTDPSQMLYHEDPMRFIRHDDSYEVQIKLQFANP
FT                   DDIDVWVSGDELFIQIGNQRKVMTLPLTLTGVEPGDAAFKGKWLSIPFPVTPQASPVGN
FT                   GRG"
FT   gene            331890..333578
FT                   /locus_tag="Ctha_0293"
FT   CDS_pept        331890..333578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0293"
FT                   /product="Lytic transglycosylase catalytic"
FT                   /note="PFAM: Peptidoglycan-binding LysM; Lytic
FT                   transglycosylase catalytic; KEGG: gme:Gmet_2556
FT                   peptidoglycan-binding LysM:lytic transglycosylase,
FT                   catalytic"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12764"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:B3QTL8"
FT                   /protein_id="ACF12764.1"
FT                   /translation="MLKLPFFQMLVRLFCFSCLPILAGCAATQTPISIDDYQLHNDCRL
FT                   FTAPPKITLYPSRTWDDLRAAHRQIAEIDSTPAPANFADSTAIQIGYAHILYQAALKAL
FT                   QRTPMPDKETAREALTEALEIISSVLAQPDLKADPQLSRLALYVVQTYDDHIQKLSELE
FT                   GDAPALLVYERLFGNPENTIVDENLFLGILLPKTEIPLELNYQVKKFITFYSSRFHDIF
FT                   QRYLNRAEIYFPMMQKIIEEENVPPEIIYLTIVESGVNPHARSHANAVGAWQFIKSTGR
FT                   LFDLHGNNWFDERQDIEKSTRSAMRLLKSLHQRYGDWYLALAAYNAGTGKINRAIRRSG
FT                   KKNFWELTRYLRTETRQYVARYIAASIIAMHPEHFGFTSLEFEEIEETELVTVPNCLSL
FT                   DVLSQSIGMPKEQLQFLNPELRQDVTPPAYKNYPLRVPKRLASSAQQAIDSIPDSEQLF
FT                   FTLYKLKQNESLSRIAKKLDVTPSILQEINHLKSSVVPRGKVLMMPTSPEAFAETHFSR
FT                   RELSDDSRERRRRRRRYKQPASEENISLVQVYRKIQTDLQAEEKE"
FT   sig_peptide     331890..331976
FT                   /locus_tag="Ctha_0293"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.986) with cleavage site probability 0.601 at
FT                   residue 29"
FT   gene            333680..335902
FT                   /locus_tag="Ctha_0294"
FT   CDS_pept        333680..335902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0294"
FT                   /product="TPR repeat-containing protein"
FT                   /note="PFAM: TPR repeat-containing protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: sru:SRU_1028
FT                   tetratricopeptide repeat family"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12765"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:B3QTL9"
FT                   /protein_id="ACF12765.1"
FT                   /translation="MMRGIYLAAVFALVILFCGGCARDDDSLFGKAYHNFSAYFNAYYN
FT                   ASIEFEKGISAMREAQTFSASDNLHIFSKTENNTAGKANFEKVITKTSEILKSHPVSDL
FT                   ADNALLLMGKAYFYTNELQPAERKFKEILTNYPDSDIFDEASFWYGRTLTRQFHTEEAA
FT                   EILRSIMKSSKTSDVVMAKCYFSLAELAINEGNLEEAAMLIESGLALEDSEDLKTLAAY
FT                   TLARIYDQLHRFKKAAETYTFLLNLSPSYEMHYIAQLNTGIALREQSRARLAIKIFQDL
FT                   LADDNNLENFGEIRFELATAYAQNDELGKAFDLYQEIIYRHPGTEAAAKSFYQLGKLRM
FT                   EISQDLTMAKTLFDSAKAAYPKGDIAKKAQEQSTTLKNLLDLYDETIQLDSTIQLGILA
FT                   TADVLAEDTALPNDSLESEPAPKKEEPPRKRTRQDYRKSAFLARGAHDAFNETTTQKSS
FT                   TSTKPKFQPAANEAALKQYQIQAIENRIALGRFYHLTMQTPDSALSWYTQALRKIQADS
FT                   SDKLATLREVVLFSLSDIYRNLGDTTQMDSVYKVLLADFPESAYINRVREHFNLPKLRR
FT                   GENAPEQILYTNAIQTLENSQADTSLAMLKTLLSRYPNSALIPKVLLGIGFIYENNLSE
FT                   PDSAILAYQKLAADYPKSEEAKHVKNKLDAVQSRAKLIPTTPDDKIELPEKPPTPAPEM
FT                   NRLERFPIKKDSTKANGVQPELQKMIKFAGNRADSVQHNPEKQNLE"
FT   sig_peptide     333680..333748
FT                   /locus_tag="Ctha_0294"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.783) with cleavage site probability 0.769 at
FT                   residue 23"
FT   gene            335899..336717
FT                   /locus_tag="Ctha_0295"
FT   CDS_pept        335899..336717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0295"
FT                   /product="oxidoreductase FAD/NAD(P)-binding domain protein"
FT                   /note="PFAM: oxidoreductase FAD/NAD(P)-binding domain
FT                   protein; Oxidoreductase FAD-binding domain protein; KEGG:
FT                   cph:Cpha266_2302 dihydroorotate oxidase B, electron
FT                   transfer subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12766"
FT                   /db_xref="GOA:B3QTM0"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR012165"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR019480"
FT                   /db_xref="InterPro:IPR037117"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:B3QTM0"
FT                   /protein_id="ACF12766.1"
FT                   /translation="MTHMTEATTKADDIFDLSLTVQETTQLNATTAVLAFKSELIAPLI
FT                   KPGQFVNIKVNDTLAPLLRRPLSVHRVEGDIFEVMVKVVGSGTKLLYNALPGSTVQVLG
FT                   PLGNSFDYARQDYDTAILVSGGVGVAPMTILDDCLRQAGKEIFNYVGGRTASDIIARKL
FT                   TNLRIATDDGSQGFKGTVVALLEQDFPEFAKKRVRIFSCGPNRMLQALADFSMKKNIPC
FT                   EVSLESVMGCGIGICYGCPVHVKNEQGEPDGHKLLCQHGPVMDAKQVVFE"
FT   gene            complement(336778..337926)
FT                   /locus_tag="Ctha_0296"
FT   CDS_pept        complement(336778..337926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0296"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   cch:Cag_1473 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12767"
FT                   /db_xref="GOA:B3QTM1"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:B3QTM1"
FT                   /protein_id="ACF12767.1"
FT                   /translation="MKKILIFSEDFPPNVGGIAQWAAGMAESFQKLGYDVAVLTRFLSQ
FT                   EIADLQRRSSYPVRHMRGNYWKKLRTWYAYKGVKSLVKSGFLPDTVIATTWNLARGATG
FT                   LAKKFGFRLIIVVHGLEVTRKMTPIKQKWLKETLNAADLIVSVSHFTKERVVSQHGIAP
FT                   EKIMVLPNGVNPEQFFPISALSDWRRKYQLDGQKVILTLARLKERKGHDRVIQALPKIL
FT                   SEVPNVRYLISGKTDSDYARRLMQLCRDLNLEKQVTFIGYIEPEALNAHYNLCDVYIMP
FT                   SYELTETGDTEGFGITYLEANACEKPVIGGRSGGVLDAIEDGKSGFLVAPDNILEIEEK
FT                   LLLLLKNPEVAEKIGKYGRERILKSLTWERIAERLAETTPVG"
FT   gene            complement(337923..338972)
FT                   /locus_tag="Ctha_0297"
FT   CDS_pept        complement(337923..338972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0297"
FT                   /product="glycosyl transferase family 9"
FT                   /note="PFAM: glycosyl transferase family 9; KEGG:
FT                   pvi:Cvib_0687 glycosyl transferase, family 9"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12768"
FT                   /db_xref="GOA:B3QTM2"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="UniProtKB/TrEMBL:B3QTM2"
FT                   /protein_id="ACF12768.1"
FT                   /translation="MIQKATKRRLLARLMRLFWGRLLEKPAFQGNLNRIVILAQEKLGD
FT                   AILLTPLIKQLRQANPKLEIHLVAVRAAADFFQHDKNIDVLHRPKSGLMNFIFSVRKFE
FT                   FDVLFNTKDHPSWTFMMYSILIPARYKIAVFHDYHRGFYHHLLDVPFESHVVRKNCAVL
FT                   PYLKIPASDEACRPYLPDAPISEEIQQFAESFVGKKVIGINLSAGEPSREWPLEKWSQL
FT                   LALLPLPTIIFSMPDRFSEKESLEKAHPHVLKTPRTKSLFDAAVLIKKLSLLITPDTSF
FT                   IHVASCSQTPVVGLYRADVIHHTRFAPYQLPNIQVISKTSLVHDISVVDVQTAAEKMLQ
FT                   VDLRKGFSA"
FT   gene            complement(339107..339574)
FT                   /locus_tag="Ctha_0298"
FT   CDS_pept        complement(339107..339574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0298"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cte:CT0190 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12769"
FT                   /db_xref="UniProtKB/TrEMBL:B3QTM3"
FT                   /protein_id="ACF12769.1"
FT                   /translation="MYRKIFIDDENAAHRELSIYRKGHVNAIRLNDEGYFVYQSLPISA
FT                   HNYAALFHYNSIDALNALPFISETKNGLDSWDEAYLPNTLLEKLIGILGDELDAHRETK
FT                   PEEIMLGWQDSPEKISYWRVISPTEFCSFLESLMAFVKEAQTTGYDLEFIL"
FT   gene            339704..341128
FT                   /locus_tag="Ctha_0299"
FT   CDS_pept        339704..341128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0299"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lbl:LBL_1341 cytoplasmic membrane protein,
FT                   ImpL63"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12770"
FT                   /db_xref="UniProtKB/TrEMBL:B3QTM4"
FT                   /protein_id="ACF12770.1"
FT                   /translation="MVGKYLRRIGFYLLTAILFFSQSSQAQANDEETRGTDSYSLYQEN
FT                   PVMNAFTGGMGITVFDDEVYYNLYLAPELVLGKVGIGFDVNLRIGTDGKLRKEDWDDDV
FT                   SSYLRLIRYVRYGNKFDSLYVRVGQLEATRLGHGSLMYMYRNNGSYDTRKIGLEFDMDF
FT                   AKWGFESMVSDLTSFDLVGVRGYMRPLLESNLPIIDQLEVGASLVSDFRDNTNLVATTQ
FT                   SLRSAYSENGQIAFNPSLANRESSLMAWSVDLGLPLIRLPILEIEGYMDYAKIVDYGSG
FT                   GLIGLSASLKNITSIATFSARLEHRVAGDQFQFSYFDALYEQDRFETIQNFGDSSVVRT
FT                   RANELANYTSPGPGVYGDLGATILSSIRLWGSYQRLYNTKQSGQLHLSAGLKELIPQVL
FT                   LKADYYKRDVGSETEVFTLDDRSLALVEFGYYPQPYMLLSIIYQWTYLPVRNGDEVIGY
FT                   EPIRRIEPRVSLNFQF"
FT   sig_peptide     339704..339784
FT                   /locus_tag="Ctha_0299"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.534 at
FT                   residue 27"
FT   gene            341351..343906
FT                   /locus_tag="Ctha_0300"
FT   CDS_pept        341351..343906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0300"
FT                   /product="ATPase AAA-2 domain protein"
FT                   /note="PFAM: UvrB/UvrC protein; AAA ATPase central domain
FT                   protein; Clp domain protein; ATPase associated with various
FT                   cellular activities AAA_5; ATPase AAA-2 domain protein;
FT                   SMART: AAA ATPase; KEGG: cph:Cpha266_0334 ATPase AAA-2
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12771"
FT                   /db_xref="GOA:B3QTM5"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:B3QTM5"
FT                   /protein_id="ACF12771.1"
FT                   /translation="MEGNFSNRVQDVIRYSREEALRLGHDYIGTEHLLLGIIREGEGIA
FT                   VRILKNLGCDLYKLKRAIEDSVRSTGGTLTLGNVPLTKQAEKVLKITYLEAKICKSDII
FT                   GTEHLLLSLLKDEENIASQILSQFGVRYETVREELENIMSGKSSSGEISAMSPGQQSGS
FT                   GQYQQQYESRKMEKTKTPVLDNFGRDLTKLALEDKLDPIIGREKEIERVAQVLSRRKKN
FT                   NPVLIGEPGVGKTAIAEGLALRIVQRKVSRVLYDKRVVALDLAALVAGTKYRGQFEERM
FT                   KAVMNELEKSKDVILFIDELHTIVGAGGASGSLDASNIFKPALARGDLQCIGATTLDEY
FT                   RQYIEKDGALDRRFQKIMIEPTSVEETVSILNNIKEKYETHHNVRYMPEAIDSAVKLSD
FT                   RYITDRHLPDKAIDVLDEAGARVHLSNIHVPKEILDLEAKIEDIKVEKNQVVKSQNFEE
FT                   AARLRDQEKKLLETLDKAKQDWEKTTAEMVYDVNESDVAAVVAMMTGIPVLKVAQSESE
FT                   RLLKMGEMLKGEVIGQNEAIEKVTKAIQRTRAGLKDPNRPIGSFIFLGPTGVGKTELAK
FT                   ALTRYLFDTEEALIRIDMSEYMEKFSVSRLVGAPPGYVGYEEGGQLTEKVRRKPYSVVL
FT                   LDEIEKAHPDVFNILLQVLDDGILTDGLGRRVDFRNTVIIMTSNIGARDIKSMGMGMGF
FT                   GGAPDHKSKYDSMKSTIEDALKRVFNPEFLNRIDDVIVFHQLEKADIFKIIDISAGRLF
FT                   KRIRDMGISIEITDRAKQFLVDKGYDQQFGARPLRRALQRYIEEPLAEEMLKGNFAEGS
FT                   TIRIKYDESNDALQFVDAAKDDSSSEESGQTVEGKQQDA"
FT   gene            344268..345227
FT                   /locus_tag="Ctha_0301"
FT   CDS_pept        344268..345227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0301"
FT                   /product="PSP1 domain protein"
FT                   /note="PFAM: PSP1 domain protein; KEGG: gfo:GFO_3243
FT                   protein containing PSP1 C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12772"
FT                   /db_xref="InterPro:IPR007557"
FT                   /db_xref="UniProtKB/TrEMBL:B3QTM6"
FT                   /protein_id="ACF12772.1"
FT                   /translation="MKCVRDNCTGRSVCNVRACLPDYLLSLENKILEEADPTELQECSL
FT                   YEVEFRGNRKEFYKDDNPQNLRIGDFVIVQADSGHDAGWIFSSGALARKKVEQRSLDPN
FT                   NKKILNILRKASTEEIEALQVIETREPEIAEICRKKIAAHQLDMKFVDVELRFDQQKIS
FT                   VFFTADHRIDFRELVRDLASEFHVRIQMVQISTRDEAKRMGGVGSCGRMLCCTTWLKEF
FT                   HQVSTDSAKYQNMQMNMSRLSGQCARLKCCLNYERDSYLEQLKKFPIVESIVKTEQGKA
FT                   KIERVDIFRDEIWLHYEANDTWQCLNLEEFNRIFTRRN"
FT   gene            345243..345704
FT                   /locus_tag="Ctha_0302"
FT   CDS_pept        345243..345704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0302"
FT                   /product="cyclase/dehydrase"
FT                   /note="PFAM: cyclase/dehydrase; KEGG: ter:Tery_3513
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12773"
FT                   /db_xref="InterPro:IPR005031"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:B3QTM7"
FT                   /protein_id="ACF12773.1"
FT                   /translation="MHTLSFSVDIAAPCDAVFHFHDDVENLKQITPPEADLKILYADDP
FT                   GKGQKVVLSIAQFGFLHMKWEVLITDYEPPFRMTDEQIKGPFHSWRQTRSFQSLSNAHT
FT                   RLTDAVVYELPLQFFSDFFFGALVEQQITEQFKYRQAKLKAILENQFHS"
FT   gene            complement(345784..347343)
FT                   /locus_tag="Ctha_0303"
FT   CDS_pept        complement(345784..347343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0303"
FT                   /product="Mg chelatase, subunit ChlI"
FT                   /note="KEGG: cph:Cpha266_0558 Mg chelatase, subunit ChlI;
FT                   TIGRFAM: Mg chelatase, subunit ChlI; PFAM: magnesium
FT                   chelatase ChlI subunit; ATPase associated with various
FT                   cellular activities AAA_5; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12774"
FT                   /db_xref="GOA:B3QTM8"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3QTM8"
FT                   /protein_id="ACF12774.1"
FT                   /translation="MLSQLCAAAVIGVDAIRIDVETNLDSGLPAFIVVGLPDSAIKESR
FT                   ERVMTALKNSGFSIPPKKITVNLAPADVRKEGTAFDLSLAIGILASCGIVPSEDLGDTL
FT                   ILGELALDGSLRRIIGALPMAAMAARLGMKRMILPKENASEAAVAAAACGSVLQVFGVS
FT                   SLSETVDLLTGQNPIAPTQISVSEIFSDAPNYTIDFSDIKGQNDAKKAMEIAAAGSHNI
FT                   IMIGPPGSGKTMLSKALPSILPPMVFEEALETTKIYSVAGHLPTGKALLTQRPFRNPHH
FT                   TTSSVALIGGGTMAKPGEVSLAHNGVLFLDELPEFSRISLEVLRQPLEDREVTVSRAAL
FT                   TTKYPAGFMLVAAMNPSPAGALKDEHGNLTATPQQIQRYLSRISGPLLDRIDIHIDVPK
FT                   VNYEDLISRAKGESSAAIRERVLQAREIQQKRFMAYKNQHIFSNAQMTSRMIREFCRLD
FT                   ADSETRLLDSMRRLNLSARAHDRILKVSRTIADLNGAADIQFRHLVQAIQYRSLDREFW
FT                   NY"
FT   gene            complement(347583..348863)
FT                   /locus_tag="Ctha_0304"
FT   CDS_pept        complement(347583..348863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0304"
FT                   /product="acetyl-CoA hydrolase/transferase"
FT                   /note="PFAM: acetyl-CoA hydrolase/transferase; KEGG:
FT                   cte:CT0029 4-hydroxybutyrate coenzyme A transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12775"
FT                   /db_xref="GOA:B3QTM9"
FT                   /db_xref="InterPro:IPR003702"
FT                   /db_xref="InterPro:IPR026888"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR038460"
FT                   /db_xref="UniProtKB/TrEMBL:B3QTM9"
FT                   /protein_id="ACF12775.1"
FT                   /translation="MGKVVSAEEAVSAIKSGDRVFIHTAVASPQRLVQAMTNRASEFRN
FT                   VEIVHLHTEGDAPYVKPEYRESFRVNAFFVGANVRKAVQEGRADYIPIFLSEVPHLFTR
FT                   NILPLDVALVHVSPPDKHGYCSLGVSIDAAQAAVHTAKYVVAQVNPNMPRTHGDGLIHT
FT                   RNIDALVESNDALPEFPPHPLTDVEKSIGRNVAEIVEDGATLQMGIGAIPDAVLALLGN
FT                   HKRLGIHTEMFSDGIIDLVEKGVITGEDKRVHPGKVVSSFVMGSRRLYDFIDDNPLIVM
FT                   LGSDYVNDTAVIRRNPKVTAINSALEVDMTGQVCADSIGTKQYSGVGGQMDFIRGASLS
FT                   PNGKPIIALPSTTKHGESRIVSSLKHGAGVVTTRAHVHYIVTEYGAAMLYGKNLRQRAE
FT                   ALINIAHPDHREALSAEAHKLYGSNVF"
FT   gene            349155..350084
FT                   /locus_tag="Ctha_0305"
FT   CDS_pept        349155..350084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0305"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rno:689787 hypothetical protein LOC689787"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12776"
FT                   /db_xref="UniProtKB/TrEMBL:B3QTN0"
FT                   /protein_id="ACF12776.1"
FT                   /translation="MKRDLFMTLLTFLVLGAFSIAGCDDDNPIVETDYSSEYSEYAAND
FT                   IASTMGSDNGGLNDQFTDLANLVVDSLDMAETAASDTIVISRERSGPYYNNGQWTLKLS
FT                   SQASSSSLTGSWSRGYRYWYSKNTQRQKHFFQKGSGIADSIGFGLISDSCSGSYENAYR
FT                   THTLNQLQAEWACRVDSASNMIRLGSTQNYTCQSTDEVKLGQNTRVSTYTLTLSMSDIE
FT                   IPIKERFIRGKYVHPRSGTITGTHVASHKMLSSTGTALWERSGIERSFEITYSYNASTQ
FT                   TRTVTVTVAGPISSLTKTLNIETGTVED"
FT   sig_peptide     349155..349223
FT                   /locus_tag="Ctha_0305"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.991) with cleavage site probability 0.911 at
FT                   residue 23"
FT   gene            complement(350183..350860)
FT                   /locus_tag="Ctha_0306"
FT   CDS_pept        complement(350183..350860)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0306"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cph:Cpha266_1734 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12777"
FT                   /db_xref="InterPro:IPR025524"
FT                   /db_xref="UniProtKB/TrEMBL:B3QTN1"
FT                   /protein_id="ACF12777.1"
FT                   /translation="MKKRTTPVIFLFLLFFCAQSLAYAKKSFEGRLELQISAPKFSGSA
FT                   EFFLSKQGIRIEAKGEKMQQIMLIRQKSNALYQLNLSEKTYSEIDLEETRRRSAALSHL
FT                   KNYTIEKLGEEKVLGYSCSHFTISDGRLTLELWTSKDILDGESLKRLSSASQFLGVNEK
FT                   MLDAMDAQGVGGFPVKMRADMQGREVVTELKSIQAKNLPQSLFDLPADYVLQEAASSED
FT                   AQP"
FT   sig_peptide     complement(350792..350860)
FT                   /locus_tag="Ctha_0306"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.821 at
FT                   residue 23"
FT   gene            351118..351354
FT                   /locus_tag="Ctha_0307"
FT   CDS_pept        351118..351354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0307"
FT                   /product="putative ferredoxin"
FT                   /note="KEGG: ote:Oter_2876 putative ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12778"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B3QTY0"
FT                   /protein_id="ACF12778.1"
FT                   /translation="MPAVFENRNSDNAPGRYYIDSQCYDCGLCVDICPTIFKRNGKKRY
FT                   SFVGAQPEQATHEKLCKEALETCPCGAIGDDGK"
FT   gene            complement(351470..352300)
FT                   /locus_tag="Ctha_0308"
FT   CDS_pept        complement(351470..352300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0308"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12779"
FT                   /db_xref="UniProtKB/TrEMBL:B3QTY1"
FT                   /protein_id="ACF12779.1"
FT                   /translation="MPAGFLSNIKICERFMQQSLNSFLCRFSAFFLVLFLHSFLPAHAQ
FT                   WQPQPNLFTETYLAEQALAVPIDSAEFPEFELVPDVEGSKSPFIAGLLSFVLPGLGEAY
FT                   AGNFSTGKYSLGIEIGLIAGFVGTTVYANSLETDFQTLARSNAGVSSSQKSDQFWKDIS
FT                   NYESMAAYNEERMQLRDYNGRYSQEDFWDWDTEANRKKYRDLRISSDEAFQATYFILGA
FT                   MAVNRLFSAINAVRSVRAYNESLSSSASLRITPKVYRSRPFLVDGVGLNLEKSF"
FT   sig_peptide     complement(352166..352300)
FT                   /locus_tag="Ctha_0308"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.990) with cleavage site probability 0.990 at
FT                   residue 45"
FT   gene            complement(352334..352528)
FT                   /locus_tag="Ctha_0309"
FT   CDS_pept        complement(352334..352528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0309"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12780"
FT                   /db_xref="UniProtKB/TrEMBL:B3QTY2"
FT                   /protein_id="ACF12780.1"
FT                   /translation="MLFLDWIPRCDAKNHWWQKGIYNLIAPNVNIKLADNQRLAAFSSI
FT                   ITLEGKTSGNCKWDSLGCN"
FT   gene            352581..353876
FT                   /locus_tag="Ctha_0310"
FT   CDS_pept        352581..353876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0310"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="PFAM: helicase domain protein; DEAD/DEAH box
FT                   helicase domain protein; SMART: DEAD-like helicases; KEGG:
FT                   mxa:MXAN_4081 putative ATP-dependent RNA helicase RhlE"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12781"
FT                   /db_xref="GOA:B3QTY3"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3QTY3"
FT                   /protein_id="ACF12781.1"
FT                   /translation="MSLINFESISLNPSILRALKELGYETPTAIQAAAIPEAILGKDIL
FT                   ATAQTGTGKTAAFALPILHRLGENRSYDIRAPRALILTPTRELALQIDNNIRLYARYLR
FT                   LRTGVIMGGVPAHPQIKMLRRNPDILVATPGRLIDLFDQGFIGLDQIQTFVLDEADRML
FT                   DMGFIDDIRRIESLQPRDHQTLLFSATLSPEIEALASRMLREPVRIEVAPVSSVADNIT
FT                   QKVLFVEQNNKRELLHNLFKENDIKRALVFTRTKQRANHVAEQLIRLGISADAIHSSKS
FT                   QRARQRALMLFDRGKINVLVATDIAARGIDVDGISHVINYELPDDPENYVHRIGRTARA
FT                   GASGTALSFCDADEVRMLKGIEKLTKSSIAICDNNPFHSIAVASMHKVAKAGNKPQYFQ
FT                   KKPRRFSNSKSKYSSKYSDRKHSSGKRSYKSA"
FT   gene            complement(353942..355261)
FT                   /locus_tag="Ctha_0311"
FT   CDS_pept        complement(353942..355261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0311"
FT                   /product="SurA domain"
FT                   /note="PFAM: PpiC-type peptidyl-prolyl cis-trans isomerase;
FT                   SurA domain; KEGG: cph:Cpha266_0035 PpiC-type
FT                   peptidyl-prolyl cis-trans isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12782"
FT                   /db_xref="GOA:B3QTY4"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR023058"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:B3QTY4"
FT                   /protein_id="ACF12782.1"
FT                   /translation="MINKLGKIGFALLFMLALAGSFSKPASAQEMLDGIVAVVGDEAIL
FT                   KSDVDNQAMLYAYQNQINLNTPGLWKEVFTALINQKILLMKAKLDSITVSSEEVDGLVE
FT                   QRIAFLRERLRTDEAIVETFGKSIDMLRVDLREEIKSQRLVEELQRQHFSDLTVSNEEV
FT                   VDFYNTYRDSLPEIPAEVEVAHIVIKPKTDSLSKQSALDAIQEVQKELQDGKDFAELAR
FT                   AESQDPGSARLGGDLGFVKRGEFVRRFEEVAFGLKENQISGIVETEFGYHIIQLLERKG
FT                   EAIRVRHILKRFDKTKLNDAAAIDQLNEIRENVLSGKAEFSMMARQFSEDESSAELGGD
FT                   IVSPQTNQKRIPLDGLLPAIRSIIETLRPGEISKPTRIQLGDEYAFSIVKLKYFAPKHR
FT                   LNLEQDYARLRNMALQRQQAERYSSWVEELKKTIYWKVKI"
FT   sig_peptide     complement(355175..355261)
FT                   /locus_tag="Ctha_0311"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 29"
FT   gene            complement(355279..356142)
FT                   /locus_tag="Ctha_0312"
FT   CDS_pept        complement(355279..356142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0312"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sru:SRU_1798 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12783"
FT                   /db_xref="GOA:B3QTY5"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="UniProtKB/TrEMBL:B3QTY5"
FT                   /protein_id="ACF12783.1"
FT                   /translation="MSQSVKKNILHVLFLCVLFGMVSACESNSADSVVAKVGESNLTLS
FT                   ELQASIQYASPKDSATAAAIYIEDWKHTAALYDLACQANIESDPLAQVLLEKAKRRIFV
FT                   QRFVDIEMKKAEAKGAFRVDSIEVSAYYEMHKQEFVYREPAVKLIRLYASSSDSATRMA
FT                   RALGNRRFSFDELVSEAKIIAPELDTLNTHALQDSEEFVRISRLHLESDVLQQLLEKMR
FT                   PSNISPIVKLNDSLFVVMRLETRVETGTEKPLEAAYDEIKQRLKLKKQNAFYIELQKRA
FT                   RKAAQR"
FT   sig_peptide     complement(356068..356142)
FT                   /locus_tag="Ctha_0312"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.506 at
FT                   residue 25"
FT   gene            complement(356351..358537)
FT                   /locus_tag="Ctha_0313"
FT   CDS_pept        complement(356351..358537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0313"
FT                   /product="PpiC-type peptidyl-prolyl cis-trans isomerase"
FT                   /note="PFAM: PpiC-type peptidyl-prolyl cis-trans isomerase;
FT                   KEGG: chu:CHU_0192 possible peptidyl-prolyl cis-trans
FT                   isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12784"
FT                   /db_xref="GOA:B3QTY6"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:B3QTY6"
FT                   /protein_id="ACF12784.1"
FT                   /translation="MVRFNLEFKKLKLFFAALFSASILTACGGSLSQLPVAKIEQPGWE
FT                   YAVDLQEFESKYNDGTFFSDTLRRDTFAAYQDFLDKYITFRLKVKDAQDRGFGQDPSLL
FT                   QELKDYRAQLAEPYLMERAVMEKNLRDLYDKQQEEINASHILALVSSAADPADTLRAYQ
FT                   KIMEARKLILAGAPFDSVALAFSEDPSVRQNKGNLGYFSGGMMVYQFEDAAYGGKVGEL
FT                   VGPFRTRYGYHIVKIYDRRPKTQPIRASHIMVALPKSPTPSDTLKAYRKAESILRRIQK
FT                   GEDFQSIAKKESDDKLSGARGGDLGLFGLNRMVKPFETAAFALKQAGDLSPIIRTPFGY
FT                   HIILLTGREEPKSYDESKELLKRLLSRNSEKLKHERDLFIQQLKETYHFKENESALPML
FT                   TAKIDSNSTFAQLDDLDDATLGTVFFTFAEKQTRTLADLIDFMKRFGGKNSLLTADAIH
FT                   QYAKQYVDETLKSYEIDHLEARYADFTQLMEDYRDGVLLFKVSDETVWSQAAATDSAGR
FT                   AYYATHKGDFRLGERMKVSEIVVSEKSLADDIYNELTQNIRQRDVVSAQDVKIQKRKIQ
FT                   AQLRKLKKRRDKKSQLKFQKLQEQLTGLQVDDQPRSFEALAARYSETADSLGSAESAIF
FT                   NRGENRRVDKLFGKPVGFVAAPESINERYRIMRLDIMLPPTEKTYEEARTEIFSILQEQ
FT                   NTRALETEWVNRLRAKSKITVFEDNLKQAFKEDK"
FT   sig_peptide     complement(358439..358537)
FT                   /locus_tag="Ctha_0313"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.823 at
FT                   residue 33"
FT   gene            complement(358721..359509)
FT                   /locus_tag="Ctha_0314"
FT   CDS_pept        complement(358721..359509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0314"
FT                   /product="ABC transporter-related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: sat:SYN_00410 ABC-type transport system, ATP-binding
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12785"
FT                   /db_xref="GOA:B3QTY7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3QTY7"
FT                   /protein_id="ACF12785.1"
FT                   /translation="MIEVQNLKKQFRQKEVLRGVSLEIKTGETMVIIGRSGCGKSVLLK
FT                   HMVGLLVPDEGRVLVDGEDISQMSKAALYRVREKFGMLFQSAALFDSMTVGENVGIALK
FT                   ENAQLPNKEIEKIVAEKLAMVELPGTEHLKPSELSGGMRKRVGLARALATNPQYIFYDE
FT                   PTTGLDPIMSDSIDSLILNLAKSLQVTSIVVTHDMQSVDKVADRVAMMHEGRIYFLGTR
FT                   QELRHSRDVIVRNFVERNAYQDVEIEGELGRLSQIDKKKR"
FT   gene            complement(359658..360695)
FT                   /locus_tag="Ctha_0315"
FT   CDS_pept        complement(359658..360695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0315"
FT                   /product="phospho-2-dehydro-3-deoxyheptonate aldolase"
FT                   /note="TIGRFAM: phospho-2-dehydro-3-deoxyheptonate
FT                   aldolase; PFAM: DAHP synthetase I/KDSA; KEGG: dau:Daud_1183
FT                   phospho-2-dehydro-3-deoxyheptonate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12786"
FT                   /db_xref="GOA:B3QTY8"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006268"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR041071"
FT                   /db_xref="UniProtKB/TrEMBL:B3QTY8"
FT                   /protein_id="ACF12786.1"
FT                   /translation="MFIVMSHEATEEQIHAVYDRVRELGCMPHKILGSQRIAIGVTGNK
FT                   GVLDEDGFSSMSGVVDVVRITKPYKLVGREVKPENTIVRIGDVEIGGKEIQIMAGPCAV
FT                   ESREQIYEVAESISVAGVKILRGGAFKPRTSPYSFQGLKIKGLELLKEAAEKYGMLVIT
FT                   EVKDTENLPAVAEHSDILQIGARNMQNFALLEAAAKYKNPILLKRGMAATIEEFLMAAE
FT                   YIYSNGNQNVILCERGIRTFETHTRNTLDLNAVPAVKHLSHLPIVVDPSHGVGLWEYVN
FT                   PMSKASIACGADGLIVEVHPHPEKALSDGPQSLKPKKFYRLLKELKPVAEAVGRTLNAT
FT                   VEELI"
FT   gene            complement(361009..362346)
FT                   /locus_tag="Ctha_0316"
FT   CDS_pept        complement(361009..362346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0316"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rba:RB1252 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12787"
FT                   /db_xref="InterPro:IPR025641"
FT                   /db_xref="UniProtKB/TrEMBL:B3QTY9"
FT                   /protein_id="ACF12787.1"
FT                   /translation="MMNEQKKTLIFVATALMLGLLGFLSAPKASTPDAFADVGAAFFPD
FT                   FTDPNTAAVLEVVKYDEETASARPFKVTFKKGLWVIPSEYNYPADGKEQLSKTAAAMIQ
FT                   IKKEDFRTDNPAEFESLGVIDPLDESSTAMSGHGKRVTVRNENDKVLADLIIGKKVSGK
FT                   KDYYFVREPEGKRVYTAKLNFEISTKFNDWIDTDLLQLDKKRVSEILLKDYSINEVTGT
FT                   VDERGEIRLSKNGETWMLDRMKPGEDLNTKKVAEVLSALDELKIVGVRPKPSGLSAGLK
FT                   KQSAGIEVSKDDMLSLQSKGYFFTRDGRLLSNEGELQLRTEDGVIYTLRFGEVVPGEND
FT                   EDDSQTKENRFLFLTASFDEDAFKEPKQPESTAFETKPDSLWSAADRENKKQSRAHEKW
FT                   QKQVEDGKKLASSLTNRFADWYYIIPGKNFDKLKLSRRELLKEKNS"
FT   sig_peptide     complement(362257..362346)
FT                   /locus_tag="Ctha_0316"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.948 at
FT                   residue 30"
FT   gene            complement(362671..365343)
FT                   /locus_tag="Ctha_0317"
FT   CDS_pept        complement(362671..365343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0317"
FT                   /product="putative permease of ABC transporter"
FT                   /note="KEGG: rba:RB1250 probable permease of ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12788"
FT                   /db_xref="GOA:B3QTZ0"
FT                   /db_xref="InterPro:IPR019196"
FT                   /db_xref="UniProtKB/TrEMBL:B3QTZ0"
FT                   /protein_id="ACF12788.1"
FT                   /translation="MMNLNVKMISALIKRDLRLFFTNPSGYVFITLFIFLSAGAAFWQE
FT                   QFFLNNLASLSRLNAVFPVLLVFFIAALTMNVWAEENKQGTDELLLTLPATDAELVLGK
FT                   YFAVLGVYAASLVLSLSHIVVLFFLGSPDIGLMFANYFGYFISGAALISVGMIASMLTA
FT                   NATIAFILGVVFTGLLASTSVLSGLFGDALKPFIDAVSIRAHFEDFSRGVLSFSAIFYF
FT                   FSIAAFGLYINIILLGKRHWPKSAGGMKMSGHHAIRAISLIVALVSLNMIFQRFGFRWD
FT                   VTSEKLHSLSGETRRLLGDLPGEKTVLVQAFISPEVPQVLVQTRSNLLSFLKEIEASSG
FT                   GKVQVLIKETEPYSDEAREAREKFGITPREVVANTGAMQAVPKQIYMGLAFTCGAEEQV
FT                   IDFFDKGLPVEYELIRSIRVVSKSERKKIGVVKTAAKIFGGFDFQTMQNSPEWQVVSEL
FT                   KKQYEVVEISADSPIEEQLDGLLVVLPSSLSQEEMDNLAAFIEAGNPALVLTDPLFLET
FT                   VALSPSEKSGAEMNPFLRNQGMQPKPKGNIQGFMRRLGFNWNPQEIVWDSYNPHPELAT
FT                   LPPEVIFIGEGNRNPDSFNKKLVPTQGLQELVFLFPGFLEMSPSGSYGYEPLISCSEMS
FT                   GRLNYRQLVQRSYFGVQMVPSRMIPHQVGGVKYTLAARAFSDNSDSTKSKTKLNVITVA
FT                   DIDFISEQFFDIRKSGYESLNFDNVTFFLNCMDWLAGDESFIELRKKRLKHRTLETLEK
FT                   QVMAYAKLRRDEEKQAELEAEKALSEAQDRLNNKVAEMRRRTDLDEQTKQIMARNIQEV
FT                   ESRRFEALKSRIEAEKDAKIQRSKENMEARVQTIQSTIKLFAVLLPPIPVGLMAVMIFM
FT                   RRRRREKAGTAVARRRRQA"
FT   gene            complement(365359..366111)
FT                   /locus_tag="Ctha_0318"
FT   CDS_pept        complement(365359..366111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0318"
FT                   /product="ABC transporter-related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: rba:RB1248 ABC-type multidrug transport system,
FT                   ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12789"
FT                   /db_xref="GOA:B3QTZ1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3QTZ1"
FT                   /protein_id="ACF12789.1"
FT                   /translation="MSEKNSKVMIEAKGLSKFYESFVAIENVSFSVPEGQVVAFLGPNG
FT                   AGKSTTMRILSGYLAPSEGSAKIAGFDVAEARLKAAAHLGYLPENGPLYLDMTPYESLQ
FT                   FFGEARGLEPAKLKTRIETVTELAALQEVLDKPIGRLSKGYRQRVGLAQALLHDPDVLI
FT                   MDEPTSGLDPNQIRDFRANIKVLGKTKTILLSTHILQEVEAVAERVIFINEGRLVFDGS
FT                   PAELHAESSLEEAFYRLTSPTETQTTES"
FT   gene            366450..366929
FT                   /locus_tag="Ctha_0319"
FT   CDS_pept        366450..366929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0319"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   cth:Cthe_2687 thioesterase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12790"
FT                   /db_xref="GOA:B3QTZ2"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR033120"
FT                   /db_xref="InterPro:IPR040170"
FT                   /db_xref="UniProtKB/TrEMBL:B3QTZ2"
FT                   /protein_id="ACF12790.1"
FT                   /translation="MSEKTRPAKPVSASRVETTHFVTPPDVNYLGNLAGGKLMHWMDLT
FT                   AAIAAGRHANAVSVTASVDSLDFKHPINLGEVVIIKASVNRAFNSSMEVGVKVISENLI
FT                   TGEQKVCNRAYFTFVAIDDSLSPTSVPAVLPETEEEKQRYNKAELRRQIRLLNKG"
FT   gene            complement(367038..367994)
FT                   /locus_tag="Ctha_0320"
FT   CDS_pept        complement(367038..367994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0320"
FT                   /product="Alcohol dehydrogenase zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   gtn:GTNG_0896 NADPH quinone oxidoreductase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12791"
FT                   /db_xref="GOA:B3QTZ3"
FT                   /db_xref="InterPro:IPR002364"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B3QTZ3"
FT                   /protein_id="ACF12791.1"
FT                   /translation="MKKIVADNDLNLSLQEVPSPEVHDNEVAIKIEAIGVNFADIKILN
FT                   GNTLDKGTEMGSEIAGIVESAGRDAHRFKPGDRVFAATHWGGCYAEKAVVPEFSVRKLP
FT                   EYLSFEQGAAFAVTTQTAYHAVITTGKIQAGEWVLILAAGGGVGTQALQIAKLRGAKVI
FT                   AAASSAEKLERLKAFHPDVLVNYAEEDLQKAVMDATNGDGVNCVLDGNGGADFAKNFKM
FT                   MANFGRVVLYGNAAGPIPPIDPYSLIWNAHQIIACTMRVVVAQPELFERAYNDIFEWLK
FT                   TGQLKVEIGHVLPLSDAAKAHELMLGRKNYGKIVLKP"
FT   gene            368442..372143
FT                   /locus_tag="Ctha_0321"
FT   CDS_pept        368442..372143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0321"
FT                   /product="methionine synthase"
FT                   /note="TIGRFAM: methionine synthase; PFAM: dihydropteroate
FT                   synthase DHPS; homocysteine S-methyltransferase; Methionine
FT                   synthase B12-binding module cap domain protein; Vitamin B12
FT                   dependent methionine synthase activation region; cobalamin
FT                   B12-binding domain protein; KEGG: cte:CT1857
FT                   5-methyltetrahydrofolate-homocysteine methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12792"
FT                   /db_xref="GOA:B3QTZ4"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR003726"
FT                   /db_xref="InterPro:IPR003759"
FT                   /db_xref="InterPro:IPR004223"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR011822"
FT                   /db_xref="InterPro:IPR033706"
FT                   /db_xref="InterPro:IPR036589"
FT                   /db_xref="InterPro:IPR036594"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="InterPro:IPR037010"
FT                   /db_xref="UniProtKB/TrEMBL:B3QTZ4"
FT                   /protein_id="ACF12792.1"
FT                   /translation="MQRDIIKLLQERILVLDGAMGTLIQRHKLTEEDFRGERFKDHSHS
FT                   LKGNNDILVITQPEIIKDIHRQFLEAGSDIIETNTFSSTPISLADYEVQDLTYELNLTA
FT                   TKLAREVADEMTAKTPDKPRFVAGSIGPTNKTLSLSPDVNNPGYRAITFQNVVDAYTEQ
FT                   LKGLLDGGVDILLVETVFDTLNCKAALFAIHEFFNKTQRRVPVMVSGTVVDASGRTLSG
FT                   QTTEAFWISISHMPDLMSVGLNCALGAKQMRPFVEAMSNVAQTYTSVYPNAGLPNEFGE
FT                   YDDSPEYMAAQIEDFAKSGFVNIVGGCCGTTPAHIKAIAETVKTLPPRKRPEPHHILQL
FT                   SGLEPLAVDKTTGFINIGERTNVTGSRKFARLIKEGNYDAALSIARQQVESGAQVIDVN
FT                   VDEGMLDSEKVMAEFLNLIASEPEIARVPIMIDSSKWSVIEAGLRCTQGKCIVNSISLK
FT                   EGEAIFKERAEKILEYGAAAVVMAFDEKGQADSYERRVEICSRAYKILTEEVGFPPEDI
FT                   IFDPNVLTVATGIEEHNNYAVDFINSVRWIKQNLPHAKISGGISNISFSFRGNEPVREA
FT                   MHAAFLYHAIREGLDMGIVNAGQLAIYEDIDKDLLERVEDVLLNRREDATERLVDFAET
FT                   IKSDGSKSEAKKAEWRNLPVEERLKHALIKGIVEHIDEDTEEARQKYPRPLHVIEGPLM
FT                   DGMNTIGDLFAEGKMFLPQVVKSARVMKKSVAYLIPFIEEEKAQCEDSKPAAKVLLATV
FT                   KGDVHDIGKNIVGVVLACNNFQVVDIGVMMPCEKIMEAIEKEKPDVVGLSGLITPSLDE
FT                   MAHVAKEMQRAGMNIPLLIGGATTSKVHTAVKLAPHYSAPVLHVLDASRSVPVVNNLVS
FT                   DEQKSDYIAKHFAEQAQMREDHEKRNAKRKFVSLEAARENALKIDWSESEVFAPKQAGI
FT                   TKFENVSLAELRKYIDWTPFFLTWELHGKYPNIFEHEKFGEEAKKVFDDANALLDKIIT
FT                   ENAIQAKGVVGIFPANSVGDDIEVYADENRSETCTVLHTLRQQNEKSSGQSNIALADFV
FT                   APKESGLKDYVGGFAVTAGLGIEKLMKEFAAAHDDYHRIMTQALADRLAEAFAEMLHEK
FT                   VRRELWGYATSESLSSDELIHEKYQGIRPAPGYPASPDHSEKPILFKLLGAEEATGISL
FT                   TETCAMSPAASVSGLYFAHPKASYFSVGKIGKDQAEDYAARKGMKMEEVEKWLSTALNY
FT                   EPNVETVG"
FT   gene            372277..372774
FT                   /locus_tag="Ctha_0322"
FT   CDS_pept        372277..372774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0322"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cak:Caul_1257 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12793"
FT                   /db_xref="GOA:B3QTZ5"
FT                   /db_xref="UniProtKB/TrEMBL:B3QTZ5"
FT                   /protein_id="ACF12793.1"
FT                   /translation="MQERYWNLFCHLKINSLYTYYYHIETERIDRYLRIFLAITSSASI
FT                   AAWTIWKEISYIWGGIIAFSQLLNAVKDYLPYQNRMRKLSAFSSDLNTLLLLCERKWYD
FT                   EASGDMTESEIHQAFMDLKENLKKIDEKYFSESPLPRNNKIFEKAELEAATYFKTFYNS
FT                   PL"
FT   gene            complement(373057..373380)
FT                   /locus_tag="Ctha_0323"
FT   CDS_pept        complement(373057..373380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0323"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12794"
FT                   /db_xref="UniProtKB/TrEMBL:B3QTZ6"
FT                   /protein_id="ACF12794.1"
FT                   /translation="MKFVTLAAGLLLTFFTMNADLSDAKKDISSKYGKAEEVVLQTVGE
FT                   QNSESWWYFSQGKCISFKSWNSMDNYYEINIYEFEPVSKSDANSIEKAKQEAKLVKTEL
FT                   VTN"
FT   sig_peptide     complement(373324..373380)
FT                   /locus_tag="Ctha_0323"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.840) with cleavage site probability 0.460 at
FT                   residue 19"
FT   gene            complement(373485..373979)
FT                   /locus_tag="Ctha_0324"
FT   CDS_pept        complement(373485..373979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0324"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12795"
FT                   /db_xref="UniProtKB/TrEMBL:B3QTZ7"
FT                   /protein_id="ACF12795.1"
FT                   /translation="MHIPKNFTFRCPSCAGQLTLDVKDIKPGKKINCSACDFELELPPE
FT                   FAKEINAMVVSMLFLTEPEEFDGVKYKAVGSLIVWLEYDAEKGKGKDKSALLLTLCQKH
FT                   EILPEKLELAVFINPQNPKLPPTPHICPLKWEAAHKNFSYSNLTPIPYEFFHETLKSHL
FT                   I"
FT   gene            complement(374195..375520)
FT                   /locus_tag="Ctha_0325"
FT   CDS_pept        complement(374195..375520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0325"
FT                   /product="TRAP dicarboxylate transporter, DctM subunit"
FT                   /note="TIGRFAM: TRAP dicarboxylate transporter, DctM
FT                   subunit; PFAM: TRAP C4-dicarboxylate transport system
FT                   permease DctM subunit; KEGG: noc:Noc_0709 TRAP
FT                   dicarboxylate transporter, DctM subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12796"
FT                   /db_xref="GOA:B3QTZ8"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:B3QTZ8"
FT                   /protein_id="ACF12796.1"
FT                   /translation="MPEAVMPLLMFLSLFLLLVLGFPVAFTLGGVSLFFGVLTFGFDFF
FT                   NLLPMRIWGTMTNYVLLAVPLFVYMGVMLEKSGIAERLLETMALLFGRLRGGLAISVVI
FT                   VGAILAASTGIVGATVVTMGLLSLPTMLKRGYSPELATGTIAASGTLGQIIPPSIVLVL
FT                   LGSILNVSIGDMFVSAMIPGLMLVGLYLFWIIGVAIFKPEWAPAMPKDVLEKFRSQNMG
FT                   KTILEAFVIPFFLVLAVLGSIFAGIASPTEAAAVGAFGATLLTLAQKRFNFETLKSVMQ
FT                   ETAHLTSMVFIILVGASAFALVFRGMHGDRYLSELILEANLGEGSFLFIVMLAVFIAGF
FT                   FIDFIEIIFIIVPVVAPIFQQMGVDLLWVGILLAMNLQTSFLTPPFGFSLFYLKGVAPE
FT                   GISTGHLYRGILPYIAIQLIALLAIVAFPELATWLPKALVGK"
FT   sig_peptide     complement(375437..375520)
FT                   /locus_tag="Ctha_0325"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.927) with cleavage site probability 0.384 at
FT                   residue 28"
FT   gene            complement(375513..376049)
FT                   /locus_tag="Ctha_0326"
FT   CDS_pept        complement(375513..376049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0326"
FT                   /product="Tripartite ATP-independent periplasmic
FT                   transporter DctQ component"
FT                   /note="PFAM: Tripartite ATP-independent periplasmic
FT                   transporter DctQ component; KEGG: noc:Noc_0710 tripartite
FT                   ATP-independent periplasmic transporter, DctQ component"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12797"
FT                   /db_xref="GOA:B3QTZ9"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:B3QTZ9"
FT                   /protein_id="ACF12797.1"
FT                   /translation="MDFAKSLVRAIDRLSEFVGRVVSWLTTLLVLVVVYDVFTRYFLKT
FT                   TIVAIQEFEWHLFSLIFLLAASYTLKHDKHVRVDVFYARFSKQQQAWVNLLGGIFFLIP
FT                   FALMVIFASQNFVINSFVIGETSPDPGGLPARYLLKAAIPIGFFLLLLQAFSLAVKSAL
FT                   SIAGVDMGGKETTHA"
FT   gene            complement(376417..376683)
FT                   /locus_tag="Ctha_0327"
FT   CDS_pept        complement(376417..376683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0327"
FT                   /product="twin-arginine translocation protein, TatA/E
FT                   family subunit"
FT                   /note="TIGRFAM: twin-arginine translocation protein, TatA/E
FT                   family subunit; PFAM: sec-independent translocation protein
FT                   mttA/Hcf106; KEGG: cph:Cpha266_0577 twin-arginine
FT                   translocation protein, TatA/E family subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12798"
FT                   /db_xref="GOA:B3QU00"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/TrEMBL:B3QU00"
FT                   /protein_id="ACF12798.1"
FT                   /translation="MFGLGGQELIVILLIILLFFGAKKLPELAKGLGKGLNEFKKAQAG
FT                   LEEEFNKAVEAPKTGSDDLSERVKNMSDDEKAKLAAMLNASKK"
FT   gene            complement(376828..378033)
FT                   /locus_tag="Ctha_0328"
FT   CDS_pept        complement(376828..378033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0328"
FT                   /product="Eco57I restriction endonuclease"
FT                   /note="PFAM: N-6 DNA methylase; Eco57I restriction
FT                   endonuclease; KEGG: ttj:TTHA1583 site-specific
FT                   DNA-methyltransferase (adenine-specific) TthHB8I"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12799"
FT                   /db_xref="GOA:B3QU01"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR011639"
FT                   /db_xref="InterPro:IPR023135"
FT                   /db_xref="InterPro:IPR025931"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B3QU01"
FT                   /protein_id="ACF12799.1"
FT                   /translation="MKTKKALGAVSTPPEVIRFMLSLFSPTKTDSLKVLEPACGDAPFL
FT                   QAFQEKFGDKHALFGVEYDAETLRPPALPNFHFEQTDFLLWDDERKFDLILGNPPYGII
FT                   GDRSHYPIYTFKDMKAAYRQRSETWHGKYNIYGAFIEQAVKRLGDAGELIFVVPSTWML
FT                   LQDFKLLRKFLAESGELHVYYLGRIFPGVQVTAVVIHLKKSSCRTLRLYDEKTLWLEKN
FT                   DYQGEMIRFETGETQKWEQSASQTLGELFDIFFAARSPEFKKNPFVHDHQFIGATPALT
FT                   GRNLSPGKIDYETNHTNFWVKHSGAATLREFYGFAHIVIGHTKGARVVAAYDEKCYPWR
FT                   EEFHLVPKVNVHERQIVEYLNSEQVQVHIKTLYRDLIPHLTRLQLAMIPIPDEVASGIS
FT                   QV"
FT   gene            complement(378043..378684)
FT                   /locus_tag="Ctha_0329"
FT   CDS_pept        complement(378043..378684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0329"
FT                   /product="phosphatidylserine decarboxylase related protein"
FT                   /EC_number="4.1.1.65"
FT                   /note="KEGG: cch:Cag_1747 phosphatidylserine decarboxylase;
FT                   TIGRFAM: phosphatidylserine decarboxylase related protein;
FT                   PFAM: phosphatidylserine decarboxylase-related"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12800"
FT                   /db_xref="GOA:B3QU02"
FT                   /db_xref="InterPro:IPR003817"
FT                   /db_xref="InterPro:IPR033175"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3QU02"
FT                   /protein_id="ACF12800.1"
FT                   /translation="MITPYGKKTLGQALVISMIFFALSYVLPPISSLIVSSLAIFILVF
FT                   TLQFFRDPERKTPQKPNIIISPADGKVVLIKDLDFHDYFQGPVKQISIFMSPINVHVNR
FT                   IPISGRVTHYKYIPGQYLMAFDHASGENNERTEIGIEGKNMKVFFKQISGFVARRIICE
FT                   VRPGDEVEIGKRFGMIRFGSRVDIFFPPTVSLKVSEGQKTTAGETIIGEY"
FT   gene            complement(378749..379420)
FT                   /locus_tag="Ctha_0330"
FT   CDS_pept        complement(378749..379420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0330"
FT                   /product="cytochrome c-type biogenesis protein CcmB"
FT                   /note="PFAM: cytochrome c-type biogenesis protein CcmB;
FT                   KEGG: hau:Haur_2718 cytochrome c-type biogenesis protein
FT                   CcmB"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12801"
FT                   /db_xref="GOA:B3QU03"
FT                   /db_xref="InterPro:IPR003544"
FT                   /db_xref="UniProtKB/TrEMBL:B3QU03"
FT                   /protein_id="ACF12801.1"
FT                   /translation="MSLLSAVFAVLKKDFLLEYRTRFGINIVLLFVLMSVSLVIFSFAG
FT                   ETLESNLLGTLLWNTIFFSAMASMHRGFVSEAEQSTILFLKLSVPATAVLLGKLIYNVV
FT                   LALAINLLVALLYFLALDFSVENYLVFLLTLLLGSLASAITLTLISAIVAGTAARSGLF
FT                   AVLAFPPILPAIWLVVRATKSAALPESTFSDAQSELQLLLAYSVVMLTLSVMLFEYVWE
FT                   E"
FT   sig_peptide     complement(379286..379420)
FT                   /locus_tag="Ctha_0330"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.747) with cleavage site probability 0.741 at
FT                   residue 45"
FT   gene            complement(379444..380613)
FT                   /locus_tag="Ctha_0331"
FT   CDS_pept        complement(379444..380613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0331"
FT                   /product="DNA-directed DNA polymerase"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: cch:Cag_1778 DNA polymerase III, delta
FT                   subunit, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12802"
FT                   /db_xref="GOA:B3QU04"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3QU04"
FT                   /protein_id="ACF12802.1"
FT                   /translation="MAWERINGQERQISVLRRAIKTNRLPNAFLFTGPEGVGKEAVAIE
FT                   LAKVLNCDSPNALLTAEACEKCESCKKISALKHPNLEFIFPVEKILLEKTSETGADRAK
FT                   QEDALERMKALLEEKRRNPYHSLRMDKAMGILKDQILLLQEKAAYKPLAGKKRVFILSQ
FT                   AESMNEASANKLLKLLEEPPPYVLFILVSSQPEMLLPTIVSRCQPLRFSKLRPEEIREF
FT                   LERQSFSLEADAERFIASFSRGNLNHVVQMAFQSVENREKPELQRTRDEALQLLRMLLS
FT                   RDRGHEVIRQVEQFSKRDKTRDEQRQILLAMLRIFQDVVRKQNAPNETGLVNADIETAI
FT                   SKFAQNFPDADFESAVKETESAIYKIGRNANPFLTFSALCIKLKTFLTR"
FT   gene            complement(380621..381595)
FT                   /locus_tag="Ctha_0332"
FT   CDS_pept        complement(380621..381595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0332"
FT                   /product="branched-chain amino acid aminotransferase"
FT                   /note="TIGRFAM: branched-chain amino acid aminotransferase;
FT                   PFAM: aminotransferase class IV; KEGG: pvi:Cvib_1391
FT                   branched-chain amino acid aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12803"
FT                   /db_xref="GOA:B3QU05"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005785"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR033939"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:B3QU05"
FT                   /protein_id="ACF12803.1"
FT                   /translation="MNKSAQIWMNGRLIPWDEAKVHVLAHAIHYGSSMFEGIRCYETEN
FT                   GSAVLFLKEHMRRLFDSAKIYRINIPYTIDELCQATIGVIVANKQRSCYIRPIVFRGAG
FT                   ALGVNPKSAAIDLAIATWEWGSYLGEAVLETGVDVRIATWNRPAPNTTPAGAKAGGNYL
FT                   NSQLIKMEALMDGYAEGIALDAFGYVSEGSGENIFVVRDGVIHTPFAAQSILPGITRNA
FT                   VMQLAKSLGFEVKEAFISRESLYIADEIFMTGTAAEITPVRSVDKYQIGTGKPGEMTKA
FT                   LQSAYFDVIHKGIDNRGWLTFLDNESDEAEKAAAVSENNTGKA"
FT   gene            complement(381927..382697)
FT                   /locus_tag="Ctha_0333"
FT   CDS_pept        complement(381927..382697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0333"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /note="PFAM: phospholipid/glycerol acyltransferase; KEGG:
FT                   cte:CT0967 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12804"
FT                   /db_xref="GOA:B3QU06"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:B3QU06"
FT                   /protein_id="ACF12804.1"
FT                   /translation="MLKVRRSALYTLWFRWYSRRQFAKHFNSLRTFGTEQLQNMDLSIP
FT                   IIFYMNHAYWWDGFWSQLCTEAYFKQNLFIIIEYKQLVRYQFFTRLGAFSIVRENPREA
FT                   IKTINYAIELLSSPSPKQNALWIFPQGLIEHVDKRPLQFFGGTAKIVEQLCKKGKGVYL
FT                   CSLVTRVDYLEEQKPEMFLSFKAPELLTAENFAGVKPLTSELQAKTETHLDELKLRIQN
FT                   REFAGEHYLVEGELSVNKRLDQFKALFGLNGGKS"
FT   gene            382751..383056
FT                   /locus_tag="Ctha_0334"
FT   CDS_pept        382751..383056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0334"
FT                   /product="Rhodanese domain protein"
FT                   /note="PFAM: Rhodanese domain protein; KEGG:
FT                   bur:Bcep18194_A4015 rhodanese-related sulfurtransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12805"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:B3QU07"
FT                   /protein_id="ACF12805.1"
FT                   /translation="MKHINPEQALEIMKMRPEFQVLDVRTRREFGVRRLACAMNIPVDE
FT                   LSRRYHELDEDAEIIVLCEHGLRSQRAALLLEDAGFEKIYNVLGGLSRWKAQTVSG"
FT   gene            complement(383078..383581)
FT                   /locus_tag="Ctha_0335"
FT   CDS_pept        complement(383078..383581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0335"
FT                   /product="protein tyrosine phosphatase"
FT                   /note="PFAM: low molecular weight phosphotyrosine protein
FT                   phosphatase; KEGG: ote:Oter_3671 protein tyrosine
FT                   phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12806"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:B3QU08"
FT                   /protein_id="ACF12806.1"
FT                   /translation="MSFPEIVVQRRVRLLTENRRSILFICTANSIRSQIAEAIVNAKSD
FT                   QLIAYSAGIRPVGFVDGRVVDVMAEIGISMDSHESKGLDEFKDKQVDISITMCGTAYAQ
FT                   CPYWLYDSSLSGHWGFKDVSRKGKSAFRHLRDQIQVHIQKFLVEYSPELTDEEVKALLR
FT                   KHML"
FT   gene            complement(383594..384277)
FT                   /locus_tag="Ctha_0336"
FT   CDS_pept        complement(383594..384277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0336"
FT                   /product="membrane protein-like protein"
FT                   /note="KEGG: nar:Saro_3116 DedA"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12807"
FT                   /db_xref="GOA:B3QU09"
FT                   /db_xref="UniProtKB/TrEMBL:B3QU09"
FT                   /protein_id="ACF12807.1"
FT                   /translation="MRNSDSLFSEPHIHNKAPNIEQPNQPAQPKKLKEKIRSLAVRTSE
FT                   SPFGCGLLFLIGLIEATLIPMPADEVLISLGALKPRRALSYSFALIAGAVVGSLIGYAI
FT                   GYMAYHTVGTFLIEKLGWEQAASQILNDYRHSGLEILLTSGFIPLPYALFTVLAGANET
FT                   LPVVPFVIAGAIGRTVRFLPVGVVLRLFGAKLAPYVEHHLDKIIMIFAGFMLTFFAIRV
FT                   WLGSF"
FT   gene            complement(384274..384888)
FT                   /locus_tag="Ctha_0337"
FT   CDS_pept        complement(384274..384888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0337"
FT                   /product="protein-L-isoaspartate O-methyltransferase"
FT                   /EC_number="2.1.1.77"
FT                   /note="KEGG: cte:CT0202 protein-L-isoaspartate
FT                   (D-aspartate) O-methyltransferase; TIGRFAM:
FT                   protein-L-isoaspartate O-methyltransferase; PFAM:
FT                   protein-L-isoaspartate(D-aspartate) O-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12808"
FT                   /db_xref="GOA:B3QU10"
FT                   /db_xref="InterPro:IPR000682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B3QU10"
FT                   /protein_id="ACF12808.1"
FT                   /translation="MVETLRVDYGISDERVLQAFLKVKRHLFVDTMFWDSAYEDSPFPI
FT                   GSNQTISQPYTVAYMTSIITKHYQTGKILEIGTGSGFQAAILCELGYRVCTVERIDLLY
FT                   QKAKRIFEQLRLRIALRYGDGTLGWSEMAPFDAIIVTAGAPSVPHSLLEQLNEDGRLII
FT                   PVGDTERQRMMIYHRQGDTIYETKTNTFAFVPLIGREGWNK"
FT   gene            complement(385300..386274)
FT                   /locus_tag="Ctha_0338"
FT   CDS_pept        complement(385300..386274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0338"
FT                   /product="DegV family protein"
FT                   /note="PFAM: DegV family protein; KEGG: tpd:Teth39_1304
FT                   DegV family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12809"
FT                   /db_xref="GOA:B3QU11"
FT                   /db_xref="InterPro:IPR003797"
FT                   /db_xref="UniProtKB/TrEMBL:B3QU11"
FT                   /protein_id="ACF12809.1"
FT                   /translation="MRIALVTDSACDLPIDLVYSYNIRCIPMRVIIDGKIRYDNGIDLD
FT                   NDTFYTQFANPKSLTTMATEPPSVDEFIQFYKRLCIDYDAVLSIHVASRLSDTVKHARA
FT                   AAVKGADSFRQQRLQKNIGTPFQIRVIDSQNISIGSGLLVIRAAELLQEDVAFPKLANE
FT                   LELLANESYTFSVLDDPSYLKSGKNAIKVPLLASKVANAFSIKPILSCHRGEISVVDRK
FT                   FGYESAVQEAMNIATEQMHQKSSYEKVGMSYAGVGQELMTNAFLLSFRSELAGMGLTSF
FT                   SSITSPTLGAYTGPKCMTIGILNSDIKVQAVSNDRQKNVAMQS"
FT   gene            386557..386985
FT                   /locus_tag="Ctha_0339"
FT   CDS_pept        386557..386985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0339"
FT                   /product="ApaG domain protein"
FT                   /note="PFAM: ApaG domain protein; KEGG: reu:Reut_A3020
FT                   ApaG"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12810"
FT                   /db_xref="InterPro:IPR007474"
FT                   /db_xref="InterPro:IPR036767"
FT                   /db_xref="UniProtKB/TrEMBL:B3QU12"
FT                   /protein_id="ACF12810.1"
FT                   /translation="MTSDICTVSIDSLEDISQRKLQPPYKYAHAYTITIHNISTYTVQI
FT                   KSRMWIVKDGDMKDRVVEGDGIVGHKPILMPGDTFTYTSYHVMLNRFGSALGKYFGTYA
FT                   YVPEFEQESLFDDDEFEGDEFEVNIPEIQLIHKLRPGA"
FT   gene            387181..388812
FT                   /locus_tag="Ctha_0340"
FT   CDS_pept        387181..388812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0340"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: chu:CHU_1807
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12811"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR019412"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:B3QU13"
FT                   /protein_id="ACF12811.1"
FT                   /translation="MMMVKKAFRQKSIYLEGKVFRAALTFLMAALFFFSHSSGACAQTS
FT                   SIDWSPNAKRLLQEGMNELFSYQLQSAEAKFDSLIQLEPQRPEGYFYKSDCYLLTFIPG
FT                   GENMATYERFLELADQSVRVSEFYLEHLAKTPSEKALGQFFLAESHFAIAVADARAQNV
FT                   IGAALNAHSSKGYYKDALETDSAFYDAGKGVGMFYFFSSLIPSSFRWLATIFGYEQNRQ
FT                   EGVRLMQLAAQKGFYTKNETRFYLAMFTFLFHQNKIQAEKELLTLLSEYPHSTILNYAL
FT                   GLIYLDSKEMANAEAYFVRAAGDLSKDSENSISKFALFRLAELHFRLNDFEKAKAFLLT
FT                   FEKKANYALYTAQLHYLLGVSEWMLGENQQAKEHFEKAKASGENPDELFMQRRAKFFLE
FT                   HGISETSKAILLGKNAFDSGRYPAALTYLEPLLSTPLKKDELAEVHYLLARIQDETGQS
FT                   ENAIANYQACYKLFAQKERYLAPFSRYYLGKLYAKQGHTKLAYEELEKSLRYISYDFED
FT                   ILKEKAKYELEKIAAGQTEITNQPSR"
FT   sig_peptide     387181..387309
FT                   /locus_tag="Ctha_0340"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.777 at
FT                   residue 43"
FT   gene            complement(388790..389785)
FT                   /locus_tag="Ctha_0341"
FT   CDS_pept        complement(388790..389785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0341"
FT                   /product="glycosyl transferase family 9"
FT                   /note="PFAM: glycosyl transferase family 9; KEGG:
FT                   cph:Cpha266_2514 glycosyl transferase, family 9"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12812"
FT                   /db_xref="GOA:B3QU14"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="UniProtKB/TrEMBL:B3QU14"
FT                   /protein_id="ACF12812.1"
FT                   /translation="MSVTSILVIRLSAIGDIILTTPLVRQLRRKFPQAEIDFFIKPAYR
FT                   SILAENPYLSAVVSEPEKLKSQYDVVIDLQNNFRSSQIRKRRSSRVFCYQKRNWKKFLL
FT                   VHFKVNVLKNNLPVPERYLEAIAALDLSDDGFGCDYFITEKDRAFAEKAMAQKRKTLAL
FT                   CFGAKHFTKQYPPARYAEVINKLFAEQPPVQILLLGGKEDAPLAKAISANVADKTHLRD
FT                   FSGQCTLGQTAALLACCDAVLTNDTGLMHMASAFGKKMVVIFGSSVREFGFAPYRTPHK
FT                   ILEIPALACRPCSHIGKSQCPKKHFQCMNLITPESVVRAVREALSDSVDW"
FT   gene            390141..394523
FT                   /locus_tag="Ctha_0342"
FT   CDS_pept        390141..394523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0342"
FT                   /product="5'-Nucleotidase domain protein"
FT                   /note="PFAM: 5'-Nucleotidase domain protein; KEGG:
FT                   syn:sll0654 alkaline phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12813"
FT                   /db_xref="GOA:B3QU15"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR008334"
FT                   /db_xref="InterPro:IPR013211"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR026444"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR036907"
FT                   /db_xref="UniProtKB/TrEMBL:B3QU15"
FT                   /protein_id="ACF12813.1"
FT                   /translation="MKRKLTHHVKQLLSLMVLIAATCLRFTSAQAQDVSLTKLSTYATG
FT                   IFDESAAEIASYDATTGYLAFVNAHANEVVVLDLSDPANPSEVRTLDVTTEVAGGSANS
FT                   VSAKNGVLAVAVEADTKTDNGYVVLYDASSGNHLKTLSVGALPDMVAFTPDGNKILVAN
FT                   EGEPNDDYSIDPEGSVSIIDISSGASNATVQTLNFNDFDDQKANLIAAGVRIFGADASN
FT                   GYSVASFSAVDTIFYSGFDNADLAGFDTVSVVGEQVWGTTSYGTPKPSGMMTGYANSTR
FT                   NDNEDWLIIPAMDFTGKSGVKLSFTEAINYETVSVDDNQQVLISTDYTGFGDPNAATWD
FT                   TLNVTNRSTGSSWTFVTVDDFDLSDYEGESSVYIAFKYISSATDNNASTWEIDDITVQA
FT                   DNATIQLTDASGITAGQWITLDSDNSDEDTDAVLPYQVLSVDGNTICLTTGFESSFDGD
FT                   KFEEGTDTSANASAWTVYSHNTTASVSKDLEPEYIAITPDSKTAYVSCQENNAFVIIDI
FT                   DNATVSSIKALGFKDHSVAGNGLDASDKDDMINITTYPNLKGMYMPDATVAYEIGGATY
FT                   IFTANEGDAREYDALIEEVRVQDLPLDPTAFPDAEDLQKKANLGRLTVTNTLGDIDGDG
FT                   DFDELYSYGARSFSIWDTDGNLVWDSGDQIEKAAAVAYPSYFNSGNDDKGELDDRSDNK
FT                   GPEPEAMAVGKIGDHVYAFVGLERIGGVMIFDVTNPTSPSFKKYINNRDFTVDPSKNLS
FT                   AAGDLGPECVVFIPADSRTDGKNLLAVANEISGTVSIYEISAPETYTLTILHNNDGESA
FT                   LLSEDGYAGISHFKSAVDSLKKSAMESTDGVVMLSSGDNFLAGKEFSASLNDGIYYDAI
FT                   GLDFIDYDAICLGNHDFDFGPKVLSDFIQTIQANPAPYLSSNIDFSGESDLQTLVDNGR
FT                   IAKRTVFEKNGRKIGVIGATTENLKAISSPGDVVMSAVKDAVMAQVNAIKDTVDIIILI
FT                   SHLQSVEEDKELAAELSNVDVMIAGGGDEVLASEIAELYPGDSRDGDYPTIVTDADGKE
FT                   VPIVTTGGNYKYVGKLVVSFDDNGDIVNINSLESDPVLVKSSSYPTNVGLETNVITPVS
FT                   AYIASLENNVIAVTEVALDGKKSHVRTQETNAGNLVADALLWQGRQLAADYGATVPNIG
FT                   MENGGGIRNDVTLEAGDNITSLTTFDMLPFSNYVSIIEVTHKQLKAVLENAVSRVEYVD
FT                   GRFAQIAGMRVYIDTTAAAREQDDETGVATVEGSRITKVVLFAADGSDSTTIIENGVVA
FT                   TPTEKVAVATNNFSAAGGDGYPWMDSEFITVGVSYQQALENYLVAENGLDSVVSADMYP
FT                   VVTDDVAESKRRIIYKTGTSAVAGETEKTPATYALEQNYPNPFNPTTTINYTLASSGFV
FT                   TLKVYDILGREVATLVNEQMKAGQHIATFNAARFASGVYFYRLKAGEFVKVKKMMLLK"
FT   sig_peptide     390141..390236
FT                   /locus_tag="Ctha_0342"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.981 at
FT                   residue 32"
FT   gene            394730..395251
FT                   /locus_tag="Ctha_0343"
FT   CDS_pept        394730..395251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0343"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12814"
FT                   /db_xref="UniProtKB/TrEMBL:B3QU16"
FT                   /protein_id="ACF12814.1"
FT                   /translation="MKGKSLSDHLKTYIEERLKKKGDEHVTDSSVLKRTCSAVVFTGLT
FT                   TGSLTVVEHHRSNSADKGLSIHDGTLRIDLSAFPELSKTDGFLWITDSDVIVLKTSPNT
FT                   FKAYTSICVNWQKKQTFTADNQLRCPSSLEWAFDIHHPTDEEHAHLTEYPIRSDGNFLL
FT                   IELQSTAKKS"
FT   gene            complement(395344..396618)
FT                   /locus_tag="Ctha_0344"
FT   CDS_pept        complement(395344..396618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0344"
FT                   /product="nickel-dependent hydrogenase large subunit"
FT                   /note="PFAM: nickel-dependent hydrogenase large subunit;
FT                   KEGG: cte:CT1894 hydrogenase/sulfur reductase, alpha
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12815"
FT                   /db_xref="GOA:B3QU17"
FT                   /db_xref="InterPro:IPR001501"
FT                   /db_xref="InterPro:IPR018194"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="UniProtKB/TrEMBL:B3QU17"
FT                   /protein_id="ACF12815.1"
FT                   /translation="MKCDLNIDVHHLTRVEGHGNIHVKVKDGKLVDAKWAVVETPRFFE
FT                   AMVRGLSHDLAPVLTARICGICSIGHALASLRAVERAMDVQIPKTAKKLRLLAKHGETL
FT                   QSHILHVFFLVAPDFYNVGSVIPIVAQHPDVAGLAVRLKGLANDLCDLVAGRTTHPVSL
FT                   AVGGLTKAPSKDDLAKMKIAIEERLPDMLATIDLFASLKMPAFVRETEFVSLKGVNEYP
FT                   WIGGDLISTDGVVKPEDDYLAMTNEYVVDFSTSKFTKLSRDAFAAGALARFNNNHHFLH
FT                   EKAREAAERLGLRAVNHNPFMNNVAQVVESYHVMLESIEMIQALLDSDLKDIRADYKPT
FT                   AGKGVGAVEVPRGILYHCYETDDSGIIKKANCIIPTTQNNANIHYDLPELVNQEMARGK
FT                   DENEIEKLCEMLVRTYDPCISCSVH"
FT   gene            complement(396608..397372)
FT                   /locus_tag="Ctha_0345"
FT   CDS_pept        complement(396608..397372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0345"
FT                   /product="NADH ubiquinone oxidoreductase 20 kDa subunit"
FT                   /note="PFAM: NADH ubiquinone oxidoreductase 20 kDa subunit;
FT                   KEGG: cph:Cpha266_2168 NADH ubiquinone oxidoreductase, 20
FT                   kDa subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12816"
FT                   /db_xref="GOA:B3QU18"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="InterPro:IPR037024"
FT                   /db_xref="UniProtKB/TrEMBL:B3QU18"
FT                   /protein_id="ACF12816.1"
FT                   /translation="MKYLGVELQKPKVGVFDFTSCEGCQLQLANKEGSLVDFLSLIEIV
FT                   NFREISSDKSDDYDVALIEGSISRADEVERLKKIRENAKILVALGSCACFGGVNSLKNR
FT                   FPIEEVVTEVYGDMPKETEPVRRVSDVVKVDLCIPGCPVSKAEVERIVVNLVTGAEVKF
FT                   PKYPVCVECKQHVNTCLFDLGQLCLGPITQAGCGAVCPNGKYPCLGCRGAFADPNYEAF
FT                   KNIVAEKGFSMEYLKERLSFYNGFSGAYKDEM"
FT   gene            complement(397383..398297)
FT                   /locus_tag="Ctha_0346"
FT   CDS_pept        complement(397383..398297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0346"
FT                   /product="oxidoreductase FAD/NAD(P)-binding domain protein"
FT                   /note="PFAM: oxidoreductase FAD/NAD(P)-binding domain
FT                   protein; Oxidoreductase FAD-binding domain protein; KEGG:
FT                   cch:Cag_1567 hydrogenase/sulfur reductase, gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12817"
FT                   /db_xref="GOA:B3QU19"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR012165"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR019480"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:B3QU19"
FT                   /protein_id="ACF12817.1"
FT                   /translation="MKTEYQIPKQDVNLEPFMSVPPQYTRKMIVMKTDKVYKCKIINVI
FT                   KLTELEKLFHLRIVDQRERDIFQFRPGQFVMLDVPGYGEVPISLSSSTNNHEYIELCIR
FT                   KAGRTTNVLHEAKIGSYVGIRGPFGNSFPMEKMAGHNILLIAGGLGIAPLRGPLYWVAD
FT                   YRDHYKDVHVLYGAKEPSQMLFTYQYDEWERVNHIKMLSIVEHPDENWTGHVGRITKLF
FT                   DEIEFDPQDTFAIVCGPPVMFKFVCSHLDKMGIPMNRMFVSLERRMHCGMGKCCRCMVG
FT                   STFTCVDGPVFDYWSVLNLKEAI"
FT   gene            complement(398272..399330)
FT                   /locus_tag="Ctha_0347"
FT   CDS_pept        complement(398272..399330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0347"
FT                   /product="hydrogenase/sulfur reductase, beta subunit"
FT                   /note="KEGG: cte:CT1891 hydrogenase/sulfur reductase, beta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12818"
FT                   /db_xref="GOA:B3QU20"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B3QU20"
FT                   /protein_id="ACF12818.1"
FT                   /translation="MIYKVISKPEFRKFVEALIEANDVLGPVKADMDAHGKPLYKFERV
FT                   ASFDEMDLDYTISYSSVKNFFLPYREKLSEYDFSENDWHQDIEYRVNPRVLLGLRPCDI
FT                   NALNILDKIFYKGTYPSPYYIARRKNTFILGLDHDPLPDCFCSSLGCHTVGTGFDMFGS
FT                   DLGDRYYMAVNSAIAFNFLKNFNVKDPTNTDDKAYIERRKFLKKSFQTNVEVSGLPSFL
FT                   DIEFQSPIWKKWGDKCLNCGTCAMVCPTCYCYQVEENIAVNLRTASKDQMLYSCTILDF
FT                   AEVAGGHNFRPNKEDRLKYRYYHHYRGFAENASEPICVGCNRCGRACLAGINPKDVIND
FT                   LRLENEDRVSNT"
FT   gene            complement(399801..401351)
FT                   /locus_tag="Ctha_0348"
FT   CDS_pept        complement(399801..401351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0348"
FT                   /product="protease Do"
FT                   /EC_number="1.3.1.74"
FT                   /note="KEGG: sru:SRU_2064 protease DegQ precursor; TIGRFAM:
FT                   protease Do; PFAM: peptidase S1 and S6 chymotrypsin/Hap;
FT                   PDZ/DHR/GLGF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12819"
FT                   /db_xref="GOA:B3QU21"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR011782"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:B3QU21"
FT                   /protein_id="ACF12819.1"
FT                   /translation="MKRRTVFTAIGLIMIGVVIGVVGMIGAERSNGTAAEEIRLVPQEV
FT                   HSFVPNKSEMPHPPMSQTFVTVAKLSTPTVVSIQVKVDEARPDALDFLYDFQEDEEGDA
FT                   EHDEKEEMERKKDMFHWFFRSPTEPMLSSGSGVLISRDGYIMTNHHVVKNASSASNILV
FT                   TLHDKREFHASITGTDPLTDIAIIKIDAKNLSAATFGNSDSLHVGEWVMAVGNPFELTS
FT                   TVTAGIISAMNRNINIIHDSFGVETFIQTDAVINPGNSGGALVNMNGQLIGINTAIASR
FT                   NGSYQGYGFAIPINLAQSVAKDLIAHGEVIRGYIGVSLGEIDAVMAKALGLKQPTGALI
FT                   QEVLPECAAKEAGIESMDVILKIDGVQIAERNQLQAYVARKHPGDVLRLQVWRDKKIIE
FT                   LRVKLKALKKNSPVAKLDAEPKEEDLGMEVANLSQEEKKEFRTEHGIRVISIDPFGSAF
FT                   TRGIEKNDLILEINREKIASVQSFNQKLVALKSEEAILLKIRKPYSQSAMFVAVEVPH"
FT   sig_peptide     complement(401289..401351)
FT                   /locus_tag="Ctha_0348"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.863) with cleavage site probability 0.539 at
FT                   residue 21"
FT   gene            complement(401411..402190)
FT                   /locus_tag="Ctha_0349"
FT   CDS_pept        complement(401411..402190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0349"
FT                   /product="DNA repair protein RecO"
FT                   /note="TIGRFAM: DNA repair protein RecO; PFAM:
FT                   Recombination protein O RecO; KEGG: pvi:Cvib_1680 DNA
FT                   repair protein RecO"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12820"
FT                   /db_xref="GOA:B3QU22"
FT                   /db_xref="InterPro:IPR003717"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022572"
FT                   /db_xref="InterPro:IPR037278"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3QU22"
FT                   /protein_id="ACF12820.1"
FT                   /translation="MIRKTQAIVLRTINYGDQSKIVTFFTRSFGKLTGLVKGYRNPKGK
FT                   FASVLEIGNDLDLVLYKKDTREVQLITEAVLRAPMLGATSSLEQLSALHQTLELIRLTT
FT                   ENDDAHLGVFELLHATLQKINVSRKNHISFFFYFQVQLISLLGFRLNFQKCVLTGKSLS
FT                   EKALPKDARVVLLAEHGGFALQLAAEERGFAGMPVSTDAFKAVQWLSLVAIESVENLFL
FT                   EKLVINEIFQLLDSYFRFHIDDLPAFRSREIFNQLVF"
FT   gene            402453..403760
FT                   /locus_tag="Ctha_0350"
FT   CDS_pept        402453..403760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0350"
FT                   /product="Glu/Leu/Phe/Val dehydrogenase"
FT                   /note="PFAM: Glu/Leu/Phe/Val dehydrogenase ;
FT                   Glu/Leu/Phe/Val dehydrogenase dimerisation region; KEGG:
FT                   sru:SRU_0505 glutamate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12821"
FT                   /db_xref="GOA:B3QU23"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR014362"
FT                   /db_xref="InterPro:IPR033922"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B3QU23"
FT                   /protein_id="ACF12821.1"
FT                   /translation="MPQRQHSPYSKSVYKEPAPVHDPENPFESMMERFNLAAELLNLDE
FT                   GIYNFLKMPAKQVIVSIPIQMDSGEIKVFEGYRVIHDDTLGPSKGGVRYAPDVTLDEVK
FT                   ALAAWMTWKCSILGLPFGGAKGAVKCDPSKLTPTELEKITRRYTASLISIFGPERDIPA
FT                   PDMNTNEQIMAWIMDTYSMHVEHTETAVVTGKPVILGGSLGRIEATGRGVMISALSAMK
FT                   KMNISPESAKVVVQGFGNVGSVSAKLLAEQGCKIVGISDISGGYYNPNGIDLEKVREHL
FT                   KVHHVLSGFPEADSVTNAELLELPCDVLVPAAKEDQITAKNADKLNCKLIVEGANGPTT
FT                   ADADPILNERCIMVVPDILANAGGVTVSYFEWVQDRQGYFWPLDRVNMRLERFMRNAFD
FT                   TVYETASRYNQPLRIGAYIQAIDKVARTVRLRGIYA"
FT   gene            complement(404547..405647)
FT                   /locus_tag="Ctha_0351"
FT   CDS_pept        complement(404547..405647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0351"
FT                   /product="D-alanine/D-alanine ligase"
FT                   /EC_number="6.3.2.4"
FT                   /note="KEGG: cth:Cthe_1938 D-alanine--D-alanine ligase;
FT                   TIGRFAM: D-alanine/D-alanine ligase; PFAM:
FT                   D-alanine--D-alanine ligase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12822"
FT                   /db_xref="GOA:B3QU24"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3QU24"
FT                   /protein_id="ACF12822.1"
FT                   /translation="MNKKKVALLFGGRSSEHEISVISARSIANALDKTKYKIQPIYITK
FT                   AGKWLGAEASRKILAMDFESAIKSPTKKEIHLIEKEIVLLCQNSQFRFDFRTAKIDVAF
FT                   PVLHGPYGEDGTVQGLLEMFDVAYVGSGVLASAITMDKAVAKICFEHAGLQVGEYLAFL
FT                   RREFEENRGSVVARAEKKLRYPMFVKPANMGSSVGISKAHNRNELIEAIELALAYDRKF
FT                   LIEKAINAREMEVAVLGNDEPIASAVGEVVPCNEFYDYDAKYVKGSSEVIIPAQISEAF
FT                   AGKLKAAALNAFVAADCEGMARVDFLVEKETNEIYINEINSIPGFTSISMYPKLFAQVG
FT                   ISYTELINRLIELALERYSERKLRKI"
FT   gene            complement(405680..406381)
FT                   /locus_tag="Ctha_0352"
FT   CDS_pept        complement(405680..406381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0352"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   sru:SRU_1194 glycosyl transferase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12823"
FT                   /db_xref="GOA:B3QU25"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR026461"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B3QU25"
FT                   /protein_id="ACF12823.1"
FT                   /translation="MKISMIVPVLNEAENIVKTLASGVEQELDDKTALEMLVVDGGSSD
FT                   ETCSLVRDFAMRESRFPIRLFSSARGRATQMNFGAQQASGDALLFLHADTRLSKNAIRE
FT                   MAHALCTTQDAFGYFFMKFDSQNPLTELYSSLTLINSIFCHYGDSGIFVRRSFFNELGG
FT                   FPEQALMEDVELLFRARAKSDPLLIKNAYVTTSARRFEKNGFLEQQMQNGLLLLLYLLG
FT                   VDATILKKLYS"
FT   gene            complement(406438..407967)
FT                   /locus_tag="Ctha_0353"
FT   CDS_pept        complement(406438..407967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0353"
FT                   /product="surface antigen (D15)"
FT                   /note="PFAM: surface antigen (D15); KEGG: chu:CHU_2430
FT                   outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12824"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:B3QU26"
FT                   /protein_id="ACF12824.1"
FT                   /translation="MTRRFPIRELFYLFVFFCLRVICFENAYGEEEKIKREQFSRSDTR
FT                   KALGQVIDTVLISGNFVTREMVIRSELLFHEAEPLTPTNLARSQQQVFNLQLFNSVVIS
FT                   AKTFSPNAKSSVAADKTEPCSLLGQQMSNTLNRKYTVVLITVFERWYLFPVPKFDLRGT
FT                   SITRWIKKPTISNFNIGLSLQHRNFSGFGDLLATSFGLGYDPFVGISYTTPYFFGSNRT
FT                   GFGFSAEYRKSSNVADGDTAGVVPSYSQRNIGLGVSISQRLSMFEYVGLSLDYKSLRVG
FT                   KEIRQFYPMSTVSPDGNDEYVSVSAFYRYREIDFVQFPMDGFVFGLTLTQNGLPWISKN
FT                   LNYFSGSLDVRLYQKLAGELSFAFRNYSILATNKPIPNHQRQYIGFGTQIRGYTSETFN
FT                   GDNLQFNSLELRYPLLNMRTVKLNFISIDQFSIVQYGLFLTAFFDAGTIWYNNESAGPV
FT                   KRINQFNFDDYKYGYGVGVIFIGGYRFTSRVDFSFNDQGDFEVVFEKGVSF"
FT   gene            complement(407989..408420)
FT                   /locus_tag="Ctha_0354"
FT   CDS_pept        complement(407989..408420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0354"
FT                   /product="CoA-binding domain protein"
FT                   /note="PFAM: CoA-binding domain protein; KEGG: cte:CT1344
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12825"
FT                   /db_xref="GOA:B3QU27"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B3QU27"
FT                   /protein_id="ACF12825.1"
FT                   /translation="MKQLSTKMDYIEILKTYKTIAIVGVSDKPQRPSFTVTKYMIQAGY
FT                   NIIPINPNLDEVLGLKCYPSLLELPEVVKQQVEVVNIFRKPQDVPPVVDEAIAIGAKAV
FT                   WMQLGITNEAAAEKARNANLAVVENHCIAVDHQNHLLNA"
FT   gene            408571..409395
FT                   /locus_tag="Ctha_0355"
FT   CDS_pept        408571..409395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0355"
FT                   /product="protein of unknown function DUF344"
FT                   /note="PFAM: protein of unknown function DUF344; KEGG:
FT                   bth:BT_0778 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12826"
FT                   /db_xref="GOA:B3QU28"
FT                   /db_xref="InterPro:IPR016898"
FT                   /db_xref="InterPro:IPR022300"
FT                   /db_xref="InterPro:IPR022488"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3QU28"
FT                   /protein_id="ACF12826.1"
FT                   /translation="MKKSSLPFEKTASLDTISSLPPEGLTADEAKSQNKANLKAIYDLH
FT                   YTMYAEDKQSLLIILQGIDASGKDGSVRHLCTGLNPQGFHVYSFKTPTTEETRHDYLWR
FT                   VHKVAPAHGEIVICNRSYYEEVTVVKIHPEFLVPQKISAASGLDEIFERRYRQINDFER
FT                   MLAETGTRVLKFFLHISKKEQKKRLEERLRNPMKKWKFSEKDVAERAFWSQYMQVFDEM
FT                   LAATHTEYAPWYVIPADKKWYRNYLLGQIVRRELESFRMEFPKPKLGKVKLD"
FT   gene            409392..410198
FT                   /locus_tag="Ctha_0356"
FT   CDS_pept        409392..410198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0356"
FT                   /product="biotin/lipoate A/B protein ligase"
FT                   /note="PFAM: biotin/lipoate A/B protein ligase; KEGG:
FT                   cph:Cpha266_1659 biotin/lipoate A/B protein ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12827"
FT                   /db_xref="GOA:B3QU29"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="UniProtKB/TrEMBL:B3QU29"
FT                   /protein_id="ACF12827.1"
FT                   /translation="MNRTLSNLYVIDSGARSGAYNMQFDSALAQQFFSEKIQRLLQSER
FT                   AAVVRFYAWSPFAITIGYNQNIDEIDVAACQKRGIDVVRRPTGGRAIFHAGELTYSVVM
FT                   NLCGASPSALYKEIHLALEAGLQRLGVSGKFQKSSPNFRQRYQSAEAVPCFTASARNEY
FT                   EVQGKKLIGSAQRRLGEVLLQHGSILLTQEHKALVDFLKEQHPETRAAIRRALEEKTLS
FT                   ISEVLPKTPTYSDLVHAMKRGFEQTWNLPMQPLSVVDFEQAFDFAG"
FT   gene            complement(410302..411096)
FT                   /locus_tag="Ctha_0357"
FT   CDS_pept        complement(410302..411096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0357"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   mth:MTH377 dolichyl-phosphate mannose synthase related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12828"
FT                   /db_xref="GOA:B3QU30"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B3QU30"
FT                   /protein_id="ACF12828.1"
FT                   /translation="MGESIRLMLHSESEPPIKSLKESDAIAESLFAVVPCYNVENTLPF
FT                   FLHRLSEQFPLKQTFFINDGSTDKTADVLKKKFAQVHHHESNCGKGKSLKHGYGKALQA
FT                   GATWVFTIDSDLQHSPSDIPKFLEVASQHDIVIGSRRQAFCWSNPVMPLPRKISNRITS
FT                   GILSKLCDQPILDSQCGFRFIKRDCLERVLPKCRENGFMFETEFLLHAANEGFSISFVD
FT                   IEVVYGTAKSHMRYVIDTLNFIKLAVRFGHKKLLGKSLRKPR"
FT   gene            411474..412580
FT                   /locus_tag="Ctha_0358"
FT   CDS_pept        411474..412580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0358"
FT                   /product="adenosine deaminase"
FT                   /EC_number="3.5.4.4"
FT                   /note="KEGG: sco:SCO4901 adenosine deaminase; TIGRFAM:
FT                   adenosine deaminase; PFAM: adenosine/AMP deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12829"
FT                   /db_xref="GOA:B3QU31"
FT                   /db_xref="InterPro:IPR001365"
FT                   /db_xref="InterPro:IPR006330"
FT                   /db_xref="InterPro:IPR028893"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B3QU31"
FT                   /protein_id="ACF12829.1"
FT                   /translation="MQKILSDEMLNRMPKVLLHDHLDGSVRASTVVELAKSQNYSALPT
FT                   MNADELSDWFHRGANKGSLPEYLSGFVHTCAVMQTPEALERAAYEHVEDCQKDGVCYVE
FT                   VRFAPSLHTANGMHWDEVVNSVLKGFDRGERDFGITARLIICALRHLDSHHSEDMAQLA
FT                   VDFRDKGVVGFDLAGEEGGYPPKKHLSAFHFCQRANFNLTIHAGEGFGKESIWQAIQWC
FT                   GAHRIGHATRLIDDMAVHENEVIKMGSLAQYVLDKRIPLEICLSSNIHTGAAASFETHP
FT                   FKTFYNTKFRVTLNTDNRLMSNTNMTQEYQIARDFYGFTFSDFERISINSMKSAFICYR
FT                   ERCDLIYHVIKPAFAKLRDELAAQEVPR"
FT   gene            412740..414560
FT                   /locus_tag="Ctha_0359"
FT   CDS_pept        412740..414560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0359"
FT                   /product="diguanylate cyclase and serine/threonine protein
FT                   kinase with TPR repeats"
FT                   /note="KEGG: hau:Haur_2390 diguanylate cyclase and
FT                   serine/threonine protein kinase with TPR repeats; TIGRFAM:
FT                   diguanylate cyclase; PFAM: GGDEF domain containing protein;
FT                   TPR repeat-containing protein; Tetratricopeptide TPR_2
FT                   repeat protein; SMART: Tetratricopeptide domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12830"
FT                   /db_xref="GOA:B3QU32"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:B3QU32"
FT                   /protein_id="ACF12830.1"
FT                   /translation="MPNGIQELESKLQQATNDEEKIELLSELAWHLVNINPKRGGELSQ
FT                   EAYLLAQTIGYTYGIAKSLRAQAACLSFLSQYRAALEKAELAVGLFRQLKDTPGLALAK
FT                   IILAECDTKLGLFKEAIEMYTKAYKLYEILGERCSQTTILTSMGKIFQNIGDYEKAVDY
FT                   HLKALSLDPDKDSLNTAGVLSNLADVYFALGKYKTSLDYLTRAIHIYKLQEHLYGITKC
FT                   LGKIGDIYLTLNQLDKAEEFYTKSFGCSYNFQDKEGQASCLISFGKLYIQKCNYEKAEK
FT                   SFRAGYEAAQKISHKHFMAEAKLGLGRVRKMEEKWDEAIEHFNYALTLGKELNLHNIVF
FT                   ESHRYLCLVFEKLEDYKAALEHHKLFYAVKTKIFSEEAERKTKNLLLQHELEEFKREAE
FT                   IYRLKNVELVSANENLEVTTLALKEANAENQLLLERLREQAETLERLVTYDGLTGLANR
FT                   RHFDEQFEYEFRRTRRYKRPLSIAMSDIDFFKKVNDNFSHQVGDEVLKKVASIFRENVR
FT                   AGDLVARYGGEEFVFIFTETNKESAIRAAEKIRKAIEDYDWSNVHAGLKVTISIGVAED
FT                   AGFDGCDELIAAADSKLYEAKRNGRNQVRA"
FT   gene            complement(414557..415699)
FT                   /locus_tag="Ctha_0360"
FT   CDS_pept        complement(414557..415699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0360"
FT                   /product="queuine tRNA-ribosyltransferase"
FT                   /EC_number="2.4.2.29"
FT                   /note="KEGG: cch:Cag_0712 queuine tRNA-ribosyltransferase;
FT                   TIGRFAM: tRNA-guanine transglycosylase, various
FT                   specificities; queuine tRNA-ribosyltransferase; PFAM:
FT                   Queuine/other tRNA-ribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12831"
FT                   /db_xref="GOA:B3QU33"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004803"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/TrEMBL:B3QU33"
FT                   /protein_id="ACF12831.1"
FT                   /translation="MNFTLQGVDSQTAARAGVLETAHGTIETPIYMPVGTRASVKAIEQ
FT                   RELLELDAQIILGNTYHLYLKPGTAILQNAGGLHKFMNWPRPILTDSGGFQVFSLSELR
FT                   EISEEGATFKSHIDGTRHLFSPENVIDTQRLIGSDIMMAFDECPPHDADPDYLRKSHEL
FT                   TLRWAARCQNQFAKTSGVYGYEQSLFAITQGGTNEMLRAESTKRLVEMDFEGYAIGGLA
FT                   VGEPAEEMYRMIEVSHPLLPANKPRYLMGVGTPENILNAIERGVDMFDCVIPTREGRNG
FT                   RIYTRTGILNLRAAKYRDDFRPIDEGFDNYVCKNFSRAYIRHLLNVGEILGLQLCSLHN
FT                   TSFFIWLTKTARAHILKGDFQTWKAEFFARYCHEQESDKR"
FT   gene            415873..417798
FT                   /locus_tag="Ctha_0361"
FT   CDS_pept        415873..417798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0361"
FT                   /product="asparagine synthase (glutamine-hydrolyzing)"
FT                   /EC_number="6.3.5.4"
FT                   /note="KEGG: sco:SCO0386 asparagine synthetase; TIGRFAM:
FT                   asparagine synthase (glutamine-hydrolyzing); PFAM:
FT                   glutamine amidotransferase class-II; asparagine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12832"
FT                   /db_xref="GOA:B3QU34"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR006426"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR033738"
FT                   /db_xref="UniProtKB/TrEMBL:B3QU34"
FT                   /protein_id="ACF12832.1"
FT                   /translation="MCGIAGIITGGNPEILQKMVDIQAHRGPDDAGLQWFESANAGLAQ
FT                   RRLSILDLTNAGHQPMKNARGNRWITFNGEIYNYRELRAELQTKGYQFKSNSDTEVILA
FT                   AYDEWGASAVNRFNGMFAFAIYDTDTRELFLARDHLGIKPLYYAQLGETLLFASEAKAL
FT                   FEYPAMKKEIEPDAVVSAIMLLWVPEPKTGFKNVFKLPAGHYAIFKNGKLSIQEYWDIP
FT                   IPETTPTLTPALEAESTAKLVELLEQTIARQMISDVPVGAFLSGGLDSSLIVALMRKAA
FT                   PGAKLSTYTIAFTEADKKMEAMPDDAMYARRVAKEFGTEHHELCIEPDSNKHLQKILWH
FT                   LDDPVADGAAINTYLISKQAKDNGTTVLLNGMGGDEVFGGYRKHFASLMIERYQKIPTP
FT                   LRKGLIEPTVNAMPVAIGGKGIILTRWAKRFLGSASISPLNAYIYGFNYHKPDGLKQIL
FT                   AEHLFQTDFENLYPVRRYFELAERVKHLPLLQKMTYLDTKLFLTGINLLYSDKAMMAAS
FT                   VEGRPPLIDKEIVEFAAYLPSELKIKGREQKYLLKKAAESYLPNDIIYRPKAPFGTPLR
FT                   AWMKTGLKSQMETLFSNNDFPHNHYLQNAYVLNLLEAHASGKTDNAHALWGAFGVANWI
FT                   NQNEPA"
FT   gene            417842..419023
FT                   /locus_tag="Ctha_0362"
FT   CDS_pept        417842..419023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0362"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pdi:BDI_0041 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12833"
FT                   /db_xref="GOA:B3QU35"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="UniProtKB/TrEMBL:B3QU35"
FT                   /protein_id="ACF12833.1"
FT                   /translation="MATSKESIEKIQNAVLQTEKYILAEQYRGYDPYDALGSPIFDLPV
FT                   LQTNKILRLGAQQVLKRLPINLRPQLHIQKGYNPVTLGLCLYAYSYLAKVFPKKESDYL
FT                   KHITFCINELEKFRSKGYSGACWGYDFDWEARYAKIPAYTPTIVATGFITNALFTAYNL
FT                   HKIQKAVDLCISACDFLKSDLNRTEFEDGSFCWSYSPLDRQVVLNATMKGARLCAQVAC
FT                   ETKDQTLIELAEKTVRFVVKKQRANGSWPYSIGDTRTWADNFHTGYVLDALDSYQIVSG
FT                   DELVQEAKHLGWKYYRNSFFIDDQIPKYYDNQLYPIDATAVAQSILTLVRFGDVETANT
FT                   VALWSIDNLMNSDGSFIYQKHKFYRNSVVYMRWSVAWMFCALSELLYFCYQKG"
FT   gene            419027..420070
FT                   /locus_tag="Ctha_0363"
FT   CDS_pept        419027..420070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0363"
FT                   /product="protein of unknown function DUF354"
FT                   /note="PFAM: protein of unknown function DUF354; KEGG:
FT                   lch:Lcho_1392 protein of unknown function DUF354"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12834"
FT                   /db_xref="InterPro:IPR007152"
FT                   /db_xref="UniProtKB/TrEMBL:B3QU36"
FT                   /protein_id="ACF12834.1"
FT                   /translation="MRIWVDIDNSPHVPFFSPILKELKQRGHEVIVTSRQYAQTRELLE
FT                   NHEIEFLEVGEHAGKSKLKKVLNVIQRANHLKKAVQSFKPEVAVSHGSRAQSIAAWMLG
FT                   IPKLLLFDYEWTEMHIFKRFSTLMACPTALTDDVLQRAGLPIKKIKKYHGFKEELYLPS
FT                   LQPDHHFRSSLEIPDNAIFVVIRPSSMTSNYHDALSEEILTRLLLKVKDIANVMALVVP
FT                   RTEVDRRFTEKIIAEQNIQNVKILKKAVPGLQLLYWADVVVSGGGTMNRESALLGTPTY
FT                   SMFTGARPAIDQVLQQQGTITFIETPQQVDSIEFQKVTRKERYTYEEKGLPEEISNMIE
FT                   QLVKKSF"
FT   gene            420166..421650
FT                   /locus_tag="Ctha_0364"
FT   CDS_pept        420166..421650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0364"
FT                   /product="exopolysaccharide biosynthesis polyprenyl
FT                   glycosylphosphotransferase"
FT                   /EC_number="2.7.8.6"
FT                   /note="KEGG: rrs:RoseRS_3578 undecaprenyl-phosphate
FT                   galactose phosphotransferase; TIGRFAM: exopolysaccharide
FT                   biosynthesis polyprenyl glycosylphosphotransferase; PFAM:
FT                   sugar transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12835"
FT                   /db_xref="GOA:B3QU37"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="InterPro:IPR017475"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B3QU37"
FT                   /protein_id="ACF12835.1"
FT                   /translation="MFKSIPKYKYVLAILDYLLLLISFLIAVQFRFADSSLIEILSWPG
FT                   ALEQLLLVAIYNIAWLTIFQHFHLYKINVFLMVIDHAVPIFKSVGYGIIGLMILSFLLK
FT                   EMPLVESRLIIGYFSISALTLISVVRIGIFRNLFVFLSEKRMIQRKVLIIGAGKSGQMM
FT                   AADLALDTSHGFQVIGFLDDNQPSGSRAFEDLRVLGKIEDVKRVVDENGIEEVLVMIDN
FT                   VSHDKLIHTLDIARQTSAIIKVSSELLDIVPNKVVIEKYLGVPVISVTHNKDSHGLLFI
FT                   KRAFDIVFSLAGLVMLFVPMSIIAIVIKMTSKGPVFFKQNRIGKDGKPFSFYKFRSMYV
FT                   NNDDKIHRDYAKQFITDAKSHTDQKAMSNTVVNSNGQVKKIVNDPRITTIGGILRKTSL
FT                   DELPQLFNVLKGDMSLVGPRPCMPYEWEEYDKWHQRRLSVTPGCTGLWQVSGRSAVDFN
FT                   DMVILDLYYIDNMSPLLDVKLILKTIPVMFFSKGGY"
FT   sig_peptide     420166..420267
FT                   /locus_tag="Ctha_0364"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.907) with cleavage site probability 0.894 at
FT                   residue 34"
FT   gene            421688..422692
FT                   /locus_tag="Ctha_0365"
FT   CDS_pept        421688..422692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0365"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: Semialdehyde dehydrogenase NAD - binding;
FT                   oxidoreductase domain protein; Oxidoreductase domain; KEGG:
FT                   cau:Caur_1630 oxidoreductase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12836"
FT                   /db_xref="GOA:B3QU38"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B3QU38"
FT                   /protein_id="ACF12836.1"
FT                   /translation="MKIAVIGLGYWGPNLVRNFLAVEQVDGVIGCDKDESRLHKLKKRF
FT                   PEVELCSSLDEVLTRDDVAAVAIATPVSTHYPLAKKALEAGKHCFVEKPFTTTVAEAED
FT                   LINTAEKKGLKIMVDHTFIYTGAVRKIKEVVDKQMLGDLYYFDSVRVNLGLFQHDVNVV
FT                   WDLAPHDLSIMDYVLGKKPTSVSAIGSDHTGSGLENMAYLTVGFNNGLMAHFHVNWLAP
FT                   VKIRKTLIGGSKSMIVYDDMEASEKIKIYDKGIEVKTREGVYETLVQYRTGDMLAPKLD
FT                   QTEALAIETNHFVDCMLNNKTPLTDGISGLNVVRILEASEKSIKNSGSIVKLS"
FT   gene            422708..423463
FT                   /locus_tag="Ctha_0366"
FT   CDS_pept        422708..423463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0366"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sus:Acid_2343 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12837"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:B3QU39"
FT                   /protein_id="ACF12837.1"
FT                   /translation="MSISKKATIGKNVQIGYNSIIHDNVIIEDDVVIGDLCAIGIPAKT
FT                   AKTPLHIGKNSVIRSHGALYEGSNFSGGIQTGHHVLIRENTIAGKAFRIGSFSDVEGDC
FT                   LIGDHTSFHSYVHVGKGSKIGNYVWLYSLVTLTNDPLPPSHIERPVTIEDGAVVCVGSV
FT                   LLPGAILKKGAFVAAGSLVSGEIGEGKVVSANGDISGNVTSLIDFQTMTRHPWMRHFAD
FT                   RYPESSQEEIQTLFSDIQSSIKSNKKKRG"
FT   gene            423456..423725
FT                   /locus_tag="Ctha_0367"
FT   CDS_pept        423456..423725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0367"
FT                   /product="acyl carrier protein"
FT                   /note="KEGG: sen:SACE_4132 acyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12838"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:B3QU40"
FT                   /protein_id="ACF12838.1"
FT                   /translation="MDRPTILSNIKQILERQGKAVEQLQEDSQLRDISFRSLDFSELCL
FT                   RVEEEIGRELNFDAVVLRGIHTVKDVCNFIEKSISLTNRESTTQ"
FT   gene            423706..424983
FT                   /locus_tag="Ctha_0368"
FT   CDS_pept        423706..424983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0368"
FT                   /product="AMP-binding domain protein"
FT                   /note="KEGG: hne:HNE_2075 AMP-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12839"
FT                   /db_xref="GOA:B3QU41"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B3QU41"
FT                   /protein_id="ACF12839.1"
FT                   /translation="MNLQPNNRFIVDSQVFSPSTLGGNTKALLQRHQLHGKRVAIISDD
FT                   IHALLDAIICFYQEKADGLVLFRENIEDALKSVITAQGYTILFLGKNQQELVQPAQASS
FT                   CEARPGYISILTSGTTGTPKLIPHTWDSLFTLKHNTGVQALSWLFPYTPGTYAWYQMVT
FT                   LWMFVENQTIVSAAEVLPELLWDVGVQNQVNAVSATPTFWRYLLLQKGTDELSALSMKQ
FT                   LTLGGEPIDRVILNQLKEIYPAAKLTHIYASSEAGASIVVNDGQAGFPSSWLDESDTKN
FT                   KSIKIVDNKLFIKSPHRSVAVADWLDTGDVVEIKDERVFIVGREGSEYINVGGQKVYSK
FT                   LVQDVLLQHPKVAWCRVYGRKAPIVGEMVCAEIVMKKQVAGEPIGDLEKELTAHCNRHA
FT                   LSANMIPRLWRFLEKIPVGKNFKSKV"
FT   gene            424986..425717
FT                   /locus_tag="Ctha_0369"
FT   CDS_pept        424986..425717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0369"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: sdn:Sden_3106 short-chain
FT                   dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12840"
FT                   /db_xref="GOA:B3QU42"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B3QU42"
FT                   /protein_id="ACF12840.1"
FT                   /translation="MSELQSVIVSGGSRGLGLSFVKQCLEKGVKVATCARKLTNEINDL
FT                   QQRYPDRLFFQEVDITDSNAQKKFVNSVASAFGEISALVNNAAVGQDHLLTHLPEEKIH
FT                   QIITTNLTSQILMTKLVVKKMLLGGNKGRIINISSICGVRGYPGLSVYSATKGAMDAFT
FT                   RSLARELGNRGILVNSIAPGFFSSEMSQVLTEEQMQIIKRRTATEELTTPEQILPVLEM
FT                   LLFTDNNISGQVLYVDGGAGI"
FT   gene            425692..426159
FT                   /locus_tag="Ctha_0370"
FT   CDS_pept        425692..426159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12841"
FT                   /db_xref="UniProtKB/TrEMBL:B3QU43"
FT                   /protein_id="ACF12841.1"
FT                   /translation="MLTAAPASDFHRIQAPKTWGYCTICNSPEAFPVLLAPRAYDNSGR
FT                   TLYWTDESLAFKRACDFENHETDVSWMASRYHLTDDVFLKSWVCTEVAAKLFDLPILVF
FT                   LKKNGLFKLNQDYTSFTCIHEGKDVRAEIVYINSTAKQAHIALGRFFRERQ"
FT   gene            complement(426164..427249)
FT                   /locus_tag="Ctha_0371"
FT   CDS_pept        complement(426164..427249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0371"
FT                   /product="TPR repeat-containing protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: mar:MAE_03610
FT                   tetratricopeptide repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12842"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:B3QU44"
FT                   /protein_id="ACF12842.1"
FT                   /translation="MKEWMLANMKTAKFWQKKEGKVQLILILFFAVNIFASSQLFAQAG
FT                   YKEYKKAQEFVSTGDLEKALQSLNGAIKKNPSYAEAYNFRGIVKKSLGRTQESIADFSQ
FT                   ALKYSPNSTTIYNNRGISLYLVGRYQEALEDFNESLAIDNLNAEIWANRARTLTALGLT
FT                   KDAIDSYNNAIGKEAYDPELYKLRGDLYAKLGFYGDALADFEKALELRDSYALCYLSRA
FT                   DVYRRLGLYAEAIEDVNVAIKLIPSNPEGYYYRGLILISRGGYPQAIRNFDYALSQDPN
FT                   YHLAYHARGVAHDSLAQYQMSISDYTKAIELRANAWESYFNRGLAYIHLNELVKAKKDI
FT                   KTALDLNPTSVEAREVLGKIQ"
FT   sig_peptide     complement(427121..427249)
FT                   /locus_tag="Ctha_0371"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.980 at
FT                   residue 43"
FT   gene            complement(427371..430559)
FT                   /locus_tag="Ctha_0372"
FT   CDS_pept        complement(427371..430559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0372"
FT                   /product="peptidase S41"
FT                   /note="PFAM: peptidase S41; WD40 domain protein beta
FT                   Propeller; KEGG: rrs:RoseRS_1092 peptidase S41"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12843"
FT                   /db_xref="GOA:B3QU45"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR012393"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR028204"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR029414"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:B3QU45"
FT                   /protein_id="ACF12843.1"
FT                   /translation="MQSQHQVQGYYRHPSVFENAIVFVSEDDLWTVEASGGVARRLTAG
FT                   LAECAFPSVSPDGKFIAFVSSEEGQPDVYLMPILGGQPKRLTYLGATGTRVIGWHDGKI
FT                   IFSTNAKQPFLNIQAVYALSPEGGEPEPFAFGTATYLSFGAENQIVLGRNSADAARWKR
FT                   YRGGTAGEIWWARSANEPFENFSKKLGLKGNFNSPIWIQENGAARIYFVSDHDGVANLY
FT                   SALPDATDLKRHTHHTDFYVRYPQKDASGKNRIVYHAGADIFLYDIESGESAKVEIDFC
FT                   SPRTQRNRKFVGAGAYLEHFSLHPNSSIFALNARGKAFSLPLKSGPVLQYAERQGVRYR
FT                   LATFLHDGEHVAMTSDAADDQEILEIYNGDNVQVHSFEHFDIGIARFLQPNPKNKLLAV
FT                   GNNRNELKLIDIDNETAVLIEQNSFGAIGEADWSPCGRYLAYSSPISMEQTEIKIYDTK
FT                   TGKTHPVTEPVLRDYCPAFSVDGKYLYFLSDRIFDPVYDNLLFDLNFPRGTKPYLLTLQ
FT                   KDLTSPFFEEPASRAKEEPEEKSDSETPEIDFENIAQRVLEIPVPEGRYVQLAAADGML
FT                   LLGERPIMGALSAPKSDDAATGIFHAFKFSDKKLEKITDKLSHFEISQDRKMVMYRSGK
FT                   RLCYGSLEELLQPGKTHDAVELKRVKISIEPPQEWRQMLKEAWRLQKEHYWTPDMAGLD
FT                   WQEVFDRYEPLLNRVGSRAEFSDLTWEMQGELGTSHCYEYGGDYRPKPPYHQGLLGADI
FT                   SYSTEKKAFEVTGLPKGDFWKEGEASPLHTPGVNVQVGDLILEVNGQSLSKNQSFGELL
FT                   VSMAGQEITLTVANAKKENMRRVRIKPIASEQKLRYRDWVEKNRALVKSASDGKIGYVH
FT                   IPNMGPLGYAEFFRGYLKALRHPGLIIDVRFNGGGHVSQLLLEKLAQRRIGYDIQRWAK
FT                   IPEPYPAYAPFGAVVALTNEFAGSDGDIFSHAFKLMKIGPLLGKRTWGGVIGINPRHSL
FT                   SDGTVTTQPEYSFWFEDVGWNVENYGTDPDIEVEFAPHDYAANLDPQLTRAIEETLSLI
FT                   ETRKPAIPDFSKNR"
FT   gene            complement(430603..431175)
FT                   /locus_tag="Ctha_0373"
FT   CDS_pept        complement(430603..431175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0373"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="PFAM: metal-dependent phosphohydrolase HD sub
FT                   domain; KEGG: sat:SYN_03611 GTP pyrophosphokinase /
FT                   guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12844"
FT                   /db_xref="GOA:B3QU46"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="UniProtKB/TrEMBL:B3QU46"
FT                   /protein_id="ACF12844.1"
FT                   /translation="MLFEAVEFATLAHKGQFRKGSKVPYILHPLGVAKILIDKNCAQPL
FT                   IIAGILHDTVEDTPVTLAGIEAEFGEVVARLVAGVTEPEKSYSWEYRKNHMLTELERAP
FT                   IDVLAVSCADKIDNLHSLSQDYEKHGEAVWEKFSRPRESQKWYHESLMRIFEKRLSDTP
FT                   YTPLFNEVQQLVQQVFTADMDAAVFKP"
FT   gene            complement(431177..432697)
FT                   /locus_tag="Ctha_0374"
FT   CDS_pept        complement(431177..432697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0374"
FT                   /product="Lytic transglycosylase catalytic"
FT                   /note="PFAM: extracellular solute-binding protein family 3;
FT                   Lytic transglycosylase catalytic; KEGG: plt:Plut_1004
FT                   extracellular solute-binding protein, family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12845"
FT                   /db_xref="GOA:B3QU47"
FT                   /db_xref="InterPro:IPR000189"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:B3QU47"
FT                   /protein_id="ACF12845.1"
FT                   /translation="MRSNFPRYLIVGFTIFSLACSNEKITEDTQSSKEDHENQPSVHID
FT                   LPQIKKRKKLIAITSYCATCYFIYRGKPMGFEYELLERLAKHLDVDLEIVVAENLNDVV
FT                   KMLNEGKGDIIAYGMTITQARQKKLAFTEHYTTTRQVLVQRKPNNWRRMKHHQIEKSLI
FT                   RNQIDLIGKSVHVRRNSSYYARLKTLSNELGGDINIVEVPGYLETEELIQMVAEGKIDY
FT                   TVADQNIAFINKTYYPDLDVETPISFPQKIAWAVRKNSPELLAAVDDWILETKRTTDYH
FT                   VIYNKYFKNRKAYKRRIESPFYSKTGEKISQYDALIKKSAKELGWDWLLLASMIYQESR
FT                   FDPNATSWVGAKGLMQVVPETAEPYGVTNLYDPKQNILAGTKYLIYLMDFWKTIPDSLE
FT                   RIKFVMASYNVGAGHILDAQRLAEKYGSDPNVWTDHVEKYILLKSEKKYYYDEAVRNGY
FT                   CRGAEPYNYVREIWSRYSHYRQVLEISALRNASKKELISKLNFSFNAK"
FT   gene            complement(432971..435043)
FT                   /locus_tag="Ctha_0375"
FT   CDS_pept        complement(432971..435043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0375"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sde:Sde_3807 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12846"
FT                   /db_xref="InterPro:IPR025193"
FT                   /db_xref="InterPro:IPR031025"
FT                   /db_xref="InterPro:IPR032295"
FT                   /db_xref="UniProtKB/TrEMBL:B3QU48"
FT                   /protein_id="ACF12846.1"
FT                   /translation="MPHRKRYSNKFYQGLATFWLALALLFSSFGCDDEDSSTSTPLLAS
FT                   STEDLEIPSSFDFVTTKEISIALELQAPDGSALKTVKVGFYNDKEDNDGILIASGLTDE
FT                   NGKISLILNVPSYLDSISIRPNYIGLVHEAYVSIEQSSLSLTIGGPNESTFGSSEAFVF
FT                   DAVKQAARVLAETWYTTLGTWNHQGVPNYLESPGDVITQDLLDDLNASLPESQPVPTAN
FT                   PEYLVDSDMNTKLKEDADLWITFVHEGAGWRNALGFYTYDIDNPPSSPDEIDVLYMIFP
FT                   NVSYKNSGGGLQSGNKVKLGTFSAGIGIGWFLVPDGWNSSTREVTEKSQIKWSVKDFNA
FT                   YVASDYRQHMIALKDENRELILLGFEDTSRPAGDNDFNDCIFYVSANPFTAIQTDELIS
FT                   VKTEKDADEDGVDDYSDEYPNDPDRAYNQYAPAKNVYGTVAFEDLWPAKGDYDFNDIVV
FT                   DYNHQLVMNASNQVVEMSSSFKTRAIGGTYKNGFGYELQVDPSKIEQVSGYELTENIIS
FT                   TNANGTEAEQTNAVIIVYDNAYAHMTPSSGYYTVNAEKGSPYQTPYTSDIFVTFTEPLA
FT                   ASELGSSPYNPFIISNKRRGYEIHLPGSTPTDLCADSLFSTQDDDTNPANDYYFKTQKG
FT                   HPWAVHIPEAFDYPSEKSDIVKAYLYFANWAESGGNAYPDWYQDKTGYRDDDYIY"
FT   sig_peptide     complement(434951..435043)
FT                   /locus_tag="Ctha_0375"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.995 at
FT                   residue 31"
FT   gene            complement(435212..436393)
FT                   /locus_tag="Ctha_0376"
FT   CDS_pept        complement(435212..436393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0376"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   pdi:BDI_1297 glycosyltransferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12847"
FT                   /db_xref="GOA:B3QU49"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B3QU49"
FT                   /protein_id="ACF12847.1"
FT                   /translation="MTAIEILFWASAFLVVYAYVGYGAVLFVLVKLKRIFFGKNELDES
FT                   EVFEPEVALVIPAYNEKDYVGEKVANSFALDYPKEKLKIIFVTDGSDDGTPDALRKYDG
FT                   IAVLHEPERRGKIAAINRIMPTIQAPITIFTDANAMLSPQTVRMIVRHYRDAKVGAVAG
FT                   EKRIRRQAEERASGAGEGIYWKYESLLKKWDSDLHSVVGAAGELFSIRTELYAPVEKNA
FT                   ILDDFMISLRIAKNGYKVAYEPEAYAEELPSENVKEELKRKVRICAGGIQSIVWLKELL
FT                   NPFKYGILSFQYVSHRVLRWTLAPLALVLLIPLNLQLMLEFGGLYAVIFALQLLFYLMA
FT                   VPGWILEQRHLRVKLFFVPYYFFIMNLAVFLGFFRYLKGRQSVLWERSVRAKA"
FT   gene            complement(436399..437361)
FT                   /locus_tag="Ctha_0377"
FT   CDS_pept        complement(436399..437361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0377"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   rca:Rcas_1348 glycosyl transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12848"
FT                   /db_xref="GOA:B3QU50"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B3QU50"
FT                   /protein_id="ACF12848.1"
FT                   /translation="MKVSIIVVNYRVPKLLRACLQSIREQVKAECEVIVTDNASGDGSV
FT                   EMVREEFPWVHLIANPTNDGFAAGNNIALPHATGEYVFYLNPDAEVIADAVDALVTYLD
FT                   THPDVGLVAPRLINTDDSLQKSVHRFYSFWDTLIDNRLFPYLFKNSKRLKSYNYAFWPH
FT                   DEEREIDWAKGAALMVRKSILDELGAFDEQFWIYGEEIDLCYRIKKAGWKIVFFPNAVI
FT                   RHHEKQSSRQHSTVMFIQNYKSLYLFIRKHYSRLDFELYRARAVLSILIWLFTFWIKKM
FT                   SGKKGAAEEFGKYAALFKWHLKLKENLHKPLLINQSAKS"
FT   gene            438466..438909
FT                   /locus_tag="Ctha_0378"
FT   CDS_pept        438466..438909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0378"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cph:Cpha266_0789 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12849"
FT                   /db_xref="GOA:B3QU51"
FT                   /db_xref="UniProtKB/TrEMBL:B3QU51"
FT                   /protein_id="ACF12849.1"
FT                   /translation="MNEPLRTRLPNNVELKLKEKYAESFAGQSDLMDKLAQQLLTLELA
FT                   IPGLYATVLKLVAGDKATVPVNRMFYLIFSLWLLALLLTLWALLPRAWKVNTEIMQKDP
FT                   RSKSDELGIKDFFVKSAEFKRNCLVAAAILFFLGIALAALTVT"
FT   gene            438929..439177
FT                   /locus_tag="Ctha_0379"
FT   CDS_pept        438929..439177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0379"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cch:Cag_1503 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12850"
FT                   /db_xref="UniProtKB/TrEMBL:B3QU52"
FT                   /protein_id="ACF12850.1"
FT                   /translation="MQKRLEFRCWNCDKPYSLFRKIDEDNPQLWVACPFCHKEAIVDLD
FT                   PYRKPVDKIYRGKSSSNDNSGETEFDLPDILPTRPKS"
FT   gene            439206..442733
FT                   /locus_tag="Ctha_0380"
FT   CDS_pept        439206..442733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0380"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: cph:Cpha266_0788
FT                   tetratricopeptide TPR_2 repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12851"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR024983"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3QU53"
FT                   /protein_id="ACF12851.1"
FT                   /translation="MPSNVCPVPFIIEPPDDLLSKYPEIKRNGNTLAMNYAFNRLVEEK
FT                   DLKIVGEQLWQALDLNEAFAAACAAAGRQILPLVVRSAQPALLQLPWETLYHPEHGFLG
FT                   LHPAFTLSRNFGRPAPDGEHSPPTAGPLRILLFTSLPDNVDQENSRLDVEREQAEVQAA
FT                   LMPWILDGTAKLEMPDDGRLETLKEYLKKFDPHLLFLSGHGKFFGDPHQDKHYAEFVFE
FT                   DEYGRAEGVHEKELAEAFVGSNVRAVVLSACESGMSASDALNVGLANRLSRFVPHVIGM
FT                   RESILDEAGIQFARAVADAVATGERLDVALQTARKMITKPLKGRAIFRREGEATDLSEL
FT                   SFGQWCLPMLLTADPALPLLDDWNFVRQAPTARPAAESLQGIVLPPEFSGRRSELRTLK
FT                   SRLLSGKLRRLLITGPGGQGKTALAGKLARDMQAAGFAVLAWAARPENDWDEFLFDLEL
FT                   SLNEYDAKKYDRVKARYKDDLVKQAHYLLGFLLNRHKGKLLLFFDNLESVQDPESLTLT
FT                   DANFSAWIEAAQSLGEKGLTLLLTSRWKLPEWSEAEHHALRHPLYGDFLRMVRNEKLPP
FT                   EFSKERYRLWRLYDTLHGNGRGLTFFASAVRGMTAVEEEAFLNKLAEVSAESQTDMALD
FT                   TVISHLPAEARTLLERLPAYRTPAPKEGVFVLAPDLPEPAALLSRLTDVSLVEYYDEPT
FT                   WQCREYQVHPRVTDWLEKNAPQLNIRWLKVAARYRRYLFDWERPTLNQAFIVHAALQRA
FT                   EQTDEADRFALDYIVGKLNLAGLYRTLLSDWLPPICQSEDNFTRAEALGQTGKQNLHIG
FT                   DYDTALKYLQQSLQIRQDIGDKQGEGTTLNNISLIYQARGDYETALKYLQQSLQIRQDI
FT                   GNKEGEGTTLNNISLIYDARGDYETALKYLEQSLQICQDIGDKKGEGATLNNLATTSYA
FT                   RGDYDTALKYLQQSLQIKSEPAGEASVSALKYLQQSLQIQQDIGDKQGEGKTLNNISQI
FT                   YDARGDYDTALKYLQQSLQISQDIGDKQGEGATLNNLATTSYARGDYDTALKYLQQSLQ
FT                   ICQDIGDKQVEGTTLNNISQIYQARGDYDTSLKYLQQSLQISQDIGDASGVCNSLFNMG
FT                   HIHWQNGEQQEAVSAWVTVYKLAKKINLAEALNALAGLAEQLGLTGGLQAWEELAKKMD
FT                   EGASGENGD"
FT   gene            complement(443137..443754)
FT                   /locus_tag="Ctha_0381"
FT   CDS_pept        complement(443137..443754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0381"
FT                   /product="putative acetyl transferase"
FT                   /note="KEGG: bth:BT_0521 putative acetyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12852"
FT                   /db_xref="GOA:B3QU54"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="UniProtKB/TrEMBL:B3QU54"
FT                   /protein_id="ACF12852.1"
FT                   /translation="MSGLKSLLDGKPWLKNTVHRLLIPKGQARPRWTTRVFINPWVHRR
FT                   GRGAKVAGSARLDLFPFNRFELGAGSTVEDFVTLNNGVGDLCIGDNTRIGISNVLIAPV
FT                   RIGNNCILAQNIVISGLNHGYENPDLPIKDQPVSKKEIVIEDDCWIGANVSIAAGVTVG
FT                   KHAVVGAGSVVTKSVPPFHIAVGNPAKVIKKYDFAEKKWVKV"
FT   gene            complement(443751..445022)
FT                   /locus_tag="Ctha_0382"
FT   CDS_pept        complement(443751..445022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0382"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   hmo:HM1_1182 glycosyl transferase, group 1 family protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12853"
FT                   /db_xref="GOA:B3QU55"
FT                   /db_xref="UniProtKB/TrEMBL:B3QU55"
FT                   /protein_id="ACF12853.1"
FT                   /translation="MNTAKLPVVMQALPRWDGKYASTSLNLAKELSKERRVFYCDHPFT
FT                   YKDLFTGKTRQDIRFRKPIWAGKSSPVYQPFADFPNLSVVSPAPTLVINFLPKSVLYDL
FT                   AENFVNRHIWKTLNRVLSAQGISKFIYINSFDPCFSRIYTPFEVALKVYHSVDNIAGER
FT                   YIARHGVRREQEFAKIADLTISTSLALTEKLRALNPKSHFVPNAADYALFSRPCAGEPK
FT                   AFEKIPKPRVLYMGNIGLRIDYDALEDLAKNHPEWQLVFVGPKDPREFRGQALEALPNV
FT                   WFLGAKPYAELPDYAHAADVCLIPFIPNDLTKFIYPLKINEYLGTGKPVVTSRFADLTE
FT                   FETTVQIYESPEMLYDAIMQAVKENSPEKEAARKKVASANTWEERGKRFDKILEDGLRE
FT                   RSQIEKSQLKKDAHGQKNSERKKI"
FT   gene            complement(445019..445930)
FT                   /locus_tag="Ctha_0383"
FT   CDS_pept        complement(445019..445930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0383"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   mma:MM_2102 glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12854"
FT                   /db_xref="GOA:B3QU56"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B3QU56"
FT                   /protein_id="ACF12854.1"
FT                   /translation="MTQPKISLIVPTYNRKALLAELLETVYRQALPESDYEVVVVSDGS
FT                   SDGTDELMAGMTAAHPNLRYVRQQNQGPAAARNNGAKLARADIIAFTDDDCHVSPTWLK
FT                   EILEIFGKKNIVGIQGRTTTVREERTPLTHQIENETGHPALPTCNAAFRKSAFESIGGF
FT                   DCSFPFAHNEDADLAWRMKKLGEISFEPSVHVIHPPRQDTFKKLAGRMKILQSEFLLYH
FT                   KDPAAYQKYRTSSPWKTIYWEVFFVHQLRNLKSTLKYLFRPKYFFIGLALNFAWWFSLV
FT                   KLFPKFLAANRLYEQKYRGGAR"
FT   gene            complement(445927..447243)
FT                   /locus_tag="Ctha_0384"
FT   CDS_pept        complement(445927..447243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0384"
FT                   /product="polysaccharide biosynthesis protein"
FT                   /note="PFAM: polysaccharide biosynthesis protein; KEGG:
FT                   ava:Ava_0839 polysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12855"
FT                   /db_xref="GOA:B3QU57"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:B3QU57"
FT                   /protein_id="ACF12855.1"
FT                   /translation="MLNYRKIAWTLINNSLEILIGLGSIVLVTRLYTPEDVGAWSVFTA
FT                   LFFFVTKIREGIVQTALVKYSAGIDGESYWTVLKSSFWINLAIEVAICMTISTSGALGF
FT                   FPLLSALLMIYPVYSVGWSIYRWMLFVFQSRLEVELIFRMNLIIVSVLGVGFGLLVRQA
FT                   WPLWAMVLVLGSASGLAAVYGTWRLGIKNLLQAKAQRQMVKDLLAFGKYGLLREIAGTL
FT                   STRINVFLTAGLLTFAEAGLLGVAQRFTQLVLIPNAAIQTLIFPKACELNNQAKNRDLK
FT                   TLYETSVAMLLGMFLPMVAVIALFAEQIILLFNGSAYLAAAPLLTVMVITVALYSPFGN
FT                   AFGSVINAISKPEINVMVVTVNSVINIALSVTLISTVGLYGAVIAPFLTETFGFFWIGI
FT                   LLKKELDISFLRCFLLIPKSYQNLYVAVRQKLSPGRTGT"
FT   gene            complement(447570..448625)
FT                   /locus_tag="Ctha_0385"
FT   CDS_pept        complement(447570..448625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0385"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   mma:MM_0650 mannosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12856"
FT                   /db_xref="GOA:B3QU58"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:B3QU58"
FT                   /protein_id="ACF12856.1"
FT                   /translation="MKLTLTSCLTQNCGIGRYTHELASYFHQSGLEVTLYRKDGGAEPY
FT                   IKGYPYRSFKNLRYYVAPYYLSKALESVESDIWHADYVDAGWALALAKKSRQPVIVTAH
FT                   DAIPFIYAKPLDRWVYQYELKKTTEIADAIIVVSQKSKDDLIRHAQIPEEKIHVVHNGI
FT                   NHDFFYPEPNRKENSVFTIRYIGGLAKHKNVESLIYTALLLERKNITCKIQIGGGFHQQ
FT                   TTLPKLVRELKVQNVEFKGFISNDKLRAFLASADVFLYPSLYEGFGFPPLEAMACGTAT
FT                   VSSNRGSLPEVLQNGAICCEPTPENFANAIESLYRHPSKLHALRERGLKTAAEYTWEKT
FT                   AKQTLGIYGRL"
FT   gene            complement(448630..449724)
FT                   /locus_tag="Ctha_0386"
FT   CDS_pept        complement(448630..449724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0386"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   mba:Mbar_A0239 mannosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12857"
FT                   /db_xref="GOA:B3QU59"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:B3QU59"
FT                   /protein_id="ACF12857.1"
FT                   /translation="MNIVMVSCQHFTSGIGNYAYELAKHVRAENPELSLFKVYKPGHAD
FT                   SSFHEQAWIHPIPYKSFRDLHPYILPLFIRKALGNTKADIYHAHWFLSGLALGYALGRP
FT                   AVVTMHDVSLLHIKEASATYEAYYKWALERFQKKRFTLVMVSETAKQDAVKYAGYPENL
FT                   IEVVPNGINQQRFYPLPTEAEDAKKAHFRIIYSGGLGKRKNLELLFNAYKLISQKHSDV
FT                   ELVIAGAYPERTAYPQIARDMALKNVRFTGYLPDEEMNAFYNSGDLLIYTSLYEGFGFA
FT                   PLEAMAAGVPVITTSGGSLKEISGGGGICTDYDEHQISEAANELIASEAKRRTLIEKGR
FT                   NWVQQYTWEKAAEKTLSIFKNKLS"
FT   gene            complement(449721..451229)
FT                   /locus_tag="Ctha_0387"
FT   CDS_pept        complement(449721..451229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0387"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pdi:BDI_1279 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12858"
FT                   /db_xref="GOA:B3QU60"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="UniProtKB/TrEMBL:B3QU60"
FT                   /protein_id="ACF12858.1"
FT                   /translation="MKNENLESSAIGKSPKSKLNEYLASELVLRRFDSPLGWAILTAVT
FT                   LGISVGIAKFGLILAVLIIAGAVGAPILFSTMVSIRLGVYLAITISCMLGTILMALPNV
FT                   KIGLLQDALVLFMMIGYLYKCYTQKQWEGFKTQLNVPIIIWIVYNILEIANPIAASRTA
FT                   WFFVMRPAVGYILVFFLTYRMLETKQDVKNILHLIVILCFVSATWGLVQFFNGYFPFEM
FT                   SFVVANDAVHLVYINGRWRSFGTMASPAQYGVVMAGMLILIPLLTRGKHSWLKKWFYRV
FT                   ATLFVLLAMVYSGTRSAIAILPVSILALVVLAKNWRLYLAGAVMGVIFMGIINMPTNNY
FT                   HIQRLQSTFSGKKDESYMVRKRNREMIFPWILAHPIGGGLGSTGVWGQKFSPGTFLANF
FT                   PPDSGFVRVAVELGWIGFIFYIFLWLNILIKGTLQYWKLQDEELKVIVLAILCMLAGVF
FT                   VVEYAQDIIGKTPFNLLFWVFCAILFKAIKLDEHVEEIAKGEIA"
FT   gene            complement(451210..452472)
FT                   /locus_tag="Ctha_0388"
FT   CDS_pept        complement(451210..452472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0388"
FT                   /product="Glycosyltransferase-like protein"
FT                   /note="probably involved in cell wall biogenesis; KEGG:
FT                   bth:BT_1167 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12859"
FT                   /db_xref="GOA:B3QU61"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B3QU61"
FT                   /protein_id="ACF12859.1"
FT                   /translation="MTWAIYFGTSLLMVIVAYFFFYSFYWMATILFGVLYKPPKFDSKS
FT                   SSEVKDILVLLPAYKPNRFFLTVLESLTKSIEGQSHIKPIILLQEASPDLSLAVKQFDF
FT                   YTLEKAFSHLSGNPYHHALKFLSAHIAAQTERGIWSPSHVVILDKDNLVDGDFFHELEA
FT                   GFKSGYDLVQGQRLPLAAQNATQSFDATSEALNDVMFRAAKSKLGMMLEISGSGFGVRY
FT                   DIFADAVAGLDGVAPGMDKNLMVGLLKHNLKSVYNPRAKVFEEKTESEAAIKKQRTRWL
FT                   GVQYYIAMRYGWQLILFGLKTGRLSPIDYAISLYRPPRSLQLFVVPILAVAESIILAIY
FT                   GKLPYSIPGMLLSLGMLFIAFVLFISHTNGWKNLSAMMFKLPKFALNNLFSMLEGVKSK
FT                   NRGKFLHTEHQANGANEKRKS"
FT   gene            complement(452469..454724)
FT                   /locus_tag="Ctha_0389"
FT   CDS_pept        complement(452469..454724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0389"
FT                   /product="Uncharacterized protein involved in
FT                   exopolysaccharide biosynthesis-like protein"
FT                   /note="KEGG: pdi:BDI_1278 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12860"
FT                   /db_xref="GOA:B3QU62"
FT                   /db_xref="UniProtKB/TrEMBL:B3QU62"
FT                   /protein_id="ACF12860.1"
FT                   /translation="MEQFFSIIRAVLHRWKLWTALPILAMAVVFFLTRSQPKTYVSEAT
FT                   LNINFQSSKGLSLTDDVLQQYEINEYFENLIQLTRSRKNIELVRLQLLKEFYLKKHNHL
FT                   KFDENDAAVLDTSQIMPIINRLIKEKEMLNLLDKTHAEINFFLKKNNLSHDYINANLGM
FT                   ARIGKSNYISVVYEADTPFKAAYINGLIIETMKQLYQSISKHRTDYDRDMFEKLVVSSK
FT                   DELDKKIKRLEQYKIKNNVINLPEHTKAIVNQIVNMEIQLSHLKEVRASRQKAVERIKE
FT                   DYETELPMPVNLEANQKIVDLKRKLSAANSTLIANKFKPNPSIDIQKQEKEVQEIKDQV
FT                   SHEIVKLVKDVPYDPKQTKQEMVYRLIGYQLDVEIAEESIPVVQNEISRILEYARSFAP
FT                   LESTIGGMENEIYVAQQGYLILLNKLNLAKTVAEGKGSAEIYTVDFPSIPIKPKPGKRG
FT                   VLVVASGVVIFLLIVVVLVLIEILDASISTVDRFEKVSMFGVVAAIPDMQSECVKNGSL
FT                   SQAEAFHILQQQLKALRQEILKIEPENRIVLWLSGHRMDGKVWFTSQVMESLQKINQKV
FT                   LLIYGDPHDNSVPDASMPILGTQPFAILGHEKSGILDLTESQLSPLEIMDSANWQQFFQ
FT                   EIRAKYDYIFIVPPALEKSADWKEWAMFAKSAFYLFRAHKIFQSIDARSMQMIADSSLQ
FT                   VAGAVLSKIDIEKMENYIGSVSKRRSKLRLIAKHLINRDFMKIKDELKFNRKKKVKT"
FT   gene            complement(454735..455451)
FT                   /locus_tag="Ctha_0390"
FT   CDS_pept        complement(454735..455451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0390"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mar:MAE_14730 outer membrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12861"
FT                   /db_xref="GOA:B3QU63"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:B3QU63"
FT                   /protein_id="ACF12861.1"
FT                   /translation="MFKILIVWLTIALLEVPSVLFAQSQTLKTELDSTDKKIIDSLVIQ
FT                   VFRHSYDIEALREEHIQEKERIIQEKMSWLGSFRFGIQFLNYENSSEANQSAQVNFVPA
FT                   FGLTLNLDLEGLFTLPSRVRLAEAGARRVEDEIMKRKRTLRIWVEEKYQQYTQMLSAMQ
FT                   LKQEILASQEEQARLALERFQRGEGQIEGYIDAMNAVSQTREAILELRFSSEQIYREIS
FT                   IVSGQFEDLNNLMFRE"
FT   sig_peptide     complement(455383..455451)
FT                   /locus_tag="Ctha_0390"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.952) with cleavage site probability 0.907 at
FT                   residue 23"
FT   gene            complement(455707..456921)
FT                   /locus_tag="Ctha_0391"
FT   CDS_pept        complement(455707..456921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0391"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: sugar transferase; SMART: response regulator
FT                   receiver; KEGG: bth:BT_0523 putative glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12862"
FT                   /db_xref="GOA:B3QU64"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B3QU64"
FT                   /protein_id="ACF12862.1"
FT                   /translation="MGTDKKIRHILCIDPDKDACNSLQAGFENNHQGRFLVTAFCSCHE
FT                   VFKWLQAGNIPDAIISEYTLTDMNKLQFLHLLKSSGSLKKSLFLFTSTVELSKPERIAL
FT                   LKEGVDDFFVKPIEIDALAYRLSYLFQIKNFKQSEEKQVFKSYKIPILKRAFDIFSSAM
FT                   ALILLSPVLFIVGLIIKLESKGPVLYKSKRVGMGYQIFDLYKFRSMAAGADKNIEKLKH
FT                   LNMYQNQEAVLQKVGVHDGFHQAVEDEAILAPIANAKDVFIADNVIYTQSEYANLQKSK
FT                   QSGIFMKFKDDPRVTKFGRFIRNTSIDELPQLINVLIGDISIVGNRPLPLYEAEKLTTD
FT                   AWTERFMAPAGITGLWQVTKRGKSDMSEAERIALDNHYAQNCSVWFDIQIILKTFPALL
FT                   QSENV"
FT   gene            complement(457031..457408)
FT                   /locus_tag="Ctha_0392"
FT   CDS_pept        complement(457031..457408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0392"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   bvu:BVU_3956 putative two-component system response
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12863"
FT                   /db_xref="GOA:B3QU65"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B3QU65"
FT                   /protein_id="ACF12863.1"
FT                   /translation="MKKTILVVDDEVAMLKILSFILTKSYDVVTKKDGDEALFWLQQGN
FT                   IPDLVIVDINMPNVDGYSFIKNVRVSGFFKDIPIVVLSANDKSEDRIKCLNIGADDFIV
FT                   KPFNPEELKARISSIFRRVGS"
FT   gene            complement(457664..458494)
FT                   /locus_tag="Ctha_0393"
FT   CDS_pept        complement(457664..458494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0393"
FT                   /product="Glucosamine 6-phosphate synthetase contains
FT                   amidotransferase and phosphosugar isomerase domains-like
FT                   protein"
FT                   /note="KEGG: dde:Dde_1864 glucosamine 6-phosphate
FT                   synthetase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12864"
FT                   /db_xref="GOA:B3QU66"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:B3QU66"
FT                   /protein_id="ACF12864.1"
FT                   /translation="MLLYPRQRNESALAEIRNLLTKNLLANEERGKEATGVAIIQKDGE
FT                   AFIEKQPVSASDFVDSERYAKLLEKIDSNTVVILGHTRRPTKGDVLCHHNNHPIVTGAI
FT                   LGIHNGQVENDEQQFAECGCTRTGEVDSEIIFRYIERYSRDGITEKTLPKVQSKLQLLK
FT                   GQLTFLSCDRRTPHKLLVAKHLNPLSLYYDDELSTLIFSSRYVFLRKYYGTKAIQQNVK
FT                   GEHLYLFDATTLEAYEGKPVYQMALGRTAVKNPLEYECYKNTLKDYPFEAKFAV"
FT   gene            complement(458711..459892)
FT                   /locus_tag="Ctha_0394"
FT   CDS_pept        complement(458711..459892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0394"
FT                   /product="glycosyl transferase family 9"
FT                   /note="PFAM: glycosyl transferase family 9; KEGG:
FT                   pne:Pnec_1535 lipopolysaccharide heptosyltransferase II"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12865"
FT                   /db_xref="GOA:B3QU67"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="UniProtKB/TrEMBL:B3QU67"
FT                   /protein_id="ACF12865.1"
FT                   /translation="MIWKFLRLFFTNTNPPDEPKKILVIREAAIGDVILITPFLKQLRK
FT                   LYPKATIEYVVVDWASSILAHNSNIDRVYQVSNELIFGSKMDLLKKRLSFFSELAKKNY
FT                   DIVFSPTTQLIYKAALLLFRNTYKIGFDTVAYGVIGLSNFMLSDYVYIDLKEIPRKRHV
FT                   AQLYLEMLRRLHPNYNVQAETTGLEIFLSDVEKNRIDEIFQSLGWCDEHEFIAIAPSAG
FT                   GGVKPDAAIKTAPPEKFVQTIRLLRENNPKRRFVMIGSKGERDYVDKMALCDGKNIINL
FT                   CGDLTLLESTQLLKQSALLISNDSGVSHMASALKLNHIVLFGATDSIEFGPYQNPNAKV
FT                   LKVALPCAPCRENHCMVEESTQTKDFKRPYCLNMITPEEIVEQAEMLLKKRAK"
FT   gene            complement(459957..461249)
FT                   /locus_tag="Ctha_0395"
FT   CDS_pept        complement(459957..461249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0395"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: amt:Amet_1899 ATPase associated with various
FT                   cellular activities, AAA_5"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12866"
FT                   /db_xref="UniProtKB/TrEMBL:B3QU68"
FT                   /protein_id="ACF12866.1"
FT                   /translation="MQDPIILRRDDILSPVEAQYWKDLLYRASKIGTEIEVATPSGVRR
FT                   PVFEDAIRSALEPSGSFERLGPNGVLDVQTEHCGIEIRVIGRHPSFRALQKQYNQIMQV
FT                   ITLNGGRVKSTCGLHFHLLTPGLAEPVPEIIMANLWNLVRRYAPELKYLTSTGDKREAL
FT                   CRRRNHNSHLEMVRHSPATMTMKDIYEQLKKSKIVPEHQNFFNIQHLGFVESGSILPLH
FT                   LEYRFPDATLSASAVTAFSFLFLALLLKAVNLSQFGVIHVGKIKQWRRKQEILNLLSNN
FT                   DGDLATSDTSGVSDEVVSELRNGANELLELLQSLFQRFNHNQAFEVLQALADQPISLMR
FT                   CAGYDWPTIEQRLHQKVKLMDFDFEKVERRLMLGIELCEWTKQLSQQHWESHVAKELLL
FT                   SPGDIEKRIKKIQEFRELRWDNQKGTMTFTS"
FT   gene            complement(461297..461848)
FT                   /locus_tag="Ctha_0396"
FT   CDS_pept        complement(461297..461848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0396"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hau:Haur_0381 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12867"
FT                   /db_xref="GOA:B3QU69"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="UniProtKB/TrEMBL:B3QU69"
FT                   /protein_id="ACF12867.1"
FT                   /translation="MEERKSWVIKDEAILEELLAMTRMTEEEKKVLGEMRSQAESIVGE
FT                   MINAFYDRLLSHENTSEYLSDKIERMRETLKGWFLELFTGDYNDKYVKSRLQIGKVHVR
FT                   IGLPVRYPLAMMDVIMEYGQKAALQSSQPEIASSAFRKLAALDIAIFNQAYESTQLKHL
FT                   AKMVGNEMLARRILTQDDVE"
FT   gene            complement(462015..462491)
FT                   /locus_tag="Ctha_0397"
FT   CDS_pept        complement(462015..462491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0397"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12868"
FT                   /db_xref="UniProtKB/TrEMBL:B3QU70"
FT                   /protein_id="ACF12868.1"
FT                   /translation="MASEEQKKQNQLRLTSMALTSLAQAVWETLGESAFSYSGLMGDEL
FT                   LRVMEKEMGLEIAGHTPKEVIMEVSRIFVDEFGYASDIEVEGDDDTLITLKVRQCINRK
FT                   FSDRLDAAGVEKPFICPIMNACQAGLRRLGYKMREEVHKWHEGGGSIITFERVA"
FT   sig_peptide     complement(462414..462491)
FT                   /locus_tag="Ctha_0397"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.716) with cleavage site probability 0.696 at
FT                   residue 26"
FT   gene            complement(462558..463274)
FT                   /locus_tag="Ctha_0398"
FT   CDS_pept        complement(462558..463274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0398"
FT                   /product="Roadblock/LC7 family protein"
FT                   /note="PFAM: Roadblock/LC7 family protein; KEGG:
FT                   ace:Acel_1325 roadblock/LC7 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12869"
FT                   /db_xref="InterPro:IPR004942"
FT                   /db_xref="InterPro:IPR025497"
FT                   /db_xref="UniProtKB/TrEMBL:B3QU71"
FT                   /protein_id="ACF12869.1"
FT                   /translation="MQGDIKHMSVADLIQHYCEDHKTAKITLNNDGQEAELFLKDGNVV
FT                   HATMGDIVGEQVVFNILAWNEGTFNLDMDTEPSFKTIERSWKGLLLHGAQLLDESSSTN
FT                   QPVTKPVEKTMVKKKGEIIAEALQELLQQSTDIQGAAIVGTDGLVYSANVPDKGLDENM
FT                   VGAVSAAILGLSKRSVQQLKRGTFSQTLIQGDNGNVIVAGLNDRTLLIGLTAHGVNLGM
FT                   AFAEVRDFASRLRDLV"
FT   gene            complement(463298..463699)
FT                   /locus_tag="Ctha_0399"
FT   CDS_pept        complement(463298..463699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0399"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12870"
FT                   /db_xref="UniProtKB/TrEMBL:B3QU72"
FT                   /protein_id="ACF12870.1"
FT                   /translation="MVPNKNTYTKTGSAELTKILAEMNEKGSFAISVLTDLQGFPIAYA
FT                   TTEGYDPERQAAVVAMVQKTAIQVKNHLGMGQTDEVCLFDEEGCRLVSRTFRVKNYELI
FT                   LALQIPDKHQSYRSLMNHSIKSIQRVWKL"
FT   gene            complement(463709..464299)
FT                   /locus_tag="Ctha_0400"
FT   CDS_pept        complement(463709..464299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0400"
FT                   /product="putative gliding protein MglA"
FT                   /note="KEGG: ttj:TTHA1132 probable gliding protein MglA"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12871"
FT                   /db_xref="GOA:B3QU73"
FT                   /db_xref="InterPro:IPR006689"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3QU73"
FT                   /protein_id="ACF12871.1"
FT                   /translation="MQINWERKELNLKIVYYGPALSGKTTNLEQVHAHVDPGRKGKLLS
FT                   LKNREDRTLYFDFFQLELGKIGGLTPKLNLYTVPGQTYYEATRKMVLRRADGVVFVADS
FT                   SPTRLTDNIDSWHNLKSQLSSLQLYTDDFPIVIQLNKRDLPYPVPPEVLKRKLGVTGYR
FT                   TYEAVAVKNIGVFETLKAITQVVVARVQQELYA"
FT   gene            complement(464303..464830)
FT                   /locus_tag="Ctha_0401"
FT   CDS_pept        complement(464303..464830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0401"
FT                   /product="Roadblock/LC7 family protein"
FT                   /note="PFAM: Roadblock/LC7 family protein; KEGG:
FT                   gme:Gmet_3418 roadblock/LC7"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12872"
FT                   /db_xref="GOA:B3QU74"
FT                   /db_xref="InterPro:IPR004942"
FT                   /db_xref="InterPro:IPR037587"
FT                   /db_xref="UniProtKB/TrEMBL:B3QU74"
FT                   /protein_id="ACF12872.1"
FT                   /translation="MRLRSGISIDSSQHKKFEQVLENLLQKAPAKFILLTDVSGQVVSA
FT                   CGPSSQFDLIALGSVMAGGLSAAQEVAQMLGGEQEYQLVLHEGLSANTFMAGAGPDFAI
FT                   LVQLDKSVPLGWARMLIQEAAKKIDDNCQESDYQESSDAEQIPDAKKLDLLGDPTNLSD
FT                   QIGDSLDALWKG"
FT   gene            complement(465426..466694)
FT                   /locus_tag="Ctha_0402"
FT   CDS_pept        complement(465426..466694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0402"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   cph:Cpha266_0386 protein of unknown function DUF214"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12873"
FT                   /db_xref="GOA:B3QU75"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:B3QU75"
FT                   /protein_id="ACF12873.1"
FT                   /translation="MIQTIFKIAIGHLVGRARQTVTTLVGVSVSTMVLITTISLMRGLV
FT                   DSFTESIVDIAPHIVVRGESIIPDKIDLISNDKGTRRAFVVDNVQEEDPEEITNYRQIL
FT                   SLMEEAPYDEAISVASPYVSSQVMAIKGTANQPIEVNGVLIDRENKVAKIESNLKSGSL
FT                   ESLQKTPNGLLLGEKIAEDLEIQLFDELTLVASSGVTVRAKVVGTFFTGVKSIDNKAFV
FT                   NLKVGQLLEEMPPNKVTGINLRVKDLLQNTELARELERVTGYKCETWQEANDSIIGLFN
FT                   RIGNIVYSLVGFVALVSGFGVANILVTTIYEKTRDIAIMKSYGFTSNQIVALFVLEGVL
FT                   VGLAGALLGAILAIGSTNLLASLPTESAQGPVVRKGFAMSQSPIYYLITIGLTVFISTV
FT                   AAMIPSRKAAKLQPVQVLRDANL"
FT   gene            466839..467984
FT                   /locus_tag="Ctha_0403"
FT   CDS_pept        466839..467984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0403"
FT                   /product="isopentenyl-diphosphate delta-isomerase, type 2"
FT                   /EC_number="5.3.3.2"
FT                   /note="TIGRFAM: isopentenyl-diphosphate delta-isomerase,
FT                   type 2; KEGG: cte:CT0257 isopentenyl-diphosphate
FT                   delta-isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12874"
FT                   /db_xref="GOA:B3QU76"
FT                   /db_xref="InterPro:IPR000262"
FT                   /db_xref="InterPro:IPR011179"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B3QU76"
FT                   /protein_id="ACF12874.1"
FT                   /translation="MHNRHFTRPSELTEIVERKQSHVEICLNGPIDYENKTNGFDHYFF
FT                   EHTATPEVNFSEIDLSTTFLGRKISYPLMISSMTGGYSGAMFVNQMLAEICQHLNIPLG
FT                   VGSMRQALEDKSYQQSFEIVRKVAQNVQIFANIGAPEVAQGLSRDQLKFLTNLIKADGL
FT                   IIHINPAQELFQPEGNTNFKGFLSQLKALIDAVQIPVIAKEVGAGISGKVAARLIDAGV
FT                   TAIDVAGAGGTSWQKVEKVRYERKYGIDKRFSATAMNELLNWGIPTAECLVQITKLKAS
FT                   EPEKYNNIELISSGGISNGVEIAKSLALGAQIAASARPILKQLLAREDSSQDNLERTIM
FT                   TWMNDLRATMFLAGVSSIAQLRQTKLICRQRQDFFQSAHEL"
FT   gene            468231..469238
FT                   /locus_tag="Ctha_0404"
FT   CDS_pept        468231..469238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0404"
FT                   /product="Polyprenyl synthetase"
FT                   /note="PFAM: Polyprenyl synthetase; KEGG: cph:Cpha266_0384
FT                   polyprenyl synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12875"
FT                   /db_xref="GOA:B3QU77"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:B3QU77"
FT                   /protein_id="ACF12875.1"
FT                   /translation="MKTTTTENIGMDIQQKYLEFHTRINEELQQCLLGKEPKSLYEPAT
FT                   YILTGKGKRVRPVLVLLGAESICGTSDHALNLALSVEVLHNFTLIHDDIMDNAALRHGR
FT                   ETVHLKWNENAAILSGDMMLAFAYELALKTNSSRLTKILDVITQSTIVICEGQTYDMDF
FT                   EKRTDVTMSEYLDMISKKTGRLIAASLELGGLAAEATDEQLAILTEYGELIGQAFQVQD
FT                   DLLDIMADDKKFGKVPGGDLMEGKKTFLLLRALELTTGEDHLLLQSVIDNHGIAQERIP
FT                   EIKDIYERCGILNEAQELINSNFEKAVTLSEKLPNEAGREALVGFTAMVMKRDS"
FT   gene            complement(469291..470664)
FT                   /locus_tag="Ctha_0405"
FT   CDS_pept        complement(469291..470664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0405"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gfo:GFO_2394 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12876"
FT                   /db_xref="InterPro:IPR021272"
FT                   /db_xref="UniProtKB/TrEMBL:B3QU78"
FT                   /protein_id="ACF12876.1"
FT                   /translation="MRIPEKYLRHIWQNLYFAKSSLHTVDGHLLKVLSPGTPNFNEGPD
FT                   FQDAKICINGNAQTGSVELHFQTTDWLKHRHSKAEKYQNVILHVVFQHDAEIDVNLPVF
FT                   ELRHFLSSPLHEILKQCIADENRAGKKHLLACFPLVSQVSDGTKLDWIKSLAFKRLHQK
FT                   ATLIKENRNGKSYDEMIYQGVARALGYSENVLPMGALAQKISFGDIQAYSSESMVARKM
FT                   KIEAIFFSLSGLLKELQPCDEDSKAYIKQSKFLFQTTSFSQIEPLRSLEWVFFRLRPNN
FT                   FPTLRIAGLAEILSKNLQKGFLQKANQVLKLSLPLKQKIILLEALFDADADFFWRSHYR
FT                   FCKASSHKIEKLVGKNRSSEIVINTLLPALLSFYQETFDAIGVAKVQELYEKYPKKLSS
FT                   EVAKKVLYELLGEDYTVNSACFEQGLLELKKNYCEKQTCLDCKIGQVALGRAAESEKF"
FT   gene            complement(470832..471173)
FT                   /locus_tag="Ctha_0406"
FT   CDS_pept        complement(470832..471173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0406"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /note="PFAM: nitrogen regulatory protein P-II; KEGG:
FT                   plt:Plut_1164 nitrogen regulatory protein P-II (GlnB,
FT                   GlnK)"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12877"
FT                   /db_xref="GOA:B3QUH1"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:B3QUH1"
FT                   /protein_id="ACF12877.1"
FT                   /translation="MKYIIAMIQPHKLPDVKQALFDADIRKMTVTNVLGCGQQGGYEET
FT                   YRGVPTEINLLKKVKIEIAVNEDYAQKAIDAITKGARSGNIGDGKIFVLDLPQCIRIRT
FT                   GETGHDAIG"
FT   gene            complement(471201..472541)
FT                   /locus_tag="Ctha_0407"
FT   CDS_pept        complement(471201..472541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0407"
FT                   /product="ammonium transporter"
FT                   /note="TIGRFAM: ammonium transporter; PFAM: Rh family
FT                   protein/ammonium transporter; KEGG: plt:Plut_1163 ammonium
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12878"
FT                   /db_xref="GOA:B3QUH2"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR002229"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:B3QUH2"
FT                   /protein_id="ACF12878.1"
FT                   /translation="MKKLDSPKLMLLLLGLGVLGLSVPAYAEEAAAAAAPTSVAIDAYA
FT                   IDNMFLFFAAVLVLFMQAGFAMVETGLNSAKNAVNILFKNLMDLCIGALLYYVVGYSMM
FT                   YGAPVIGGFFGFNGFGISSVAPDAPGAGVLDPQVDWLFQVAFAATAATIVSGAVAGRLQ
FT                   FRAYLIYSAVITGIVYPISGYWKWGGGWLDQMGFYDFAGSLVVHAVGGFAGLAGAIVLG
FT                   PRLGRFAKDGTPKAMPGHNLSLAALGVFILLIGWYGFNPGSQLAIVGADNTHAVMLIAT
FT                   NTTLAAAAGAVGALILAWIMFKKPDLTMALNGVLGGLVGITANCDSVTNNEAIIIGIIA
FT                   GILVVVGVKLLDMLKIDDPVGAFPVHGMAGVWGGLATGIFGGHPMVAQIVGSVVIPIWA
FT                   FVTMFILFTILKAIGLLRVSEEDEIKGLDITEHEEEAYAGFQFFSVE"
FT   sig_peptide     complement(472458..472541)
FT                   /locus_tag="Ctha_0407"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 28"
FT   gene            complement(472635..473702)
FT                   /locus_tag="Ctha_0408"
FT   CDS_pept        complement(472635..473702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0408"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: chu:CHU_3732 conserved hypothetical protein;
FT                   possible outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12879"
FT                   /db_xref="InterPro:IPR011486"
FT                   /db_xref="UniProtKB/TrEMBL:B3QUH3"
FT                   /protein_id="ACF12879.1"
FT                   /translation="MKKSFLLVLVALLLVAFTAKAQDAAKTEGSEKKEEVSGLEVHGGV
FT                   DAYFGYNFNEEAMKTSFTGVHNSFELGMANVILSQKMDKVSFVADLAWGPRADAANGSA
FT                   GSSTDAIKQLFMTYAATDDLTITAGNFSTFVGYEVIDATGNFNYSTSYMFSNGPFYHTG
FT                   VKADYAVNDQFGFMVGLFNDTDSKTDANGINHYGCQLSYAPSEELSAYFNVLHGREAID
FT                   QKGTQFDLTGTYQASKDLMVGLNATYKMISIDTDGADDQSWMGAALYLNYMVNDGLGLG
FT                   FRGEYFDDPDGVNLGVASGSNVIDLTFSANMKSGPLTFIPEFRIDMASEDIFVDTDGKP
FT                   TSTSPTLLFAVVYGF"
FT   sig_peptide     complement(473637..473702)
FT                   /locus_tag="Ctha_0408"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 22"
FT   gene            complement(474281..476365)
FT                   /locus_tag="Ctha_0409"
FT   CDS_pept        complement(474281..476365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0409"
FT                   /product="Peptidylprolyl isomerase"
FT                   /EC_number="5.2.1.8"
FT                   /note="PFAM: HEAT domain containing protein;
FT                   peptidyl-prolyl cis-trans isomerase cyclophilin type; KEGG:
FT                   sru:SRU_2431 peptidyl-prolyl cis-trans isomerase,
FT                   cyclophilin-type domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12880"
FT                   /db_xref="GOA:B3QUH4"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:B3QUH4"
FT                   /protein_id="ACF12880.1"
FT                   /translation="MKKAIFLCIALFSFLAPLPAQFLENSAIVALKQAAYNRDTKQVIS
FT                   YFGFFDELDEQVLLSLGSLQVDSVAGRIAARLSSPSAPVRRMAAFALGQSVQDSGSISV
FT                   YESEIFEKLETETDVRTKALLLDALGKFGSSTALKKLINLPFQEIELRQAAALSLARFA
FT                   MRDTILPEAAQRAVALYLSTKDSVTEGMNYAMYALSRIQNRALLYPHIPVLLEASESSN
FT                   PEVRMHAVFALSKLATPKTINAVLLAAKDPDWRISAFAAQALSKYLNSTRGYKSIAAKV
FT                   ITELLATSTHPHVLDACLNTLSLLTPHDTLAVPHLRRLLKSPSVRLRNKAMQTLVRAYP
FT                   RVAEKLLLKEIDRKTDTPAMLAAVGELAIANQEINLDFMPWLYEHVNDDRKQIATAALN
FT                   SWGQCWNVYRNTMAGSSYWTPTDTLFEGVLLRALKKHSAKKTPSPAAVKTISAILSDEF
FT                   LPKKKYLKVLSEALDMFADAEDVSTILQLLESLGNLKEKSSVPVIEKYIYYKDLSVRRK
FT                   ASEVYTLVTGKDAPIPPTFIPPKKIDMTPYREIEKNPVVRLETDKGAIEIELFLREATF
FT                   TVANFMKLVQQGFYDGLTFHRVVPNFVVQSGDPNGDGTGGPGYTIRSEFTPQSFDRGIV
FT                   GMASAGKDTEGSQFFIMHSHYPHLDGQYTPFGKVVRGMAVVDQIEVGDVIQKATVENAD
FT                   "
FT   sig_peptide     complement(476294..476365)
FT                   /locus_tag="Ctha_0409"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.908) with cleavage site probability 0.437 at
FT                   residue 24"
FT   gene            complement(476537..478054)
FT                   /locus_tag="Ctha_0410"
FT   CDS_pept        complement(476537..478054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0410"
FT                   /product="signal transduction histidine kinase, nitrogen
FT                   specific, NtrB"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; KEGG: sfu:Sfum_1487
FT                   signal transduction histidine kinase, nitrogen specific,
FT                   NtrB"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12881"
FT                   /db_xref="GOA:B3QUH5"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B3QUH5"
FT                   /protein_id="ACF12881.1"
FT                   /translation="MPNIAIVSSLSMLIVQVQRAIKLQANKVEIFSHTALDAIPQDTDL
FT                   IYFGLNNDGHDGESIEYLHQRLVQTPIIVLITENKIEYAIRAIRCGACDVVYISGDPVN
FT                   DNVEIANSVYRGLRVRQNKVVVRQTLAEKTCDAFPFDVNRGESGGFLNQMQQAVVIIDQ
FT                   SAKVISFNRAAEKLIGDDDELGLQGKDISAILNLSEQDKEKIFVQGESHRGELRIRHED
FT                   QDITIGYAISPRYSINGHLDGAMMLFKDITEDKHLRFQAEKAEKMQTLGEIAAAISHEV
FT                   KNPLAGIKSMVQAMMYDLEPESDNYHYTQRILQEVDRINTFIEDTFAFARHRRQYLVKV
FT                   EISSIVNAVVSLLTENLKENQIQVEKQFEPELPAVKVDPDQIHQVFLNILMNAIEAIKE
FT                   QPSAERRNPPFIKVMARKTSMRINHVLTPFVETLFEDSGPGIPESAFEKVFDPFFTTKP
FT                   SGTGLGLSICYKIIREHHGELDLKNAVAGGAIVSVKLPVVPPNRFSK"
FT   gene            complement(478286..479260)
FT                   /locus_tag="Ctha_0411"
FT   CDS_pept        complement(478286..479260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0411"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hau:Haur_4902 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12882"
FT                   /db_xref="GOA:B3QUH6"
FT                   /db_xref="UniProtKB/TrEMBL:B3QUH6"
FT                   /protein_id="ACF12882.1"
FT                   /translation="MMKSLINKIWALLLYGLLVALPQVSAAAEPSVSVEVSTDTCTIGD
FT                   NIFYTLRVLHEPSVSVAYPTEADTIFAPFEIRKLERHSETNAERVQDDLHYTLTIFETG
FT                   LHYVPPIILRYIEDQPGAAEGKLQVPAKPVFVRSVLDSTQKSIADIKPVQTPDLPAWIY
FT                   AAVIAGIALVALIAYLIYKAKNRQTPATTSKPKPQKPPYDEAMEKLSALKQYPFETEVH
FT                   YRNYYTDLSDALRVFLERFYQIPAQEQLTAEIHSAMLKAQLREQAENAKLILEKADLVK
FT                   FAKYYPSKLEAGESLQLAIKVVEVAKPTVQQAPASMEDAETKS"
FT   sig_peptide     complement(479177..479260)
FT                   /locus_tag="Ctha_0411"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.788 at
FT                   residue 28"
FT   gene            complement(479337..480221)
FT                   /locus_tag="Ctha_0412"
FT   CDS_pept        complement(479337..480221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0412"
FT                   /product="protein of unknown function DUF58"
FT                   /note="PFAM: protein of unknown function DUF58; SMART: von
FT                   Willebrand factor type A; KEGG: gfo:GFO_3411 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12883"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR002881"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:B3QUH7"
FT                   /protein_id="ACF12883.1"
FT                   /translation="MSEALDKDIFQKIRLLEIRTRGLVNNIFSGEYHSAFKGRGMEFAE
FT                   VREYQFGDDVRTIDWNVSARSDDVFIKMFEEEREQSMMILFDGSGSGVFGTANQFKRDL
FT                   AAEICATLAFSAIKNNDKVGLMIFTDVVEKFIPPRKGRSHVLRILRDIFHFRPRGKQTN
FT                   IGGAVDLAARVLKRRSIVFLVSDLMGYQFEHSFRVMSRKHDFIAIHVSDPREFELPRVG
FT                   LLELEDAETGEHYLVDTYDEQFRGSYARRMEQFLDYRRAQLQRMKIDMVSVSTAESYIK
FT                   PLTAFFRRREKRH"
FT   gene            complement(480318..480494)
FT                   /locus_tag="Ctha_0413"
FT   CDS_pept        complement(480318..480494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0413"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12884"
FT                   /db_xref="UniProtKB/TrEMBL:B3QUH8"
FT                   /protein_id="ACF12884.1"
FT                   /translation="MLSFLAKQLCAGYVGFFGFRSLRMTWFVFVIGSGDEFDPTEVNRS
FT                   VVVIEIPEMLLLA"
FT   gene            complement(481108..484197)
FT                   /locus_tag="Ctha_0414"
FT   CDS_pept        complement(481108..484197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0414"
FT                   /product="heavy metal efflux pump, CzcA family"
FT                   /note="TIGRFAM: heavy metal efflux pump, CzcA family; PFAM:
FT                   acriflavin resistance protein; KEGG: mms:mma_1769
FT                   cobalt/zinc/cadmium efflux RND transporter, permease
FT                   protein, CzcA family"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12885"
FT                   /db_xref="GOA:B3QUH9"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004763"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:B3QUH9"
FT                   /protein_id="ACF12885.1"
FT                   /translation="MLNKFIEISMRERLGVIGGIIILAALGFYSLREIPIDSQPDVTNN
FT                   QVQIITAVSGLSPVETERLVTFPIETAMNGLPDMTELRSISKYGLSVVTVVFEDNVDPY
FT                   FARQIVMERLQSVKGDLPPAASEPTIGPLSSALGEIYQYEVKGAHYSAMELRGIQDYVV
FT                   KQQLKTIPGVTEVNSFGGFVKQYQVAVSPLKLQTYGLTLSDVFEALEKGNSISSGNFIE
FT                   HNDEQYIIRGLGMASGTEDLKNIAVGTNNNVPIFIKDVAEVSVGSEIRQGAVTRDGKGE
FT                   AVTGIVMMLRGENSREVIQRVQEKVDDLNRILKPQGIEIESFYDQTTLVLRTIQTVQTN
FT                   LIEGGLLVVFVLVAFLGNLRAALIVAAVIPFSMFFTFIGMNWLGLSANLMSLGAIDFGM
FT                   VVDGSVVMMENIIRRLEHDKKGDRIHVIRESAYEVSRPIFFGVMIILMVYVPILTLQGM
FT                   EGKLFSPMAFAVGFAIFGSLILALGVVPVFATFVFKGDVKEKENKLLTWLQPHYETVLR
FT                   AALRHRFLTLAIAVVLLALTFATVPFMGREFLPELDEGNSLIEAKMLPSVSLDKSIEKG
FT                   EKISRILKKFPEVKTVVAKTGRPDIANDYMGVHETDIFVILNPIETWTTAETKSALEDT
FT                   LRKAIEPVTSGMYINFSQPIAMRVNELVSGTKADVAVKIFGDDYDDLERYAHAIEEIAL
FT                   GVQGTASVLVEQVSGQPYLNLHIDRNETARYGLSIADVQTAIETAVGGKVATEILEGRQ
FT                   RYGVLVRFEKNAREQILSLKNILIPLPDRNSRLPLGQLARFEQTEGPAQVSHESSQRRL
FT                   VVECNIDGRDIGSYVEELRTKIESTVKMKPGYLIDYGGQFENQERAMTRLAIVVPLAIF
FT                   IIFVLLYLMFGQIRYAALILVNLPFATIGGVFALLLRDLPLSVTASIGFIALFGVAVLN
FT                   GVVLISYINDLRETHPDWDLNTAIISACKTRLRPVLMTALVASLGFIPMATSHGVGAEV
FT                   QRPLATVVIGGLITSTLLTLLVLPTVYETMEERVLRRKRG"
FT   gene            complement(484230..485396)
FT                   /locus_tag="Ctha_0415"
FT   CDS_pept        complement(484230..485396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0415"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   mfa:Mfla_0503 secretion protein HlyD"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12886"
FT                   /db_xref="GOA:B3QUI0"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:B3QUI0"
FT                   /protein_id="ACF12886.1"
FT                   /translation="MKHIATFLAWLLSLFILAGCQNDDAPKETEDAPSTVQASVVELSE
FT                   AKFQRANLAFATVTYEPIEFLLTVPAEIFPMPNSEAFVGSLVAGRIKSVGAKLSQFVQA
FT                   GAPLAVLESAEIGAATADLKQCAAELEVAESDLRRKASLSDENIISGKALAEAEARLKI
FT                   AKASLYAAESRVAAIGFSSREIEDMKKNPDTRVTSVGIRAPISGFLSARSARIGEYVLP
FT                   EQTLFKIHNLSKVMLVGSIFEPDFHKVAEGQKVEVFFGENHREKLLATIESVGTTLDEV
FT                   THALSVRAVLQNPDYRLKPSMHAEMWIHARAKEPAFLLPAGAVGIDGEKKFVFVRKAER
FT                   VFEQRTVVPLYETQAQVALSEGVGEGETVVSEGVFFLKSEIKASEMEE"
FT   sig_peptide     complement(485328..485396)
FT                   /locus_tag="Ctha_0415"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.952) with cleavage site probability 0.733 at
FT                   residue 23"
FT   gene            complement(485359..485664)
FT                   /locus_tag="Ctha_0416"
FT   CDS_pept        complement(485359..485664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0416"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12887"
FT                   /db_xref="UniProtKB/TrEMBL:B3QUI1"
FT                   /protein_id="ACF12887.1"
FT                   /translation="MAKANVILSRRGEESTMDASLIRKQVVQHDKGNVILNGESECHSE
FT                   PARRRIHYGCFTSFSMTEKKLVIHRFTFFRQSETFNANMYQENSYETHCYIFGLAA"
FT   gene            complement(485914..487164)
FT                   /locus_tag="Ctha_0417"
FT   CDS_pept        complement(485914..487164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0417"
FT                   /product="outer membrane efflux protein"
FT                   /note="PFAM: outer membrane efflux protein; KEGG:
FT                   mfa:Mfla_2553 outer membrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12888"
FT                   /db_xref="GOA:B3QUI2"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:B3QUI2"
FT                   /protein_id="ACF12888.1"
FT                   /translation="MHVMKHFFTSILTLFIAGSLFAQERIQLSADQAIELALKNNFSLK
FT                   AEQAESEAVSARTLSVISPEKTELTFYKEKTPYELPGEAQEIKRLQIAQSFEFPLTTYF
FT                   RAGAQHALSDAAAFRVIEQKTRVAAAVRKAYAEVLFSRSQAVLLRENLALLQDFAKKSA
FT                   RLAEVGETSPLEALRAKSELAKAENLLEEANAQNGAAENNLCTLLALPLGATLQLTDTL
FT                   RCDFPVFQIAGLHEIAQSGRGALQSAKQEWLAESRTAQAAWSEVLPEIRLAYFWQSFSP
FT                   ALEPDRTFTGGEITLSLPVWFWFGDRGNIQEKAALSEAAKYAFEDAKRQLETEVRNAAL
FT                   HYTAAVSQLENARKTYLPFAQQAFHAAQKAFAAGSIGYLEFLDSKQAYYEAKLHELEKR
FT                   LAAESALAELFQAIGKI"
FT   sig_peptide     complement(487096..487164)
FT                   /locus_tag="Ctha_0417"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 23"
FT   gene            487471..489138
FT                   /locus_tag="Ctha_0418"
FT   CDS_pept        487471..489138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0418"
FT                   /product="protein of unknown function DUF87"
FT                   /note="PFAM: protein of unknown function DUF87; KEGG:
FT                   gvi:glr4405 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12889"
FT                   /db_xref="InterPro:IPR002789"
FT                   /db_xref="InterPro:IPR008571"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3QUI3"
FT                   /protein_id="ACF12889.1"
FT                   /translation="MERKHIGKIIRGSLLEGLEMKLDAFEHVESVKAGKFVVVEGEQYD
FT                   FFSIITDLRLEATSNALLSNPPSLQSDVLRDIISGTISYSVVNLRPMLMLERHLYPEFA
FT                   APLEPVKTIPSHFAFVSEATDEDIAKVFGSESENQNGRKFFYIGTPLDMTQPVCLDLER
FT                   FCERSSAVFGRTGTGKTFITRLLLAGLIKTDAAVNLVFDMHNEYGTKGTFEGQGASSVK
FT                   GLQPLFATTGKVKIYSLDPESTQRRGAHCDREVRLSIEQIEPDDILLLQEELRLNPTAA
FT                   EYSNILKNRYGKDWLARFMDLMEDDDEKALENFAAQNHLLPSSLEALYRRLTRLRDICQ
FT                   FLDFSPNKGKLNIIEDLLNDLSRGTSVVMEFGKYDNMMSYLLVANIITRRVEEAYKEKT
FT                   DVFLRTGNELDKPKQLVITIEEAHKFLNPKSAQQTSFGKIARELRKYFVSLMIVDQRPS
FT                   GIYDEILSQIGTKIVAALSDERDINAVLTGTSNPGGMRNILASLDTKQQALVMGHAVPM
FT                   PVVIRTRDYDEKFYTDMGYTDREARKRKNKANLSDLYD"
FT   gene            489183..489524
FT                   /locus_tag="Ctha_0419"
FT   CDS_pept        489183..489524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0419"
FT                   /product="membrane protein of unknown function"
FT                   /note="PFAM: membrane protein of unknown function; KEGG:
FT                   cph:Cpha266_0995 membrane protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12890"
FT                   /db_xref="GOA:B3QUI4"
FT                   /db_xref="InterPro:IPR007165"
FT                   /db_xref="UniProtKB/TrEMBL:B3QUI4"
FT                   /protein_id="ACF12890.1"
FT                   /translation="MKLILSWIINAVAVYATASFLDGIYVKSFWAALIVALILGLVNTI
FT                   IKPILVFLSMPFIVLTLGLFLILINAFMLYIASQVVAGFALAGFWPAVIGSIFISVISW
FT                   ILSTLFNTK"
FT   gene            489583..490938
FT                   /locus_tag="Ctha_0420"
FT   CDS_pept        489583..490938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0420"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gme:Gmet_0138 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12891"
FT                   /db_xref="InterPro:IPR037291"
FT                   /db_xref="UniProtKB/TrEMBL:B3QUI5"
FT                   /protein_id="ACF12891.1"
FT                   /translation="MLKITQLFLLGTLLIQTELGALQAQDLERKSLAVTVYNANFGIVK
FT                   DVREAQMKSGISEIRLTDVAAQIDPTSVLVKSQGSIIEQNFRYDLASLSKILERYIEKE
FT                   IRLIGEDKELLEGTLLSVQGNSVVLRKKDGGLLLIPSIDDYRLSVEALPDGLITKPTLV
FT                   WLVNSKKSGKENLEVSYKTYGIRWHAEYVALLNPNDEQMELKAWVSVENNSGASYPNAK
FT                   LKLVAGDVNQVSTQPVLAKAERATFGAAVADEAQFQENSFFEYHIYTLERPATLMENEV
FT                   KQISLFEADGVRVKKKYLYRGGNSKVSVAIEFQNDKSSGLGQPMPKGTVRVMKSDGQSL
FT                   EFIGEDELDHTPLKEKVNLKIGDAFDVVAEEVRENYKRISQSVNEQTYKVTLKNRKKEN
FT                   ISVEVERYLGLNWEILDSSLKYEKKDASRVVFDVPVKSDSETVLKFTVRYVN"
FT   sig_peptide     489583..489657
FT                   /locus_tag="Ctha_0420"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.812) with cleavage site probability 0.728 at
FT                   residue 25"
FT   gene            complement(491072..492031)
FT                   /locus_tag="Ctha_0421"
FT   CDS_pept        complement(491072..492031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0421"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12892"
FT                   /db_xref="UniProtKB/TrEMBL:B3QUI6"
FT                   /protein_id="ACF12892.1"
FT                   /translation="MARFTVAISFVFFWTFSVALPAFAGLPRIHPASQVLPYPEGEGYT
FT                   GFQAAFFSTTTEFAATGDKRDLFSSESTSGGKFYETTISVQYERGISNFWTLVVWLGYR
FT                   NFSTKYTDLDVRPTDPARFRSIKTDAFSELWVSGRIKLWQQQTIVGAFSSGLQPGIKLP
FT                   TGDVTTTIPTGTGAMDYELLLLPRLDVSAWGSPAALTGLVGYRMRGGGLDDELPYLLEF
FT                   RVGVSKELVLRTSVGGISASPDGTNNVVGLSYSDVDYSTGDVDASVSVIGDEAYTQLAL
FT                   GFEFSFSRVVSVSFDYINRVSGKAAMSGETYLLGFALH"
FT   sig_peptide     complement(491957..492031)
FT                   /locus_tag="Ctha_0421"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.998 at
FT                   residue 25"
FT   gene            complement(492220..493056)
FT                   /locus_tag="Ctha_0422"
FT   CDS_pept        complement(492220..493056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0422"
FT                   /product="glutamate racemase"
FT                   /EC_number="5.1.1.3"
FT                   /note="KEGG: cch:Cag_0573 glutamate racemase; TIGRFAM:
FT                   glutamate racemase; PFAM: Asp/Glu/hydantoin racemase"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12893"
FT                   /db_xref="GOA:B3QUI7"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004391"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="InterPro:IPR033134"
FT                   /db_xref="UniProtKB/TrEMBL:B3QUI7"
FT                   /protein_id="ACF12893.1"
FT                   /translation="MNLQTSAETLNLKAERPIGIFDSGIGGLTVVRKIRERLPNERLIY
FT                   FGDTARVPYGTKSQVTVRRYAAEDTRLLLKYQPKMIVVACNTVSALALDVVEHESGGLP
FT                   VLGVLKAGANLAVKYSQTKHIGVIGTIATISSNAYPLEISKLDCEAEVYSKACPLFVPL
FT                   AEEGFISHQATKLIATEYLTELLVKKIDSLVLGCTHYPILKSMLAEVTGKNVVIIDSAE
FT                   AVAMEVENLLREKSLLNREINQALPKVLVSDLPQKFKTMFELFLGLSLPDVELVEM"
FT   gene            complement(493084..494430)
FT                   /locus_tag="Ctha_0423"
FT   CDS_pept        complement(493084..494430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0423"
FT                   /product="Tetratricopeptide domain protein"
FT                   /note="SMART: Tetratricopeptide domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12894"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:B3QUI8"
FT                   /protein_id="ACF12894.1"
FT                   /translation="MKLAQLFAICFLFGAVSASSLQAKVPETAHEGERIAISISDKYFK
FT                   PAQSVWARVQVDFQQVESDENSVHVFQMKKQADAFAATFSIPKGAARVHFIYATKDTAL
FT                   IDPTVLRILDKKGNFVRRARLIGPGVTPNAKSMIKEEFAAYPDSYEALLQSWEITEKYD
FT                   SPSALKQQLPGTLEAYLGKKRNAEFYYAVIWAYAKMQNTDRISHCFGRYEEDFPHSHYF
FT                   LKTYEASADIAAEGGWSLPQDVQELAVRYFTNNLSAENLFEYGYLLSHDEASAEDIENF
FT                   IAEQTRRHGNVPMIYYNAASAYLARLNYDKAIENALKARELMQMEQPDAVYFQDRMAGQ
FT                   QYPLLWPYLTKMLAVSYMALENTDKALAALKNGYSANRNMKIDGELYALEARCWELLHK
FT                   YQKAEDLYFKAYILGLKWTKESLRDVYEKTHQTNEGFEAYFSRRIANYQ"
FT   sig_peptide     complement(494359..494430)
FT                   /locus_tag="Ctha_0423"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.975 at
FT                   residue 24"
FT   gene            complement(494667..494912)
FT                   /locus_tag="Ctha_0424"
FT   CDS_pept        complement(494667..494912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0424"
FT                   /product="regulatory protein, FmdB family"
FT                   /note="TIGRFAM: regulatory protein, FmdB family; PFAM:
FT                   Putative regulatory protein FmdB; KEGG: cch:Cag_1970
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12895"
FT                   /db_xref="InterPro:IPR013429"
FT                   /db_xref="UniProtKB/TrEMBL:B3QUI9"
FT                   /protein_id="ACF12895.1"
FT                   /translation="MPTYQYRCSSCSHELEAFQSMNDEPLTVCPECGAEQLKRVISAGG
FT                   GFMLKGSGFYNTDYKNASKSQAAAPPCACANGACNL"
FT   gene            complement(495122..495877)
FT                   /locus_tag="Ctha_0425"
FT   CDS_pept        complement(495122..495877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0425"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12896"
FT                   /db_xref="UniProtKB/TrEMBL:B3QUJ0"
FT                   /protein_id="ACF12896.1"
FT                   /translation="MKKIKFIVFAVALATMLQFNAVYAQTSTFDQVHLFQTFFEDASMS
FT                   RTPYGQISLRYSDYDQLSSIYLPVQAAIPLGDQKEFQLGAELGFINTNPEIGDGESGLS
FT                   DLKVIGRYNFPTSSYTKIAAGGYITLPVGKEEAGYGNVNFGGFGSVRHPLTKDVVLTGT
FT                   VMLEFLESVNDDRESSLLFAVGSIYQVSPKMYLIGELNLKTEGDYGLLSAGMDYRLSPD
FT                   GCFRGMLGFGLDDGAPDLALQVGYHMFFN"
FT   sig_peptide     complement(495803..495877)
FT                   /locus_tag="Ctha_0425"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 25"
FT   gene            complement(496009..496425)
FT                   /locus_tag="Ctha_0426"
FT   CDS_pept        complement(496009..496425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0426"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sbn:Sbal195_3679 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12897"
FT                   /db_xref="GOA:B3QUJ1"
FT                   /db_xref="UniProtKB/TrEMBL:B3QUJ1"
FT                   /protein_id="ACF12897.1"
FT                   /translation="MFISLLIVTFLIALIVSGLVGRFFSQPVERILGRIVEDDIRYAWT
FT                   RYLTFAIYVVGISGGVRIFELEKYITSRYTDSNMPDLNLERWVLEVYRTIIETLQSIAW
FT                   LLFSFFVFALIAYVIVRIAGKRHQSNEAKKKINE"
FT   gene            496685..498016
FT                   /locus_tag="Ctha_0427"
FT   CDS_pept        496685..498016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0427"
FT                   /product="ATPase AAA-2 domain protein"
FT                   /note="PFAM: ATPase associated with various cellular
FT                   activities AAA_5; ATPase AAA-2 domain protein; SMART: AAA
FT                   ATPase; KEGG: plt:Plut_2054 ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12898"
FT                   /db_xref="GOA:B3QUJ2"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3QUJ2"
FT                   /protein_id="ACF12898.1"
FT                   /translation="MPVKDTLHQDIETRLAEIDQQLANLREEQERIQAKWQSQKELIMS
FT                   IRKLKSDIEEAKVQAEEFERQGNYGKVAELRYGKITQLEKELEQGKKKVEALRASGNML
FT                   MKEDIESKDIADVVSKWTGIPVSKMLQSERQKILNIEDELRKRVIGQREAIHAVSEAVK
FT                   RARAGLSDEKRPIGSFIFLGTTGVGKTELARSLAAYLFNDEDAMVRIDMSEYMEAFNVS
FT                   RLVGAPPGYVGYEEGGQLTEAVRRKPFSVVLLDEIEKAHPDVFNILLQVLDDGRLTDNK
FT                   GHTVNFRNTIIIMTSNLGSHLIQEEMAKLTDENKETILPELRAKLFDLMRKSLRPEFLN
FT                   RVDETILFTPLTREDLKQIVDIQFERIRQTAQKQNILLRITDEAKNWLGQLGYDPHFGA
FT                   RPLKRVMQRYITNELAEKILGGEVSDGDSIEIVLENNQLVFRKN"
FT   gene            complement(498106..499602)
FT                   /locus_tag="Ctha_0428"
FT   CDS_pept        complement(498106..499602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0428"
FT                   /product="Na+/H+ antiporter NhaA"
FT                   /note="PFAM: Na+/H+ antiporter NhaA; KEGG: sde:Sde_1762
FT                   NA(+)/H(+) antiporter 1"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12899"
FT                   /db_xref="GOA:B3QUJ3"
FT                   /db_xref="InterPro:IPR004670"
FT                   /db_xref="InterPro:IPR023171"
FT                   /db_xref="UniProtKB/TrEMBL:B3QUJ3"
FT                   /protein_id="ACF12899.1"
FT                   /translation="MGHNSNQNDCNEHMPGKQVEVDDSSYKAPFEDAFRKVMSPVQAFT
FT                   QNEIAGGLVLMLCLIVALIFANTELHDAYEHFIHTMVGVAIGEEVLEKSIHHWINDGLM
FT                   TLFFLVVGLEIKREAMVGELSSLSKAALPVIAAFGGMIVPASLYFLVNHEGAMVRGWGI
FT                   PMATDIAFAVGILALLGRHVPSSVMAFLLALAIADDLGAVLVIGIFYTEHLYLSYLAIA
FT                   AVFLGVLLLFNVMGVRSLTAYLLVGIFVWAAFLKSGIHATLAGVLVAMTIPVRPKYHPE
FT                   SFSNDMRCLLKRFDSYNKPASEKTSFAWGTFSNSKQAELVEEMDMAATQAASPLRKLEH
FT                   ALHPLAAFVIIPIFALANAGVVIHFEKIGEAVSNPVTIGVMLGLVVGKLIGIAGSTWIA
FT                   IKLKIGILPRGADFKHIIGVGLMGGIGFTMSIFVTELAFLGSHELLDSAKTGILFASAT
FT                   AGILGYLWMKYMTKPLPISGGENVDGSSEKTEKAYQLAEN"
FT   gene            complement(499961..502057)
FT                   /locus_tag="Ctha_0429"
FT   CDS_pept        complement(499961..502057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0429"
FT                   /product="dehydrogenase E1 component"
FT                   /note="PFAM: dehydrogenase E1 component; Transketolase
FT                   central region; Transketolase domain protein; KEGG:
FT                   sru:SRU_0576 2-oxoisovalerate dehydrogenase, E1 component,
FT                   alpha and beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12900"
FT                   /db_xref="GOA:B3QUJ4"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:B3QUJ4"
FT                   /protein_id="ACF12900.1"
FT                   /translation="MMLENVEGLDIKHRNSNGLNHKYNYSVTISKEQILRAYTQIYRTR
FT                   QLDNKLLILLRQGKAPFHVGAAGHEIAQVAMAMHIKPGQDWSYPYYRDLAYCLELGMSV
FT                   EDVVLEFLAKDVSPISGGRQMYGHWSHNDLRIPTQSSPTGSQYLHAAGTAIACKRENEL
FT                   RKEGEKEIVFVSSGEGATSEGEFHEALNWATREKLPVVFLIEDNGYAISVPIEEQTTGQ
FT                   SIYKVAAGYSGLTRFDVDGGNFFEMYAAAQKAVDICRRGDGPCLIRASVVRLLPHSSSD
FT                   NQAAYRSQDELESDKKRDGLLRLEKHILTEGVLSQKELTALQAEIYNKIEAAVTWALKQ
FT                   EDPRPESHADFVVSAEPPPISYESTTPQGRSLFMVESINQALAEELEHNPKMMVYGEDV
FT                   GNAKGGVFSATKGLSEKFGKGRVFNSQLAENSIIGTAVGLAFKGYKPVVEIQFGDYIWP
FT                   GMMQIRNELALIRYRSKGCWSSPVVVRVAIGGYIHGAMYHSQNVEGFLAHIPGLFVVYP
FT                   SNAADAKGLLKTACRMDDPVIFLEHKYLYRQGFAKSPEPDKNYFLPFGKARVVQSGNDA
FT                   TVITYGATVRLAQEAAAKIQEETNRTIEILDLRTIIPYDKEAIAASVKKTGKVLVLHED
FT                   TLTQGFGGEIIAFISENCFEFLDAPVYRLGAADTPVPNHPNLELAVLPSKESVYRKLAA
FT                   LVAY"
FT   gene            complement(502103..502828)
FT                   /locus_tag="Ctha_0430"
FT   CDS_pept        complement(502103..502828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0430"
FT                   /product="lipoate-protein ligase B"
FT                   /note="TIGRFAM: lipoate-protein ligase B; PFAM:
FT                   biotin/lipoate A/B protein ligase; KEGG: gfo:GFO_2925
FT                   lipoyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12901"
FT                   /db_xref="GOA:B3QUJ5"
FT                   /db_xref="InterPro:IPR000544"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR020605"
FT                   /db_xref="UniProtKB/TrEMBL:B3QUJ5"
FT                   /protein_id="ACF12901.1"
FT                   /translation="MTAKHIQVVSIGKIAFEEAWQLQREIFERVRKQEMPSTVLMLEHF
FT                   PVYTLGKTAQRSHLLLSEAALRAEGISVFEIDRGGDITFHGPGQFVAYPILNMNEFYLD
FT                   VHRYLRDLEEVIIRLLQTFGIFSERKISSQPGKSFTGVWVGNAKICAMGVRFSHWTTMH
FT                   GLALNVRTDLKFFGGIIPCGIRDKEVTSMRKIASRDFLLKEIEACFLQHFQAVFNVVAK
FT                   KISFSEVKEQVGGDFISFK"
FT   gene            503355..504449
FT                   /locus_tag="Ctha_0431"
FT   CDS_pept        503355..504449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0431"
FT                   /product="glycosyl transferase family 9"
FT                   /note="PFAM: glycosyl transferase family 9; KEGG:
FT                   gme:Gmet_2881 ADP-heptose:LPS heptosyltransferase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12902"
FT                   /db_xref="GOA:B3QUJ6"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="UniProtKB/TrEMBL:B3QUJ6"
FT                   /protein_id="ACF12902.1"
FT                   /translation="MNLKTDCKFFRGDAPCKPHKKEGVHCENCSHYQPISHRILIIKLG
FT                   ALGDVIRTTPILEALRNIYPNAHIYWLTYATDILPDTVDRKLPFTAGSTLILEETEFDL
FT                   AFNFDKDLEACALLNRVRAKKKKGFGLKHGVCTPLDSDVEHKFLTGVFDDISKANTKSY
FT                   PQEIFEIAGLSFSGEAYQLDNTEAGKTVWPVDKEKKIVGLNTGCGERWPSRLWPNDYWQ
FT                   ALMSGLLKSGYEVVLLGGASEHEKNQSLSKATGAKYFGHFSLKKFIDLIDQCDIVITQV
FT                   TMAMHLAIGRKKRLILMNNIFNKHEFELYGHGEIIEPSTGCDCYYLAKCKREAEGGVPC
FT                   MRDILPGEVLSAIDRQAKLVEKAS"
FT   gene            504446..505591
FT                   /locus_tag="Ctha_0432"
FT   CDS_pept        504446..505591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0432"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   sru:SRU_2402 glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12903"
FT                   /db_xref="GOA:B3QUJ7"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:B3QUJ7"
FT                   /protein_id="ACF12903.1"
FT                   /translation="MKISYISTFFPLRGGIAHFNTLLYKELSARGHQLHAITFSRQYPK
FT                   LFFPGKTQEETGGGEEIFKTHAEILLDSINPFSWIRVGWRVRKQAPDIILFKYWITFFA
FT                   PAYFTISFVAKLFRKTKVIFILDNFFPHEKRFGDAFLHELAIRTADGYLAMSEKVERDI
FT                   QTHLPRALYIKAPHPVYNIFGDAIAKSEARALLGLNPNEKVILFFGYIRKYKGLDLLLD
FT                   ALPQLLKKYPDLKLLIAGEFYGDEAEYRKKIDDMGLWKHLLLQSDYIPNHEVARYFCAA
FT                   DCIVLPYRSATQSGIAQIAYHFERPAIATNVGGLKEVVLDGKTGYLASSSEPKEIAAAI
FT                   IRFYEAFGKVDFEKHMREEKKKYSWENFANAIEQLAEKLQA"
FT   gene            complement(505713..508124)
FT                   /locus_tag="Ctha_0433"
FT   CDS_pept        complement(505713..508124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0433"
FT                   /product="DNA topoisomerase I"
FT                   /EC_number="5.99.1.2"
FT                   /note="KEGG: cte:CT0055 DNA topoisomerase I; TIGRFAM: DNA
FT                   topoisomerase I; PFAM: TOPRIM domain protein; DNA
FT                   topoisomerase type IA central domain protein; DNA
FT                   topoisomerase type IA zn finger domain protein; SMART: DNA
FT                   topoisomerase I ATP-binding; DNA topoisomerase I
FT                   DNA-binding; Toprim sub domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12904"
FT                   /db_xref="GOA:B3QUJ8"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005733"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013498"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR028612"
FT                   /db_xref="InterPro:IPR034149"
FT                   /db_xref="UniProtKB/TrEMBL:B3QUJ8"
FT                   /protein_id="ACF12904.1"
FT                   /translation="MPAKKSTTGNVGSAKGKKLVIVESPSKAKTINKYLGKDFAVYASV
FT                   GHIKDLPKKEIGLDFEHHYEPRYEVIEGKEKVVREMKKLAGEADEIMIATDPDREGEAI
FT                   AWHIANEVSGAKKPIRRVLFNEITARAVKEAIQETRDIDYSLVRSQQARQAMDKIVGYR
FT                   ISPFLWDTVLRGLSAGRVQSVALRLICEREAEIDAFETKEYWSILADFTTESGEKFTAK
FT                   LVKQNGKDIEIPNEAEAKRLLDLLNARLYAISEIRRRKTKRNPPAPFTTSLLQQSASNR
FT                   LGYGSKKTMSLAQQLYEGIEIGSEGAVGLITYMRTDSKRISQDAQEEARKFIQQAFGED
FT                   YTPEKPKQYKTSEKAQDAHEAIRPTSVFRKPSDLAPFLSKDQLRLYELIWKRFVASQMS
FT                   PAELEQTGVDISDHEKEFIFRASGSVVLFDGFLKIFGDQRELDYEERKSTKEEASEEDA
FT                   PTKLPKNLKEKESLTLDALKENQHFTKPPARYSEASLVKELDNYGIGRPSTYASIISTL
FT                   LDRKYVELRQRRLNPTELGKDVSRILIANFPELFNVTFTAGMENNLDKVAAGDDDYESL
FT                   LDNFYKPLEETLGVRKANPILPQNENAEVCDKCGEGRMVVKWTKSGKFLGCSRYPKCKN
FT                   IKPIAVEKPKPVETGIKCSKCESGRMVVREGRFGKFLACTNYPECESLLNINKKGQVEP
FT                   PKVPPLTTELACPNCGAPLYLREGKRGLWLGCSKFPKCRGRKSWNDLDDETRAKLEAAH
FT                   SANLAKHPPVEIKMLDGSPLNLNAKLEDLISNASDFVKGIEESAEAEIDS"
FT   gene            complement(508280..509140)
FT                   /locus_tag="Ctha_0434"
FT   CDS_pept        complement(508280..509140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0434"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cch:Cag_1091 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12905"
FT                   /db_xref="InterPro:IPR010106"
FT                   /db_xref="UniProtKB/TrEMBL:B3QUJ9"
FT                   /protein_id="ACF12905.1"
FT                   /translation="MSYLQEKYINPLTDFGFKKLFGTEPNKILLMDFLNQILPEKHQIQ
FT                   ELSYSKNEHVGQQELDRKAIFDVYCVGQSGERFIVEVQKAKQNYFKDRSIYYASFPIQE
FT                   QAKRGNWDDKLEPVYTVGILDFIFDDHKLDAELIHVVALKKSAQRSFSDKLKFIYIELP
FT                   KFKKTEAELETQFDKWLYVFRHLSQLQKRPTKFQEKIFEKLFEAAEIAKFSKNELVAYE
FT                   ESLKYYRDMKNVVDTSKEEGWLEGQKAGCEQRNYEIARVLKAKGMPIQEISEITGLTAQ
FT                   EIEHL"
FT   gene            complement(509223..509936)
FT                   /locus_tag="Ctha_0435"
FT   CDS_pept        complement(509223..509936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0435"
FT                   /product="cobalt transport protein"
FT                   /note="PFAM: cobalt transport protein; KEGG: tpe:Tpen_1104
FT                   cobalt transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12906"
FT                   /db_xref="GOA:B3QUK0"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="UniProtKB/TrEMBL:B3QUK0"
FT                   /protein_id="ACF12906.1"
FT                   /translation="MLQLSENSAMTSVNPLVKFLFIAALTLGIFLSDDILRLSAASLYL
FT                   FALFYFGKIRLKEVKWFLLVFFASVPFTYAVFIASFWVEENRLSYGLEKGTIEATIFTL
FT                   RLLILLLANLIFVKTTDIRRFSEQLHAIRVPRSITVLISTVFRFLPLIIDESARILEVQ
FT                   RVRGLKPTHLLKPRYFLPLVVPLITLNMQRAYEMALSMQLRGGLFPKKSQPVRFSKYDA
FT                   LAIANALGFALILMA"
FT   gene            complement(510022..511674)
FT                   /locus_tag="Ctha_0436"
FT   CDS_pept        complement(510022..511674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0436"
FT                   /product="ABC transporter-related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: mba:Mbar_A3550 cobalt transport ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12907"
FT                   /db_xref="GOA:B3QUK1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3QUK1"
FT                   /protein_id="ACF12907.1"
FT                   /translation="MPVQIEVQHLSFTAWETKENLLQDVSLSVHQGERIGLVGASGSGK
FT                   TTLTYFLAGVQRMALAGKTEGRIFYNGISADDFFENPEPDFRVGMALQNPDSQIFSATV
FT                   YEEIGYGLPEDALFDKKLNAALEQVGLEKLKHAPIRSLSLGQKQRVVIASFLVHEPDFF
FT                   ILDEPTNSLDAPATDALFEVLDHLKSTILIIEHDVERLCDWAQRMVEMEAGKIVAEGSP
FT                   ERWLQETRRLPKLYRIGAALARPEHRESIFVRPSKLLHFSPECSRENNFQTQSTAQKPE
FT                   SEPLLRLETVHCGYKKDQPVLSDISFSVRKNERLAILGHNACGKTTLLKHLAGILQPIS
FT                   GDIFLNNRKMNHEPPEKRFGQVGFVFQNPDYQLFETTVERECGFCLRTQSASESEISEK
FT                   TAFWLKRFGLASLNTRSPLSLSFGEKRRLTLASVLVSGAELIALDEPTTALDEENISIL
FT                   KKLLLDLSESSGKTLIFATHDVDFALDVATRILVIGNGGLLADFPVDEISNEDFHAMQI
FT                   SLPFSSRLAINSGFLDYPVGSQKILTALNQNQS"
FT   gene            511928..512779
FT                   /locus_tag="Ctha_0437"
FT   CDS_pept        511928..512779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0437"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12908"
FT                   /db_xref="UniProtKB/TrEMBL:B3QUK2"
FT                   /protein_id="ACF12908.1"
FT                   /translation="MLHFLLPKELHPIFDHIPSSALHVVGWGSVLPSVITVGRRLAFDE
FT                   GKHEMIADLTPLLPAHVQFSLEHRRCQHHRQDDEADTHPGLINAEHLSEDEAERKRFGE
FT                   AVLEVFFSQLFSEKGFFIDLREHGFSLDAEAIYWNPPNLWYHLEHNFRIGLLKIYEGYF
FT                   FGPFSEVEAGLSDLGLFTEDHASNQKVVDLLLSHFGTGEQRDVLFEIEPFAESFEQFFD
FT                   YLKAKNMQLDANFIYFGIYLITLYLCLDKLKVPLDAREAFTNARTRLAKENLDNQMDSA
FT                   VS"
FT   gene            512998..514206
FT                   /locus_tag="Ctha_0438"
FT   CDS_pept        512998..514206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0438"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mmw:Mmwyl1_2441 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12909"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3QUK3"
FT                   /protein_id="ACF12909.1"
FT                   /translation="MAWIRPKTITGPPAEGERYLRREYINSGFWHHIKSGAHIVFSAPR
FT                   RVGKTSIMKDLAKNPPEGILAFYDIIESDKTQKDLFKRLFNLLLERTKTHERLFERIRQ
FT                   YLKEIKIGGASVTGEADSITGGINFDKVELDYKNELLRLIEHLGKEKVRIVFLLDEFPE
FT                   VIRSIELSEGQQTAIDTLHTLREIRQHEKFKNFTFVFAGSIGIHHVVASLERPALINDL
FT                   HPIHVEQLTNDEAHELLAQLLDGATMQIGDDKKAYFLRKIDHRLPYYIQLMVEKCDEIL
FT                   NKAGRDVLTNHDIDAAFEMIIKEGRNFDDWESRLKRYVQREDAKYCIGILTRCAHSEPY
FT                   SIQEAYNYSKKDVPAAPYKQLLDNVLIKDGYLVEENRSYRFLSPFLKEWWKHRHPKFEI
FT                   EDL"
FT   gene            514875..517976
FT                   /locus_tag="Ctha_0439"
FT   CDS_pept        514875..517976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0439"
FT                   /product="TPR repeat-containing protein"
FT                   /note="PFAM: TPR repeat-containing protein; Sel1 domain
FT                   protein repeat-containing protein; SMART: AAA ATPase;
FT                   Tetratricopeptide domain protein; KEGG: mmw:Mmwyl1_2442
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12910"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041664"
FT                   /db_xref="UniProtKB/TrEMBL:B3QUK4"
FT                   /protein_id="ACF12910.1"
FT                   /translation="MNPITFYQAAHLTDEEVIRQFVVRKKEFERVISEVRRDDMLGSIQ
FT                   HYIFVGQRGSGKSTLLRRILAEINTDEALSEKLVAIYPSEEQAGIYRLDDLWDRVCQEL
FT                   REMRFETEEVKWEAYEKDHTGFAKALYGAMQKSLAEKGKKLVLLIDNIDRIFDSIKVSD
FT                   DTHLFREQLIKYKDVRIIGGSTRLSEHFWQYDQPFYEFFRTLPLEPMTEAELKELLLFW
FT                   SDFLGEPDLKKFVENNPGKLNAVRILSDGMPRTMLGLVELFLKQPDRHGYDYLRYILDR
FT                   ATPVYQERLGKLSPMQQKVVLELSFFWDVAKVKDLSQAARVESKTLSALLGQLTDLQIV
FT                   EKIKGTGKNHLYRLKERFFNLWLIMTQGGPREKSRVKWLTIFLETWYDATELKTIYRDF
FT                   STRLTEGKITPDRAVVMTKALAHCRYLSMDERDELLEQTKKLIGNRKEHLDFLPPKAGD
FT                   VFKNVIGLIEQKRLDEAQKELDSIEQDGALKQMLQGLIYDESGNFNEAEKFYLMAIDNG
FT                   DVGAMFGLANLYKETNRKEEAEKYYLMAIDNGDVQAMNNLANIYQKTNRKEEAEKFYLM
FT                   AIDNGVAQAMNNLAILYENTNRKEEAEKFYLMAIDNGNVSAMFNLAILYENTNRKEEAE
FT                   KFYLMAIENGVAQAMNNLAILYENTNRKEEAEKFYLMAIKNGDVNAMNNLALLYQETNR
FT                   KEEAEKFYLMAIDNGNVSAMTNLGLLYQETNRKEEAEKFYLMAIDNGNVSAMTNLGLLY
FT                   QETNRKEEAEKFYLMAIDNGHVQAMLGLANIYQETNRKEEAEKFYLMAIKNGDVNAMNN
FT                   LALLYQETNRKEEAEKFYLMAIDNGVAQAMNNLALLYRETNRKEEAEKFYLMAIKNGDV
FT                   NAMNNLAFLLYEENRNTEKAYSLIVRHNATEQKSIISTTLEMIIAVWSGRPERLESADE
FT                   LLREMVENKDVTWLEHFLREILIHHQKNVVWAWFRHAEFGQRLMDMARPLYYATARLLN
FT                   NNETEETLLAQAPELRETVDKIYNDIMERQEFYYGKGKQASPSA"
FT   gene            complement(518630..519154)
FT                   /locus_tag="Ctha_0440"
FT   CDS_pept        complement(518630..519154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12911"
FT                   /db_xref="GOA:B3QUK5"
FT                   /db_xref="UniProtKB/TrEMBL:B3QUK5"
FT                   /protein_id="ACF12911.1"
FT                   /translation="MITADFALGLAMKNLLAPTKILSIVRIDMVIPFMLMLVTRQLLDR
FT                   FGVLILYELVWGLFSVFAMPAAFGLPGLLKLIPAVAQGIILDVLMSSFKQNVKLRFFVS
FT                   GILGGLLSTLSYFAIRLALGMPWAKVVQILFGVQLLTGFLVWAAGAWLGVLVWENIKDS
FT                   QPARRLQFFGD"
FT   gene            complement(519278..520156)
FT                   /locus_tag="Ctha_0441"
FT   CDS_pept        complement(519278..520156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0441"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: amt:Amet_1511
FT                   cyclopropane-fatty-acyl-phospholipid synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12912"
FT                   /db_xref="GOA:B3QUK6"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:B3QUK6"
FT                   /protein_id="ACF12912.1"
FT                   /translation="MEMNFRTPEFWKHAWAEYLVDNAQGKAFSNQNIWNLVAGGYRKNE
FT                   SDLQKRQSADETMLRGFLEKGVLNEGIRILDVGCGPGTYAIPFAKLGAEVVAIDVSSAM
FT                   IERLRKETPPELAGKISSIVADWHDIDLRARGLMHAFDFVFARMTPATTEPEQFEKLNL
FT                   ASKKWVYSASWAGARHDTPMDELWRELTGARRERSNSHFFYAMNFLMSSGFFPEVQFHQ
FT                   IQWEKNEPIEQAFAFYSAFFANAITPKPDDLDEQIRAFLKSIEENGEIRGLKKGAIVEM
FT                   LWDVSVAPMWL"
FT   gene            complement(520279..520761)
FT                   /locus_tag="Ctha_0442"
FT   CDS_pept        complement(520279..520761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0442"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nve:NEMVE_v1g12544 predicted protein PROSITE:
FT                   CYS_RICH HIS_RICH MET_RICH"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12913"
FT                   /db_xref="UniProtKB/TrEMBL:B3QUK7"
FT                   /protein_id="ACF12913.1"
FT                   /translation="MLSSAKHPFVSVWIHRLSAQNDMISCLVMLSSAKHPFVSVWILRL
FT                   SAQNDMISCLVMLSSAKHPFVSMWIHRLSAQNDMISCLVMLSEVKHPFVSMWIHRLSAQ
FT                   NDMISCLVMLSSAKHPFVSVWIHRLSAQNDMIFFCHAERSEASIHEHVDSSPIGSE"
FT   gene            complement(521080..523383)
FT                   /locus_tag="Ctha_0443"
FT   CDS_pept        complement(521080..523383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0443"
FT                   /product="TonB-dependent receptor plug"
FT                   /note="PFAM: TonB-dependent receptor; TonB-dependent
FT                   receptor plug; KEGG: pca:Pcar_0454 TonB-dependent outer
FT                   membrane receptor for cobalamin and Fe transport"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12914"
FT                   /db_xref="GOA:B3QUK8"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:B3QUK8"
FT                   /protein_id="ACF12914.1"
FT                   /translation="MNFRLLLFGALFLLLSNFSADIFAQPMLRGKVMNSHGEPVFQATL
FT                   EVKESGSRTSSKMDGRFEFQNINAGTYHVKASHLGYEPVEITTKLGENDSSHVVIRFEK
FT                   EKEHVLDGITVTATRQAARPEDVPQPVAQISSEEVERSYRYNVGEMMDFIPGLRVIRSG
FT                   ATIGADYGISIRSLNGGPSSDKTLVLIDGRPLNNGWDGGINFNMLPTEMVERIEVVKGP
FT                   ASALYGSQATAGVINVIAKDPASGWHGKVSYIREFDASQEISDSDADGYARPDIGGTNV
FT                   SFNSTFGDVNTDHFLSFGYREATEDYLTNLSNDWENYDFNYRLKHQLTDKLHTTVSTDV
FT                   HQNSWLYNAESTPTDEHYRFVGADFALKYFAKNGQLNTRIYLNNVDYNELVLSTDSETG
FT                   FNTSRIGLMSDYTIPVFDGKGSLKIGLDGYLDVASVEYDDAVENLQFQGVQTILVKQKS
FT                   GAWKETTVDLYTGTYASRSDDYDLTNIALFAQYEHSFAQKLNILAGARLDNHSEFGTVF
FT                   NPKFGATYRLLTIGENTTTLKANYGKGYRAPNMRDLYSKSLGGYGDTDIEPEENESFDI
FT                   GIFQRFGDWGYLEVSYFTMKVKNLIINDKVGTSNGGYYVVVQNSSGSTDTSSFNYRKNL
FT                   GDYSPSGIEVGLKIRPIENITFSASYTYLDPEDFTFQTSENRYNASLYGWTDLESVRLE
FT                   AELTYNVTGDGYFFDYKSTPYEAFSLLDMMLAASFENYRISLIGKNLADTKYRLWHYEW
FT                   QPGRTLALRFEMSY"
FT   sig_peptide     complement(523309..523383)
FT                   /locus_tag="Ctha_0443"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.813 at
FT                   residue 25"
FT   gene            complement(523713..524534)
FT                   /locus_tag="Ctha_0444"
FT   CDS_pept        complement(523713..524534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0444"
FT                   /product="peptidase M48 Ste24p"
FT                   /note="PFAM: peptidase M48 Ste24p; KEGG: sus:Acid_5576
FT                   peptidase M48, Ste24p"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12915"
FT                   /db_xref="GOA:B3QUK9"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:B3QUK9"
FT                   /protein_id="ACF12915.1"
FT                   /translation="MKKFITRVLILLVAVASVSSCKTVRKLASNNNVYSVQDDVQLGKE
FT                   ADAQIKADTKNYTFLKSSDPNYRQVNAYVDKVMRKILSANAVPYETEFNYNVQVLKNDV
FT                   VNAFATAGGYLYFYYGLMKMLDNEAQLAGVVAHEMGHIAFRHATNEMTAQQITGGLVSL
FT                   GLKIGGAGETAEQVAGLAYNLAFLKYGRDAEEEADRNGAAWMAKTDYNPYEMQGFFKKI
FT                   LDSDRSPEFLSTHPDPANRIKYIGEVLKKMGAKNSGKTYTAEYQAFKKQLY"
FT   sig_peptide     complement(524466..524534)
FT                   /locus_tag="Ctha_0444"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.973) with cleavage site probability 0.422 at
FT                   residue 23"
FT   gene            complement(524649..525446)
FT                   /locus_tag="Ctha_0445"
FT   CDS_pept        complement(524649..525446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0445"
FT                   /product="tRNA pseudouridine synthase A"
FT                   /EC_number="5.4.99.12"
FT                   /note="KEGG: cte:CT0978 tRNA pseudouridine synthase A;
FT                   TIGRFAM: tRNA pseudouridine synthase A; PFAM: tRNA
FT                   pseudouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12916"
FT                   /db_xref="GOA:B3QUL0"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:B3QUL0"
FT                   /protein_id="ACF12916.1"
FT                   /translation="MVLPDSCEQSTFNIARSRRNLKMLLEYDGTDFAGWQRQPQNLHQK
FT                   TIQGEIESVLCRVLQEPVELIAAGRTDAGVHAKAQVANFLTENSLSISRLKHALNGLLP
FT                   SQIKIIEIEDAPENFNARFDAKSRTYRYFLLTRYSALLSRFTGIYRYDFDARAMNACCQ
FT                   EILGQHDFTSFSKAGSQTKTRICTIEKARWYQRKNGLMLEIRANRFLHSMVRLLVGTMI
FT                   KVGNGELSVQDFDAIFSAKDVCLAATSAQPQGLFLWHVEYKSA"
FT   gene            525450..527462
FT                   /locus_tag="Ctha_0446"
FT   CDS_pept        525450..527462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0446"
FT                   /product="alpha amylase catalytic region"
FT                   /note="PFAM: alpha amylase catalytic region; SMART: alpha
FT                   amylase catalytic sub domain; KEGG: cch:Cag_1381
FT                   alpha-amylase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12917"
FT                   /db_xref="GOA:B3QUL1"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:B3QUL1"
FT                   /protein_id="ACF12917.1"
FT                   /translation="MSLKKVLSSLSNLNTDATYQIPTLWNSNTISVQTVNPKTYFSEAI
FT                   QEILATPKQAFAPALQNDWTKSAVIYNLFARLTTAFDHNGDGALSLSPLENGFCETGTF
FT                   LKTIALLPYIKKLGVNTIHLLPITAIGHDGNKGSLGSPYAIKNPYKIDENLSEPTLGLD
FT                   VETEFKAFVEACHHLGIRVVMEFVFRTMSKDGDWIQEHPDWFYWIQSDIENREPGTTDE
FT                   NAYGNPIFSDEKLTEIKEKVRLEDFSKLPPPDEKYRCMFTETPESVEAQNGRLIGKLPD
FT                   GSTCKIPGAFADWPPDDIQPPWNDVTYLKMYDHPDFNYIAYNTIRMYDEALKQPAFRNK
FT                   ALWEQIIGIIPHYQDDFDIDGVMIDMGHALPFNLKKKLVETAREKKPDFAFWDENFTVS
FT                   ETSRKEGYNAVMGSLPFVSHKLHELKSYINYLGEIGVSVPFFGTAENHNFPRNVFRFGS
FT                   GEIGHRYAKFIWALASVLPAVPFIHSGMEICESFPINTGLDFTADEQKHFPSEKLPLFN
FT                   EHAYNWQNTNGMEPLGAFIKQILDIRQRFLSDLMRGEKGTMKVIESDNPSVFAVVRTGG
FT                   ERKIGFIGNYNFNGEEYFNLKIETERTALTDLFAGKSLAVENGKISASFSAGEFAIFEF
FT                   LIPKRFSYELEVELQFSDYLTKKTTCSCLYSLLAR"
FT   gene            527435..528346
FT                   /locus_tag="Ctha_0447"
FT   CDS_pept        527435..528346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0447"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein; KEGG: cte:CT0976
FT                   carbohydrate kinase, PfkB family"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12918"
FT                   /db_xref="GOA:B3QUL2"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:B3QUL2"
FT                   /protein_id="ACF12918.1"
FT                   /translation="MSLLIVGSLAFDNIETPFGNSDDTLGGSATYVAISASYFSDDIKL
FT                   VGVVGSDFGDDNIRLLQSKGIDTEGIQVIEGGKTFRWTGRYHYDMNTRDTLDTQLNVFA
FT                   EFDPVIPHRYQQCKYVCLGNIDPILQRKVLEQISRPKLTICDTMNFWIEGKPDELKKTL
FT                   ELVDVLVINDSEARQLSGDPNLVKSARIIRGMGPKILIIKKGEHGALLFTENGIFAAPA
FT                   YPLESIFDPTGAGDTFAGGFIGYIAKHDDISENTLRKAVLYGSTMASFCVEKFGPDRIQ
FT                   EISDLEIQDRFQSFLNLSRIED"
FT   gene            528525..529487
FT                   /locus_tag="Ctha_0448"
FT   CDS_pept        528525..529487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0448"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; Male sterility
FT                   domain; KEGG: sru:SRU_2708 UDP-glucuronate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12919"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B3QUL3"
FT                   /protein_id="ACF12919.1"
FT                   /translation="MNNQPVTVITGGAGFLGSHLCDRFIAEGHKVIAIDNFITGNPDNI
FT                   AHLMGNENFKFIKHDVTEFIYVEGKVDNILHFASPASPIDYLKLPIQTLKVGSLGTHKA
FT                   LGLAKAKGARFLLASTSEVYGDPLEHPQKETYWGNVNPIGLRGVYDEAKRFAESMTMAY
FT                   HRYHNLDTRILRIFNTYGPRMRLNDGRALPAFVHSALNGTPMTVFGDGSQTRSFCYVSD
FT                   LVEGIWRLLNSNETEPVNIGNPDEITILDFAKEVQTIVKELTGKDTEIIFKELPSDDPK
FT                   VRKPDNTKAKERLGWEPTINRAEGLRKTISYFFKQAGII"
FT   gene            529526..530410
FT                   /locus_tag="Ctha_0449"
FT   CDS_pept        529526..530410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0449"
FT                   /product="Methenyltetrahydrofolate cyclohydrolase"
FT                   /EC_number="3.5.4.9"
FT                   /note="PFAM: tetrahydrofolate dehydrogenase/cyclohydrolase;
FT                   KEGG: cph:Cpha266_0997 methenyltetrahydrofolate
FT                   cyclohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12920"
FT                   /db_xref="GOA:B3QUL4"
FT                   /db_xref="InterPro:IPR000672"
FT                   /db_xref="InterPro:IPR020630"
FT                   /db_xref="InterPro:IPR020631"
FT                   /db_xref="InterPro:IPR020867"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3QUL4"
FT                   /protein_id="ACF12920.1"
FT                   /translation="MVVLDGKKLSQEIKAELKTKVEQYKQEIQKVPGLTVIIVGEDPAS
FT                   QVYVRNKAKSCNEIGMASEVIELPASTSQEELLKKIADLNHNPNVHGILVQQPLPKHID
FT                   EFAVTLAIAPEKDVDGFHPENVGRLVLGHLDKCFVSCTPFGIIEILKRYNIETKGKHCV
FT                   IVGRSNIVGKPMANLMVQKLAYMNCTVTVCHSATPDIATYTKQADILIAAIGKARFITG
FT                   DMIKAGAVVIDVGINRIEATNTKSGYRLVGDVDFEAASQKASAITPVPGGVGPMTISML
FT                   LANTMKSFEHFLA"
FT   gene            complement(530558..530803)
FT                   /locus_tag="Ctha_0450"
FT   CDS_pept        complement(530558..530803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0450"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: prw:PsycPRwf_2007 4Fe-4S ferredoxin,
FT                   iron-sulfur binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12921"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B3QUL5"
FT                   /protein_id="ACF12921.1"
FT                   /translation="MALYITEDCISCGVCVDECPNNAIDYAESGYAINPDLCTECVGDF
FT                   DAPQCMENCPSEAIQPDPNYQESKEDLLAKKERISG"
FT   gene            complement(530951..531220)
FT                   /locus_tag="Ctha_0451"
FT   CDS_pept        complement(530951..531220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0451"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12922"
FT                   /db_xref="UniProtKB/TrEMBL:B3QUL6"
FT                   /protein_id="ACF12922.1"
FT                   /translation="MPLGDGTGPTWAKNQHAGKGAGNGGGRCNGHGRRHQDGAGMNAGG
FT                   RHYGALLETHGLKIEALSRELAELKAQFATQPAKGKADESSTTA"
FT   gene            complement(531288..531743)
FT                   /locus_tag="Ctha_0452"
FT   CDS_pept        complement(531288..531743)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0452"
FT                   /product="protein of unknown function DUF134"
FT                   /note="PFAM: protein of unknown function DUF134; Sigma-70
FT                   region 4 type 2; KEGG: dau:Daud_0090 protein of unknown
FT                   function DUF134"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12923"
FT                   /db_xref="InterPro:IPR002852"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3QUL7"
FT                   /protein_id="ACF12923.1"
FT                   /translation="MPRPFQIRKVTRLPKCKSFKPVGVPRKVLEQAILALDEYEAIRLA
FT                   DYLKLEHLEAAEKMGISRPTFTRLIERARTKLASAIIEAKELVIEGGHIDLQSTRLRCS
FT                   DCGEEQQAEPSESSQNCPECGSENVEDMKLFFTGAKHGRQRRRRGRA"
FT   gene            532185..533243
FT                   /locus_tag="Ctha_0453"
FT   CDS_pept        532185..533243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0453"
FT                   /product="DNA polymerase III, delta subunit"
FT                   /note="TIGRFAM: DNA polymerase III, delta subunit; PFAM:
FT                   DNA polymerase III delta; KEGG: cch:Cag_0224 DNA polymerase
FT                   III, delta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12924"
FT                   /db_xref="GOA:B3QUL8"
FT                   /db_xref="InterPro:IPR005790"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR010372"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3QUL8"
FT                   /protein_id="ACF12924.1"
FT                   /translation="MAKKAVFNDIEAALKQKRFQPIYFFFGREDFLIEELVRIIKAEAF
FT                   HSAEDSNLNFTLLYGEEQTLGDVVSVASEYPMFSERRLVVVKSFDKLKKDRSREKQKAQ
FT                   TALFTEYLKNPLPSTILVLTTGKLDKATLSKEPFPLLQSFSYEFDQIQDAGRFAEERAK
FT                   RYGWTLSPQAIKILVTFAGNSARELDAEIQKLSLFADGKSGEKILTDAEVLQTVGLSRE
FT                   YNVFELDKAIVAGDLRMASGIALMILEHEGEKTGLFAILNYLIMFFTRLWKLKMPAVQR
FT                   MTHADIAKELGMYGSQAYFLKDYLSYTGRFSVLQIENALIALHEADLALKGILPIQDEK
FT                   LLILSLMRKILT"
FT   gene            533365..534333
FT                   /locus_tag="Ctha_0454"
FT   CDS_pept        533365..534333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0454"
FT                   /product="CHAD domain containing protein"
FT                   /note="PFAM: CHAD domain containing protein; KEGG:
FT                   cyt:cce_0662 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12925"
FT                   /db_xref="InterPro:IPR007899"
FT                   /db_xref="InterPro:IPR038186"
FT                   /db_xref="UniProtKB/TrEMBL:B3QUL9"
FT                   /protein_id="ACF12925.1"
FT                   /translation="MSESKKKNVETLGSRARKAVRKHYKKILRHEQPVREDKDPEELHQ
FT                   MRVAMRRLRSVASGFSPILSLPKAASQKQIGKFSRTLGALRDLDILLESLEKRYAPELL
FT                   KREKPHFQKMVFELYARRSMILATVRDMLASESYAAFKSAMDDWLKVPEMNRTSQMPIQ
FT                   SALPDLLFPMVNQLFLHEGWMPGVRLHRGELIPPDNFSLRKLNFLLKTEGSLLHDLRKQ
FT                   IKRVRYQLAFFTDLYGETYTAYVNDTKHMQDMLGLIQDSLVLEATLQEFHGELYKKRIP
FT                   TVVKMLMAERLAAWQEWEKIRTIYLLEETRDNFRRELLNLK"
FT   gene            534498..534950
FT                   /locus_tag="Ctha_0455"
FT   CDS_pept        534498..534950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0455"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   vha:VIBHAR_05581 ribosomal-protein-alanine
FT                   acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12926"
FT                   /db_xref="GOA:B3QUM0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B3QUM0"
FT                   /protein_id="ACF12926.1"
FT                   /translation="MIYRHATPKDMLQVAALDRDVWHVNNHSDFIPDGEHAWRIWIEIA
FT                   FVCVAEENDHILGCSLVFPGFDDSLCLHKLFVHNLHQGKGIGRKLIEETVHFSDKLGKP
FT                   IWLTVDPQNQKSIALYEKFDFKITSHVEGFYRADEHRFIMRRTPLK"
FT   gene            complement(535042..536796)
FT                   /locus_tag="Ctha_0456"
FT   CDS_pept        complement(535042..536796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0456"
FT                   /product="succinate dehydrogenase, flavoprotein subunit"
FT                   /EC_number="1.3.99.1"
FT                   /note="KEGG: sru:SRU_0485 succinate dehydrogenase
FT                   flavoprotein subunit; TIGRFAM: succinate dehydrogenase,
FT                   flavoprotein subunit; succinate dehydrogenase or fumarate
FT                   reductase, flavoprotein subunit; PFAM: fumarate
FT                   reductase/succinate dehydrogenase flavoprotein domain
FT                   protein; FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12927"
FT                   /db_xref="GOA:B3QUM1"
FT                   /db_xref="InterPro:IPR003952"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR011281"
FT                   /db_xref="InterPro:IPR014006"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:B3QUM1"
FT                   /protein_id="ACF12927.1"
FT                   /translation="MALFTHDVVIVGAGLAGLRAAVELAGQCDVAVVSKLHPLRSHTGA
FT                   AQGGICAALGNEEEDSPLWHAYDTVKGSDYLGDQDAIEIMCNDAPRAIIEMEHYGVPFS
FT                   RTPEGKIAQRPFGGHTRNFGEAPVRRACYAADRTGHVCLHTLYEQSVRRNVRFYDEFQV
FT                   LDLCETDGVICGVVAYEIRTGEVHVFNSKVVMFATGGYGRAWKTTSNAHANTGDGLGIV
FT                   LRHNMPLEDMEFVQFHPTGLYRLGILVTEGARGEGGILKNSKGERFMERYAPTVKDLAP
FT                   RDVISRCIYMEIAEGRGIGPNKDYVELDLTHLSLKQIETKLPEISTFAKIYLGVDPSKN
FT                   PIPVQPTCHYAMGGIPTDVNGRVVIDEKNTPKIGFWAAGEAACVSVHGGNRLGTNSLLD
FT                   LIIFGRRAGKDILEFVKKTKGIMPVQENATDNAKARIKALLDRTSGESVGKVREDLQRM
FT                   MMDNVSVFRNEERLSAAQNAIKDIRERTKKICIQDKGKEFNSDLLDAIELEFMVDYAQT
FT                   VVECAYNRKESRGAHAREDYPTRDDANWLKHSLCWLDEAGNVEIKFKPVNMKLANEDPR
FT                   FIPKERKY"
FT   gene            complement(536851..537369)
FT                   /locus_tag="Ctha_0457"
FT   CDS_pept        complement(536851..537369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0457"
FT                   /product="succinate dehydrogenase, membrane subunit,
FT                   putative"
FT                   /note="KEGG: sru:SRU_0486 succinate dehydrogenase, membrane
FT                   subunit, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12928"
FT                   /db_xref="GOA:B3QUM2"
FT                   /db_xref="InterPro:IPR014312"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:B3QUM2"
FT                   /protein_id="ACF12928.1"
FT                   /translation="MEKRAAKQSGAFGWFFQRISGMLLLATLIGHFWVQHMPTDALSNP
FT                   EEYRAIRQAYMEKYPEYKAAVEHGKISEARAGEHLITYEKVTTRLSNPIWKIFDLLFLI
FT                   FGLYHGMNGLLNIIDDYVRHTGLRLTLVSFCWVLAALLLVQGGLTVITAGVYQPPLGLE
FT                   NILSGLALK"
FT   gene            complement(537396..537839)
FT                   /locus_tag="Ctha_0458"
FT   CDS_pept        complement(537396..537839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0458"
FT                   /product="succinate dehydrogenase, cytochrome b556 subunit"
FT                   /note="TIGRFAM: succinate dehydrogenase, cytochrome b556
FT                   subunit; PFAM: succinate dehydrogenase cytochrome b
FT                   subunit; KEGG: sru:SRU_0487 putative succinate
FT                   dehydrogenase membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12929"
FT                   /db_xref="GOA:B3QUM3"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR014314"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="InterPro:IPR039023"
FT                   /db_xref="UniProtKB/TrEMBL:B3QUM3"
FT                   /protein_id="ACF12929.1"
FT                   /translation="MAEKEQEPRLAAKLKYKPSFPNALKSIFSYNWHGGMWAWLLHRAS
FT                   GIGLVVYLIIHINGLRSMYDPVKFDMAMSAYRSPLFKIGELVILALVAYHSINGFRIVM
FT                   IDFLGWTPQQKRMFFATVALSIVIIALGGYPIVAPYFINTLGN"
FT   gene            complement(538035..540296)
FT                   /locus_tag="Ctha_0459"
FT   CDS_pept        complement(538035..540296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0459"
FT                   /product="TPR repeat-containing protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: cch:Cag_1453 TPR
FT                   repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12930"
FT                   /db_xref="GOA:B3QUM4"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:B3QUM4"
FT                   /protein_id="ACF12930.1"
FT                   /translation="MQAFLQQYKWLMLYGLALLGSAWYFRHTNRLKAFVRAGWPIGLLL
FT                   SGFLWLLVLPSLYENGLFRDFSLNPYEVILHLIKIEKWLLSGTLVATVVLSVGLNVFSS
FT                   ALYGLLFPSAEKEILENTEALAQGQEQIKSGISETSEKMDKLLLQAGLDPRDVERYLKD
FT                   LPIKNGERKTREKIQEWYDERKISATEKELLFVAVTAIYKYNKELSAEIKKLKAEGNTE
FT                   LASFLETIQKYFEEGNAGKIRDEYFLIEKQIEAEAEQKKIKALKESIKATQALFAIEAT
FT                   KDLYTELLALEPSAENYFNCAYFLQKQNSFRDAGDYYENALKKYREQEKENPDAFLPDV
FT                   AMTLNNLANLHSDQHEYEAALNAFNEALSIYRQLARRNPDAFLPNVAMTLNNLANLHYA
FT                   KHEYEAALNAYNEALEIRRQLARRNPDAFLPYVATTLNNLGLLHSDQHEYEAALNAFNE
FT                   ALSIYRQLARRNPDAFLPDVAMTLNNLATLHYAKHEYEAALNAYNEALEIRRQLARRNP
FT                   DAFLPYVATTLNNLATLHYAKHEYEAALNAYNEALEIRRQLARRNPDAFLLYVATTLNN
FT                   LATLHSDQHEYEAALNAYNEALEIRRQLARRNPDAFLPYVATTLNNLAILHSDKHEYEA
FT                   ALNAYNEALEIRRQLARRNPDAFLPYVATTLNNLAILHSDKHEYEAALNAYNEALEIRR
FT                   QLTKENPSVYDIDYANTLILGAMLSDNNKSNLTEAKRLLEKYPHVYRAQELLKIIQELE
FT                   "
FT   gene            complement(540484..540888)
FT                   /locus_tag="Ctha_0460"
FT   CDS_pept        complement(540484..540888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12931"
FT                   /db_xref="InterPro:IPR021866"
FT                   /db_xref="UniProtKB/TrEMBL:B3QUM5"
FT                   /protein_id="ACF12931.1"
FT                   /translation="MTATVSMDLSQHLVRIDFSGKLDVKDIIRSLKNLIENPDYQKGTS
FT                   LLFDFSEAYIDADYYELDRLRNYISAICDFLGECKCAFVTHNNPSKVVIKLLSIMCEAY
FT                   HLGFHAQIFEEQAAALKWLQAEDVNQLHQV"
FT   gene            541289..543121
FT                   /locus_tag="Ctha_0461"
FT   CDS_pept        541289..543121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0461"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   ttj:TTHA1250 acetyl-coenzyme A synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12932"
FT                   /db_xref="GOA:B3QUM6"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B3QUM6"
FT                   /protein_id="ACF12932.1"
FT                   /translation="MINITETNRLIKPPAYLRDAAHIQNYESTYARSIENPDAFWDEIA
FT                   SGFIWENKWTKVCEVQPPYHRWFVGGTTNITLNMLDRHIVGHRRNKVALLWASENGREV
FT                   VVTYDRLLRRVCQLANALTMSGVRKGDTVLIYMPNTVEFVYAMLACARIGAIHASVHTG
FT                   LGVQALRERIESVRPKVVFCADATLSGGKVIALKPMLDDALQGNDCVEKIVVLRRQEPK
FT                   IELYSGLEVDFYDFLIGMPQWINPEIVESSHPLFVYFTTDAAGAPKGIVQAQGGYMVGS
FT                   AYYTRIFFDLQDSDILWNTSDLSWITGHTNGIYGPLLNGATLYFREGALTTPNTEATWA
FT                   AIERHGINILSTMPTTLRILKSFGAAFSEKYDLSTLRLVASTGEPLPAELYSWASEFVA
FT                   GRNGFVANSWWEAELGAPMLGTLMANEAKLNFVGKPFPGVALEVVQTDGSSAAPNQPGK
FT                   LAILRPVPTMLSETWQNQEQYSAYWSQIPGRFATGDDALKDEDGFFAILGRHDDALIIG
FT                   GFRIGVHEIEQTLAKHPAVKEAAIFGVPDSVTGTKLKAWVVLHQETSAPERTRSMLYGY
FT                   IFHELGRMAVPGEIVFCDALPQLGDGSRALQHPR"
FT   gene            543329..543574
FT                   /locus_tag="Ctha_0462"
FT   CDS_pept        543329..543574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0462"
FT                   /product="glutaredoxin 2"
FT                   /note="PFAM: glutaredoxin; glutaredoxin 2; KEGG: cte:CT0237
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12933"
FT                   /db_xref="GOA:B3QUM7"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR008554"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B3QUM7"
FT                   /protein_id="ACF12933.1"
FT                   /translation="MLLVELYSKKGCCLCDEAKKVLLKVKHEIPFEFRETKIQEDEDLL
FT                   HEYGTKIPVVFINGRLAFKYHVYELELKELLLSEMS"
FT   gene            543589..544239
FT                   /locus_tag="Ctha_0463"
FT   CDS_pept        543589..544239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0463"
FT                   /product="deoxynucleoside kinase"
FT                   /note="PFAM: deoxynucleoside kinase; KEGG: sru:SRU_0956
FT                   deoxyguanosine kinase/deoxyadenosine kinase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12934"
FT                   /db_xref="GOA:B3QUM8"
FT                   /db_xref="InterPro:IPR002624"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031314"
FT                   /db_xref="UniProtKB/TrEMBL:B3QUM8"
FT                   /protein_id="ACF12934.1"
FT                   /translation="MSFEARRLKYIAIEGVIGVGKTSLAKKLSEKCGHRLLLEEFEENP
FT                   FLASFYQNPQCFALPAQLFFLLRRYKQQHQISEISLAANGLISDYSFQKNDIFAKTTLN
FT                   KEEFSLYSAYAEILQANIPKPDLVVYLQSTPERLIKNIHQRARRYEHCIESPYIKKLHA
FT                   AYNEFFFAFASSNQCVIDVSQLDFVENPRDFERLYRIIFCGDMNDKLVIKKPE"
FT   gene            544303..544509
FT                   /locus_tag="Ctha_0464"
FT   CDS_pept        544303..544509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0464"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12935"
FT                   /db_xref="UniProtKB/TrEMBL:B3QUM9"
FT                   /protein_id="ACF12935.1"
FT                   /translation="MIRSILFLILGYLVFQMVKKLLKQSISEAASNRAPFEGQAPRSNK
FT                   RSPIDQIQDAEYVEIDSKLKENS"
FT   gene            544654..545202
FT                   /locus_tag="Ctha_0465"
FT   CDS_pept        544654..545202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0465"
FT                   /product="protein of unknown function DUF150"
FT                   /note="PFAM: protein of unknown function DUF150; KEGG:
FT                   cte:CT0239 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12936"
FT                   /db_xref="GOA:B3QUN0"
FT                   /db_xref="InterPro:IPR003728"
FT                   /db_xref="InterPro:IPR028989"
FT                   /db_xref="InterPro:IPR028998"
FT                   /db_xref="InterPro:IPR035956"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3QUN0"
FT                   /protein_id="ACF12936.1"
FT                   /translation="MMDSRLKLIQDWLLQLLAEMTVSDPDGNEHEVFLVDIEVHSNKTI
FT                   DIIEVFADTDSGISVENCKFLSKHISAELDASEEMQALLPRHFKLVVSSPGLSRPLTMN
FT                   RQYKKNIGRLMQVTYQNADGEIKTIDGRFISLEEEAEASITLDITKIQKSKPNAKPKPP
FT                   ELVTIPFSQIQKAIVQVEF"
FT   gene            545268..546863
FT                   /locus_tag="Ctha_0466"
FT   CDS_pept        545268..546863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0466"
FT                   /product="NusA antitermination factor"
FT                   /note="KEGG: pvi:Cvib_1562 transcription elongation factor
FT                   NusA; TIGRFAM: transcription termination factor NusA; PFAM:
FT                   KH type 1 domain protein; NusA domain protein; SMART: KH
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12937"
FT                   /db_xref="GOA:B3QUN1"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR010213"
FT                   /db_xref="InterPro:IPR013735"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR025249"
FT                   /db_xref="InterPro:IPR030842"
FT                   /db_xref="InterPro:IPR036555"
FT                   /db_xref="UniProtKB/TrEMBL:B3QUN1"
FT                   /protein_id="ACF12937.1"
FT                   /translation="MAKKQAKLSESDERKAQILRAFGEIENSDRLKDKKADTNAVKMDI
FT                   VDLLRDTIQKQLRKDYDPEVEARVIINPDRGDFEVYILKQVVEEIDLPSIEISLEEAQE
FT                   IDDSLELGDFYEVGPIHLEDYLTRKSIQIIKQAVQKKMRDAERQAIYEECLEKVGEVVS
FT                   AEVHQVRQKEAIFTYNTTKDHKVELLLPNTEKMPKDNPRKTPRMRLYVKRIEREKIRVK
FT                   LEDGTEVEREREDGPMKVIVSRTDDRFLHKLFESEVPEIYEGLIVVKGIARVPGERAKV
FT                   SVESTSSRIDPVGACVGHRGKRIQNIVRELNNENIDVICFSDEPQIYIARALQPAKIDP
FT                   MTVHVDPKTRKSRVMLKPDQIKYAIGRNGNNIHLAEKLTGYEIEIYRDISDKALEDPDD
FT                   IDIISFREEFGDDMIYQLLDNGFDTAKKILEAGVDAIEKSLTAPPRREETLDFGRKSPR
FT                   SHQPRILSESEQRYWRKIAESIYKTIKEEFEEEDGSAQASKNSLASENQIEQSQAPVAP
FT                   SDVPDEEDEKADSE"
FT   gene            546986..550279
FT                   /locus_tag="Ctha_0467"
FT   CDS_pept        546986..550279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0467"
FT                   /product="translation initiation factor IF-2"
FT                   /note="TIGRFAM: translation initiation factor IF-2; small
FT                   GTP-binding protein; PFAM: protein synthesis factor
FT                   GTP-binding; GTP-binding protein HSR1-related; elongation
FT                   factor Tu domain 2 protein; translation initiation factor
FT                   IF-2 domain protein; Miro domain protein; KEGG:
FT                   cch:Cag_1462 translation initiation factor IF-2"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12938"
FT                   /db_xref="GOA:B3QUN2"
FT                   /db_xref="InterPro:IPR000178"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006847"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR015760"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036925"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3QUN2"
FT                   /protein_id="ACF12938.1"
FT                   /translation="MPAEKEKKKHKLIDIAVELQVSLDDIRSFVEELGYRTTNSTKVTD
FT                   SVKELILDNYSDEKKKSDLHKKLKAEKNRKIQLLEKRVSPQADKFSKKKTAAKKEASQE
FT                   KADAHAKLEPSIPEEAPAAIDIDDTPEVAPEIEIPSQNTQEPEPVEMDEVASAATLAVE
FT                   EAPIAAAPTEEPMHNSEAELPESKIDSAEAVAEEAAPEVEVHLEPKEQEVQELNHAEEA
FT                   ETPTTEASSEETSAVMTKEGDSNDAQPFTQHEPVSRKTQNTTNVSEENKQHEKQPETLK
FT                   SDKAMDVVQPVPIAEETAEQQLTEASSYEKKETNLQGENLETNEADAAQTEAKDDDAQS
FT                   DSLQAEISRQQNEISNRFSQSENIAGLKVFGEIELHKKKRKRKKNFREQAKDLKQQMTP
FT                   EQPKQEEKPVKKEKPKEREKPAAGKKEQTPGKKPVREDQKERVLQDGPARVIKKKPKKA
FT                   VDEKVVDRNIRQTMMTMDDTNDSSARQKFRKIRKRERLREQEIEAAAKEAESKVLKITE
FT                   FASTHELADMLGVTPKEVIQKCFKLGKFITINQRLDKETIELLSLEFNYEVHFISDVEA
FT                   TEIDDDPDLPEDMKTRPPVVTIMGHVDHGKTSLLDYIRNSNVVAGESGGITQHMGAYEV
FT                   TLENKQRLTFLDTPGHEAFTAMRARGAQVTDVVILVVAADDNVMPQTVEAINHAKAAEV
FT                   PIIVAINKIDKPDANPEKIRTQLADIGVLVEDWGGSVQCQEISAKKGTGVRDLIDKVLV
FT                   EAELLELKANYSEDKLSRGVVIEAELDKGKGVIATILVQTGIINVGMPFVAGGSSGRIR
FT                   AMLDERGNRLETVYPSQPVRILGFEELPQAGDLFSIMPSDREAREIAQRRQVIRREHEF
FT                   RHSSRVKLNDIAKQVQEGQVQELRVIIKADTDGSIQALADGLMKVQTDEVKVEVIHRGV
FT                   GQITETDVLLAAASDAIIIGFRVRPNVNAKKLAEKEEIDIRFYSVIYHVLEDIHDALEG
FT                   MLSPELQEKVTATVEIRDIFRISKIGNVAGCHVLDGKINRDSRVRLLRDGIQIYEGVLD
FT                   SLKRHKDDVKEVDSGYDCGLTLKNYDDIKVNDIVESFETVETKRKLVVS"
FT   gene            550322..550699
FT                   /locus_tag="Ctha_0468"
FT   CDS_pept        550322..550699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0468"
FT                   /product="ribosome-binding factor A"
FT                   /note="PFAM: ribosome-binding factor A; KEGG: cte:CT0242
FT                   ribosome-binding factor A"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12939"
FT                   /db_xref="GOA:B3QUN3"
FT                   /db_xref="InterPro:IPR000238"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR023799"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3QUN3"
FT                   /protein_id="ACF12939.1"
FT                   /translation="MSIRTERVAELIQRELSGIFEKELPRSGVLTTIVGVKITPDLSIA
FT                   RVYVSILGSKEMGASVMAHIQKENKHFRKLLSSKIRHQFKRMPSLEFYQDDLFDQAAHI
FT                   NELIRKANEASSPTPKPDDEA"
FT   gene            complement(550720..551742)
FT                   /locus_tag="Ctha_0469"
FT   CDS_pept        complement(550720..551742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0469"
FT                   /product="von Willebrand factor type A"
FT                   /note="PFAM: von Willebrand factor type A; KEGG:
FT                   pdi:BDI_0948 conserved hypothetical protein BatA"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12940"
FT                   /db_xref="GOA:B3QUN4"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR024163"
FT                   /db_xref="InterPro:IPR033881"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:B3QUN4"
FT                   /protein_id="ACF12940.1"
FT                   /translation="MFDIFSLPNFSFQNPEFLFLFLLIPLLSGIYFYYERTGRKASLLF
FT                   PDIRHPKKSTKQQIYKFRHIVFALRMLALAFLILSFARPRLENQREKVFSEGIDIVLAI
FT                   DLSGSMLAEDFEPKNRIEAAKSVATDFIHQRLSDRIGLVVFSGKSFTQCPLTLDYRLLT
FT                   NFISELKAGTIEEDGTAIGTAIATATNRLRESTAKSKVIILLTDGQNNAGEIEPVTAAE
FT                   LAAALGIKIYTVGAGTRGYARYPIPDPLFGKRYVQMKVDVDDSTLTRIARISGGRYFRA
FT                   TDLESLKKTYHEIDELEKTKVEVERYTEYREEFAMFLTPALILLALEFLLANTRFRKVP
FT                   "
FT   gene            complement(551886..553700)
FT                   /locus_tag="Ctha_0470"
FT   CDS_pept        complement(551886..553700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0470"
FT                   /product="oligopeptide transporter, OPT superfamily"
FT                   /note="TIGRFAM: oligopeptide transporters, OPT superfamily;
FT                   PFAM: Oligopeptide transporter OPT superfamily protein;
FT                   KEGG: psp:PSPPH_1251 oligopeptide transporter, OPT family"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12941"
FT                   /db_xref="GOA:B3QUN5"
FT                   /db_xref="InterPro:IPR004813"
FT                   /db_xref="UniProtKB/TrEMBL:B3QUN5"
FT                   /protein_id="ACF12941.1"
FT                   /translation="MNHPTNSNTTPSTPNFTLRAILTGMIVGAILTPCNVYSGLKIGWS
FT                   FNMSITAALLGYALWKIFADVFRAEPWSLQENTYNQTTASAAASIISGGLVAPIPAYTM
FT                   LTGESLAVPILIFWVFIVSFLGVIVAVGLRRQMLIHDKIPFPSGIATAETITDLHAKGK
FT                   DSLKKITWLFSTGALSFGLKLLNDMLVSLPRLHLFQPLSGLYTSPGGVKAYTLKKAGFF
FT                   FDPSLLMLGFGMIIGTRAGISLLLGAVISWLVLPPFLFASGAVAIPDSQSEFWFSELVT
FT                   WTLWPGVGLMVTSSLTSFGIGLFKLFTKSRETHREQNRFENDENIDEKTAKSYKTVFIF
FT                   SLLVTLIVLTIAQFQIFNIPMVMGALAVLASMILGIVSSRVSGETGIPPIGALGKVTQL
FT                   SFGLLNPGNISANLMTANVTGGAAGQSSDLLHDLKAGLLLNVDHRFQVVAQVFGILTGS
FT                   IVGSLVYLFLIPDPQTQLITAEWPAPAVATWKSVAELMAKGVTHFPAGAIEALIFAAVA
FT                   GFMLAILENILPEKALNFVPSASAMGLAFIIPASLSLTMFAGAMLVLVLKKINNPFAKS
FT                   FALVIAAGLVAGESIGGIVAVVWKAMVN"
FT   gene            complement(554024..554638)
FT                   /locus_tag="Ctha_0471"
FT   CDS_pept        complement(554024..554638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0471"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   hch:HCH_05925 sigma 54-dependent transcriptional activator
FT                   containing CheY-like receiver domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12942"
FT                   /db_xref="GOA:B3QUN6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B3QUN6"
FT                   /protein_id="ACF12942.1"
FT                   /translation="MIRKVLLVDDDADIHLFMQAVLHTEWIVAHSVYSAKEALKEFQSR
FT                   EFDLIISDISMPEMNGYEMVQELGKSNFKVPPVLILSSLANTNLIMKCLAAGVADYIIK
FT                   PAEPERIRKTVYGLLLLDKNGQPISQRSLSSYMGEMTMMKSTGKLLLDDGKHTGEMRYE
FT                   NGKLKEIKFGPLTGLNALEAAKQSKFLQVTFIEGDFIIGSS"
FT   gene            554786..556489
FT                   /locus_tag="Ctha_0472"
FT   CDS_pept        554786..556489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0472"
FT                   /product="Electron-transferring-flavoprotein dehydrogenase"
FT                   /EC_number="1.5.5.1"
FT                   /note="PFAM: electron transfer flavoprotein-ubiquinone
FT                   oxidoreductase; KEGG: cch:Cag_1800 electron transfer
FT                   flavoprotein-ubiquinone oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12943"
FT                   /db_xref="GOA:B3QUN7"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR040156"
FT                   /db_xref="UniProtKB/TrEMBL:B3QUN7"
FT                   /protein_id="ACF12943.1"
FT                   /translation="MSLQPQIERETLEMDVLFVGAGPANLAAAIRLKQLIDKHNETASE
FT                   KLDPEIALIEKGKSVGAHLLSGAILDTRALKELIPDYIEKNCPIEATVEQERVFFLTEE
FT                   KKFNMPFLPASFKNHGSPLISLSKFGKWLGKMAEEMGINLFEGIAGAEPIIENGQVLGV
FT                   RTDDKGRDKNGQPKPNFEPGMNIHAKVTVLGEGARGSLTKKIARQLSLEADATPQAYET
FT                   GVKEIWEIPSGRIKKGTAIHSFGFPLPATIYGGGWIYALSETRLSIGFVTALDAADPTN
FT                   DPHFNLQRFKTHPFVRELLNGGTLIGYGAKAISGGGYASIPKLFANGLLLTGESGGFLN
FT                   SMRLKGIHLSMKSGMLAAETIFDALKKKDFSEETLKTYREAFEQSWAKEELYEVRNFRQ
FT                   AFNYGLYSGAIRVGLQQLFSGRLVAKQLDHDPDHMQMEHFHRLHRARYLEVKADFKYDG
FT                   KLTFDKLTDLYESGTTHEENQPCHLFIVPDLITDICNTKCTVEYGNPCQFFCPAKVYEM
FT                   VVTDEKMGTKKLHLNPANCVHCKTCDIADPYQVITWKVPEGGGGPNYNKG"
FT   gene            complement(556579..557763)
FT                   /locus_tag="Ctha_0473"
FT   CDS_pept        complement(556579..557763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0473"
FT                   /product="Cytochrome b/b6 domain"
FT                   /note="PFAM: Cytochrome b/b6 domain; KEGG: cch:Cag_0395
FT                   cytochrome b-c complex, cytochrome b subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12944"
FT                   /db_xref="GOA:B3QUN8"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR005798"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="InterPro:IPR036150"
FT                   /db_xref="UniProtKB/TrEMBL:B3QUN8"
FT                   /protein_id="ACF12944.1"
FT                   /translation="MKGGLTGMDRISKPTNADSEAFMPQQSRMQSIASAIDETTSGFNL
FT                   MKWLGERSYVFEPIVHFLSKKAVPQHRISIWYYFGGLTLFFFVIQIVTGLLLLLYYKPT
FT                   EQEAFSSFLYIQKEVPYGWLIRQIHSWSANLMVLMLFIHMFSTFFMKAYRKPRELMWIT
FT                   GFVLCLLTLGFGFTGYLLPWNELAFFATQIGTEVPKAAPGGEVIVELLRGGEDVTGATL
FT                   TRMFSFHVVLIPGITLLVLSAHLLLMQILGTSVPIGYKEQGLVKGYDPFFPNFLMKDLI
FT                   GWMIGFALLLYLAVNLPWELGVKADPLAPAPQGIKPEWYFWAQFQLLKDFKFPGGELTA
FT                   IIMFTIGGVAWALVPFIDRQSAREEKSPAFTIAGVLVLVFMLVESYRVYLEYGF"
FT   gene            complement(557767..558552)
FT                   /locus_tag="Ctha_0474"
FT   CDS_pept        complement(557767..558552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0474"
FT                   /product="Rieske (2Fe-2S) domain protein"
FT                   /note="PFAM: Rieske [2Fe-2S] domain protein; KEGG:
FT                   plt:Plut_1719 plastoquinol--plastocyanin reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12945"
FT                   /db_xref="GOA:B3QUN9"
FT                   /db_xref="InterPro:IPR005805"
FT                   /db_xref="InterPro:IPR014349"
FT                   /db_xref="InterPro:IPR014909"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:B3QUN9"
FT                   /protein_id="ACF12945.1"
FT                   /translation="MGRNAAKYDNEVRLGDMPESPSEFSGSIDSGSDEATSFGMRRNFM
FT                   GKVTKEAVRLSNSATGDETPKEQKAEPKEKNQVEKTSETSSSGVFSRKSTSLNTTTMRL
FT                   GNIDSNSSAVVSETVEFRAERRGFLEKIVAGMATLLGISVLYPVSQYVIPPAKKKAVET
FT                   QKAVGKVSEVPQDSGKIYRFAGDRVLVLNYKGELKAMSAVCTHLGCLVQWRTDEQLVYC
FT                   ACHGARYTKEGEIISGPQPAPLKPYGVHVEGDDIVLSVI"
FT   gene            complement(558912..559433)
FT                   /locus_tag="Ctha_0475"
FT   CDS_pept        complement(558912..559433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0475"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cph:Cpha266_1559 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12946"
FT                   /db_xref="InterPro:IPR024775"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:B3QUP0"
FT                   /protein_id="ACF12946.1"
FT                   /translation="MNWRELISAEAAPAYKATERLLGHVDENALNWKPNSGENWMTVGQ
FT                   LLFHLSRSCGAGCRGLVTGDWGLPENVDPSKMKGHAIASAERLASVQNVEEAKKLLAED
FT                   KSLMYEMLEKCTDQALDTKLLTAPWHPVPMLLGYRMLQCVEHLVQHKGQLFYYLKLQGK
FT                   PMHTGMLWGA"
FT   gene            559640..560569
FT                   /locus_tag="Ctha_0476"
FT   CDS_pept        559640..560569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0476"
FT                   /product="Ppx/GppA phosphatase"
FT                   /note="PFAM: Ppx/GppA phosphatase; KEGG: cph:Cpha266_2586
FT                   Ppx/GppA phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12947"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="UniProtKB/TrEMBL:B3QUP1"
FT                   /protein_id="ACF12947.1"
FT                   /translation="MPKIATIDIGTNTALLLIAEFDLATKQLHTILNQIEVVRLGQGVD
FT                   KERRITAESISRLVLAMAKFKSTIQAHGVEKTYAVATSAMRDAQNRDDVIQTVQEQTGI
FT                   DIELLKGEAEADMTFLGATIGWRNLPKKFLVIDIGGGSTEIALGDQNGIIDGVSLNIGA
FT                   VRLVERCFSTIPPKPAELEAAKDIITKALSAPLSRFIQGRESVFAVAGTPATLAKVIQK
FT                   LPDFLPDRIHGFELTYAHVHSLLDAFSKSTTEQILEMGVEPGREDLIVVGTMILHQFMR
FT                   IFGVPSVRVSIQGLRYGVAARKANEFLK"
FT   gene            560841..561119
FT                   /locus_tag="Ctha_0477"
FT   CDS_pept        560841..561119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0477"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12948"
FT                   /db_xref="GOA:B3QUP2"
FT                   /db_xref="UniProtKB/TrEMBL:B3QUP2"
FT                   /protein_id="ACF12948.1"
FT                   /translation="MKLYARLTDLFLGKDVLWTNANFMNVDCLRLTQQIWGLLFNNFLR
FT                   SSNYQQIKNNILFFRAIIIFSYILLSFQETPTTNQLNIYESANYTYC"
FT   gene            561091..561774
FT                   /locus_tag="Ctha_0478"
FT   CDS_pept        561091..561774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0478"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: sru:SRU_2292 response
FT                   regulator DrrA"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12949"
FT                   /db_xref="GOA:B3QUP3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B3QUP3"
FT                   /protein_id="ACF12949.1"
FT                   /translation="MNPRTILIADDESQYVSWLRTRLEQEGYNIVWARDAAETLAHLSQ
FT                   KPEVVLLDLMNDSNGLELCRQLRALPEGKSVPIIMLASKSEESDEVLGLELGADDFLSK
FT                   TTSPKVLSARIKNVLKRYHVNAREELTRLKIGDLEIDRSSHTVRLDEKDIFLPRKEFEL
FT                   LWILATNKGKVFSREMLLRRVWGENIYVTDRTVDVHICKVRQRLGKFGEDAIETIKGVG
FT                   YRLKF"
FT   gene            complement(561926..562867)
FT                   /locus_tag="Ctha_0479"
FT   CDS_pept        complement(561926..562867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0479"
FT                   /product="Muramoyltetrapeptide carboxypeptidase"
FT                   /EC_number="3.4.17.13"
FT                   /note="PFAM: peptidase U61 LD-carboxypeptidase A; KEGG:
FT                   pvi:Cvib_0023 muramoyltetrapeptide carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12950"
FT                   /db_xref="GOA:B3QUP4"
FT                   /db_xref="InterPro:IPR003507"
FT                   /db_xref="InterPro:IPR027461"
FT                   /db_xref="InterPro:IPR027478"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR040449"
FT                   /db_xref="InterPro:IPR040921"
FT                   /db_xref="UniProtKB/TrEMBL:B3QUP4"
FT                   /protein_id="ACF12950.1"
FT                   /translation="MVLKPKRLAPGDVIGLVAPASPIENVEKIEQAAHYLESQGYWVKY
FT                   GAHIRKAYGYLAGTDEERAEDLNRMFADPDVTAIFCLRGGYGSPRILKLLDYDLIARNP
FT                   KILAGYSDITALSLAIFAKTGLITFSAPMLTTDFANTDVYAFEAFWKMITIPDVFGHIE
FT                   NHPLHERKPLKEGIAIGRLFGGNLSLCSVLVGTEFMPKLDDAIFFAEDIGEEPYRVDRL
FT                   LSQLENANILAHLSGLIFGQFTNAIPKHELSLTMEDVFARYVAPLKENASAMSGLSYGH
FT                   VKHKHVLPVGAKAKLGVAAAGCELEILESVVS"
FT   gene            complement(562956..563216)
FT                   /locus_tag="Ctha_0480"
FT   CDS_pept        complement(562956..563216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0480"
FT                   /product="H+transporting two-sector ATPase delta/epsilon
FT                   subunit"
FT                   /note="PFAM: H+transporting two-sector ATPase delta/epsilon
FT                   subunit; KEGG: pvi:Cvib_0024 H+-transporting two-sector
FT                   ATPase, delta/epsilon subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12951"
FT                   /db_xref="GOA:B3QUP5"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="UniProtKB/TrEMBL:B3QUP5"
FT                   /protein_id="ACF12951.1"
FT                   /translation="MADNSFELDLVTPEESVFSGKVVSVTAPGDYGSFQVMRDHAPMLA
FT                   SLGTGEVKLVLPNKSEQTYSLSDGFFEVSDNKAILLAEKIN"
FT   gene            complement(563222..564619)
FT                   /locus_tag="Ctha_0481"
FT   CDS_pept        complement(563222..564619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0481"
FT                   /product="ATP synthase F1, beta subunit"
FT                   /note="KEGG: cph:Cpha266_0049 F0F1 ATP synthase subunit
FT                   beta; TIGRFAM: ATP synthase F1, beta subunit; PFAM:
FT                   H+transporting two-sector ATPase alpha/beta subunit central
FT                   region; H+transporting two-sector ATPase alpha/beta subunit
FT                   domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12952"
FT                   /db_xref="GOA:B3QUP6"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3QUP6"
FT                   /protein_id="ACF12952.1"
FT                   /translation="MHEGKITQIIGPVVDVDFVDGQLPSIMDALIVERPDGTELVLETQ
FT                   QHLGEERVRTIAMEATEGLVRGMKVVNTKNPIQTPVGENVLGRMLNVVGKPIDGLGEVH
FT                   ATKTYSIHRPSPAFDELSTKAEMFETGIKVIDLLEPYSRGGKTGLFGGAGVGKTVLIME
FT                   LINNIAKQQSGYSVFAGVGERTREGNDLWEEMKESGVIDKTALVFGQMNEPPGARARVA
FT                   LTALSIAEYFRDEENRDVLLFVDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGAL
FT                   QERIVSTKKGSITSVQAIYVPADDLTDPAPATTFTHLDATTVLSRSIAELGIYPAVDPL
FT                   DSTSRILDPNIIGRDHYDTAQAVKQILQRYKDLQDIIAILGMDELSDEDKLLVARARKV
FT                   QRFLSQPFFVAEQFTGLEGKYVRLEDTIKAFKEIIEGRHDSLPENAFYLVGTIEDAIKK
FT                   AKQLQNA"
FT   gene            complement(564703..564778)
FT                   /locus_tag="Ctha_R0003"
FT                   /note="tRNA-Thr3"
FT   tRNA            complement(564703..564778)
FT                   /locus_tag="Ctha_R0003"
FT                   /product="tRNA-Thr"
FT   gene            565079..566131
FT                   /locus_tag="Ctha_0482"
FT   CDS_pept        565079..566131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0482"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG: lpc:LPC_0636
FT                   pyruvate formate lyase-activating enzyme PflA"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12953"
FT                   /db_xref="GOA:B3QUP7"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR016431"
FT                   /db_xref="InterPro:IPR027596"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="UniProtKB/TrEMBL:B3QUP7"
FT                   /protein_id="ACF12953.1"
FT                   /translation="MIIPKLDTDVYGKVAQYWRPLHNNRVQCTLCPRLCNIPDGARGFC
FT                   YVRENINGTLYLTSYGHAIGFNCDPIEKKPFYHFYPGSKIYSFGLIGCNMACMFCQNWH
FT                   LTKYFPPVYEKRTYAPQDILYRAVKNDCIGLAFTYNEPITSAEWLAVLAHEAKEQGMKS
FT                   VMVSNGYINPEARETLFKNIDAVNIDLKGFNDFFYQRLTHSHLQPVLDTLEWLVHETNI
FT                   WVEITNLIIPSKNDSAAAIAQLTEYVATRLSPLIPIHFNAFHPDFKMMDLPKTPFETLE
FT                   KARDIALKNGLNHVYIGNALSDESALAKQTYCATCGEVLIRRSQFDTVDVLLKDGHCPN
FT                   CGAVLNGLFN"
FT   gene            566115..566993
FT                   /locus_tag="Ctha_0483"
FT   CDS_pept        566115..566993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0483"
FT                   /product="protein of unknown function DUF52"
FT                   /note="PFAM: protein of unknown function DUF52; KEGG:
FT                   dol:Dole_0299 protein of unknown function DUF52"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12954"
FT                   /db_xref="InterPro:IPR002737"
FT                   /db_xref="UniProtKB/TrEMBL:B3QUP8"
FT                   /protein_id="ACF12954.1"
FT                   /translation="MAFLTKKRVMQFIREPQAMDLYPSDCGQQIFAFLKKYTPSTELPE
FT                   KLIGAVVPHAAWKYSGKVAARTLHTLSERSSPDICVLLGADHIGLKKHTLLPDGTWKTP
FT                   LGSLPIASELASALYSALPKILSNDMSAHELEHSLEVISPMIAYFWPKLSILPIIIVPN
FT                   ANALEIGNALVQLLKASGKTAIFVASTDLTHYGRFYGNAHAGTGEKALDWVQHNDKKMI
FT                   ECICNVKATEILKEAAENQNACGAGALTTLCAIAKAHEIQKGYLIEYTTSHGNEHPNFF
FT                   QSGVGYAGVVF"
FT   gene            567152..567619
FT                   /locus_tag="Ctha_0484"
FT   CDS_pept        567152..567619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0484"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cte:CT1769 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12955"
FT                   /db_xref="UniProtKB/TrEMBL:B3QUP9"
FT                   /protein_id="ACF12955.1"
FT                   /translation="MNEVMEERLAEMEQRKEQLEELINQRQAQINRRAATLKKDIEARF
FT                   QPKEVIRQYPLASAGMLFGIGVAIGGWLKKDSPQHAVHSMASTPAAPRAAQPQPAPNYH
FT                   HAPPKQQSKLSGLASDLAFDFLNAMKEVLVSYAIEYASEKFKEKASPKKNG"
FT   gene            567686..568639
FT                   /locus_tag="Ctha_0485"
FT   CDS_pept        567686..568639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0485"
FT                   /product="WD-40 repeat protein"
FT                   /note="PFAM: WD-40 repeat protein; KEGG: ava:Ava_1556
FT                   ribosome assembly protein 4 (RSA4)"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12956"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:B3QUQ0"
FT                   /protein_id="ACF12956.1"
FT                   /translation="MHTTETLEKIQLLQSFPENRENAYTVGFSHDGQRFAAAGGLRAAF
FT                   IYDLHKAKPIGGLLDHSQSIYSVKFSKNGKWFFSTGRDGKVMVYDAEKFDKIAVLLPEF
FT                   DLESAPPQIIPNFTLALNPDQTLLAVGASGGVMRLYRTDDWSLHKVLPLHQGNIRSIAF
FT                   SPNGELCATGSSDRMVKILDGNTFEELQTIEGHGDVVFSVRFSPDGKTFATGGKDARLR
FT                   IWSVDGKKFTPKVKLLAHTFAIKSMQFLPNAHELVTVSQDKTIKLWDLEKMLATQIIDK
FT                   TCGGHAFTINSVDLSPDQPHMITGSDDKTVKLWKIS"
FT   gene            568906..569367
FT                   /locus_tag="Ctha_0486"
FT   CDS_pept        568906..569367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0486"
FT                   /product="6-pyruvoyl tetrahydropterin synthase and
FT                   hypothetical protein"
FT                   /note="PFAM: 6-pyruvoyl tetrahydropterin synthase and
FT                   hypothetical protein; KEGG: cph:Cpha266_0977 6-pyruvoyl
FT                   tetrahydropterin synthase and hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12957"
FT                   /db_xref="GOA:B3QUQ1"
FT                   /db_xref="InterPro:IPR007115"
FT                   /db_xref="InterPro:IPR022470"
FT                   /db_xref="InterPro:IPR038418"
FT                   /db_xref="UniProtKB/TrEMBL:B3QUQ1"
FT                   /protein_id="ACF12957.1"
FT                   /translation="MNTEFNRILKEKHTVFVTRKVHFSAAHRLFNPEFSDAENELIYDR
FT                   CNNIYGHGHNYELEVTLKGPVDKATGYVFDLKKLDKILSEEILSKVDHKHLNFDVEMLK
FT                   DMIPSAEVLSIVFWNAIQNRLSELGYTQVALYEVKLFESERNFVRYRGD"
FT   gene            569411..570124
FT                   /locus_tag="Ctha_0487"
FT   CDS_pept        569411..570124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0487"
FT                   /product="GTP cyclohydrolase I"
FT                   /EC_number="3.5.4.16"
FT                   /note="PFAM: GTP cyclohydrolase I; KEGG: chu:CHU_0955 GTP
FT                   cyclohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12958"
FT                   /db_xref="GOA:B3QUQ2"
FT                   /db_xref="InterPro:IPR001474"
FT                   /db_xref="InterPro:IPR018234"
FT                   /db_xref="InterPro:IPR020602"
FT                   /db_xref="UniProtKB/TrEMBL:B3QUQ2"
FT                   /protein_id="ACF12958.1"
FT                   /translation="MKHAEKSLTDARNGHRTATSFIDAVTEEIGDEHISTSVDTPIRPD
FT                   AFDQDDELKMELIAEHFEKIMLILGLDLKDDSLRGTPKRVAKMYVKEIFSGLNPANKPK
FT                   VALFDNSYKYNEMLIEKDIIVHSTCEHHFVPILGKAHVGYISSGKVIGLSKINRIVQYY
FT                   AKRPQVQERMTMQIVKELKETLQTEDVAVVIDARHLCVSVRGVEDVASSTVTSSYNGKF
FT                   LNEQTRNEFLKHIYG"
FT   gene            570203..571015
FT                   /locus_tag="Ctha_0488"
FT   CDS_pept        570203..571015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0488"
FT                   /product="polysaccharide deacetylase"
FT                   /note="PFAM: polysaccharide deacetylase; KEGG: dsy:DSY2456
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12959"
FT                   /db_xref="GOA:B3QUQ3"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:B3QUQ3"
FT                   /protein_id="ACF12959.1"
FT                   /translation="MNSSSNFCSFRRSALFGWAVFINFVCFQKLDNQTYMQSVLSYHKI
FT                   TSRVDFGICTRTPKDFRKDVEFIAALPSEKRPIVSFDDGYTDTYEAAFPILSEYGLTGQ
FT                   VFVITDAIGKPNSWDANFFGEFQHIELSQVRELAQAGWEIGSHTKTHRALTVLSLSALR
FT                   EELETSKWFLEDAIGQPVTSISFPFGKFNEQVLQVCREVGYERAISISRRSQDGFVERS
FT                   LAVYRFDRRAHLKAKLNKNKLELWRLQTINAFSTLTVLMHHINSFNRG"
FT   gene            571022..572236
FT                   /locus_tag="Ctha_0489"
FT   CDS_pept        571022..572236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0489"
FT                   /product="protein of unknown function UPF0118"
FT                   /note="PFAM: protein of unknown function UPF0118; KEGG:
FT                   eba:ebA7105 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12960"
FT                   /db_xref="GOA:B3QUQ4"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:B3QUQ4"
FT                   /protein_id="ACF12960.1"
FT                   /translation="MLEPHNERYFLLALATLSAIYFVAVIHEALSPLVLFLLVIFLLYP
FT                   LRDSEYGRRLLWSSVILFFIWFVTALSGLLSPFIISFTLAYLFDPMVNWLCKKRVPRSV
FT                   AAFFITMFGIGGLALLIILVVPEVSRQIMALLGLIKILPERTLDVINALSKWEFFDRLN
FT                   LDVEMMEKQLSGLVTSRVGDIGKLTADFATSLALSIPKVISTIMNIIFIPILSFYFLND
FT                   FETIRDTLYKILPNTYTQTVHRYVDVAGTIFKQYLRGYLIIMTLEIILYTIIFSLIGIK
FT                   YPLVLAIIAGAMLFVPYIGIFISVSLTALVIALGNGEGQIYLFTGLTYLTIQSVENFFL
FT                   IPKIVGSRVQLNPILLFLAIVLFGYFIGFVGILIAVPVSAFLVAIFRHKVFNEPFFKIV
FT                   SSNNS"
FT   gene            complement(572336..574219)
FT                   /locus_tag="Ctha_0490"
FT   CDS_pept        complement(572336..574219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0490"
FT                   /product="PAS/PAC sensor hybrid histidine kinase"
FT                   /note="KEGG: gur:Gura_2373 multi-sensor hybrid histidine
FT                   kinase; TIGRFAM: PAS sensor protein; PFAM: response
FT                   regulator receiver; ATP-binding region ATPase domain
FT                   protein; histidine kinase A domain protein; PAS fold-3
FT                   domain protein; PAS fold-4 domain protein; PAS fold domain
FT                   protein; SMART: PAS domain containing protein; PAC
FT                   repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12961"
FT                   /db_xref="GOA:B3QUQ5"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B3QUQ5"
FT                   /protein_id="ACF12961.1"
FT                   /translation="MVTDTAPSYLYVYDLEQRRTSWMNKAYVYIFKNIVNNISNITYRD
FT                   VIRSVHPDDLHVFYDALQQIRSNLHQQPLRVEYRVKDKSGNYRWVEEWMAAFERTSGGE
FT                   LKRIIGAGHEITERKINELQIRKLSKIVEQSPLSVVITDIDGNIEYVNQAFMKVTGYEF
FT                   EEVKGQNPRVLKTEYTSQEEYKKLWDTISAKKQWNGEFYNKKKNGEYFWENASICPLLD
FT                   ENGKITHFIGIKEDITEKKRMEEERLQSQKMEAVGKLAGGIAHDLNNILTVIIANSDLV
FT                   LSEVEDGSEAYESVTQIETAAERAAHLVRQLLAFSRKQILRKKVLDLNKLISDFEKMLR
FT                   RIIGEDIILSTTYSPNLQRVKADPAQIEQVVMNLVINARDAMPMGGHLSIETQNIFIDK
FT                   EQAKKYKIDVGYYALIVVSDTGSGMSEEIQKKIFEPFFTTKPIYEGAGLGLSMVFGVIS
FT                   QSGGTIRVKSAVNEGATFKVYLPAIQAPIEPEVKPKVIEKFSHGKETILIVEDEELIRN
FT                   TISSNLKRQGYKTLTASDGEEALAFSQAYGDPIHILVTDVVMPNMSGKQLADNFLEAHP
FT                   ETEIIYMSGYADKQVMKHGIFDKDVLFIQKPFTFHELAKLMAKALKKEIQT"
FT   gene            complement(574238..576325)
FT                   /locus_tag="Ctha_0491"
FT   CDS_pept        complement(574238..576325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0491"
FT                   /product="putative PAS/PAC sensor protein"
FT                   /note="KEGG: mhu:Mhun_1350 multi-sensor signal transduction
FT                   histidine kinase; TIGRFAM: PAS sensor protein; PFAM: PAS
FT                   fold-3 domain protein; PAS fold-4 domain protein; PAS fold
FT                   domain protein; SMART: PAS domain containing protein; PAC
FT                   repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12962"
FT                   /db_xref="GOA:B3QUQ6"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B3QUQ6"
FT                   /protein_id="ACF12962.1"
FT                   /translation="MYGGSNKVANEAKLARENTVLKAIRSVNKLIVREQEPEVLLQKAC
FT                   DLLVATGGYDHTWIFFTEGEQCCSHVYQSQSGSEYGKLSNVIFSEENCFCLQESSKHDG
FT                   ALFLEKRSETCSQCPVIKFLPEGVAISAKISFQTKVFGVLTVYLKALLVTQEMEFELIS
FT                   DIASDLGKAFYDIEKRKKDIADLQDSLETVGQKERFLQDVYNAIQDGISILDTNLNIIS
FT                   VNSVVEERQAHNWPVIGRKCYEAYQNSESPCPKCPSLRTLETGLPQKELIFVPEITRSG
FT                   SKEMSWIELSTFPLRDDAGKLIGVIEYTKDVTEQKVAEEKYHESQTRLNLAVESAGVGL
FT                   WDWYVQTGEVVLNDEWALMLGYTRDELLPHSIKTWENLTHPDDLKKATALLESHFSGQQ
FT                   PQYECALRMRHKEGRWIWVLDRGKVIEWDENHKPVRMAGTHVDINALKQAQLTLAESEA
FT                   NFRGFFETIDDLFVVASLDGRVLQTNYAYEAKLGYTQSELQQMKIVELHAEQDREQATR
FT                   RLMEIIKGIQTFCDLSLCTKTGTLIPVETRIWMGTWNQEKVMFGISKDLSEQHAALELF
FT                   EKIFEHNPSPMALTKLENSVFVNVNQSLCKLLECEKADVIGKTAVELNFFQDEEVFLDA
FT                   KKQLRENGAISNMCLRLRTQNGTLRYGNFSGEIIKFQTGSFFLTTMLDITEQVEARLAL
FT                   H"
FT   gene            complement(576664..578394)
FT                   /locus_tag="Ctha_0492"
FT   CDS_pept        complement(576664..578394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0492"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lpf:lpl0994 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12963"
FT                   /db_xref="GOA:B3QUQ7"
FT                   /db_xref="UniProtKB/TrEMBL:B3QUQ7"
FT                   /protein_id="ACF12963.1"
FT                   /translation="MSLQTNSSFVQKLIFYIVGVVLLASSAFFLQPDIFIPFVSKYKQL
FT                   ESHHLLWIANLQRIATLTLWGFLTLSLAAFFKSDEKKFDIAVWAFFFGLWSILTFYFSN
FT                   QFTDDSYITYRYAKHFAEGHGMTWNVGDAPVEGYTSFLWTFLLAIVYKLGLSIELFAKA
FT                   FGALFWLLMAIVVTKISRLFVTQKRLAYISTFLILGNFQVAFWALSGMETSFAMLLLSL
FT                   ALYQTLKNEQTSHKSARAGIVASLLWGLAAMTRPEAMLYFAIVAAWKFFSQEKPFALEN
FT                   IQKLLPFALPAGLMILGHFAARYMYYGDILPNTYYAKRWILKGIPYIYDFLKDYIWAFA
FT                   VIFLLFLRKTSREEKLILFLIVSAAVPLINTSPIMGYAHRFFLPIFPFVVVLFLNGVHR
FT                   FLKNQPSESEYSWFGKSLVFGLCFFVYIYPFKDLKEQTDQTQQAQLSGHFPIIEDFKDK
FT                   VTGKTVMAMIDCGTIPFYLDVKVIDLWGLNDRKIAKEFRGAFSTALDEEKLNDYVFQED
FT                   PDYFILCSNSRTQYIDAHRGGNENPLVTDPRFKKYQPLKVYWYTGYYYYWVFGKASESQ
FT                   "
FT   gene            complement(578534..579667)
FT                   /locus_tag="Ctha_0493"
FT   CDS_pept        complement(578534..579667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0493"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   chu:CHU_2174 polysaccharide-forming
FT                   b-glycosyltransferase-related protein, glycosyltransferase
FT                   family 2 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12964"
FT                   /db_xref="GOA:B3QUQ8"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B3QUQ8"
FT                   /protein_id="ACF12964.1"
FT                   /translation="MEDVIKTLLLFLIGVHVLQSVLVFIGQFRMPKAIQFSSWPKITVV
FT                   VAARNEEKNIARTLDSLVAIDYPHDKLEIIIGDGNSEDRTAEIIEAYAKKHPFVKLLRV
FT                   DQNRPIKGKANALHQAAEIAKGDYILITDADCLVQPTWAKETVKHFTAGVGLVCGITIP
FT                   EAKGLFASLQTLDWCYILGTSSAVASLGYPIGGIGNNFNLRKEAYFETGGYEKIPFSIT
FT                   EDYTLFRAISNSRWKIAFPLKQETYNSTAPMESLRELYSQKQRWTLGGLDASPLQSIMA
FT                   MLIFLVHLVTLVSFAFLPVWMPLAALLVKSFGDFLVVSATLLKLRKPKMLLTFPAFELY
FT                   YYLYVLMVPFILIFDRKVTWKGVSYKVTSGRGKKSHG"
FT   gene            579881..581980
FT                   /locus_tag="Ctha_0494"
FT   CDS_pept        579881..581980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0494"
FT                   /product="PpiC-type peptidyl-prolyl cis-trans isomerase"
FT                   /note="PFAM: PpiC-type peptidyl-prolyl cis-trans isomerase;
FT                   KEGG: plt:Plut_1922 peptidyl-prolyl cis-trans isomerase,
FT                   PpiC-type"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12965"
FT                   /db_xref="GOA:B3QUQ9"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR023058"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:B3QUQ9"
FT                   /protein_id="ACF12965.1"
FT                   /translation="MNKMRDSMHIVLYALVGAFVLLIVFEWGMDFTGLNRRKTDAGVVN
FT                   GKPISLTEYDATYRRYLDGFRQRSNNVEISEQMDARMRDQAWDFLVSQILLDDKYEELG
FT                   LFVTDEEIVSEVMSDDPPAIIAQQFRDPKTGKINTEALQAAIASPENKEAWIQVEDIIR
FT                   QELLFKKLQNLVMSGVFVTDDEARRLFDEQNTKVSGRYILFELAHAKADSLYEITEADI
FT                   RNYFNEHKEDYKQDPVREANFVMFSTAATTEDTLEIIHDLEALKPKFQTAKNDTEFVEL
FT                   QSDRFADFVKTYRPGKLDAKISRLFFDNPSLKVGDVVGPFQEFSEYKIVKILAIDSDED
FT                   RQAHASHILLKPEGARRADTLAVMAEAKQLMRELTSDEKFAEVAREKSDDPGSAQKGGD
FT                   LGWFGKGRMVKEFEDAVFHAKPGQIVGPIQSQFGIHIIKVHGFEDRAIRGAELVRKIKA
FT                   GPATLERVNRQADEFQYFATEEGFEKTAKQDSVEIQKTGEFTKNGFIPSIGFNRSVSNF
FT                   AFHEEVGAVSPVISTQDAFVIMQLTGKNDDGYRKLDEDLKNTIREKVLREKKMADLREK
FT                   AKDVMAKADGNLQKAIEIDSLLTIHKTNQVMLTNAFVPGLGRDKNFVAALSALDEGKVS
FT                   NPIETKRGVAIAELTKKIKGFDSDFEVRKNALKDQILQEKKKEVMNNWLKDLKESAKIE
FT                   DLRTM"
FT   gene            582113..582925
FT                   /locus_tag="Ctha_0495"
FT   CDS_pept        582113..582925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0495"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: plt:Plut_0933 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12966"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:B3QUR0"
FT                   /protein_id="ACF12966.1"
FT                   /translation="MKKKFSANAFSKLAFLCLMVIFALPYGVAKNNENSKTSEKSYSAI
FT                   IMEADSAYSAFNYDFAIARYEAAQKDPAASCDLYLKLADAYFYGAYVKPENEQEALYLK
FT                   AEKTLRHALTIDSTNAGIYARLGQVTGQLALFRGGKEKVKLGLKIKSLADSALALDPKN
FT                   PIGNAVLGIWHYQLADLSFFEKFFGKVFFGGIPEGSYDTSAVYLKKAVELAPQMTYYRY
FT                   YYAKALIEIDQRKEAQKQLETALSQPPLVLADKKNEKQLRELLEDIKD"
FT   sig_peptide     582113..582202
FT                   /locus_tag="Ctha_0495"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.675 at
FT                   residue 30"
FT   gene            583293..584093
FT                   /locus_tag="Ctha_0496"
FT   CDS_pept        583293..584093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0496"
FT                   /product="Inositol-phosphate phosphatase"
FT                   /EC_number="3.1.3.25"
FT                   /note="PFAM: inositol monophosphatase; KEGG:
FT                   cph:Cpha266_0543 inositol-phosphate phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12967"
FT                   /db_xref="GOA:B3QUR1"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR020550"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="InterPro:IPR022337"
FT                   /db_xref="InterPro:IPR033942"
FT                   /db_xref="UniProtKB/TrEMBL:B3QUR1"
FT                   /protein_id="ACF12967.1"
FT                   /translation="MTRELITAIEAAKAAGKNARRSFGKLSTAHISLKDRNDFVTVVDK
FT                   RCEELAANTIRRRFPEDGILGEEGTTDGGTSGRKWIIDPLDGTLNFIHSVPNFSVSVAM
FT                   MDETGDLIVGAIYNPIMKELFTAQRGKGAFFNNHRIHVTQNYRSERLLLATGFPYKVYD
FT                   HLDKYLAVLSDLIQSTAGIRRAGSAALDLAYTACGRYDGFWEYHLNAWDIAAGALLVRE
FT                   AGGIVTDFKGDDAFLKTGNIIATNGKIHSMVLEKVQSHFGLSFE"
FT   gene            584231..586399
FT                   /locus_tag="Ctha_0497"
FT   CDS_pept        584231..586399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0497"
FT                   /product="ABC-type branched-chain amino acid transport
FT                   systems periplasmic component-like protein"
FT                   /note="KEGG: cph:Cpha266_0542 ABC-type branched-chain amino
FT                   acid transport systems periplasmic component-like"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12968"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B3QUR2"
FT                   /protein_id="ACF12968.1"
FT                   /translation="MQRLRLAIFAAVAFGVLLCSLSNTAYSQRKQKEPIVKTSPSGGVE
FT                   KDPEELFLKKLTNKSPHRILQYALNQYQFGFFAKAESLFTDYRQISSEEPPAERDLGQL
FT                   MHAKTLIRLKRYQPAIEELTKLKFSATYPALRQETIFDLGVAETHTGKFYSAAERFMEV
FT                   GGQTWSTKDSLYLRKKAITNLRLLAMTNLSLNQIEKLIKNTPYINLKAVLAGELMRKSL
FT                   SGDFYDAQPLETKETGSEKQVSSPAEILESSNSGDQFSVQQRKDEEKQKVKDEWESEEY
FT                   EDESARDEDESSFEMVVPGEVVTLEPRGEAFIERLDTLLRNRIIPIIDTLLMSSELDPA
FT                   IRSWLIDYRFQASDVASRRYQHFPIGVLLPIDLDVFDGSESQRVGSQILTGMALRAFEH
FT                   NRSSPMRYISLLVRNTEGVDSLALIRVMDELIDRDSVKIILGPIFSDKAVIAAQHAAAR
FT                   EFPLITPTATDERITKAHPTCFQMNPPHRTRGKIIADYFLEDSTKKTFGIFAEQMTYGV
FT                   EMAEGFKDEVLAHGGKMKMYSLLPFGFRSLKEAVDTLHLEKPEDFMGYPETKFDAIYLP
FT                   LTTMESIGIALSQLHYYNFTGQIVGSGDWHDANVLNRFSDMLNGTIYAIDTYVSSADPR
FT                   VYYTLEKYYNFWQSHPSTLFWHGADAIDYLTETIVNKEMASPCKISEALRQAPPYKAVR
FT                   TEIFFDGGNINQSMNIMQFSDGNISKLK"
FT   sig_peptide     584231..584314
FT                   /locus_tag="Ctha_0497"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.622 at
FT                   residue 28"
FT   gene            586746..588824
FT                   /locus_tag="Ctha_0498"
FT   CDS_pept        586746..588824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0498"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sru:SRU_1454 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12969"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR026444"
FT                   /db_xref="UniProtKB/TrEMBL:B3QUR3"
FT                   /protein_id="ACF12969.1"
FT                   /translation="MSATVEKNFSGVVSGVATTQYHCNITAKAASFSDLDNKAGVSESA
FT                   ADGFDAASDIPEPPHAPTGYVSLYFPHPEWNHAEYEDFMHDIRANGDLSAEAEQWPFEV
FT                   ATDQTGTDVSLAFSLHDIPSGVGVTCLDKDSGTLINLRDTTEYAYAAQSLRKFVLSIGD
FT                   STKPEIALTAPNGGETFFHGDAVNIAWQAADASGLLGYRLYATPLSSGEKTLIAEMSGS
FT                   QRTYEWTVPEDITGAVRLSISATDSLFNESEVALATDIRISSSEHVFLPGWTLMSVPFL
FT                   PANASADSVLGQFVPQYYYLYNYQPNSGFAVSDTVEFTKGYWLTSPDTVRVAITGEVQD
FT                   TASLTLQAEWNIAGNALYEFVPKSALKVEKEGQTKSFDDAVKAGWLSPACYGFSTDASS
FT                   YVEADTLEPWAGYWIAAIDSNLTLIFDGDELGGTETKAMATKSFATSSDATDWSVQLAV
FT                   KSGTEADLISVCGTDANATDEFDASFDLPEPPLPPKKNGVSLYFSHENWPEVLGDKYNA
FT                   DIRAPLADKESKSWEFEVENANAVMLSWNAPSISGLSLRLEDLSNGQVINMLTENEYGY
FT                   TGSDAEPVRKFKLTATRDVSAVEETEAATPYEYVLAQNYPNPFNPSTTIRFSLKQAGMA
FT                   TFKVFDMLGREILSEQIAGKAGWNTYTFKANALSSGIYFYRLQAGAFSETKKMMLLR"
FT   gene            complement(588938..589747)
FT                   /locus_tag="Ctha_0499"
FT   CDS_pept        complement(588938..589747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0499"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mgm:Mmc1_3646 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12970"
FT                   /db_xref="GOA:B3QUR4"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR019288"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B3QUR4"
FT                   /protein_id="ACF12970.1"
FT                   /translation="MFTRIEPIIWFFDAEWIPNPAAGSMLYDLPDSLSEKEIFDEMWKA
FT                   GGATPEKPMPYLKTVLCRVVSIAAVIRKNENGGVALSLRSRPKNPDDALECEEKAVLQA
FT                   FFDGVEKHDPQLVGFNSRDSDLKILTQRALAHGIQAPKFFQRPDRPWDERNIDLMEHLS
FT                   GRTQAKPSLHELATMTGIPGKIDADGEHIAALWLEGKLEKIVAYNECDALTTYLLWLRS
FT                   VFVSGRISAEAYRAEEDLLRALLESEIQREGKSHLEKYLQKWEALQS"
FT   gene            589999..592359
FT                   /locus_tag="Ctha_0500"
FT   CDS_pept        589999..592359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0500"
FT                   /product="adenylate/guanylate cyclase with Chase sensor"
FT                   /note="PFAM: adenylyl cyclase class-3/4/guanylyl cyclase;
FT                   CHASE2 domain protein; KEGG: sat:SYN_01481 adenylate
FT                   cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12971"
FT                   /db_xref="GOA:B3QUR5"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR007890"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:B3QUR5"
FT                   /protein_id="ACF12971.1"
FT                   /translation="MPEIMTKLSKILKPVSTFLQEKILRKIWFIAIFIAPLLVLIAYGA
FT                   ASIGVFSNIELKILDNKFNERGPVPDLNKNAEVLLIAIDDQAQNALGQYPWPRDYYARM
FT                   IRNLMQAGASVVAFDLIFSDDAENPQEDYALRDAIQYYKRVVLAGRTSTSLTDESFLQY
FT                   TAVDELNLQNIFDGTPGSTTGIVYVRNDADGVYRRYHPYSMEFGKQLLSFAYATLQTHF
FT                   ATNDSVERKSRNLFEFSGQEIPSYDGYSVLLNYYGPSKTFPTISASEILDTRDFMTSDE
FT                   KILFRETMAETGLDSLSLARDESLRELWAMDIFDDPLSGLRSRVKGKICVIGPMFPESK
FT                   DLFPIPMYPGDRSDENQMYGVEIHATAMQNYIDKNFITKADPLFQIITLLAISYLIFGG
FT                   SVELKRFRIKNPRVLFGVSILAAFGVLATVMWIIFFIAGIAQSGPIDFYLIQNLRIQLT
FT                   LLSVLVLLSVAVAYYFKRAGSSSEFVTEIGAILITAITFLVVYKYTNYIFLHERILVPV
FT                   MPFGATIILAYGASIFYQYFTESRQKKLIRGFFTVYVNRELVDQLIDNPNQFRLGGEKR
FT                   ELSILFSDVKGFTNISEAMDPADLVILLNEYLGAMTDIVFKYGGTLDKYIGDAVMAFWG
FT                   APVPQEDHAKRCCWAALEMQEKLEELREKWKSEGKPELYARIGINTGQVIVGNMGSESR
FT                   FNYTVMGDSVNLAARLEPANKAFGTSIIVSEFTNEQIYDFCRTRELATITVQGKAKPVK
FT                   IFELVAKKRAGVFYEPLPPAPTAGKDIMAIKKE"
FT   sig_peptide     589999..590133
FT                   /locus_tag="Ctha_0500"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.898) with cleavage site probability 0.707 at
FT                   residue 45"
FT   gene            592475..593041
FT                   /locus_tag="Ctha_0501"
FT   CDS_pept        592475..593041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0501"
FT                   /product="methionine-R-sulfoxide reductase"
FT                   /EC_number="1.8.4.11"
FT                   /note="TIGRFAM: methionine-R-sulfoxide reductase; PFAM:
FT                   Methionine sulfoxide reductase B; KEGG: tel:tlr1214 peptide
FT                   methionine sulfoxide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12972"
FT                   /db_xref="GOA:B3QUR6"
FT                   /db_xref="InterPro:IPR002579"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="InterPro:IPR028427"
FT                   /db_xref="UniProtKB/TrEMBL:B3QUR6"
FT                   /protein_id="ACF12972.1"
FT                   /translation="MAQTTKYHAKWLAALFLLGSIAACQSTASRTEASTADQAFSCQIK
FT                   PENREDMPDKVIKTDEEWKSKLTPLQFEVTRNKGTERAFTGKYYNHKGKGIYTCACCGN
FT                   ELFTSNEKYDSGTGWPSFWKPVDNDKIEIKKDFSYGMTRVEVLCKRCGAHLGHVFEDGP
FT                   EPTGLRYCINSVSLDFEAANAEKEK"
FT   sig_peptide     592475..592561
FT                   /locus_tag="Ctha_0501"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.384 at
FT                   residue 29"
FT   gene            complement(593217..594446)
FT                   /locus_tag="Ctha_0502"
FT   CDS_pept        complement(593217..594446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0502"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   pca:Pcar_0367 ABC-type transport system, permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12973"
FT                   /db_xref="GOA:B3QUR7"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:B3QUR7"
FT                   /protein_id="ACF12973.1"
FT                   /translation="MDVLEFKNLFRTAYKSILKNKMRSLLTSLGIIIGVGSVIVMVSIG
FT                   EGAQAQIEENIRSLGTDLIMVQPGDIRRGGVSRGAGTRTNLTLKDVEMIRNNAQYIKAV
FT                   SPVINSSGQIIGNGENWNTQFYGVSQDYFEIKSWEIEHGKFFTEKDIKSRRKVCVLGNT
FT                   VVEELFNGQNPVGQKVRVRNVPFTVIGTLKEKGQTSFGPDQDDLILAPYTTVLYRLKGA
FT                   QLSVDMIHASAISTPAIDQAQEEIRTILRQQHGLQGDAEDDFYVRNQSEITETATQTTE
FT                   VLTAMLAAVAGVSLIVGGIGIMNIMLVSVKERTREIGIRLSIGARPIDILAQFLTEAVV
FT                   ISLIGGLIGIVLAFIVSSLIQMFSGFTTVIQPAIILISVGFAMGIGIFFGFYPARKASE
FT                   LNPIDALRYE"
FT   sig_peptide     complement(594294..594446)
FT                   /locus_tag="Ctha_0502"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.853) with cleavage site probability 0.604 at
FT                   residue 51"
FT   gene            complement(594456..595178)
FT                   /locus_tag="Ctha_0503"
FT   CDS_pept        complement(594456..595178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0503"
FT                   /product="ABC transporter-related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: gme:Gmet_3037 ABC transporter-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12974"
FT                   /db_xref="GOA:B3QUR8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3QUR8"
FT                   /protein_id="ACF12974.1"
FT                   /translation="MSKVIEIKSITKTYLMGEIEVQALKGVDLTVDQGEFISIMGASGS
FT                   GKSTLMNIIGCLDMQTSGDYILEGQKVNQLSKNAYADIRNQKIGFVFQGFNLLPRTSAL
FT                   ENVELPLVYDRTHRIQNPREAAIDALRKVGLAERMEHEPNQLSGGQQQRVAIARALVND
FT                   PAILLADEPTGNLDTKTSIEIMALFQALNQRGMTIVLVTHEPDIASFTKRIVEMRDGVI
FT                   IKDAIVAEPQRASESLPA"
FT   gene            complement(595323..596597)
FT                   /locus_tag="Ctha_0504"
FT   CDS_pept        complement(595323..596597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0504"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   pca:Pcar_0365 membrane-fusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12975"
FT                   /db_xref="GOA:B3QV21"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:B3QV21"
FT                   /protein_id="ACF12975.1"
FT                   /translation="MSQKIIVLGVLLLIVVGGALWFFVFRTTNTETAFNLARLERGDVE
FT                   NTVSCTGTISPLSEVEVGTQTSGIIKKIYTDFNQEVKKDQLLAVLDTELLKASLLSAEA
FT                   NLEKSEAELEQAELDYARNKKLYEGGFLAEADFLPYKIDLKTAKASVKTAQSTVAQAQQ
FT                   NMHYAYIRSPINGTVIEKDVEEGQTVAASYSTPTLFVIAEDLSKIQIEAEVDESDIGSI
FT                   KEGQPVRFEVPAYTNMSFTGTVFQIRLQPEVTNNVVNYTVIIYADNKDDILLPGMTCTV
FT                   DFIIEAKKDVLKVPNSALNFNPDQALAFSVMEKKREQMPDSLKRAPRPDFAGGTPPQGQ
FT                   MPSEPPAKPADAGMIWFINSSGELDATPVKTGISDGSYTVLENAGSLKEGTEVVTGLLS
FT                   ATASSKSSDSDSRRKSGFGGGPPPF"
FT   sig_peptide     complement(596505..596597)
FT                   /locus_tag="Ctha_0504"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.765) with cleavage site probability 0.424 at
FT                   residue 31"
FT   gene            597081..599315
FT                   /locus_tag="Ctha_0505"
FT   CDS_pept        597081..599315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0505"
FT                   /product="(p)ppGpp synthetase I, SpoT/RelA"
FT                   /EC_number="2.7.6.5"
FT                   /note="KEGG: cte:CT1545 GTP pyrophosphokinase; TIGRFAM:
FT                   RelA/SpoT family protein; PFAM: amino acid-binding ACT
FT                   domain protein; TGS domain protein; metal-dependent
FT                   phosphohydrolase HD sub domain; RelA/SpoT domain protein;
FT                   SMART: metal-dependent phosphohydrolase HD region"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12976"
FT                   /db_xref="GOA:B3QV22"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004811"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR033655"
FT                   /db_xref="UniProtKB/TrEMBL:B3QV22"
FT                   /protein_id="ACF12976.1"
FT                   /translation="MLAQIEEDHYVKLNEILSLCKEKLYHYDEALIRKAFFLCYRAHSE
FT                   EKRASGEPFFFHPVEVAKILLTEIPLDSVSVAAALLHDVVEDTDYTYEDLQDEFGDEIA
FT                   SIVAGLTKISGIFDNREIKEAESFRKMLLSVIHDIRVILIKFCDRLHNMRTLDALPPHR
FT                   QIRIAIETRDIYAPLAHRFGVGRIKIELENLALKYIDREAYDEIVQKLQMTRPERERYL
FT                   ESVMSPIRKKLNELNFEYNMSGRPKHVFSIYNKIQQRGKSFEDIYDIYGIRIILHSETN
FT                   ADCYNVYSRITELFSPVPDRFKDFISVPKHNGYASLHTTIVGPGGRMIEVQIRTEKMNE
FT                   IAETGIAAHWRYKEKTKERDKAIDELIKWAREFIENSSMSSTVMDSDSATSFMEGFRMH
FT                   LYQDEIYVFTPKGDMKTMPVNATPVDFAFEIHTEVGMRCIGAKVNGKIVSLNSKLKSGD
FT                   QVEIITSKNQTPKADWEKFVVTHKAKIKIKQALNEERRTEIEKGRGIWNRVLTKTKSII
FT                   ALTERDLLKAIKEHGFHFNTPADFYRGLATDKINAEEVLNNLNEKKKSPPQKELTPLTG
FT                   EAQANTLKKLREPSINQKNKDAVRIEGLPGIAFEYARCCNPVPGDDIIGLLSVGSKAVK
FT                   IHRRNCRSLTSDKLATMKLLDACWEKDNNGQFLAGLKILGEDVIGMTNKITEVILKSDI
FT                   NIRSISLDASDSLFEGNVLLYVKDVATLNRLAEKIKRIKGILSVGRLSNE"
FT   gene            complement(599326..600399)
FT                   /locus_tag="Ctha_0506"
FT   CDS_pept        complement(599326..600399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0506"
FT                   /product="Helix-hairpin-helix DNA-binding class 1"
FT                   /note="SMART: Helix-hairpin-helix DNA-binding class 1;
FT                   KEGG: sru:SRU_1533 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12977"
FT                   /db_xref="GOA:B3QV23"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="UniProtKB/TrEMBL:B3QV23"
FT                   /protein_id="ACF12977.1"
FT                   /translation="MPKPLYGAFERLDVSARAGALGGAFVALGNSSFGGFYNPASLELL
FT                   PSREVGVFYSQPYGMSELSYFAFSFADPGFLPNSLGSLGLSVKRYGFELYNEKTVAASY
FT                   AGAFERVFFYGFSLNYHHLSIKNYGSAAAFGLSLGTLFLVSPEFSLGFSGFNLNRPTIG
FT                   KTSEALPQSYILGMAYRPDGNLRILIDFEKDPRFALMLKSGVEYEPVEAISLRAGFSTE
FT                   PKKMSGGIGIHYGAMDIDYALAAHSDLGLTHQVALMVHFGAPENEPVFQAKLLAFETAW
FT                   YRSESLKSGEVIDLNRASASDLLRVPGMSRRAAFNILRYREAYGAFLTISELENVRGIS
FT                   PGMYEKIKDYLIIGEHE"
FT   gene            600681..601769
FT                   /locus_tag="Ctha_0507"
FT   CDS_pept        600681..601769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0507"
FT                   /product="glycine cleavage system T protein"
FT                   /note="TIGRFAM: glycine cleavage system T protein; PFAM:
FT                   glycine cleavage T protein (aminomethyl transferase);
FT                   Glycine cleavage T-protein barrel; KEGG: cte:CT1788 glycine
FT                   cleavage system T protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12978"
FT                   /db_xref="GOA:B3QV24"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR006223"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="InterPro:IPR022903"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR028896"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3QV24"
FT                   /protein_id="ACF12978.1"
FT                   /translation="MKYTPLHKIHQQLGAKLVDFAGFEMPVQYDGILVEHKAVREAVGL
FT                   FDVSHMGEFEVKGKGAKAFLQNMTTNDVESLCDGKAQYSLLLYEDGGVVDDLLVYKIAD
FT                   EHYFLIVNASNIEKDFDWLKQHQPDDEVVLENRSDELSLIAIQGPKAEAVLSKLTDVPL
FT                   DAIKYYHFVFGDVCGKRTLISRTGYTGEAGFELCMANEHAEEIWHALIEAGLPFGIVPV
FT                   GLGARDTLRLEMGYSLYGHEIDHQTNPYEAQLGWITKLQKGDFIGKNACVEKKLHLEQT
FT                   LVGFTLTGKNIPRQGYKIQDLSGTDIGVVCSGTLSPTLGKPIGTGYVKSSFSKIDSKVY
FT                   INIRGKLQEAAVVKVPFLHKNR"
FT   gene            601824..602600
FT                   /locus_tag="Ctha_0508"
FT   CDS_pept        601824..602600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0508"
FT                   /product="2-phosphosulfolactate phosphatase"
FT                   /EC_number="3.1.3.71"
FT                   /note="PFAM: 2-phosphosulfolactate phosphatase; KEGG:
FT                   tte:TTE1972 2-phosphosulfolactate phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12979"
FT                   /db_xref="GOA:B3QV25"
FT                   /db_xref="InterPro:IPR005238"
FT                   /db_xref="InterPro:IPR036702"
FT                   /db_xref="UniProtKB/TrEMBL:B3QV25"
FT                   /protein_id="ACF12979.1"
FT                   /translation="MKVDVFLTPAGIDEHHLRDRIVVIIDVLRASTSIVMALQNGAKEV
FT                   IPVEEVEKALKIASSLAKGQALLCGERNGQKIEGFNLDNSPEAYDEDTVKGKSLVYCST
FT                   NGSKTLSLTQSAVIKDLLVAAFTNITVVKEYIVKPENAENHLAIICAGKSSRFSLEDTI
FT                   CAGLLIDKLMADKKNQTGYILSDTARAAKILYEQFRGNELGALKESEHGRFLISLGYER
FT                   DIEVCAKIDSSQALPQLENGVLKLSKFETKKYKRVS"
FT   gene            602696..606022
FT                   /locus_tag="Ctha_0509"
FT   CDS_pept        602696..606022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0509"
FT                   /product="cell divisionFtsK/SpoIIIE"
FT                   /note="PFAM: cell divisionFtsK/SpoIIIE; KEGG: pvi:Cvib_0452
FT                   cell divisionFtsK/SpoIIIE"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12980"
FT                   /db_xref="GOA:B3QV26"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR018541"
FT                   /db_xref="InterPro:IPR025199"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041027"
FT                   /db_xref="UniProtKB/TrEMBL:B3QV26"
FT                   /protein_id="ACF12980.1"
FT                   /translation="MLKPETPSRDTARNTSSSTSKTTRKKQTNGGLQDVLQRRKHEVIG
FT                   LAIMFVSFLLLISIFSYSPEDNSKIENISIFDFFSEYATLAADQLKNPLGLIGAKLSGF
FT                   IMESILGYPTALLVGVAAFWGWTLFRRQKHEHAVSVTVYATLFAVQIAAMFGATNWEIS
FT                   EAMSGAIGRLIATFLRTIIGDFGTWSILLILLFVTIVLMIDLDIQKTLDRITYLFRDKA
FT                   AGASTKFKEWHESRESARGKKTTAKPEPTQAKQNASQTPNESLPESSDDTNALAATTPD
FT                   APLTQSPQRNTDATSVADDDDDALFEHLNKRVSSYVEFLPSEKKEGNAQPAARQQETRQ
FT                   PNLTKGQLKKSPDATDLQPSNRTQKEKAGQPDDSHLRITVHPGSGAKEETFLLSELEKL
FT                   EKEALHGDAPKEKTMPSQSGFSKEASHSHEPKTEELLQKRETTKAPEQIASKKPADAFS
FT                   PSASLKEEIKQPKPFEPPVQPKLNTTFPPETTQKNRSFDELSDEETIDELISPYTRSLS
FT                   KAQPEEPDFTSRENEPLTPENDEETELPTVTTNPPFVEETPSSLETNLQKSAAQEEMAR
FT                   AETTPGIENTQAEEEAVEITVKETVREEAANLDDRDLKVDTRHHVAYRFPSVDLLNDPE
FT                   NEENTVSREELEENKAKLLEKLRIYKIEVIKIEATVGPRVTLFELELAPDVKVSRIVAL
FT                   QDDLAMALAARGIRIIAPIPGKNAVGVEIPNNQPQMVHIKTVLQSQKFKNSKCTLPIAF
FT                   GKTISNEIFIDDLAKMPHLLIAGATGSGKSVGINTLLASLIYFCSPDNVKFLLIDPKRV
FT                   ELFPYHQLKNHFLVKYPELEEQIITDTSKAVYALKSIEKEMDNRYDRLAKAGVRNIKAY
FT                   NEKFSDEALPYIVVVIDELADMMITAGKEVEEPIARLAQLARAVGIHLVVATQRPSVDV
FT                   ITGIIKANFPARVAYQVTSKVDSRTILDMMGADQLLGNGDMLYLPSTEPKPIRIQNAFI
FT                   STSEVERLTDFIYSQKGFSAYYELPLPEIKGTSSRGRFDEDISAAKDKMFEDAARLVVR
FT                   HQQGSVSLLQRRLKLGFSRAARIMDQLEQSGIVGPQDGSKARVVLIETEDSLDLLLNNL
FT                   D"
FT   gene            complement(606165..607418)
FT                   /locus_tag="Ctha_0510"
FT   CDS_pept        complement(606165..607418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0510"
FT                   /product="acetate kinase"
FT                   /note="TIGRFAM: acetate kinase; PFAM: acetate and butyrate
FT                   kinase; KEGG: sus:Acid_3041 acetate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12981"
FT                   /db_xref="GOA:B3QV27"
FT                   /db_xref="InterPro:IPR000890"
FT                   /db_xref="InterPro:IPR004372"
FT                   /db_xref="InterPro:IPR023865"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3QV27"
FT                   /protein_id="ACF12981.1"
FT                   /translation="MNILVLNCGSSSVKFRLIHTYFDLIRENKDYSIASGLIERVGSEG
FT                   LLSFRSTNAQGEVLSTLRTTAPVRTHQAAIDQIIKWITSENSGIQGIQSLEDIHAVGHR
FT                   VVHGGEKLTRSVLIDDSVVEQIEDCIELAPLHNPQNLKGIYAAKKTFGPNIPQVAVFDT
FT                   AFHHTLPDHAYLYALPYQIYRRHRIRRYGFHGLSHRYVRFRYRTILGMERENVNIISLH
FT                   LGNGCSACAIKNGNSIDTSMGMTPLEGLVMGTRAGDVDPAILTYLAHKEGHSLDDLDKL
FT                   LNSQSGLLGISGLTNDMRELIEESLENDDRRAKLALEIFAYRIKKYVGAYLSAMNGADA
FT                   IIFTGGIGENADFIRQKICAGMNWCGIEIDENLNKQTTRGREGRISPDGNKPEVWVIPT
FT                   NEELVIARDTYRCVMRKE"
FT   gene            607472..608698
FT                   /locus_tag="Ctha_0511"
FT   CDS_pept        607472..608698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0511"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   sth:STH2817 putative glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12982"
FT                   /db_xref="GOA:B3QV28"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B3QV28"
FT                   /protein_id="ACF12982.1"
FT                   /translation="MEFTPFDPELRTFGVLSLLFLYCLGGWLIMFLRILLTYRNMPVLS
FT                   KQNYPHHAPLVSVIVPACNEASNIAKTLRSLIIQTYPNVEILAINDRSSDETGKIMRQL
FT                   SQESARLRYLEIEQLPDDWLGKNHACQKGYELAKGEYFLFTDADVTFQPDVLEKTVAYA
FT                   AHAHAEHIVTYPKLRTENIFEYALIALFGMLFTWKFNPGEAKNPKNKTAYVGVGAFNFI
FT                   SRRAYETLGTHRRLRAEVADDVMLGYYAKQAGFGTHILNGYDKLSVRWREGFLDTLRGI
FT                   ERSGFPGVNYSWLWVLAGVFGSVFGLILPYWLLFFPGLLAKITAAISFLLIWLSYVTLG
FT                   NPLGKSAMATALHPFITIAFMYALVKSAVKITMEGGVWWRETFYPLELLKQKVANPSNA
FT                   SSYQTSEEF"
FT   gene            complement(608754..609038)
FT                   /locus_tag="Ctha_0512"
FT   CDS_pept        complement(608754..609038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0512"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12983"
FT                   /db_xref="UniProtKB/TrEMBL:B3QV29"
FT                   /protein_id="ACF12983.1"
FT                   /translation="MQQEMLSKGFIEKTFLDYYAKGHHQEFYLADNFNNLKSYFPVFEH
FT                   EHPKKLKDVAVSLVQAGLVQGSISDYNHVITVCISGITRDGYIYLRSIS"
FT   gene            complement(609252..610676)
FT                   /locus_tag="Ctha_0513"
FT   CDS_pept        complement(609252..610676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0513"
FT                   /product="alpha amylase catalytic region"
FT                   /note="PFAM: alpha amylase catalytic region; SMART: alpha
FT                   amylase catalytic sub domain; KEGG: mmr:Mmar10_2732 alpha
FT                   amylase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12984"
FT                   /db_xref="GOA:B3QV30"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR032091"
FT                   /db_xref="UniProtKB/TrEMBL:B3QV30"
FT                   /protein_id="ACF12984.1"
FT                   /translation="MRLIVLTIVSLIAFASIFFVIARGFAKTPSKLAHETAMQSPEWLK
FT                   KAIIYKIFIRNYTEEGNLNAIIKRFSELKQYGTTVICLSSIFPCGEPNDKSMAKNPYAI
FT                   SDFRKISPDIGSEEDLRNFIKEAHQEGFKVILDFVAGATALDSSLCASHPEFYKKDKEG
FT                   KIQPFANEVISDMAMLDMENPATQAYLLDSMKYWVSEFGIDGFNCILTEAAPLSFWEQA
FT                   NKALHEISKEPILFADGGQPNYHLHAFSLTPSRSMSEVISDVISGEKKAGLLESALETE
FT                   MKYFPQNSLRVRFNNGYMLNPFAAPKHTDAVCSKIAKLKAVLTFTLGGFGSIRAIPMIY
FT                   GGEEVGLSLPAMARTEQPLQWESPCQREFQDLYRKLGFLRNTDPLFIYGKMVLVKNSKE
FT                   ESVFAFTREYKGKKALVVVNLSGTDFAGFLKVEPARILNDYLEPDKQNTTKDGNMKLTL
FT                   PPFGYKIYFFGDASGN"
FT   sig_peptide     complement(610596..610676)
FT                   /locus_tag="Ctha_0513"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.762 at
FT                   residue 27"
FT   gene            610769..612097
FT                   /locus_tag="Ctha_0514"
FT   CDS_pept        610769..612097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0514"
FT                   /product="Three-deoxy-D-manno-octulosonic-acid transferase
FT                   domain protein"
FT                   /note="PFAM: Three-deoxy-D-manno-octulosonic-acid
FT                   transferase domain protein; KEGG: pvi:Cvib_1190
FT                   three-deoxy-D-manno-octulosonic-acid transferase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12985"
FT                   /db_xref="GOA:B3QV31"
FT                   /db_xref="InterPro:IPR007507"
FT                   /db_xref="InterPro:IPR038107"
FT                   /db_xref="InterPro:IPR039901"
FT                   /db_xref="UniProtKB/TrEMBL:B3QV31"
FT                   /protein_id="ACF12985.1"
FT                   /translation="MQRAWLRAYNILFPLFLFSLKILGFFNAKIRATLLGRENLFQRIR
FT                   AKQKALTHKSGFRLWVHAASVGEFEQARPIVKAIREKDPDAAIILTFLSVSGYEARKNT
FT                   KEADLVTYLPADTPSNARKFLDLLQPDALLLMRYDFWPNHLFEAKRRGIYLMLAAAVLQ
FT                   PDSTYNKPIIRGFYQTIFSLFDQIFTVAEDDAKNFKTLFGLDRVQQAGEPRIDQVIWRS
FT                   QQQERVAHLKPIYNERLVLVAGSVWKTDEAHLIPAYQSVREKLLNYPISLILVPHEIGQ
FT                   ENLNRMADDLKSKHLSYQFISRLHSNFNTETVLIIDEIGYLAELYSLAHIAYIGGGFGV
FT                   HVHNTLEAAVYHLPLIYGPHFHKSPEAKAFQKLGGATVVSNTQSLEKILYDLFSTDELR
FT                   EKMGKIAGNYVHSRAGATQKIAGALLPAQKNAPPHRGNTLNAT"
FT   gene            612094..612657
FT                   /locus_tag="Ctha_0515"
FT   CDS_pept        612094..612657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0515"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cte:CT1770 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12986"
FT                   /db_xref="GOA:B3QV32"
FT                   /db_xref="InterPro:IPR007485"
FT                   /db_xref="UniProtKB/TrEMBL:B3QV32"
FT                   /protein_id="ACF12986.1"
FT                   /translation="MIFSDELSLSIFKIFTMISKTRLFLLFFFFLMATLSGCYSFSEGS
FT                   LPSHIKTIAIPVFGDESSSGIGQLREQLTTKMVDHVQSQSSLVIEQDRRLANSVMEAVI
FT                   KSYSDEPSQVSSTTERATQNRISITISVTYKDLVTKKTLFTQSFTGISDYAIGDFTAQQ
FT                   ESIEEAIDQVSDDILNRLLAGAGW"
FT   sig_peptide     612094..612222
FT                   /locus_tag="Ctha_0515"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.964) with cleavage site probability 0.858 at
FT                   residue 43"
FT   gene            612714..613733
FT                   /locus_tag="Ctha_0516"
FT   CDS_pept        612714..613733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0516"
FT                   /product="S-adenosylmethionine/tRNA-ribosyltransferase-isomerase"
FT                   /note="TIGRFAM:
FT                   S-adenosylmethionine/tRNA-ribosyltransferase-isomerase;
FT                   PFAM: Queuosine biosynthesis protein; KEGG: pvi:Cvib_0597
FT                   queuosine biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12987"
FT                   /db_xref="GOA:B3QV33"
FT                   /db_xref="InterPro:IPR003699"
FT                   /db_xref="InterPro:IPR036100"
FT                   /db_xref="InterPro:IPR042118"
FT                   /db_xref="InterPro:IPR042119"
FT                   /db_xref="UniProtKB/TrEMBL:B3QV33"
FT                   /protein_id="ACF12987.1"
FT                   /translation="MNVSDFDYTLPDEQIAKYPPKERGTTKLLALNRKTGEVQHSLYRS
FT                   LDAFLEPGDLLVLNNTKVIKARLQANKPTGASVELLLLEKHEGPQQIVMYGGKIKAGNT
FT                   LLVGEDEVLVEEILGNGLAKVSAAVPLLSLVEKYGNVPIPPYLNRKAEKSDEMRYQTVF
FT                   AKEQGSVAAPTASLNFTESLEKKLKEKGVQLAFLTLHVGLGTFMPIRTETLSAHEMHRE
FT                   FYHISHETAAAIRLAKAEKRRVVALGTTVTRAIEHASARLLAHEPAELAGEADIFIYPG
FT                   GYEFQIVDALLTNFHAPRSTVLMLAAAFAGAAHLKAAYEAALQNDYHFLSYGDSMFIF"
FT   gene            613948..614946
FT                   /locus_tag="Ctha_0517"
FT   CDS_pept        613948..614946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0517"
FT                   /product="tryptophanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.2"
FT                   /note="KEGG: fal:FRAAL6284 tryptophanyl-tRNA synthetase;
FT                   TIGRFAM: tryptophanyl-tRNA synthetase; PFAM: aminoacyl-tRNA
FT                   synthetase class Ib"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12988"
FT                   /db_xref="GOA:B3QV34"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024109"
FT                   /db_xref="UniProtKB/TrEMBL:B3QV34"
FT                   /protein_id="ACF12988.1"
FT                   /translation="MEKIALTGIKPTGTPHVGNYLGAILPALELAEKYRAFYFIADYHA
FT                   LTTVRDGKQLQELTYEVAATWLALGLDHEKVTFFRQSEVPELFELQWILSCNTPKGLLN
FT                   RAHAYKAAVDQNVAAEKDPDFGVNAGLFNYPVLMASDILMFGTNIVPVGLDQKQHIEIA
FT                   RDIAENFNNTFGDILTMPEGLIQEDLMTIPGTDGRKMSKNYNNTLPLFFPSKQLRKRVM
FT                   QIQTDSKTVEEPKNPDECNVFAIYRRFATPEQIADMRARYEKGGLGYGTAKQELFELLE
FT                   ARFGQQREKYESLMANKAEIDSILLAGAEKARAVSRPMIHKVRQAIGARPR"
FT   gene            614999..616021
FT                   /locus_tag="Ctha_0518"
FT   CDS_pept        614999..616021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0518"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sru:SRU_1730 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12989"
FT                   /db_xref="InterPro:IPR021428"
FT                   /db_xref="UniProtKB/TrEMBL:B3QV35"
FT                   /protein_id="ACF12989.1"
FT                   /translation="MRLLFIFEIIARKNHLTQMKNMNRIYTAILSVVFLFSALSHANAQ
FT                   ETKTTEVSTETVKIDTISIGADGSIETATIIRKIQKTTFLPDFIYNIRPYGSIVQVSFK
FT                   DWAEGGINSVAWAAGLEANSKYIFKPFVWENRLELGFGQNKSNGESLRKTTDIIDFETN
FT                   IRYGARVFKPEFVATLRTQFAPGYDYDTDGDPQISAFFDPAYLVQSIGMSYKHSEQLEA
FT                   SLGLAFREIITDKYTLFSDDTDTDEIESVDFKTGIRASGLLAMNVLDDIFFKSRLQLFS
FT                   AFDQLDVWDVNSKNTLHMRINDSIHTEVGVYFLFQKNATGRLQIQQTFALSFGYAFSNI
FT                   "
FT   sig_peptide     614999..615127
FT                   /locus_tag="Ctha_0518"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.679 at
FT                   residue 43"
FT   gene            616031..616711
FT                   /locus_tag="Ctha_0519"
FT   CDS_pept        616031..616711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0519"
FT                   /product="beta-phosphoglucomutase family hydrolase"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 3; HAD-superfamily hydrolase, subfamily IA, variant
FT                   1; beta-phosphoglucomutase family hydrolase; PFAM: Haloacid
FT                   dehalogenase domain protein hydrolase; KEGG: cch:Cag_0071
FT                   beta-phosphoglucomutase hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12990"
FT                   /db_xref="GOA:B3QV36"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR010976"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:B3QV36"
FT                   /protein_id="ACF12990.1"
FT                   /translation="MQDRVAFIFDMDGVIIDNMQYHVDTWLALFRDKGHELSLDDFLEK
FT                   TAGKKAEEVVRMFLGESVTDADVQKYAEQKDFLYRYLYRPKLAPLAGFMAFVEAAKSAE
FT                   ILMGVGTGGSPENIEFVLGGLNLKPYFKTIVGAANVSKGKPDPEIYLKAADQLGIAPEN
FT                   CIVFEDALPGLEAARRAGMKSVAITTSHTEAEFAAAESVFCIAGDFTNLKPLALIEESR
FT                   QAVL"
FT   gene            616846..618504
FT                   /locus_tag="Ctha_0520"
FT   CDS_pept        616846..618504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0520"
FT                   /product="arginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.19"
FT                   /note="KEGG: pvi:Cvib_1732 arginyl-tRNA synthetase;
FT                   TIGRFAM: arginyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12991"
FT                   /db_xref="GOA:B3QV37"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/TrEMBL:B3QV37"
FT                   /protein_id="ACF12991.1"
FT                   /translation="MRDILVEALRMALSELSVENAEAREIQIEKPADEKFGDASTNVAM
FT                   TLARELRKNPRQIAADIISNLSLGESVDKIDVAGAGFINFYFSKKYITGAVKEILTEGE
FT                   DFGRSEVGKGKTAIVEYVSANPTGPLTVGRGRGGVLGDCIANMLEAQGYDVTREYYFNN
FT                   AGRQMRILAGSVRFRYLELCGEQVDFPEDHYQGGYIGDIAQKIYDEKGTSLAGEEDLSF
FT                   FKEFAEAEIFESIKNTLGRLGIKHDSFFNENTLYEKGENGKSRNDEVVERLAEKGYIKH
FT                   EDGATWFLTTKFGLEKDKVLVKSTGEPSYRLPDIAYHITKFERDFSLMVNVFGADHIDE
FT                   YPDVLRALEVLGYEKERVQVAINQFVTTTVNGEVVKMSTRKGNADLLDDLIDDVGADAT
FT                   RFFFIIRNKESHLNFDVDLAKKQSTDNPVFYLQYAHARICSLIRVAGEETDFEPSASEY
FT                   DLLDALTANEELQLAKILLEYGTALEVCVNALEPQKLIGYMNRVAEAFHKFYQECRIVS
FT                   EEESVRKSRLYLCLATRQVLQNGFKVLGISAPEKM"
FT   gene            618699..620111
FT                   /locus_tag="Ctha_0521"
FT   CDS_pept        618699..620111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0521"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="SMART: metal-dependent phosphohydrolase HD region;
FT                   KEGG: pvi:Cvib_0352 metal dependent phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12992"
FT                   /db_xref="GOA:B3QV38"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:B3QV38"
FT                   /protein_id="ACF12992.1"
FT                   /translation="MQNPIDAHFLFRSDGGFIRMPVWGHIPLIQPLKKIISHPAFLRLK
FT                   GIRQLSFAHHVFPGATHTRFEHSIGVYHLMKLILQRVVTNPLTASHQTETFCFDENTCR
FT                   LLLAASLLHDIGHYPHAHALESAALKLNGALVFEHHEKLTEARLYESHQGFGSLAGILK
FT                   EEWKVEPEQVIALISGKTASPFSKLISGTLDPDKMDYLMRDAHHCNIPYGNIDIERLIE
FT                   SFVPDAERRRFAITEKGIAPLESLMFAKYMMMRNVYWHHTVRTLSAMLRRAVQDILGGK
FT                   HLSVQECQHIFYHNADERVLYDLRERVAIAKCKSAELLDRLVERQSYKRAMTIGLQEAG
FT                   AIANMPNLLSRIYAISEDAELCKQKEIEICEMMNHKFQLKLHGHEILIDAPSNKHIFDY
FT                   QDFRELHIFRGDTSGNKGVFLPFDKSGESVFESRFILEFEKYTKKLRIVSRPEIATHLR
FT                   NLKREVLEILYS"
FT   gene            620162..620506
FT                   /locus_tag="Ctha_0522"
FT   CDS_pept        620162..620506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0522"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: plt:Plut_0286 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12993"
FT                   /db_xref="GOA:B3QV39"
FT                   /db_xref="InterPro:IPR024623"
FT                   /db_xref="UniProtKB/TrEMBL:B3QV39"
FT                   /protein_id="ACF12993.1"
FT                   /translation="MEKEKEGIGFVKGLAIGALFGAAAGTVIGLLFAPRKGTETQQALA
FT                   ESISDLVEQIRHVPQPSQTHDTAADDVENDAKIRAQAIIDDARTEAQQLIDDANVLLKE
FT                   IKQQVKQSRN"
FT   gene            620512..621294
FT                   /locus_tag="Ctha_0523"
FT   CDS_pept        620512..621294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0523"
FT                   /product="alpha/beta hydrolase fold"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG:
FT                   cph:Cpha266_2276 alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12994"
FT                   /db_xref="GOA:B3QV40"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B3QV40"
FT                   /protein_id="ACF12994.1"
FT                   /translation="MLSYIEKNIKEKNEHAVLFWHAFPLSADMWEKQIDAVTAAGYPAI
FT                   ATNVYGVKGSQKKENWTFNHYVADVAQLLGKLHIEQVTLVGISMGGYQAFAMHKKFPGL
FT                   LRSVVLCDTRAEADTDGARKNRFDFIDALAQNGSQEAVSRMIPNFFAKSTYRDKQALVD
FT                   WTSKLIFSHEPEAIADQLRALASRDDSTDHLPKMNCPVTIIVGDKDKLAPPEIAKSMQS
FT                   QIPNAKLEILADSGHLPNLEHPDVFNQVLLNHLAALDG"
FT   gene            complement(621376..622197)
FT                   /locus_tag="Ctha_0524"
FT   CDS_pept        complement(621376..622197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0524"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   cch:Cag_1639 oxidoreductase, short-chain
FT                   dehydrogenase/reductase family"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12995"
FT                   /db_xref="GOA:B3QV41"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B3QV41"
FT                   /protein_id="ACF12995.1"
FT                   /translation="MGVLQDKIAIITGSTKGIGKSIAKKFIEQGAKVVITSSNETNVQK
FT                   AVKEFPADKILGVACDVTNYEEVEQLIEKTVAHFGKLDVMINNAGVAEPFKRIVDASLD
FT                   AWYKPIDINVKGTYHGSRAALIYFLKQGKGKLINMAGAGTEQNNTPYFSAYGSSKAAIY
FT                   RMTFALAEEYKNTGIEIMLLNPGLVRTEILSVHNPTPELQKRMDTFLKVQDIFAQPPTV
FT                   AADMAVKMASSWSDSKTGLFLNALSKSRSRMLLFSYPFRKMFKKIDQTVYG"
FT   gene            complement(622341..624884)
FT                   /locus_tag="Ctha_0525"
FT   CDS_pept        complement(622341..624884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0525"
FT                   /product="Nucleotidyl transferase"
FT                   /note="PFAM: transferase hexapeptide repeat containing
FT                   protein; Nucleotidyl transferase;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain I; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain II; KEGG: gme:Gmet_3178
FT                   phosphoglucomutase/phosphomannomutase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12996"
FT                   /db_xref="GOA:B3QV42"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:B3QV42"
FT                   /protein_id="ACF12996.1"
FT                   /translation="MPENSNLYTIEKAIIMAGGFGTRLRPLTMNIPKPLVPMMQRPMMH
FT                   HIAELLKKYGVKEITSMLYYQPESIREYFGDGKKFGYKMHYILSDADYGTAGSVRNAYD
FT                   FVDGRFVVISGDVLTDFDLSKAIEFHVKRGALATMVLTHVKNPLQFGVVITDKDGRITR
FT                   FLEKPTWGEVFSDTINTGIYILEKEVMDLIPYKEDYDFSKDLFPKMLKENMPLYGYISN
FT                   GYWRDVGTLTEYQEAHIDCLNGKVNLDFTYDYEKIADDVYAHKSAKVDLNSVKFSGKVY
FT                   IGKECSIGKNAIVEDSVIGDGSSVGEGCHLKKTVIWRNTKIDSGADIYLSVITDDVEVG
FT                   AHAKIEEQTFIADKCQIGKEANIRSGVKLWPEKEIEAGAIVTKSLVWESKWSRELFTGS
FT                   RVTGISNIEISPDFAAKLGASFGSILGPNSTVLVSRDVDKSSRMINRAIIAGLLSAGVS
FT                   VNDLQIVPISIARHRLKNGSEVGGLHIRKSPFNQKLLDIIFLDKDGKDIPNAKTKTIER
FT                   NFFGEDYKRADFENIGTISFPERAIEGYTEDFLSQIDTEIIKKARLRIAIDYAHGAATT
FT                   ISPSILGELGVDVVSLNAFIDPKKGTRTADEFYEASDRLSEVVVSLGCDIGFMMDAGAE
FT                   RVFVSDEKGTFLENQRLLTIVTRLFLDVNPETKKIVLPITASQEVEELCKERNVKVIRT
FT                   GDSHLDMMRAVTSDSEIAFAGGTKAGFIFPGFLFACDAMFSTVKILELIAKANTRIGDL
FT                   NLKYPQRYFLVKRNVTCPRDVKGKVMRKIMEDTAENERILIDGVKVIYDDDTSLLLLPD
FT                   RARDIFHVDAESKSKSRATMLVSEFEQKLNTWVRE"
FT   gene            625118..625735
FT                   /locus_tag="Ctha_0526"
FT   CDS_pept        625118..625735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0526"
FT                   /product="regulatory protein RecX"
FT                   /note="PFAM: regulatory protein RecX; KEGG: cac:CAC2410
FT                   uncharacterized protein recX"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12997"
FT                   /db_xref="GOA:B3QV43"
FT                   /db_xref="InterPro:IPR003783"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B3QV43"
FT                   /protein_id="ACF12997.1"
FT                   /translation="MLVLDVRRKPKSDELVLIQFDSDFILETTYELALKFGLKKGLSIS
FT                   SEKFQQVKLASEMALALRQALSYLSRRIHTQKELSIKLQKKGFSTEAIEATTKQLHARG
FT                   ILNETAYAETFIESRKRKLLGTKKLSYELKQRGVAPEAIATALRSTDYEEPTLCRQAAE
FT                   KKFRLLQHVEDKQKLKQKLCAHLMRKGFAWEHIAEALAELGV"
FT   gene            complement(625924..626634)
FT                   /locus_tag="Ctha_0527"
FT   CDS_pept        complement(625924..626634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0527"
FT                   /product="uridylate kinase"
FT                   /note="TIGRFAM: uridylate kinase; PFAM:
FT                   aspartate/glutamate/uridylate kinase; KEGG: cte:CT1779
FT                   uridylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12998"
FT                   /db_xref="GOA:B3QV44"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR011817"
FT                   /db_xref="InterPro:IPR015963"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:B3QV44"
FT                   /protein_id="ACF12998.1"
FT                   /translation="MLKYKRILLKLSGESLMGGQGYGIDGDVLERFAMEVQQCKELGTE
FT                   IAIVIGGGNIFRGVSKASENMDRVQADHMGMLATVINSLAMQDALERKGIFTRLLTAIK
FT                   MEQIAEPFIRRRAIRHLEKGRVVIFGAGTGNPYFTTDTAASLRAIEIEADIIIKGTRVD
FT                   GIYDADPEKNPAAILFPHISYIDILKKNLRVMDLTAITLCRENSLPIVVMNMNIPGNLE
FT                   RLILGEQIGTLVSV"
FT   gene            complement(626743..627612)
FT                   /locus_tag="Ctha_0528"
FT   CDS_pept        complement(626743..627612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0528"
FT                   /product="translation elongation factor Ts"
FT                   /note="TIGRFAM: translation elongation factor Ts; PFAM:
FT                   ubiquitin-associated- domain-containing protein;
FT                   Translation elongation factor EFTs/EF1B dimerisation; KEGG:
FT                   pvi:Cvib_0459 elongation factor Ts"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ACF12999"
FT                   /db_xref="GOA:B3QV45"
FT                   /db_xref="InterPro:IPR001816"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR014039"
FT                   /db_xref="InterPro:IPR018101"
FT                   /db_xref="InterPro:IPR036402"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3QV45"
FT                   /protein_id="ACF12999.1"
FT                   /translation="MAEISAKAVKDLRDKTGVGMMECKKALQETDGDMEKAVEFLRKRG
FT                   AAMAAKRADREAKEGVIAVKTTEDSRNGVIVEVNCETDFVARGEDFTKFAEAISEIALA
FT                   NFPENKEALLALSMGDDYQGQTVEQAIEAMTGKIGEKIEISKVGVITSNDSVVTAYVHP
FT                   GAKLATLVEIGPASTDEVEDLSKDVAMQIAAAAPLVVDRSAVPQEKLAQEAEIYKQQAL
FT                   REGKPEKFVEKIVTGRIEKYYQDVVLLEQAFIKDSSKTVSDVVKETSKRLNKTIEIRCF
FT                   LRYQLGEK"
FT   gene            complement(627642..628394)
FT                   /locus_tag="Ctha_0529"
FT   CDS_pept        complement(627642..628394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0529"
FT                   /product="ribosomal protein S2"
FT                   /note="PFAM: ribosomal protein S2; KEGG: plt:Plut_0403 30S
FT                   ribosomal protein S2"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ACF13000"
FT                   /db_xref="GOA:B3QV46"
FT                   /db_xref="InterPro:IPR001865"
FT                   /db_xref="InterPro:IPR005706"
FT                   /db_xref="InterPro:IPR018130"
FT                   /db_xref="InterPro:IPR023591"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3QV46"
FT                   /protein_id="ACF13000.1"
FT                   /translation="MAQLKLEDLLKSGAHFGHLTRRWCPKMKPYIFMEKNGIHIIDLKK
FT                   TVSLADDALNAVGAIASTGKEILFVGTKKQAKAIVAEQAERAGMPYVAERWLGGMLTNF
FT                   STIRQSIRRLNSIERMEIDGTFDMITKKERLMLMREKEKLVRVLGGISKMTRLPAAIFL
FT                   IDVKKEHIAVREAYSLGIPIFAIVDTNCDPEFIDYVIPANDDAIRSIELITSSVADAII
FT                   DATAVQKDDEDAAATNLASEAQDEKSEA"
FT   gene            complement(628514..628906)
FT                   /locus_tag="Ctha_0530"
FT   CDS_pept        complement(628514..628906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0530"
FT                   /product="ribosomal protein S9"
FT                   /note="PFAM: ribosomal protein S9; KEGG: cph:Cpha266_2011
FT                   30S ribosomal protein S9"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ACF13001"
FT                   /db_xref="GOA:B3QV47"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/TrEMBL:B3QV47"
FT                   /protein_id="ACF13001.1"
FT                   /translation="MNDEMISATGRRKTSVARAFVRPGTGRVLVNGKDVKEYFAEKRYS
FT                   DNAVRPLMLTDSLEKFDVKVSVYGGGLSGQVGAVSLAIARAIVEYDEANRVALRPERLL
FT                   TRDPRMVERKKYGQKKARKRFQFSKR"
FT   gene            complement(628935..629387)
FT                   /locus_tag="Ctha_0531"
FT   CDS_pept        complement(628935..629387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0531"
FT                   /product="ribosomal protein L13"
FT                   /note="PFAM: ribosomal protein L13; KEGG: pvi:Cvib_0456 50S
FT                   ribosomal protein L13"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ACF13002"
FT                   /db_xref="GOA:B3QV48"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/TrEMBL:B3QV48"
FT                   /protein_id="ACF13002.1"
FT                   /translation="MKVDTQSFRTYSAKKGEVERKWFVVDAEGKTLGHLASEIARVLRG
FT                   KHKPQFTRHIDTGDFVVVTNAEKVSVTGAKALKKQYYSYSAYPGGERFEKYREVMAKHP
FT                   EKIIERAVWGMLPHNNLGRQQFKKLKVYVGDLHPHTAQQPAELKVS"
FT   gene            629653..630681
FT                   /locus_tag="Ctha_0532"
FT   CDS_pept        629653..630681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0532"
FT                   /product="cell shape determining protein, MreB/Mrl family"
FT                   /note="KEGG: cph:Cpha266_0800 cell shape determining
FT                   protein, MreB/Mrl family; TIGRFAM: cell shape determining
FT                   protein, MreB/Mrl family; PFAM: cell division protein FtsA;
FT                   cell shape determining protein MreB/Mrl; SMART: actin/actin
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ACF13003"
FT                   /db_xref="GOA:B3QV49"
FT                   /db_xref="InterPro:IPR004000"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:B3QV49"
FT                   /protein_id="ACF13003.1"
FT                   /translation="MGFLDFFSKDVAIDLGTANTLIFIRGKGIVLNEPSIVALDRNSRK
FT                   VVAIGSEARQMHEKTHRDIITIKPLGGGVIADYEAAEELIRGLIKKTQKDFSGSIRRMV
FT                   IGIPSGITEVEKRAVRDSAEHVGAKEVYLVAEPMAAAIGIGLDVEAPFGNMIVDIGGGT
FT                   TEIAVISLSGLAAGESIRVAGTEITNAILQHFRKTYNLAIGERTAEEIKIKIGSAYELE
FT                   EELIATVKGRNLVTSLPEQRDVSSPEIREAIAEPIGQIVNAVRRCLETTPPELSADILD
FT                   RGILLTGGGALIKGLDKRLSDETKLPVHVGEDPLTAVVRGTGKVLENLEKYQKVLMQTK
FT                   RI"
FT   gene            complement(631177..632316)
FT                   /locus_tag="Ctha_0533"
FT   CDS_pept        complement(631177..632316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0533"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG: cte:CT0548
FT                   glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ACF13004"
FT                   /db_xref="GOA:B3QV50"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR023881"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:B3QV50"
FT                   /protein_id="ACF13004.1"
FT                   /translation="MRIGITCYPTYGGSGVIATELGKALAARGHVVHFISYALPFRLKE
FT                   FSSNIFYHEVDVTNYPLFEYPPYSIALASKMADIISFESLELLHVHYAIPHAMSALLAK
FT                   EMLKEKEDRHQNFKLVTTLHGTDITIVGKDPSMAEAVRLGVNRSDGVTTVSDFLRQQTI
FT                   SNFETKKHIEVIPNFIDTKEFIRDECAQFRNVFALPEEKVLIHISNFRPVKRVKEVIKI
FT                   FYHINKAIPCRMLLIGDGPERMDAEMLSRKLDIADKVKFLGRQEALVALLSISDLMIMP
FT                   SESESFGLAALEAMACGVPVLATAVGGLPELIQNGVDGCLQPLENVEQMADCAISILQN
FT                   QEVHQRFAKNARAKAETYDTDDIVSLYEAFYAKMLTKCS"
FT   gene            complement(632383..633786)
FT                   /locus_tag="Ctha_0534"
FT   CDS_pept        complement(632383..633786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0534"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: har:HEAR0719 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ACF13005"
FT                   /db_xref="GOA:B3QV51"
FT                   /db_xref="UniProtKB/TrEMBL:B3QV51"
FT                   /protein_id="ACF13005.1"
FT                   /translation="MDPINFVIVFIGVVVIVFSFINSPLQMAMYIVAFQKIIDIFWFVK
FT                   ITVGGFELSIQRVVYTVLPIALFLVVINESQKKKIPFSMPLITVMIVFSTWILLAIIRS
FT                   PYISVALPDFFKVAGSYVIFATGWFYFDSQEKFEHFAKVYIFSYIIPFIGFFLQLFGIF
FT                   ELGDIGVGQQLASNYGVEGQSFRYPGFYNDALTQAIYTFTVVPLCFYMVNNPENRKKLI
FT                   YYIFILLSWMIIYYGFSRSGWLSGFIQIAAWLFLNKRYGVFVAMLSVSMIALFSSPFLA
FT                   SFFNDVIQSVEAGEIKGMTGRDGMWKSIMESFYQGSVIEKFVGKGLYSHSDVLDVFLNV
FT                   ETSGHNKGHSDLYEYIHDTGIIGVSIYFSLILAVFIYYSRILKQVYAFSINNSLSLKYL
FT                   AWGAMFAFYLLNIVTYASRWPGFSWPFWFLAGFALKPPMYYIYQDQAMEEDYDEDEAFV
FT                   LVNPQLVPH"
FT   gene            complement(633789..634799)
FT                   /locus_tag="Ctha_0535"
FT   CDS_pept        complement(633789..634799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0535"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG: pfu:PF1358
FT                   glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ACF13006"
FT                   /db_xref="GOA:B3QV52"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:B3QV52"
FT                   /protein_id="ACF13006.1"
FT                   /translation="MIESYFFPEILHRLPFVVKSIGQYNVYHLVNSLFDLRVSGADLDC
FT                   DVFHGFEGCSLYSMRAAKKRGAITVLDEATYHISETIQLFRDEYQLLALNMPKWVEKGD
FT                   LTIKRKYLEFKVSDYVFVGSEKIKKDFIKHEKRTPESIFVIPYGCNLERFRPGKKEDST
FT                   FRIVFVGIIGVRKGAYYILEAFKQLKLKNAEFILISPIDEDFQPIFNKYKDIVTHINGV
FT                   SQQELNRYLNNASVFVLPSIVESFGMATAEAMACGVPVIVSENCGMTCQDGVEGFVVPI
FT                   RNIEALKEKILFLYNNQKRAKEMGQEGIEYVKQFTWDNYYSKIAKAYNTILQTAK"
FT   gene            complement(635061..635996)
FT                   /locus_tag="Ctha_0536"
FT   CDS_pept        complement(635061..635996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0536"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   bvu:BVU_0890 conserved hypothetical protein, putative
FT                   glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ACF13007"
FT                   /db_xref="GOA:B3QV53"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:B3QV53"
FT                   /protein_id="ACF13007.1"
FT                   /translation="MDILPFKKFLWLKKLSKTITGDLDQQLRALSLLSRYDAIYAMING
FT                   PIVGLCFLRKAGLLKTPIIVLAHGLPPYDHPSFKISYQGADHVIATNRVTYERIKSRYN
FT                   LPDEKITLMNWWSDIEFYPDYSREERTEPFLFSNGQSWRDYSTLFQAVTKAGIKAKFII
FT                   PESQLSSDYGKNIEVTVYRKNPHANFQDGFMPGDFLPILRKTTIVAIPLDENRLHRSNG
FT                   ITNMMEAFAAGVPVIMTESPCIDIDIEREGSGFWVKEGDVEDWVEKITRISNNPTLQKQ
FT                   MAANARKTAEKYKVQSFSEGLCQTIKKVTN"
FT   gene            complement(636164..636922)
FT                   /locus_tag="Ctha_0537"
FT   CDS_pept        complement(636164..636922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0537"
FT                   /product="Triose-phosphate isomerase"
FT                   /EC_number="5.3.1.1"
FT                   /note="PFAM: triosephosphate isomerase; KEGG: plt:Plut_1464
FT                   triosephosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ACF13008"
FT                   /db_xref="GOA:B3QV54"
FT                   /db_xref="InterPro:IPR000652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020861"
FT                   /db_xref="InterPro:IPR022896"
FT                   /db_xref="InterPro:IPR035990"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3QV54"
FT                   /protein_id="ACF13008.1"
FT                   /translation="MRKKFVAGNWKMNKDLLGAVSLATEILQLLGDEAPTCEVAIAPTF
FT                   LCQQAVFQVIDESAIKLAAQNCFYEDQGAYTGEISAAMLRNSGCEYVILGHSERRQYFN
FT                   ETDEIVNKKVKNALSVELDVIMCVGETLEQRESGVTKSVVETQVRGGLKDLTAEDMKSV
FT                   VIAYEPVWAIGTGKTATPEQAQEVHAFIRGIVKDMFGEEVANELRIQYGGSVKTSNAKE
FT                   LFGMPDIDGGLIGGASLNAEDFVEIIKSAE"
FT   sig_peptide     complement(636827..636922)
FT                   /locus_tag="Ctha_0537"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.609) with cleavage site probability 0.609 at
FT                   residue 32"
FT   gene            complement(636938..637159)
FT                   /locus_tag="Ctha_0538"
FT   CDS_pept        complement(636938..637159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0538"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cte:CT1445 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ACF13009"
FT                   /db_xref="UniProtKB/TrEMBL:B3QV55"
FT                   /protein_id="ACF13009.1"
FT                   /translation="MGKRQIILNAEKIPGYSFSGDEVNVLMKNGVVWHGYVQEVTGSDV
FT                   KLRDTRFKVHTLSLSEVEKLYLDRVTDY"
FT   gene            complement(637164..637640)
FT                   /locus_tag="Ctha_0539"
FT   CDS_pept        complement(637164..637640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0539"
FT                   /product="transcription elongation factor GreA"
FT                   /note="TIGRFAM: transcription elongation factor GreA; PFAM:
FT                   transcription elongation factor GreA/GreB domain protein;
FT                   KEGG: cte:CT1446 transcription elongation factor GreA"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ACF13010"
FT                   /db_xref="GOA:B3QV56"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR006359"
FT                   /db_xref="InterPro:IPR018151"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028624"
FT                   /db_xref="InterPro:IPR036805"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3QV56"
FT                   /protein_id="ACF13010.1"
FT                   /translation="MSDKTYLTKGGYNKLKDELDDLKTNVRQQVLEKITEAKSHGDLSE
FT                   NAEYEAAKEEQAQVESRISTLERVLSTATILDEKDIKTDKVYILTTVLLKDLDRDEEVE
FT                   YTLVSSEEADSENGKISVKSPIGKNLLGKSVGEIVEIKVPKGIMRYEVLNIKVK"
FT   gene            637891..638520
FT                   /locus_tag="Ctha_0540"
FT   CDS_pept        637891..638520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0540"
FT                   /product="PEBP family protein"
FT                   /note="PFAM: PEBP family protein; KEGG: rme:Rmet_0419 YbhB
FT                   and YbcL"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ACF13011"
FT                   /db_xref="InterPro:IPR005247"
FT                   /db_xref="InterPro:IPR008914"
FT                   /db_xref="InterPro:IPR036610"
FT                   /db_xref="UniProtKB/TrEMBL:B3QV57"
FT                   /protein_id="ACF13011.1"
FT                   /translation="MQLTVHGFENGAPIPPQYAFCAPASQGIVSLAKNRNPALSWSDVP
FT                   EATQSFALIFHDRDVPSKPDDVNQEDRLVPADLPRVDFFHWVLIDMPASLRAIAEAVDA
FT                   DGVAARGKAPGKTELGVRGINDYTNWFKGDENMEGIYAGYDGPCPPWNDAIVHNYFFTL
FT                   YALDIESLSLSGNFTGQDARQAMQGHILAEATWHGTYTVTPSLLKK"
FT   gene            638728..639612
FT                   /locus_tag="Ctha_0541"
FT   CDS_pept        638728..639612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0541"
FT                   /product="5,10-methylenetetrahydrofolate reductase"
FT                   /EC_number="1.5.1.20"
FT                   /note="KEGG: lbi:LEPBI_I3275 5,10-methylenetetrahydrofolate
FT                   reductase; TIGRFAM: 5,10-methylenetetrahydrofolate
FT                   reductase; PFAM: methylenetetrahydrofolate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ACF13012"
FT                   /db_xref="GOA:B3QV58"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR004620"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:B3QV58"
FT                   /protein_id="ACF13012.1"
FT                   /translation="MIIKDLLQPDKTQFSFEFYPPKKDEEWEKLFFHISELMPMNPAYV
FT                   SVTYGAGGSTRDKTHNLVVRISKETNIPVVSHLTCVGSSKSEIHTILERYAENGITNIL
FT                   ALRGDPPKGSTTFEKPADGFAYANELVAFIKKNFPQIGVGVAGFPEGHPETLNRLTEID
FT                   HLKEKVDAGADYIVTQLFFENRDFYDFRERCEIAGIHVPICAGIMPITTDKGMQRMAEL
FT                   SPGTRFPAPLLREISKAQNDEEVSAIGLNWAIAQVRDLIENKTPNIHLYTLNHSRPTLK
FT                   IFEALSEKNPISS"
FT   gene            640070..641530
FT                   /locus_tag="Ctha_0542"
FT   CDS_pept        640070..641530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0542"
FT                   /product="alpha amylase catalytic region"
FT                   /note="PFAM: alpha amylase catalytic region; SMART: alpha
FT                   amylase catalytic sub domain; KEGG: pvi:Cvib_0500 alpha
FT                   amylase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ACF13013"
FT                   /db_xref="GOA:B3QV59"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:B3QV59"
FT                   /protein_id="ACF13013.1"
FT                   /translation="MSNAVKYPLVFEVNAHVWLRELSHKTGSPVSLSTIPHSEIQKWAD
FT                   QNINAVWLMGVWTRSPKGKEVALHHDGLHFDYTKALPGWTENDIDASPYSIVDYKVSPE
FT                   FGGESALARLRERLAEYNIKLILDFVPNHTALDHPWIASKPEYYVQVSKEAYEKAPDLF
FT                   FSPNENQFLAYGRDPYFPPWTDTAQLNYANSDCRSAMLATLKEIASQCDGVRCDMAMLM
FT                   LKEIYNGIWGNLTGKMQEEFWELAIREIKSQYPNFLFIAEAYWDKEWELQQLGFDFIYD
FT                   KRFYDRLKSGDIQGLKTHLNADMAFQQKLVRFIENHDEERAAVSLKNNHKVAAMVTLTS
FT                   PGMRLVHQGQQEGFKTKLPVQLANPKQEPQNADIYGFYERLFRVMRQTPVTRGEFHLID
FT                   LKEHDNPDVIAFERRNGVKTRHFITVANFSDRPTTLSFNTDAFSNIFSYEHIEVVSTEL
FT                   LCSPQFDISPDSLTVRLRPHEGLLFVTH"
FT   gene            641725..642555
FT                   /locus_tag="Ctha_0543"
FT   CDS_pept        641725..642555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0543"
FT                   /product="orotidine 5'-phosphate decarboxylase"
FT                   /note="TIGRFAM: orotidine 5'-phosphate decarboxylase; PFAM:
FT                   Orotidine 5'-phosphate decarboxylase; KEGG:
FT                   cph:Cpha266_2677 orotidine 5'-phosphate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ACF13014"
FT                   /db_xref="GOA:B3QV60"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR011995"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B3QV60"
FT                   /protein_id="ACF13014.1"
FT                   /translation="MFKSRLNQLIESKNSLLCVGLDADPDKIPSVFHQHDSPVVAFNAA
FT                   IIEATSELAIAYKPNIAFYESRGIRGFKDLEETLLLIPKTCLTIADGKRGDIGNTSQMY
FT                   AKAFYEHWNFDASTVAPYMGHDSLLPFFEYQEKLTFVLCLTSNNGSADFEEQRLANGKK
FT                   LYEAVLEKVLAWNKAGNIGIVVGATKPEQLAEIRQKAPEIVILIPGIGAQGGSLEETIR
FT                   YGTDKNQESAIVVSGRKIIYPDGKFTSIDEFQRAVNERAKATVLEMRQYLKTNL"
FT   gene            642697..644529
FT                   /locus_tag="Ctha_0544"
FT   CDS_pept        642697..644529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0544"
FT                   /product="glucosamine/fructose-6-phosphate
FT                   aminotransferase, isomerizing"
FT                   /note="TIGRFAM: glucosamine/fructose-6-phosphate
FT                   aminotransferase, isomerizing; PFAM: glutamine
FT                   amidotransferase class-II; sugar isomerase (SIS); KEGG:
FT                   cte:CT0130 glucosamine-fructose-6-phosphate
FT                   aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ACF13015"
FT                   /db_xref="GOA:B3QV61"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:B3QV61"
FT                   /protein_id="ACF13015.1"
FT                   /translation="MCGIVGYIGKKNASPILIDGLKRLEYRGYDSAGIALLNGTLHIHK
FT                   KKGKVADLEQILPEFSDSLTIGIGHTRWATHGEPNDVNAHPHTNEAGDIAVIHNGIIEN
FT                   YGAIRAELQRKGHKFKGDTDTEVLAHLIDEIWNEADCDFETAIRLALKEVDGTYGLCAI
FT                   TSREPDKIVTARNGSPLIIGVGEDEFLIGSDASPIVSHTRKVIYLNDGEMAILTRDSYT
FT                   IKTIENVTMPKAIDELTFGIAEIEKAGFDHFMLKEIFEQPEAIENSMRGRALPNEGQVR
FT                   LGGIREHIDRLRNAKRIIICACGTSWHSGLVGEYLIEEYARIPVEVEYASEFRYRHPIL
FT                   SKDDVVIAISQSGETADTLAAIREAKAKGALVLGICNVVGSSIARETDCGIYTHAGPEI
FT                   GVASTKAFTAQVTVLVLLALALSQKRTLSDEQTKDIIQDLYQLPKKVQEILNLNEEIFE
FT                   MAKVFKDARNFLYLGRGFNFPVALEGALKLKEISYIHAEGYPAAEMKHGPIALIDENMP
FT                   VVFIANKDSSYQKIISNIEEVRSRKGRVIVIASEGDNDIDKLAEFVIHIPDAMMPLMPL
FT                   LTVIPLQLLAYHIAVLRGCDVDQPRNLAKSVTVE"
FT   gene            644716..645426
FT                   /locus_tag="Ctha_0545"
FT   CDS_pept        644716..645426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0545"
FT                   /product="competence protein"
FT                   /note="KEGG: cch:Cag_0200 competence protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ACF13016"
FT                   /db_xref="GOA:B3QV62"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:B3QV62"
FT                   /protein_id="ACF13016.1"
FT                   /translation="MTRFLDRCLREALHLIYPHVCICCHTLLEESENYVCKTCYEQLDK
FT                   FLLPGESATEISARLAKHFPFQTSIKEGLALYRFHKSGLLQEIIHSIKYGGLQNLAVEL
FT                   GMMLGKHILSEKPFSTWEAIIPVPLHHVKHIERGYNQAEALANGVSRAIGIPVVRNAVM
FT                   RSRYTESQTKLAAEKRRANISGVFQIRQPVQFKQILLIDDVFTTGATLVELSHELKKYG
FT                   AIEITIAALAVTST"
FT   gene            complement(645543..645929)
FT                   /locus_tag="Ctha_0546"
FT   CDS_pept        complement(645543..645929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0546"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fjo:Fjoh_3216 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ACF13017"
FT                   /db_xref="UniProtKB/TrEMBL:B3QV63"
FT                   /protein_id="ACF13017.1"
FT                   /translation="MSYIKDSKIGQAIEGILANVPGTIAVSVVDLNSGMSLGSHSTSPS
FT                   FDPDTASAYNAEVIKQQQKALSALQLEHEKIEDILVTLGEQLHLLKLIGHGYFLFLAVS
FT                   TKHTNLAIARTVLRKYAEIAAQGV"
FT   gene            646679..647500
FT                   /locus_tag="Ctha_0547"
FT   CDS_pept        646679..647500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0547"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG: pae:PA2572
FT                   probable two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ACF13018"
FT                   /db_xref="GOA:B3QV64"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B3QV64"
FT                   /protein_id="ACF13018.1"
FT                   /translation="MNVLIVDDEPDILAALEYLLKDNKCSPVSVDDGEKAKSLLKSGKF
FT                   DMVISDFIMPNLDGYELLSWLRKEGHNTFFVLMSGYYNNSFSDGFKKLQVDAILPKPFT
FT                   RQSIQDIVSKCARRKPVEFINEEGINKPQAQPIAQQPLGEALSTEKSNKAVFLDKLVKD
FT                   LPGIVMIAIMDSASNYAIRQTSTIKIFPKAFYGYIQSIIEQKKKVLNALHLTEQMPRDI
FT                   TVNTSELLHFIKPINNEGRIVYLAVSKQTANLSLVRLIIERYVEQMQNVAL"
FT   gene            647541..647930
FT                   /locus_tag="Ctha_0548"
FT   CDS_pept        647541..647930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0548"
FT                   /product="Roadblock/LC7 family protein"
FT                   /note="PFAM: Roadblock/LC7 family protein; KEGG: mka:MK1325
FT                   predicted regulator of Ras-like GTPase activity, member of
FT                   the Roadblock/LC7/MglB family"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ACF13019"
FT                   /db_xref="GOA:B3QV65"
FT                   /db_xref="InterPro:IPR004942"
FT                   /db_xref="InterPro:IPR037587"
FT                   /db_xref="UniProtKB/TrEMBL:B3QV65"
FT                   /protein_id="ACF13019.1"
FT                   /translation="MPVIENTIVAERLKEIFKQLKNDVPGVNGIAIVSSDGRILAHDWH
FT                   AKDLEPDKLGAIGSTLLGFGRKTIEILSTGHFLQVLLQSTDGTVGVYSAGPKMVLMVSM
FT                   GKDSNLGILNHQSRRRAQEIADLFG"
FT   gene            647954..648655
FT                   /locus_tag="Ctha_0549"
FT   CDS_pept        647954..648655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0549"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ACF13020"
FT                   /db_xref="UniProtKB/TrEMBL:B3QV66"
FT                   /protein_id="ACF13020.1"
FT                   /translation="MVIERVQQINEISDLVLAGKPSILRFIYKKKSAVEALTQSEYMVY
FT                   NDTIYYNSQIKLFDRHLLKFLQGYVEIEIVPTNASFPPTPLSINFHQLIWNSVKKLSEY
FT                   EAEGLFVGQDELLASRDKNKSSLLSLPSHDQSDNIVFYYFYYKPKSIRGFYDEYPFGNQ
FT                   ISFYRSLLSLAVAGYLKLGEAFPMYSKGDMLHSIQSATSESKHAEQSDTAKSGKINGLR
FT                   KILNAIKSQRT"
FT   gene            648655..649191
FT                   /locus_tag="Ctha_0550"
FT   CDS_pept        648655..649191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0550"
FT                   /product="small GTP-binding protein"
FT                   /note="TIGRFAM: small GTP-binding protein; PFAM: protein of
FT                   unknown function ATP binding; Miro domain protein; KEGG:
FT                   cau:Caur_0665 small GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ACF13021"
FT                   /db_xref="InterPro:IPR004130"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3QV67"
FT                   /protein_id="ACF13021.1"
FT                   /translation="MSEYYKLVVTGAVNSGKTTFVRTISEIDPITTDELVTEEEVKELK
FT                   TYTTVAMDYGRRTIEEDLTLHIYGTPGQERFYFAWDVLVEGAFGVIFLADSTSPTSIRT
FT                   TKNIINYFHARYDLPYLLCVTKLDMPNSIGYTEVLKIINRPDLFAMQCKATEPDEVRKA
FT                   LITLLTLAIDKEQEV"
FT   gene            complement(649294..649650)
FT                   /locus_tag="Ctha_0551"
FT   CDS_pept        complement(649294..649650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0551"
FT                   /product="ferredoxin-like protein"
FT                   /note="KEGG: gfo:GFO_1472 ferredoxin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ACF13022"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:B3QV68"
FT                   /protein_id="ACF13022.1"
FT                   /translation="MALMITDACISDRCDVCEPECPNIAIYAPGRPYELFGDDYEPLST
FT                   EKYYIVPGKCTECVGFHEEPQCAAVCPVDCCVPDPNYPETKDELYAKKDMLERDKVIVQ
FT                   RIEEIKERKRNQTQ"
FT   gene            650166..652811
FT                   /locus_tag="Ctha_0552"
FT   CDS_pept        650166..652811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0552"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /note="TIGRFAM: ATPase, P-type (transporting), HAD
FT                   superfamily, subfamily IC; copper ion binding protein;
FT                   copper-translocating P-type ATPase; heavy metal
FT                   translocating P-type ATPase; PFAM: Haloacid dehalogenase
FT                   domain protein hydrolase; Heavy metal
FT                   transport/detoxification protein; E1-E2 ATPase-associated
FT                   domain protein; KEGG: ana:alr7635 cation-transporting
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ACF13023"
FT                   /db_xref="GOA:B3QV69"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR006122"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B3QV69"
FT                   /protein_id="ACF13023.1"
FT                   /translation="MATSKGKGNLESITLSVAGMSCMNCVRSVASALNNLAGVQNAKVS
FT                   LEEHSATVEYFSDLVSVDDLKTAVRNAGFSAEKQEAGLKKPIEAPLAFALELPVFSAET
FT                   TMKQAAIAKIETAEKNAEPSDGKSATESLTLLIGGMHCAACVGKVETALQRTNGVRRAA
FT                   VNLAMETATVEFFPDQCTPEALLETITGAGYEATLPDTNSAAEAAEADEREKEAAFERH
FT                   KKLTIFSAVLTAVIMAISMSMMLPAIGKTLNAQVANYLLFFLTLPVVAWCGRQFFISAW
FT                   KNLLHFSASMDTLIAVGTGSAFLYSTAVTFFPDLFSNIGRAGHVYFDTSATIITLILFG
FT                   RLLEQRAKTRASEAVKKLAKLSAKTARVVRNGIEHELPIAQVMKGDTLIVRPGEKIATD
FT                   GKIIDGASSVDESMMTGESLPAEKTADDEVIGGTLNKNGSFRFRATKVGKDTMLAQMIR
FT                   LVGEAQGSKAPIQRLADTVSAYFVPTVVLIALATFGIWFFAAAPEIRLSMALVNFVSVL
FT                   IIACPCALGLATPAAVTVAAGRGAELGILFKNAESLETAEKIQTVVLDKTGTITEGKPR
FT                   VIDFEVAHENESGINELLSLLLAIESRSEHPLADAIRTYAESQNAKPLLLEHFQAIEGK
FT                   GAKGSVSGKSVAVGNAALMADEKIQIPFELAEKASRFAKDGKSVVFMGINGKAAAVMSL
FT                   ADALKPDSKQAVTMLKSLGMKVIMLTGDGKETAAKIAHEAGISEFRAEVLPAEKVEMVK
FT                   SLQAKDQRVAMIGDGINDAPALAQADVGIAIGTGTDIAISAADVTLVKGSLLTAAETFR
FT                   LSRRTMHTIRQNLFFAFIYNTFGIPIAAGVLYPFAGILLSPIFAAMAMAMAMSSVSVLG
FT                   NSLRLKKYQP"
FT   sig_peptide     650166..650258
FT                   /locus_tag="Ctha_0552"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.626) with cleavage site probability 0.343 at
FT                   residue 31"
FT   gene            652852..653235
FT                   /locus_tag="Ctha_0553"
FT   CDS_pept        652852..653235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0553"
FT                   /product="CrcB protein"
FT                   /note="TIGRFAM: CrcB protein; PFAM: Camphor resistance CrcB
FT                   protein; KEGG: cte:CT2102 CrcB protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ACF13024"
FT                   /db_xref="GOA:B3QV70"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/TrEMBL:B3QV70"
FT                   /protein_id="ACF13024.1"
FT                   /translation="MQSLTPYLLVGIGGMAGAVLRYAVSLAGQFITTGFPFATLTVNIL
FT                   GSFLIGLFAELSATTTLISPEMRLLLATGLCGGFTTFSSFMYEIHGLLQDGQIFYASLY
FT                   IGLSAVGGFLALYCGILFSKIWS"
FT   sig_peptide     652852..652923
FT                   /locus_tag="Ctha_0553"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.617) with cleavage site probability 0.498 at
FT                   residue 24"
FT   gene            653249..653605
FT                   /locus_tag="Ctha_0554"
FT   CDS_pept        653249..653605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0554"
FT                   /product="protein of unknown function DUF190"
FT                   /note="PFAM: protein of unknown function DUF190; KEGG:
FT                   rpc:RPC_2688 protein of unknown function DUF190"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ACF13025"
FT                   /db_xref="InterPro:IPR003793"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:B3QV71"
FT                   /protein_id="ACF13025.1"
FT                   /translation="MALKGQAQLLRIFIGEQDKYGHKPLYEVIVQMAKDSGLAGASAFK
FT                   GVLSYGASSVTHTSKIFELSQDLPMVIEIVDLEDKMYPFLQKLDQILDNSGCGGLVTME
FT                   KVQILKYSPKKNNH"
FT   gene            653976..654611
FT                   /locus_tag="Ctha_0555"
FT   CDS_pept        653976..654611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0555"
FT                   /product="NusB antitermination factor"
FT                   /note="TIGRFAM: transcription antitermination factor NusB;
FT                   PFAM: NusB/RsmB/TIM44; KEGG: pvi:Cvib_1464 NusB
FT                   antitermination factor"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ACF13026"
FT                   /db_xref="GOA:B3QV72"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR011605"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3QV72"
FT                   /protein_id="ACF13026.1"
FT                   /translation="MIISRRQIRELAMQVLYAYEVRKEKVDKVAKGIIPEDVVADIKAK
FT                   DFIFKIINSVIQNIQDIDTHIAKHADNWELNRMAIIDKNLMRIAIAEMLYLDDVPPKVS
FT                   INEAIEIAKRYSTDKSSKFVNGILDATYNEVKSKGVLHKSGRGLVDLPAKKERVANPFP
FT                   STPPKKPENVPNPFSTPFKKNSSEPIRNPFEGNKSPQPPQKTLRRKKK"
FT   gene            654616..655320
FT                   /locus_tag="Ctha_0556"
FT   CDS_pept        654616..655320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0556"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: sru:SRU_0016
FT                   serine/threonine protein phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ACF13027"
FT                   /db_xref="GOA:B3QV73"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006186"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:B3QV73"
FT                   /protein_id="ACF13027.1"
FT                   /translation="MPQDETGTKNIIAIGDIHGCILSLKALIQKLDLSEKPQLVFLGDY
FT                   VDRGPNSKGVIDFLIELNDSYPCVFLKGNHEVMMQDYLIGDCIFDNWKYNGGTETLASY
FT                   QENGHLSIPSSHLKFLAQCRYTYETDDYVFVHGGLKPEFSIRENLENGSNESMVWERTH
FT                   LSKEAISTEHPNWEKTVICGHTPQHSPLLLKRLICIDTGCVYYSTRPGFGRLTAIELPS
FT                   RKITQVENQDLP"
FT   gene            655350..655991
FT                   /locus_tag="Ctha_0557"
FT   CDS_pept        655350..655991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0557"
FT                   /product="endonuclease III"
FT                   /EC_number="4.2.99.18"
FT                   /note="KEGG: plt:Plut_1681 endonuclease III/Nth; TIGRFAM:
FT                   endonuclease III; PFAM: helix-hairpin-helix motif; HhH-GPD
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ACF13028"
FT                   /db_xref="GOA:B3QV74"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR005759"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:B3QV74"
FT                   /protein_id="ACF13028.1"
FT                   /translation="MTRDEKLELVAKILGAKHPAPKTELNYETPFQLLVATILAAQCTD
FT                   KRVNLVTAALFQRYPDAKSMSELSFEALREEIKSINFLNNKAKNILDSSKALVEKYNGE
FT                   VPDTLDALTALPGVGRKTAHVVMSNAFGKPVLAVDTHVHRVANRLGLANSKNVRDTENQ
FT                   LMEILPESLVSDFHHYLILHGRYTCKARSPQCMNCELTHICNYFHSKTND"
FT   gene            656264..656761
FT                   /locus_tag="Ctha_0558"
FT   CDS_pept        656264..656761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0558"
FT                   /product="protein of unknown function DUF520"
FT                   /note="PFAM: protein of unknown function DUF520; KEGG:
FT                   aoe:Clos_1967 protein of unknown function DUF520"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ACF13029"
FT                   /db_xref="InterPro:IPR007551"
FT                   /db_xref="InterPro:IPR035570"
FT                   /db_xref="InterPro:IPR035571"
FT                   /db_xref="InterPro:IPR036183"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3QV75"
FT                   /protein_id="ACF13029.1"
FT                   /translation="MSSTFSFDVVSKLDMQEFDNALNQAKKELQQRYDLKNTNSSIEFN
FT                   QKDMQLTLESADEFSLKSVVDIIESKMIKRGISIKSLDFGKVEPASQKSVRQKISLKEG
FT                   IDKENAKKITNAVKDMKLKVQASVQGEEVRISGKSKDELQTVMSALKEMDLPVPLQFTN
FT                   YR"
FT   gene            656931..658850
FT                   /locus_tag="Ctha_0559"
FT   CDS_pept        656931..658850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0559"
FT                   /product="glycoside hydrolase family 3 domain protein"
FT                   /note="PFAM: glycoside hydrolase family 3 domain protein;
FT                   KEGG: cph:Cpha266_2499 glycoside hydrolase, family 3 domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ACF13030"
FT                   /db_xref="GOA:B3QV76"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR019800"
FT                   /db_xref="InterPro:IPR036881"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:B3QV76"
FT                   /protein_id="ACF13030.1"
FT                   /translation="MKLSFRNRTKRVGLLAMLFFFTLNAKAQLNEPALNRPAVADSLHI
FT                   ITPLQKEQQAHLSLFLKKWAWADSILATMTLEEKVGQMLVASSSSYYQSTDDKSYQELS
FT                   ELVKNDLVGGIMFSRGDVYELAMLANRYQSLAKYPLLISADMEWGVAMRVKRTTEFPNN
FT                   MGVAATWNPMYAYEMGRAIAEEARALGIHQNYAPAVDLNNNPENPVINTRAFSENVQLT
FT                   NAMAKAFVMGSQSARVIATAKHFPGHGDTEIDSHRDLPVLPFTRNRLDSLEFRPFKYAI
FT                   TNGVMSVMVGHLALPNLVSSEQVPATLSPGIISRILRKEFAFDGLIVTDAMTMYGIRKN
FT                   YSVGEAAVKAVLAGNDILLMPPDVAVAHEAIVKAVEKADIPLSHIDESVRRILIVKEWL
FT                   RLHRSRLVDMNAIASKVGTLPHQMLAQEIADHSITLLRNKGNELPLRVKTTRKRKLLNV
FT                   MIQNMNSFRVGSTFRRAMKDRFQVDHFRIFPESNTLNYTDVMKAARKASGIVVSCFVEV
FT                   RSWSKEFGLDAKQTKLLRDLNSIARKRNIPLVVVSFGSPYIIMGHSKVPAYLCAYSSAD
FT                   AAQMSVAKILYGEIEPQGRLPITIPGEFEFGEGMSFRGELPKEFKFVDYEFSPETANGN
FT                   ATTN"
FT   sig_peptide     656931..657014
FT                   /locus_tag="Ctha_0559"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.946 at
FT                   residue 28"
FT   gene            complement(658921..659751)
FT                   /locus_tag="Ctha_0560"
FT   CDS_pept        complement(658921..659751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0560"
FT                   /product="MazG family protein"
FT                   /note="TIGRFAM: MazG family protein; PFAM: MazG nucleotide
FT                   pyrophosphohydrolase; KEGG: cte:CT2086 MazG protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ACF13031"
FT                   /db_xref="InterPro:IPR004518"
FT                   /db_xref="InterPro:IPR011551"
FT                   /db_xref="UniProtKB/TrEMBL:B3QV77"
FT                   /protein_id="ACF13031.1"
FT                   /translation="MPDSNAQPNEKNIELKEKLQHHVPKATGEKFERLVSIIGVLREEC
FT                   PWDKKQTPESLVPLTLEETYELAHAVDAGDDVEMKKELGDILLHICFQALLGNERKAFN
FT                   IGDVLDAIAEKLIFRHPHVFGTAQAETEEAVKKSWEKLKMKEGRKSVLGGVPNAMPELL
FT                   RSYRVQEKAAGVGFDWDNAEGVWAKVLEELDELKAAKTPKEKEDELGDLLFSIVNYSRF
FT                   LKTNPEDALRKSTEKFMARFLKVETQVAASGKSWQAYSLEELDVFWDQAKKEVQ"
FT   gene            complement(659764..660366)
FT                   /locus_tag="Ctha_0561"
FT   CDS_pept        complement(659764..660366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0561"
FT                   /product="protein of unknown function DUF820"
FT                   /note="PFAM: protein of unknown function DUF820; KEGG:
FT                   ava:Ava_1442 protein of unknown function DUF820"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ACF13032"
FT                   /db_xref="InterPro:IPR008538"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:B3QV78"
FT                   /protein_id="ACF13032.1"
FT                   /translation="MLAQEKKYFTPEEYLELEEKAEYKSEYYQGEIFAMSGGSVNHCRI
FT                   AINVQTGLNVAFRKRNCEVFNGDMRVLVQENGLYTYPDVSAICGEIKFAEGRNDTVTNP
FT                   CLIVEVLSKSTKDYDRGQKFELYRALPSLEDYVLIHQDKVHVEHFHKQSDGKWLFMDIC
FT                   SLEENLVLESVDVTLPIRDLYEKVDRLSESTDKNTNL"
FT   gene            complement(660440..661723)
FT                   /locus_tag="Ctha_0562"
FT   CDS_pept        complement(660440..661723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0562"
FT                   /product="seryl-tRNA synthetase"
FT                   /EC_number="6.1.1.11"
FT                   /note="KEGG: cte:CT0606 seryl-tRNA synthetase; TIGRFAM:
FT                   seryl-tRNA synthetase; PFAM: tRNA synthetase class II (G H
FT                   P and S); Seryl-tRNA synthetase, class IIa-like"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ACF13033"
FT                   /db_xref="GOA:B3QV79"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3QV79"
FT                   /protein_id="ACF13033.1"
FT                   /translation="MLDIKYVRENPDAVKKMLEMRLLASESKKIDELIRYDSERKAKVT
FT                   ESDTLKAMRNSVTQEIAKIKREKTGSADELIAEMKIVSDRISEIDAELREIETKQEELL
FT                   LAVPNILHESVPEGKSAADNVVYKEVMDCKREFDFKPKDHIELGKSLGMLDFERGAKIA
FT                   GAGFPLYIGKGASLERALINFMLDLHLEKHGYKEVFPPFFVNRDSLRGTGQWPKFADQV
FT                   YYMNDDDIYAIPTAEVPVTNMHRDEMLQSKELPIKYAAYSACFRREAGSYGKDTKGFLR
FT                   VHQFNKVEMVKFVLPETSYDELEALLGDAEDVLKALEIPYRVLLLCSGDISANAAKCYD
FT                   IEVWSPAEEKFLEASSCSNFEDYQARRAQIRFRRQPKAKPEFVHTLNGSGLATSRLMVS
FT                   LMENYQTPDGKIQVPKVLQKYMGCEVIG"
FT   gene            complement(661750..662349)
FT                   /locus_tag="Ctha_0563"
FT   CDS_pept        complement(661750..662349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0563"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   bpu:BPUM_0412 possible acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ACF13034"
FT                   /db_xref="GOA:B3QV80"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B3QV80"
FT                   /protein_id="ACF13034.1"
FT                   /translation="MTIEGKRICLRPIEETDAPKLKSAINASIQDFLKTQVFLHRPTTL
FT                   KEQQVFVDFAVRKMLSNEAFFYGIILKDENELIGLVNTHAIDWKNEKTEIGYWVASAFT
FT                   RQGLATEASLLMLEFLLMECKLHRITASFTPENLASERLLCKLGFRFEGVLLDAARIQG
FT                   RWKNLNLYALLAEDYKRSRRQLFQTVLDGAYPKIRF"
FT   gene            complement(662589..663044)
FT                   /locus_tag="Ctha_0564"
FT   CDS_pept        complement(662589..663044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0564"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cte:CT0607 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ACF13035"
FT                   /db_xref="GOA:B3QV81"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR019004"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042184"
FT                   /db_xref="UniProtKB/TrEMBL:B3QV81"
FT                   /protein_id="ACF13035.1"
FT                   /translation="MSLKQQINEDLKSAMKSKEQNRINAVRSIRAALLEKEVSIRVGGQ
FT                   GELTAEQEMEVLMSLAKRRKDSIEQFKSAGREDLVEQEAAELAVLEIYLPKQLSEDEIR
FT                   ETVEKIIAEVGAASAKDFGKVMGAAMKALKGKADGNLIQQIAKEKLG"
FT   gene            complement(663401..663874)
FT                   /locus_tag="Ctha_0565"
FT   CDS_pept        complement(663401..663874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0565"
FT                   /product="2C-methyl-D-erythritol 2,4-cyclodiphosphate
FT                   synthase"
FT                   /EC_number="4.6.1.12"
FT                   /note="KEGG: cte:CT1601 2C-methyl-D-erythritol
FT                   2,4-cyclodiphosphate synthase; TIGRFAM:
FT                   2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase; PFAM:
FT                   MECDP-synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ACF13036"
FT                   /db_xref="GOA:B3QV82"
FT                   /db_xref="InterPro:IPR003526"
FT                   /db_xref="InterPro:IPR020555"
FT                   /db_xref="InterPro:IPR036571"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3QV82"
FT                   /protein_id="ACF13036.1"
FT                   /translation="MRIGIGIDIHQLVEGRKLIIGGVEIPYEKGLKGHSDADVLLHAIS
FT                   DALLGAAALGDIGKHFPDTDPAYKGIDSQLLLKHVRKLLETHGYKPVNVDSMLLLEKPK
FT                   IAPHVQKMRENIAACLEVDVDAISVKATTNEKIGYVGRGEGALAHAVCLIEKI"
FT   gene            complement(663961..664317)
FT                   /locus_tag="Ctha_0566"
FT   CDS_pept        complement(663961..664317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0566"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ACF13037"
FT                   /db_xref="UniProtKB/TrEMBL:B3QV83"
FT                   /protein_id="ACF13037.1"
FT                   /translation="MKTSTILSDSEWHDLRSQIQELFDITLKYTELVARESDRIWDKSR
FT                   PEFHKKENQSLDDALGVYQEVLNQFHEERKRAYLQTFNRVKADSFDRVSRIEKYLEKIS
FT                   DRIDGSFRASTAKE"
FT   gene            complement(664361..665044)
FT                   /locus_tag="Ctha_0567"
FT   CDS_pept        complement(664361..665044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0567"
FT                   /product="ABC transporter-related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: plt:Plut_0578 ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ACF13038"
FT                   /db_xref="GOA:B3QV84"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3QV84"
FT                   /protein_id="ACF13038.1"
FT                   /translation="MITLSDVSLQLGRNQVFDHVDLQIERGELVYIVGGSGAGKSSLLR
FT                   MLYMDLQPDSGSVQVGEFNSTLIKRSEIPYLRRHLGIVFQDFKLFDDRSVFENVAFVLE
FT                   VTGVKRKLIAKKVSDALSEVGLSQKRNELPVHLSGGEQQRVVIARAIVSEPYVLLADEP
FT                   TGNLDPDVAVEIMSLIKKINLRGITVLTVTHDYNLVKKIPARILQIKDGKIFDVQFKKN
FT                   EPVKR"
FT   gene            complement(665060..666070)
FT                   /locus_tag="Ctha_0568"
FT   CDS_pept        complement(665060..666070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0568"
FT                   /product="4-hydroxythreonine-4-phosphate dehydrogenase"
FT                   /EC_number="1.1.1.262"
FT                   /note="KEGG: cte:CT0591 pyridoxal phosphate biosynthetic
FT                   protein PdxA; TIGRFAM: 4-hydroxythreonine-4-phosphate
FT                   dehydrogenase; PFAM: Pyridoxal phosphate biosynthetic
FT                   protein PdxA"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ACF13039"
FT                   /db_xref="GOA:B3QV85"
FT                   /db_xref="InterPro:IPR005255"
FT                   /db_xref="UniProtKB/TrEMBL:B3QV85"
FT                   /protein_id="ACF13039.1"
FT                   /translation="MTILWTIGDINGIGPEIILKSFMKLERGEQFVVVGSFKVLQHYVD
FT                   VLSLPVQLKRIKNIEAISTMDAAQKVLPVLDVGKSIRLTQGKVSASAGELAMMAIERAT
FT                   TLCLMKRADAMVTAPIHKEAISKAGYSFSGHTDYITYLCGSDFSQMMLCDRQSKLKVVL
FT                   ATVHVPVSKVSALVRQDGIEKSIVAMAESLAKDFAVQDPRIAVLALNPHASDGGVIGNE
FT                   EQLTLEPQIKKLQKNYRVEGPFASDGFFGTASYNAFDAVLAMYHDQGLIPFKMLAFETG
FT                   VNVTMGLPIVRTSPDHGTAFDIAGKGIASEASFIEATLMACEIARARQMQNEEGQ"
FT   gene            complement(666074..666556)
FT                   /locus_tag="Ctha_0569"
FT   CDS_pept        complement(666074..666556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0569"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cph:Cpha266_1779 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ACF13040"
FT                   /db_xref="GOA:B3QV86"
FT                   /db_xref="InterPro:IPR025635"
FT                   /db_xref="UniProtKB/TrEMBL:B3QV86"
FT                   /protein_id="ACF13040.1"
FT                   /translation="MLARIQSLYLLLVVIFTGLNLQILPFWLFDLKSAENVEMAKHLVL
FT                   VGITEFGTSSDVVVMVWGFNVFLLTAMMLAAIGIFLFSNRKIQVKLVSSSGIATLVTIA
FT                   LGVAASITFIDKMGQYEASGLPGIGFYLLLLCLVLQWLAVGAINKDDQVANAYKRL"
FT   gene            complement(666927..668042)
FT                   /locus_tag="Ctha_0570"
FT   CDS_pept        complement(666927..668042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0570"
FT                   /product="DegT/DnrJ/EryC1/StrS aminotransferase"
FT                   /note="PFAM: DegT/DnrJ/EryC1/StrS aminotransferase;
FT                   aromatic amino acid beta-eliminating lyase/threonine
FT                   aldolase; KEGG: fjo:Fjoh_1727 DegT/DnrJ/EryC1/StrS
FT                   aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ACF13041"
FT                   /db_xref="GOA:B3QV87"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B3QV87"
FT                   /protein_id="ACF13041.1"
FT                   /translation="MDIKLVDLVTLHNRLKPEIDAELEKVFATSAFINGPTVGELEAAL
FT                   ADYLDVKYAIGCASGTDALVVALRGLGIQAGDEVLTTPFTFAATIEAILLVGATPIYAD
FT                   IDPKTLNLDTLKLESAITPKTKAILPVHLYGQGCNMTAIMAFAAKHHLFVLEDNAQAFG
FT                   ASYGEKKLGTFGHASATSFFPAKNLGAFGDAGGIFTNDEALYQKMKMIAQHGSKLRYHH
FT                   EVLGLNSRLDTLQAAVLKVKLNYLNDFNAARQKAAAWYDAFLADANLQTPQRDKAGSHI
FT                   YHQYTILVENPGQRDALQQFLKEQGVPSAVHYPVPTHLQPAFADEKYPKGSLPVAESVA
FT                   ERVLSLPMHTELTEAEVAFVCEKIIAFVGKR"
FT   gene            complement(668091..669344)
FT                   /locus_tag="Ctha_0571"
FT   CDS_pept        complement(668091..669344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0571"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rrs:RoseRS_4436 glycosyltransferase-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ACF13042"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:B3QV88"
FT                   /protein_id="ACF13042.1"
FT                   /translation="MGISGVQRTAKFVKYLPKYGWKPIVLTIEPHAYYAYDETLVDDLK
FT                   PLAVEVFRTSTKKVTRMNAIGKKKREAKLSSASIERAMSMISQVFRIPDGKISWKKPAL
FT                   LMADEIFKKHPDIKVIFSTAPPYTAHLVAEELRRKYQLPIVLDFREPWVENPSNFYLTP
FT                   FHKRRQNTLEELVIRSADKIITPNREIKEIFLRKYYERLTHYDITIIPHGFDPTDFNAM
FT                   NAITRGDKKLRFVHSGIFRNQNLPKPFFRGLKYALEKRPELKEKIEVRFVGICQKEFIK
FT                   QAESFGLRDIVEVRGHKNHRETIDENMKADVLWALLGNVPNNHAISCGKIFEYVACGKT
FT                   LFGIMPQGASRNFILEANGLVASPDNIEEIGQKILEIAALWEKNQLPVPAPDVVEKYNR
FT                   EVLTGMLAKEFEEQVSLD"
FT   gene            669744..670583
FT                   /locus_tag="Ctha_0572"
FT   CDS_pept        669744..670583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0572"
FT                   /product="2-dehydro-3-deoxyphosphooctonate aldolase"
FT                   /note="TIGRFAM: 2-dehydro-3-deoxyphosphooctonate aldolase;
FT                   PFAM: DAHP synthetase I/KDSA; KEGG: cch:Cag_1974
FT                   2-dehydro-3-deoxyphosphooctonate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ACF13043"
FT                   /db_xref="GOA:B3QV89"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006269"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B3QV89"
FT                   /protein_id="ACF13043.1"
FT                   /translation="MRTAQFEIAGIPVGTKEKLLVFAGPCVVENREMLFSTAEGLKKAA
FT                   ETIGFDLIFKASYKKANRSSSGSFTGIGDEAALALLAEVRQTFDLPIVTDIHHPEEAAL
FT                   ASKFVDVLQIPAFLCRQTELLEAAGKTGLAVNIKKGQFMAPGDMRLAAEKVAATGNTKI
FT                   LLTERGTSFGYHNLVVDFRGLPQMSALGYPVIFDATHSVQLPSAGQGISSGERQYIQPL
FT                   ARAAVAVGVTGLFFEVHPTPEKALSDSATQLPLSKAEPLLRELQEIFEITKKIQPLI"
FT   gene            670602..671153
FT                   /locus_tag="Ctha_0573"
FT   CDS_pept        670602..671153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0573"
FT                   /product="3-deoxy-D-manno-octulosonate 8-phosphate
FT                   phosphatase, YrbI family"
FT                   /note="TIGRFAM: 3-deoxy-D-manno-octulosonate 8-phosphate
FT                   phosphatase, YrbI family; KEGG: cte:CT0087 putative
FT                   3-deoxy-D-manno-octulosonate 8-phosphate phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ACF13044"
FT                   /db_xref="GOA:B3QV90"
FT                   /db_xref="InterPro:IPR010023"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B3QV90"
FT                   /protein_id="ACF13044.1"
FT                   /translation="MEIFGVSVSSEDPTSRLRQLLGEIKVIIFTIDGVFTDGQISYSES
FT                   GEEVRTFHARDGFAIQEALAKGMNIAVVSERESKAARKRLEEIGVTDITMGVKDKMPTY
FT                   EAIKARYGVSDAECVYIGDDVMDLPLFEKVGVSITPLNGVEYLRNRVYYVSGYEGGKGC
FT                   VRDVIEMVLAIQGKWKYYEM"
FT   gene            671263..671682
FT                   /locus_tag="Ctha_0574"
FT   CDS_pept        671263..671682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0574"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cyt:cce_4458 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ACF13045"
FT                   /db_xref="InterPro:IPR018727"
FT                   /db_xref="InterPro:IPR038282"
FT                   /db_xref="UniProtKB/TrEMBL:B3QV91"
FT                   /protein_id="ACF13045.1"
FT                   /translation="MPVPKEYQSATDDFYKFLVDAREISELGSTHQTYTMAQGVLQTFR
FT                   RRLTVKEALLFASVLPPILRAIFIADWNIDDPIRPFEDRITMTKEVQSLRKTHNFAPES
FT                   SIRTVAKALRKNVDELAFDKILAKLPEGAVDFWTP"
FT   gene            671763..672710
FT                   /locus_tag="Ctha_0575"
FT   CDS_pept        671763..672710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0575"
FT                   /product="glycerophosphoryl diester phosphodiesterase"
FT                   /note="PFAM: glycerophosphoryl diester phosphodiesterase;
FT                   KEGG: sru:SRU_0571 glycerophosphoryl diester
FT                   phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ACF13046"
FT                   /db_xref="GOA:B3QV92"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:B3QV92"
FT                   /protein_id="ACF13046.1"
FT                   /translation="MFEIDFSLPILSLLTGSALLFAGCHSAPKSELRTDKNSRLATFFD
FT                   IQGHRGARGLLPENTIPAFLKALELGVTTLELDLAVSNDRKLVVSHEPWFSSEICSKPN
FT                   GEPIAPADERAHLIYQMNYSEISAYDCGRRGHPRFPTQKPMQVCKPLFQDVVKAAEAYV
FT                   QEKNLPAIFYNIETKCTPEGDNRLHPAPAEFVEILLREIRLLKIESRTIVQSFDVRTLQ
FT                   EMRRLAPNIRLALLVENNDTLEKNLEKLGFVPEIYSPDAALVNAALISAAHEKKMLVIP
FT                   WTVNEPDTMTHLAELGADGIITDYPDRAHFLLEK"
FT   sig_peptide     671763..671843
FT                   /locus_tag="Ctha_0575"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.906) with cleavage site probability 0.895 at
FT                   residue 27"
FT   gene            672734..673315
FT                   /locus_tag="Ctha_0576"
FT   CDS_pept        672734..673315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0576"
FT                   /product="rare lipoprotein A"
FT                   /note="TIGRFAM: rare lipoprotein A; PFAM: Rare lipoprotein
FT                   A; KEGG: spl:Spea_3152 rare lipoprotein A"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ACF13047"
FT                   /db_xref="GOA:B3QV93"
FT                   /db_xref="InterPro:IPR009009"
FT                   /db_xref="InterPro:IPR012997"
FT                   /db_xref="InterPro:IPR034718"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:B3QV93"
FT                   /protein_id="ACF13047.1"
FT                   /translation="MANLHLKIQKCLSANMNQLMTKIAFQQILIISICLLTVTACTSTV
FT                   RYATKSSATRPSSATSSQKAHRSAATTNTSQKKATATETSSSQKLTQTESGKILGEGEA
FT                   SYYANKFHGKTTASGEPYDMYSFTAAHRTLPFGTVLRVTNLENQKSVVVRVTDRGPWKA
FT                   HRIIDLSFMAAKSLDMLGSGTAQVRIEKLN"
FT   gene            673443..673514
FT                   /locus_tag="Ctha_R0004"
FT                   /note="tRNA-Asn1"
FT   tRNA            673443..673514
FT                   /locus_tag="Ctha_R0004"
FT                   /product="tRNA-Asn"
FT   gene            complement(673697..674839)
FT                   /locus_tag="Ctha_0577"
FT   CDS_pept        complement(673697..674839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0577"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   plt:Plut_0242 glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ACF13048"
FT                   /db_xref="GOA:B3QV94"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B3QV94"
FT                   /protein_id="ACF13048.1"
FT                   /translation="MLIYQLFILGCLLVFLGILIKNLFDVERLPAHSPKAFPFVSILVP
FT                   ARNEARNIESCVQSLLAQDYPNFELIVLDDNSDDGTGDLLQALAKNSNKLKVLHGSQLP
FT                   ENWLGKCWACHQLSRQATGSLLLFTDADTWHAPESLRRAVAAFQQSRADLLTLIPDQTL
FT                   GSFWERVIVPLVHFSVLCYLPVKFVWENRNTAFAFANGQFMLFSRDMYEHIGGHESVRK
FT                   ALVEDVWLCKTVKSAGGRPVVFSGIEAVRCRMYQNLEEIIHGFSKNLFAGLGYSLFGIS
FT                   MVGIISFAAYLLPFGFLGYALISSLFTIEWFWLPLLHIILGVLMRGLIAVRYRLSIGES
FT                   FLHGLSILMFLVISVNSVRWIKTGKGALWKGRRYDFSKSA"
FT   gene            complement(674925..676142)
FT                   /locus_tag="Ctha_0578"
FT   CDS_pept        complement(674925..676142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0578"
FT                   /product="arsenite-activated ATPase ArsA"
FT                   /EC_number="3.6.3.16"
FT                   /note="KEGG: plt:Plut_1173 anion-transporting ATPase;
FT                   TIGRFAM: arsenite-activated ATPase ArsA; PFAM:
FT                   Anion-transporting ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ACF13049"
FT                   /db_xref="GOA:B3QV95"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR016300"
FT                   /db_xref="InterPro:IPR025723"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040612"
FT                   /db_xref="UniProtKB/TrEMBL:B3QV95"
FT                   /protein_id="ACF13049.1"
FT                   /translation="MRIIVFTGKGGVGKTSVAASTALKAAEMGYKTLIMSTDPAHSLGD
FT                   SLDVELGPSPIKVADNLWGQEVSVYNDLNHNWEVVRAHFADLMHNKGIDDVYAEEIGIL
FT                   PGMEELFSLSYIKQYNNSSEYDLLVVDCAPTGETLRLLSLPETFGWVLKLIRNIEKYAV
FT                   KPLIRPMSKMSNKIDKMVAPSEVFEAVENLFSATDGIIDILADNKKTSVRLVMNPEKMV
FT                   IKESMRALTYLNLYGITVDRVTINRLLPEAEDSGFLNEWKKIQHKYVDEIEKSFEPIPI
FT                   SKAPMFAGEVVGQEMLRKMSTHVYGEEDPTQIFFRENPVEIKKMSDHSFQLRLKLPFLA
FT                   DTGMDIKVLQQGDDLTVRLGDNQKTITLPIFLAGMQSDDARFIDKWLCIDFKQPSEVGK
FT                   KSHATV"
FT   gene            complement(676293..676913)
FT                   /locus_tag="Ctha_0579"
FT   CDS_pept        complement(676293..676913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0579"
FT                   /product="molybdenum cofactor synthesis domain protein"
FT                   /note="TIGRFAM: molybdenum cofactor synthesis domain
FT                   protein; PFAM: molybdopterin binding domain; KEGG:
FT                   cbb:CLD_2681 molybdopterin biosynthesis enzyme Mog"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ACF13050"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:B3QV96"
FT                   /protein_id="ACF13050.1"
FT                   /translation="MTENKPIGRARQGQGINRKITVAIITVSDLAFEGIYKDESGPIVA
FT                   NVFPEDVYDIISKTIVADELNGIMNELIRCSDEEHADVIVTVGGSGCSSRDVTPDATAK
FT                   VIEKEVPGISDVIRIANWQNYPKMIYSRGMSGVRNDSLIVNLPGNPEGARIAIETIVGS
FT                   IPNCIKTLQTQKPRKKRQWTGNAGSGRSASVGSSKTPRFRKPT"
FT   gene            complement(677136..678023)
FT                   /locus_tag="Ctha_0580"
FT   CDS_pept        complement(677136..678023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0580"
FT                   /product="ATP phosphoribosyltransferase"
FT                   /EC_number="2.4.2.17"
FT                   /note="KEGG: pvi:Cvib_0307 ATP phosphoribosyltransferase;
FT                   TIGRFAM: ATP phosphoribosyltransferase; PFAM: Histidine
FT                   biosynthesis protein HisG domain; ATP
FT                   phosphoribosyltransferase catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ACF13051"
FT                   /db_xref="GOA:B3QV97"
FT                   /db_xref="InterPro:IPR001348"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR013115"
FT                   /db_xref="InterPro:IPR013820"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR020621"
FT                   /db_xref="UniProtKB/TrEMBL:B3QV97"
FT                   /protein_id="ACF13051.1"
FT                   /translation="MSDSTNKVLKIGLPKGSLQDSTLELFAKAGFHFSVSSRSYFPSID
FT                   DDEIQAILIRAQEMAKYIESGAFDVGLTGKDWIIETGAKVVEVADLIYSKASMRPVRWV
FT                   LAVPEKSDIQSVKDLEGKHIATEVVNITKNYLQKNNVSAEVEFSWGATEVKPPDLADAI
FT                   VEVTETGNSLRANKLRIVETILESNTKLIANEAAWNDPWKREKIENLAMLLEGAIVATG
FT                   KVGLKFNIKEENLKSIVDKIPSLRNPTIAHLVETGWVAVESIVDEKQVRRLIPDLKRAG
FT                   AEGIFEYEINKLIY"
FT   gene            complement(678092..678895)
FT                   /locus_tag="Ctha_0581"
FT   CDS_pept        complement(678092..678895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0581"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: cte:CT1989
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ACF13052"
FT                   /db_xref="GOA:B3QV98"
FT                   /db_xref="InterPro:IPR010138"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:B3QV98"
FT                   /protein_id="ACF13052.1"
FT                   /translation="MRKSYFISDVHFGLQEKEKESAKLNAMLSLLERIQEDGERLFLVG
FT                   DILDFWMEYRHVVPKGHVRFFAALENLVLSGVKVTYLAGNHDFYLGRYFQESFGIETQY
FT                   GQIEAQLHGKLFLMAHGDGIGRGDLGYKFFRSVVRNNFNLRLFRWIHPDWGVGLMSYLS
FT                   RLSRRHTYSPTDYGEKERLIIYANELTEKTSFSYFVCGHRHVPKIHRLKNQQSFYVNLG
FT                   TWIDETPTYGVFDGTAMAIRSAETHAVVFSENAKHGKAVSANPKA"
FT   gene            complement(679053..680069)
FT                   /locus_tag="Ctha_0582"
FT   CDS_pept        complement(679053..680069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0582"
FT                   /product="bacteriochlorophyll/chlorophyll synthetase"
FT                   /note="TIGRFAM: bacteriochlorophyll/chlorophyll synthetase;
FT                   PFAM: UbiA prenyltransferase; KEGG: cte:CT1992
FT                   bacteriochlorophyll a synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ACF13053"
FT                   /db_xref="GOA:B3QV99"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006372"
FT                   /db_xref="UniProtKB/TrEMBL:B3QV99"
FT                   /protein_id="ACF13053.1"
FT                   /translation="MSSYETSFPVRADLTLKDKIKAHIELLDPVTWISAVQGLLCGAIA
FT                   SGEMQLSFEHVGLLVALIMLYGPLGTGFSQSINDYYDRFLDKVNEPTRPIPSGRISEKE
FT                   AVWNWVIVGILSVSLGVWLGLQFEGERRFVIIASIIVGLIMGYIYSAPPFKLKRNVLTS
FT                   APAVGISYSLITWLSGNALYADIRIEVVYMALINALMTIGLIFLNDFKSVEGDRAGGLK
FT                   SLPVMIGPRNTYVVSFFFVDLPFIWFIYLMHQWGFTFMFYFSAVSLVIIFVMQMVLYFD
FT                   PKDGAKALDASVKGMGFESFVGKSDVKEHKSFLRYLIVNNGLYLINVFAASYMLSTY"
FT   gene            complement(680446..681801)
FT                   /locus_tag="Ctha_0583"
FT   CDS_pept        complement(680446..681801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0583"
FT                   /product="RNA modification enzyme, MiaB family"
FT                   /EC_number="1.3.1.74"
FT                   /note="KEGG: chu:CHU_1821 2-methylthioadenine synthetase;
FT                   TIGRFAM: RNA modification enzyme, MiaB family; tRNA-i(6)A37
FT                   thiotransferase enzyme MiaB; PFAM: deoxyribonuclease/rho
FT                   motif-related TRAM; Radical SAM domain protein; Protein of
FT                   unknown function UPF0004; SMART: Elongator protein
FT                   3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ACF13054"
FT                   /db_xref="GOA:B3QVA0"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006463"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3QVA0"
FT                   /protein_id="ACF13054.1"
FT                   /translation="MKQDKMAEVQSHACNQKARVYLETYGCQMNFSDTEIISSILSDAG
FT                   YAIAESEQVADIIFLNTCAVRENAEQRIRNRLQNLRPLKKQNPKLIVGVLGCMAERLRE
FT                   KLFQEEKIVDLIAGPDAYRTLPNLLDLAESGEKAANVMLSLEETYADINPLRKNGHSAF
FT                   LAIMRGCDNMCAFCIVPYTRGRERSRPMTSILDELKQLSDEGTREVTLLGQNVNSYYDE
FT                   NSGTRFANLMDKASLVNPNMRIRFTTSHPKDISSELIDVIAERKNLCEFIHLPVQSGSS
FT                   RMLELMNRGHTREDYLEKIALIKSKIPNCSISTDMISGFCTETEADHAATLSLLREVRY
FT                   DYAFTFVYSVRPNTPAATRLNDDVPDDVKQRRLSEVIALQQKISAELYRNDIGNTHEVL
FT                   IEGESKRSSDMWMGRARNNRVVVFPKNGAQVGDFVNVKITDATSATLIGNAL"
FT   gene            complement(681975..683201)
FT                   /locus_tag="Ctha_0584"
FT   CDS_pept        complement(681975..683201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0584"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   ote:Oter_1640 protein of unknown function DUF214"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ACF13055"
FT                   /db_xref="GOA:B3QVA1"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:B3QVA1"
FT                   /protein_id="ACF13055.1"
FT                   /translation="MLFRDIFIMAIESLSANRLRSLLTMIGITVGVFSVIGVMTAIKAV
FT                   ESSVEEGLSDLGASTFEIQKTPELLFRRHNMPERNRKDITYREASRFQKIMSGSARAVG
FT                   IEVHDTGEQAAYAGRKTNPNIDVVGGDMNFTAANSYDIAYGRNLTNEDVLYARNVVVIG
FT                   FGVQEKLFPSESPLHKTLKLAGKTYFIVGVFDSKGSGFGESQDDLALIPITRFLANYGQ
FT                   KRSLHITIQANSQAVYQATMDRAIGVMRVVRGLSPEEKNDFEIVTNEALIESFQEVAGT
FT                   IQIGAFIISVIALITAGIGIMNIMLVSVTERTKEIGIRKSIGAKKTHILTQFLIEAIFL
FT                   SETGGVFGIFIGVIGGNFFARQVSAPFIFPWDWAFIGLAVCSAIGIGFGLYPAYKAASL
FT                   KPVEALRFE"
FT   gene            complement(683352..684602)
FT                   /locus_tag="Ctha_0585"
FT   CDS_pept        complement(683352..684602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0585"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   cte:CT1350 ABC transporter efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ACF13056"
FT                   /db_xref="GOA:B3QVA2"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:B3QVA2"
FT                   /protein_id="ACF13056.1"
FT                   /translation="MKQFFYEFIESFVIAFAQIRAHKMRSMLTALGVVIGILAVTLMGT
FT                   AIGGIDKGFDKSLSIIGFDVLYVQKWPWSSVDDWWNYRNRPRLETDYADKMNRMIATNP
FT                   NSELVTVVPQMASSKSVYYEGNAVEDIFILGTTDRYPETSTVELSEGRFFNTIESRTGR
FT                   QVCVLGYDVADALFPNASPINQKVRIGNQNFLVIGVYVKQGKFLGLFSLDTQVVIPLES
FT                   FKKVFGCGRRITLRVKIKDEARLEEAKDEVTGIMRRIRGLKFGERDNFSINEQKAFKST
FT                   LDPIKAGIAIAGLFITGLSLFVGAIGIMNITFVSVKERTKEIGTRKALGAKRRTILMQF
FT                   MIEAVVICLIGGLVGLMLSYLMTVAVEAFFPSFPVSFSMSLVLNGMLVSILTGVFSGFA
FT                   PAYSASKLEPATALRYE"
FT   gene            complement(684694..685455)
FT                   /locus_tag="Ctha_0586"
FT   CDS_pept        complement(684694..685455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0586"
FT                   /product="ABC transporter-related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: ote:Oter_1638 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ACF13057"
FT                   /db_xref="GOA:B3QVA3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3QVA3"
FT                   /protein_id="ACF13057.1"
FT                   /translation="MSYKTLMQQEKKVRPKGDIVIRIENATKEFEMGEEVVHALRGVNL
FT                   NVYRNEYVAIMGPSGSGKSTLMNLIGCLDTPTAGLYELNGKDVSGMEDDELARIRNQEI
FT                   GFVFQTFNLLPRSSSLQNVELPLIYSGVSKEEREMRAMQAMENVGLADRMYHKPNELSG
FT                   GQRQRVAIARALVTNPSIILADEPTGNLDTKTGIDIMNLFETLYEKGNTIILVTHEEDI
FT                   AQHARRIVRLRDGLIESDEEIQENHFSTTSA"
FT   gene            complement(685762..687159)
FT                   /locus_tag="Ctha_0587"
FT   CDS_pept        complement(685762..687159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0587"
FT                   /product="Phosphomannomutase"
FT                   /EC_number="5.4.2.8"
FT                   /note="PFAM: phosphoglucomutase/phosphomannomutase ;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain I; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain II;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain III; KEGG: cte:CT0260
FT                   phosphoglucomutase/phosphomannomutase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ACF13058"
FT                   /db_xref="GOA:B3QVA4"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR024086"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:B3QVA4"
FT                   /protein_id="ACF13058.1"
FT                   /translation="MSLMVSVSGIRGIVGESLTPAVLTKFTQAYATWLKRGKECSGAPK
FT                   VILGRDTRPTGQVISDLVQSVLVQSGCNVMNIGVATTPTVEIAVIDENADGGVIITASH
FT                   NPVEWNALKLLNSKGEFLTATEGKEMIALAETGDLDSATWNNFGISISDASHMERHVEK
FT                   VLALPYVKPETLAAQKYKILVDAVEGAGSEVVPALCRKLGAAEVIEVGCKGSGLFPHNP
FT                   EPIEENLQETMAMTAAEGCDFGIIVDPDVDRLALICEDGTLFGEEYTLVACADFYLKQK
FT                   KGTVVNNLSSSRALRDVAAKHGVECFSGKVGEANVIEVMKEKNAVIGGEGNGGVILPDV
FT                   HYGRDALIGIGLFMQAFCDWQKENGGGKLSDFKKIFPAYFMSKQKMKLPSGGASVDDAF
FT                   KKLEAKYANEQVTTADGLKIDFAETWVHLRKSNTEPIVRIYTEAKSKAEADALAERFSR
FT                   ELLELLS"
FT   gene            complement(687204..688127)
FT                   /locus_tag="Ctha_0588"
FT   CDS_pept        complement(687204..688127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0588"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   chu:CHU_2681 candidate b-glycosyltransferase,
FT                   glycosyltransferase family 2 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ACF13059"
FT                   /db_xref="GOA:B3QVA5"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B3QVA5"
FT                   /protein_id="ACF13059.1"
FT                   /translation="MDISVIIPVFNEEKNIPLLYARLNDTVRKICTTYEYIFVNDGSAD
FT                   ASMQVIRSLAETDDSVKFIDFSRNFGHQIAVTAGLAKAKGQAVVIIDADLQDPPELIEP
FT                   LYRKMQAGYEVVYAKRRSREGESFMKKWTAKMFYRLLSRMTAISIPLDTGDYRIIHQKV
FT                   VQMLNRMPEQQKFIRGQIAWVGFRQTFLEYDRQARHAGTTGYSYAKMLKFAIDGITSFS
FT                   DVPLKFATISGFVVSGVAFIEILYALHSRLITKDYEPGWASILISILFLGGIQLMSIGI
FT                   IGEYLSRISTNVKNRPLYVINETNIE"
FT   gene            complement(688417..688833)
FT                   /locus_tag="Ctha_0589"
FT   CDS_pept        complement(688417..688833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0589"
FT                   /product="methylmalonyl-CoA epimerase"
FT                   /note="TIGRFAM: methylmalonyl-CoA epimerase; PFAM:
FT                   Glyoxalase/bleomycin resistance protein/dioxygenase; KEGG:
FT                   plt:Plut_1289 lactoylglutathione lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ACF13060"
FT                   /db_xref="InterPro:IPR017515"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B3QVA6"
FT                   /protein_id="ACF13060.1"
FT                   /translation="MFKRIDHVAIAVNSIDATLATFKQLVDEGVASISYEEVPAQKVKV
FT                   AFLQIGDTKIEFLEPMAPDSTVSKYLEKRGEGLHHIALETDEIHNEVAGVKARGFNPLS
FT                   DPRLGAENKLVTFLHPKETGRVLVELVGQEASKD"
FT   gene            complement(688935..690248)
FT                   /locus_tag="Ctha_0590"
FT   CDS_pept        complement(688935..690248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0590"
FT                   /product="transcription termination factor Rho"
FT                   /note="KEGG: plt:Plut_1756 transcription termination factor
FT                   Rho; TIGRFAM: transcription termination factor Rho; PFAM:
FT                   H+transporting two-sector ATPase alpha/beta subunit central
FT                   region; Rho termination factor domain protein; Rho
FT                   termination factor RNA-binding; Ribonuclease B OB region
FT                   domain; SMART: AAA ATPase; Cold shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ACF13061"
FT                   /db_xref="GOA:B3QVA7"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004665"
FT                   /db_xref="InterPro:IPR011112"
FT                   /db_xref="InterPro:IPR011113"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036269"
FT                   /db_xref="InterPro:IPR041703"
FT                   /db_xref="UniProtKB/TrEMBL:B3QVA7"
FT                   /protein_id="ACF13061.1"
FT                   /translation="MSNNSSNATEMDATTVGLNINVLQKKKVAELNQMAKEMGIATSGL
FT                   RKDELIYKMIEAQTQKETTTETSNVVVNTGVLQTIPEGYGFLRSADYNYLSSPDDIYVS
FT                   PSQIKRFNMRTGDTVSGQVRAPKEGERFFALLKIETINGVDPEQIRDRVFFDNLTPLYP
FT                   QERIKLETAPGQHPGRIMDIFTPIGKGQRGLIVAQPKTGKTMLLQKIANSIIKNHPEVY
FT                   LIVLLIDERPEEVTDMQRSVKAEVVSSTFDEEPERHVQVADMVLDKAKRLVEVKKDVVI
FT                   LLDSITRLARAHNTVIPHSGKILSGGIDANALTKPKRFFGAARNVEEGGSLTIIATALV
FT                   DTGSRMDDVIFEEFKGTGNMELVLDRRLSDRRVFPAIDILKSGTRKEELLISQEELSRT
FT                   WLLRKYLADKNPIECMEFILDKMSETRSNKEFFKIMNA"
FT   gene            complement(690614..691912)
FT                   /locus_tag="Ctha_0591"
FT   CDS_pept        complement(690614..691912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0591"
FT                   /product="FolC bifunctional protein"
FT                   /note="TIGRFAM: FolC bifunctional protein; PFAM:
FT                   cytoplasmic peptidoglycan synthetase domain protein; Mur
FT                   ligase middle domain protein; KEGG: cph:Cpha266_0391 FolC
FT                   bifunctional protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ACF13062"
FT                   /db_xref="GOA:B3QVA8"
FT                   /db_xref="InterPro:IPR001645"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:B3QVA8"
FT                   /protein_id="ACF13062.1"
FT                   /translation="MNYQETIEFLFPLRRFGQKLGLENIQALCDALGNPERNLGTIVHV
FT                   AGTNGKGSVSAMTASICKEMGKKVGLYSSPHLACFTERIKINGMSIPKEKVAEYCTQIK
FT                   EIVPRISSTFFEVTTALAFKYFAEEKVDVSVIETGIGGRLDATNVIPSSYSVITNVELE
FT                   HTEWLGETKEKIAVEKADIIRPKSSVFTAAKDLDALEVITRTARDRKAKIRIASALSDY
FT                   QIISQEIGLLSVHLRTKRRTYHGLKVPFSGSYQAENAQLAILLAEEMGADELQIRNGLA
FT                   NVHQNTGHRARLERVQEKPVVLLDVSHNPPGMQATVKTISHYRKNYARVAVVFAALQEK
FT                   DVASMVAALKNGCDKIFVSELKIEKALPATEIHQICEAQDVRAEVFPNPMDAIAAAKAF
FT                   VGEDGLVLITGSFYLAGEVLAFLEPDVLETQHS"
FT   gene            complement(691938..692540)
FT                   /locus_tag="Ctha_0592"
FT   CDS_pept        complement(691938..692540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0592"
FT                   /product="Holliday junction DNA helicase RuvA"
FT                   /note="KEGG: cph:Cpha266_0390 Holliday junction DNA
FT                   helicase RuvA; TIGRFAM: Holliday junction DNA helicase
FT                   RuvA; PFAM: helix-hairpin-helix motif; RuvA domain protein;
FT                   DNA recombination protein RuvA domain I; SMART:
FT                   Helix-hairpin-helix DNA-binding class 1"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ACF13063"
FT                   /db_xref="GOA:B3QVA9"
FT                   /db_xref="InterPro:IPR000085"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR011114"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013849"
FT                   /db_xref="InterPro:IPR036267"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3QVA9"
FT                   /protein_id="ACF13063.1"
FT                   /translation="MLSYLSGTLIEKFSTEIVVEVNGVGYLLNISATTHEKLPAIGNQI
FT                   KILTYLYVREDALQLYGFITTEDREVFKLLIAISGVGPKLAQTILSGMSTAQLRESVIA
FT                   GDTKALTAIAGVGKKTAERIILELKDKLVKLDLKIDIKETAFRSDKQQVRNDAYSALIS
FT                   LGFTKSIAEKAMRAAIAEVPDGSVDDLIRVALRHVQS"
FT   gene            complement(692636..692917)
FT                   /locus_tag="Ctha_0593"
FT   CDS_pept        complement(692636..692917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0593"
FT                   /product="ribosomal protein S20"
FT                   /note="PFAM: ribosomal protein S20; KEGG: plt:Plut_1759 30S
FT                   ribosomal protein S20"
FT                   /db_xref="EnsemblGenomes-Gn:Ctha_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ACF13064"
FT                   /db_xref="GOA:B3QVB0"
FT                   /db_xref="InterPro:IPR002583"
FT                   /db_xref="InterPro:IPR036510"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3QVB0"
FT                   /protein_id="ACF13064.1"
FT                   /translation="MPQHKSAEKRVRQSKRRNARNRVHKAEMKKLVKTVKGLIEKSAEK
FT                   EEVENAYRAAIQKLDRMAVKGYLHKNNASNKKSKLSKLVNRFSKGDAA"
FT   gene            complement(693050..693265)
FT                   /pseudo
FT                   /locus_tag="Ctha_0594"
FT   gene            693536..696199
FT                   /locus_tag="Ctha_0595"
FT   CDS_pept        693536..696199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ctha_0595"
FT                   /product="alanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.7"
FT                   /note="KEGG: cte:CT0166 alanyl-tRNA synthetase; TIGRFAM:
FT